WorldWideScience

Sample records for californium 254

  1. Metabolism and toxicity of californium

    International Nuclear Information System (INIS)

    Metabolism of californium can be compared with that of other transplutonium elements. The most important points are as follows: a fast blood clearance and fast bone uptake more important than liver uptake, a relatively high urinary excretion and kidney retention. Blood clearance of californium can be compared with that of americium. Distribution of californium 252 nitrate after intramuscular injection in rats was studied. There are very few experimental data on acute or long term toxicity of californium. (28 references)

  2. Magnetism in californium

    International Nuclear Information System (INIS)

    A SQUID-based magnetic susceptometer has been constructed for studying small radioactive samples at temperatures below 350 K and in magnetic fields up to 50 kilogauss. The device has been used to study californium (element 98) in a number of solid-state forms: the dhcp metal, several oxides (Cf2O3 in both the bcc and monoclinic structures, Cf7O12, CfO2 and BaCfO3), several monopnictides (CfN, CfAs and CfSb) and the trichloride (in both the hexagonal and orthorhombic structures). All of these materials were studied in polycrystalline form, and hexagonal CfCl3 was studied in single-crystal form as well. The susceptometer has the sensitivity to measure samples containing less than 10 micrograms of californium. The magnetic susceptibilities of all of the californium materials at temperatures above about 100 K are described well by the Curie-Weiss relationship. This behavior is consistent with the assumption that the magnetic 5f electrons are localized and that the paramagnetic behavior can be interpreted in terms of the properties of the free ion. The measured values of the effective paramagnetic moment, μ/sub eff/, for all the californium materials that were studied are reasonably consistent with theoretical values based on intermediate coupling models. All of the californium materials showed some indications of cooperative magnetic effects. The dhcp metal was observed to order ferromagnetically at 52 K, and all of the californium compounds studied showed signs of antiferromagnetic ordering, mostly at temperatures below 25 K. 91 refs., 50 figs., 19 tabs

  3. Californium Multiplier (CFX)

    International Nuclear Information System (INIS)

    The availability of 252Cf as an economical high-intensity neutron source has made it possible to construct compact neutron irradiation devices with widespread applications. The simplest such device consists of a single 252Cf source within a moderating and shielding medium. Higher neutron flux levels can be attained either through the use of more 252Cf or through source multiplication by means of a subcritical uranium assembly. Although the use of larger 252Cf sources to achieve higher neutron flux is technically straightforward, an economic penalty is paid as the source strength is increased. Larger californium sources imply larger initial investments to cover the cost of source material and larger operating costs resulting from the decay of the 252Cf source. A Californium Multiplier, the CFX, which produces a flux enhancement of 30 when compared to a conventional moderated 252Cf system has been designed, licensed, built, and tested by IRT Corporation. Such systems are now available on a commercial basis for both neutron radiography and neutron activation analysis. The first commercial CFX system was installed at the Research Laboratories of Eastman Kodak Company in Rochester, NY, in March 1975. This device, using 1 mg of 252Cf, is very stable and the neutron flux generated by the CFX is very reproducible. The performance characteristics of this system are summarized

  4. Californium--palladium metal neutron source material

    Science.gov (United States)

    Dahlen, B.L.; Mosly, W.C. Jr.; Smith, P.K.; Albenesius, E.L.

    1974-01-22

    Californium, as metal or oxide, is uniformly dispersed throughout a noble metal matrix, provided in compact, rod or wire form. A solution of californium values is added to palladium metal powder, dried, blended and pressed into a compact having a uni-form distribution of californium. The californium values are decomposed to californium oxide or metal by heating in an inert or reducing atmosphere. Sintering the compact to a high density closes the matrix around the dispersed californium. The sintered compact is then mechanically shaped into an elongated rod or wire form. (4 claims, no drawings) (Official Gazette)

  5. Californium-252 Neutron Sources for Medical Applications

    International Nuclear Information System (INIS)

    Californium-252 neutron sources are being prepared to investigate the value of this radionuclide in diagnosing and treating diseases. A source resembling a cell-loaded radium needle was developed for neutron therapy. Since therapy needles are normally implanted in the body, very conservative design criteria were established to prevent leakage of radioactive. Methods are being developed to prepare very intense californium sources that could be used eventually for neutron radiography and for diagnosis by neutron activation analysis. This paper discusses these methods

  6. Californium Electrodepositions at Oak Ridge National Laboratory

    Energy Technology Data Exchange (ETDEWEB)

    Boll, Rose Ann [ORNL

    2015-01-01

    Electrodepositions of californium isotopes were successfully performed at Oak Ridge National Laboratory (ORNL) during the past year involving two different types of deposition solutions, ammonium acetate (NH4C2H3O2) and isobutanol ((CH3)2CHCH2OH). A californium product that was decay enriched in 251Cf was recovered for use in super-heavy element (SHE) research. This neutron-rich isotope, 251Cf, provides target material for SHE research for the potential discovery of heavier isotopes of Z=118. The californium material was recovered from aged 252Cf neutron sources in storage at ORNL. These sources have decayed for over 30 years, thus providing material with a very high 251Cf-to-252Cf ratio. After the source capsules were opened, the californium was purified and then electrodeposited using the isobutanol method onto thin titanium foils for use in an accelerator at the Joint Institute for Nuclear Research in Dubna, Russia. Another deposition method, ammonium acetate, was used to produce a deposition containing 1.7 0.1 Ci of 252Cf onto a stainless steel substrate. This was the largest single electrodeposition of 252Cf ever prepared. The 252Cf material was initially purified using traditional ion exchange media, such as AG50-AHIB and AG50-HCl, and further purified using a TEVA-NH4SCN system to remove any lanthanides, resulting in the recovery of 3.6 0.1 mg of purified 252Cf. The ammonium acetate deposition was run with a current of 1.0 amp, resulting in a 91.5% deposition yield. Purification and handling of the highly radioactive californium material created additional challenges in the production of these sources.

  7. Historical review of californium-252 discovery and development

    International Nuclear Information System (INIS)

    This paper discusses the discovery and history of californium 252. This isotope may be synthesized by irradiating plutonium 239, plutonium 242, americium 243, or curium 244 with neutrons in a nuclear reactor. Various experiments and inventions involving 252Cf conducted at the Savannah River Plant are discussed. The evolution of radiotherapy using californium 252 is reviewed

  8. Californium-252: a remarkable versatile radioisotope

    Energy Technology Data Exchange (ETDEWEB)

    Osborne-Lee, I.W.; Alexander, C.W.

    1995-10-10

    A product of the nuclear age, Californium-252 ({sup 252}Cf) has found many applications in medicine, scientific research, industry, and nuclear science education. Californium-252 is unique as a neutron source in that it provides a highly concentrated flux and extremely reliable neutron spectrum from a very small assembly. During the past 40 years, {sup 252}Cf has been applied with great success to cancer therapy, neutron radiography of objects ranging from flowers to entire aircraft, startup sources for nuclear reactors, fission activation for quality analysis of all commercial nuclear fuel, and many other beneficial uses, some of which are now ready for further growth. Californium-252 is produced in the High Flux Isotope Reactor (HFIR) and processed in the Radiochemical Engineering Development Center (REDC), both of which are located at the Oak Ridge National Laboratory (ORNL) in Oak Ridge, Tennessee. The REDC/HFIR facility is virtually the sole supplier of {sup 252}Cf in the western world and is the major supplier worldwide. Extensive exploitation of this product was made possible through the {sup 252}Cf Market Evaluation Program, sponsored by the United States Department of Energy (DOE) [then the Atomic Energy Commission (AEC) and later the Energy Research and Development Administration (ERDA)]. This program included training series, demonstration centers, seminars, and a liberal loan policy for fabricated sources. The Market Evaluation Program was instituted, in part, to determine if large-quantity production capability was required at the Savannah River Laboratory (SRL). Because of the nature of the product and the means by which it is produced, {sup 252}Cf can be produced only in government-owned facilities. It is evident at this time that the Oak Ridge research facility can meet present and projected near-term requirements. The production, shipment, and sales history of {sup 252}Cf from ORNL is summarized herein.

  9. Californium-252: a remarkable versatile radioisotope

    International Nuclear Information System (INIS)

    A product of the nuclear age, Californium-252 (252Cf) has found many applications in medicine, scientific research, industry, and nuclear science education. Californium-252 is unique as a neutron source in that it provides a highly concentrated flux and extremely reliable neutron spectrum from a very small assembly. During the past 40 years, 252Cf has been applied with great success to cancer therapy, neutron radiography of objects ranging from flowers to entire aircraft, startup sources for nuclear reactors, fission activation for quality analysis of all commercial nuclear fuel, and many other beneficial uses, some of which are now ready for further growth. Californium-252 is produced in the High Flux Isotope Reactor (HFIR) and processed in the Radiochemical Engineering Development Center (REDC), both of which are located at the Oak Ridge National Laboratory (ORNL) in Oak Ridge, Tennessee. The REDC/HFIR facility is virtually the sole supplier of 252Cf in the western world and is the major supplier worldwide. Extensive exploitation of this product was made possible through the 252Cf Market Evaluation Program, sponsored by the United States Department of Energy (DOE) [then the Atomic Energy Commission (AEC) and later the Energy Research and Development Administration (ERDA)]. This program included training series, demonstration centers, seminars, and a liberal loan policy for fabricated sources. The Market Evaluation Program was instituted, in part, to determine if large-quantity production capability was required at the Savannah River Laboratory (SRL). Because of the nature of the product and the means by which it is produced, 252Cf can be produced only in government-owned facilities. It is evident at this time that the Oak Ridge research facility can meet present and projected near-term requirements. The production, shipment, and sales history of 252Cf from ORNL is summarized herein

  10. Californium-252 Neutron Therapy in China

    International Nuclear Information System (INIS)

    Californium-252 brachytherapy, believed to be the most successful source for neutron therapy, gives most of the cures as well as long-term and complication-free survivals. Chinese radiation oncologists were interested in californium neutron therapy (Cf-NT) in the early 1980s, but 252Cf sources for medical use were not available in China until 1992 when a californium joint venture was established by the China Institute of Atomic Energy (Beijing) and the Research Institute for Nuclear Reactors (Dimitrovgrad) of Russia. In 1995, 25 seeds of 252Cf with a strength of 3 μg each were sent to China for preclinical investigation. Three years later, a high dose rate (HDR) 252Cf source was imported and transferred into a home-made remote after-loader for intracavitary treatment in Chongqing, and a clinical trail was started in February 1999. This is the first time that Cf-NT was performed for cancer patients in China. Since then, Cf-NT in China has developed rapidly. It is estimated that one-tenth of those radiation oncology centers with brachytherapy practice will be equipped with californium units in 5 yr. That means more than 30 units will be in use in hospitals. That is significant compared with other countries, but it is just one, on average, for each province or one per 40 million people in China. Progress also has been achieved in the 252Cf treatment delivery equipment. Preliminary clinical trails showed complete response observed in all cases treated, with a rapid clearance of tumors and mild reactions in normal tissues. The short-term results are quite encouraging. To deal with problems due to the demand for Cf-NT in China, attention should be paid to the following particulars: (1) A high-strength miniature source is needed for HDR/MDR interstitial therapy to extend the Cf-NT coverage. (2) Basic work on radiophysics and radiobiology needs to be done, including source calibration, clinical dosimetry, clinical RBE determination, and Cf-NT quality assurance

  11. Californium-252 sales and loans at Oak Ridge National Laboratory

    International Nuclear Information System (INIS)

    The production and distribution in the United States of 252Cf has recently been consolidated at the Oak Ridge National Laboratory (ORNL). The 252Cf Industrial Sales/Loan Program and the 252Cf University Load Program, which were formerly located at the Savannah River Plant (SRP), have been combined with the californium production and distribution activities of the Transuranium Element Production Program at ORNL. Californium-252 is sold to commercial users in the form of bulk californium oxide, palladium-californium alloy pellets, or alloy wires. Neutron source capsules, which are fabricated for loans to DOE or other US government agencies, are still available in all forms previously available. The consolidation of all 252Cf distribution activities at the production site is expected to result in better service to users. In particular, customers for neutrons sources will be ale to select from a wider range of neutron source forms, including custom designs, through a single contact point

  12. Californium-252 encapsulation at the Savannah River Laboratory

    International Nuclear Information System (INIS)

    More than 1 g of the neutron-emitting isotope californium-252 has been encapsulated at SRL for worldwide medical, industrial, and research uses. Bulk sales packages have been prepared for the USDOE sales program since 1971. Doubly-encapsulated sources have been prepared for USDOE's market evaluation program since 1968. Californium-252 sources for loan and sales packages satisfy the criteria for Special Form Radioactive Material. Encapsulation is performed in special neutron-shielded containment facilities at SRL. Development of improved source and shipping package designs and processes is continuing. 17 figures

  13. Production, distribution and applications of californium-252 neutron sources

    International Nuclear Information System (INIS)

    The radioisotope 252Cf is routinely encapsulated into compact, portable, intense neutron sources with a 2.6-yr half-life. A source the size of a person's little finger can emit up to 1011 neutrons s-1. Californium-252 is used commercially as a reliable, cost-effective neutron source for prompt gamma neutron activation analysis (PGNAA) of coal, cement and minerals, as well as for detection and identification of explosives, land mines and unexploded military ordnance. Other uses are neutron radiography, nuclear waste assays, reactor start-up sources, calibration standards and cancer therapy. The inherent safety of source encapsulations is demonstrated by 30 yr of experience and by US Bureau of Mines tests of source survivability during explosions. The production and distribution center for the US Department of Energy (DOE) Californium Program is the Radiochemical Engineering Development Center (REDC) at Oak Ridge National Laboratory (ORNL). DOE sells 252Cf to commercial reencapsulators domestically and internationally. Sealed 252Cf sources are also available for loan to agencies and subcontractors of the US government and to universities for educational, research and medical applications. The REDC has established the Californium User Facility (CUF) for Neutron Science to make its large inventory of 252Cf sources available to researchers for irradiations inside uncontaminated hot cells. Experiments at the CUF include a land mine detection system, neutron damage testing of solid-state detectors, irradiation of human cancer cells for boron neutron capture therapy experiments and irradiation of rice to induce genetic mutations

  14. Production, distribution and applications of californium-252 neutron sources.

    Science.gov (United States)

    Martin, R C; Knauer, J B; Balo, P A

    2000-01-01

    The radioisotope 252Cf is routinely encapsulated into compact, portable, intense neutron sources with a 2.6-yr half-life. A source the size of a person's little finger can emit up to 10(11) neutrons s(-1). Californium-252 is used commercially as a reliable, cost-effective neutron source for prompt gamma neutron activation analysis (PGNAA) of coal, cement and minerals, as well as for detection and identification of explosives, land mines and unexploded military ordinance. Other uses are neutron radiography, nuclear waste assays, reactor start-up sources, calibration standards and cancer therapy. The inherent safety of source encapsulations is demonstrated by 30 yr of experience and by US Bureau of Mines tests of source survivability during explosions. The production and distribution center for the US Department of Energy (DOE) Californium Program is the Radiochemical Engineering Development Center (REDC) at Oak Ridge National Laboratory (ORNL). DOE sells 252Cf to commercial reencapsulators domestically and internationally. Sealed 252Cf sources are also available for loan to agencies and subcontractors of the US government and to universities for educational, research and medical applications. The REDC has established the Californium User Facility (CUF) for Neutron Science to make its large inventory of 252Cf sources available to researchers for irradiations inside uncontaminated hot cells. Experiments at the CUF include a land mine detection system, neutron damage testing of solid-state detectors, irradiation of human cancer cells for boron neutron capture therapy experiments and irradiation of rice to induce genetic mutations. PMID:11003521

  15. Production, Distribution, and Applications of Californium-252 Neutron Sources

    Energy Technology Data Exchange (ETDEWEB)

    Balo, P.A.; Knauer, J.B.; Martin, R.C.

    1999-10-03

    The radioisotope {sup 252}Cf is routinely encapsulated into compact, portable, intense neutron sources with a 2.6-year half-life. A source the size of a person's little finger can emit up to 10{sup 11} neutrons/s. Californium-252 is used commercially as a reliable, cost-effective neutron source for prompt gamma neutron activation analysis (PGNAA) of coal, cement, and minerals, as well as for detection and identification of explosives, laud mines, and unexploded military ordnance. Other uses are neutron radiography, nuclear waste assays, reactor start-up sources, calibration standards, and cancer therapy. The inherent safety of source encapsulations is demonstrated by 30 years of experience and by U.S. Bureau of Mines tests of source survivability during explosions. The production and distribution center for the U. S Department of Energy (DOE) Californium Program is the Radiochemical Engineering Development Center (REDC) at Oak Ridge National Laboratory (ORNL). DOE sells The radioisotope {sup 252}Cf is routinely encapsulated into compact, portable, intense neutron sources with a 2.6- year half-life. A source the size of a person's little finger can emit up to 10 neutrons/s. Californium-252 is used commercially as a reliable, cost-effective neutron source for prompt gamma neutron activation analysis (PGNAA) of coal, cement, and minerals, as well as for detection and identification of explosives, laud mines, and unexploded military ordnance. Other uses are neutron radiography, nuclear waste assays, reactor start-up sources, calibration standards, and cancer therapy. The inherent safety of source encapsulations is demonstrated by 30 years of experience and by U.S. Bureau of Mines tests of source survivability during explosions. The production and distribution center for the U. S Department of Energy (DOE) Californium Program is the Radiochemical Engineering Development Center (REDC) at Oak Ridge National Laboratory(ORNL). DOE sells {sup 252}Cf to commercial

  16. Production of extra pure curium and californium preparations

    International Nuclear Information System (INIS)

    Preparations of curium-244,245,248 and californium-249,252 are used for the production of ionizing radiation sources for different applications and fundamental nuclear-physical investigations, placing high requirements on the radiochemical and chemical purity of the preparations. Extraction chromatography using di-(2-ethylhexyl)phosphoric acid (D2EHPA) as extractant was chosen to prepare extra pure curium and californium preparations. In order to identify the optimal conditions of Cm-Cf separation and to remove impurities from them (reagent and other impurities), investigations were performed into the effect of impurities (Na+, Ca2+, Al3+, Fe2+, Fe3+ taken as example), extractant and eluent concentration and solution flow rate on the efficiency of mutual purification of Cm and Cf. Both theoretical and experimental estimations were made of the maximum concentration at which the impurities do not affect the process. The conditions chosen allow mutual purification of milligram amounts of Cm and Cf from impurity elements at E(pur) =102 - 103 during a single chromatographic cycle (E(pur) =>103) using a column with 5 - 10 cm3 volume. In this case the production yield exceeds 98%. The purification of milligram amounts of curium and californium from fission products (lanthanides in general, cerium in particular) was performed in D2EHPA-decane-PbO2-HNO3 and D2EHPA-decane-DTPA-H3-Cit extraction chromatography systems. In order to establish the optimal conditions, the effect of [D2EHPA] and eluent on the mutual purification of Cm and Cf and on their purification from cerium and impurity elements was studied in the D2EHPA-decane-PbO2-HNO3 system. During a single chromatographic cycle the mutual purification factors of TPE and of their purification from impurity cations achieve 102-103, from cerium - E(pur) > 10. In the D2EHPA-decane-DTPA-H3Cit system, the effect of concentration of extractant and eluent pH on the efficiency of Cm and Cf purification from lanthanides was

  17. Prompt neutron spectrum of the spontaneous fission of californium-252

    International Nuclear Information System (INIS)

    The californium-252 spontaneous fission neutron spectrum was measured in the energy range of 0.01 to 10 MeV by the time-of-flight technique using various neutron detectors. The measurements of 252Cf neutron spectrum at energies of 0.01 to 5 MeV were performed as a function of fission fragment kinetic energy. The mean neutron spectrum energy in the range of 0.7 to 10 MeV was found from the results of measurements. The irregularity in the 252Cf neutron spectrum in the neutron energy range of less than 0.7 MeV compared to theoretical values is discussed. The mechanism of 252Cf neutron emission is also discussed on the basis of neutron yield angle measurements. 12 references

  18. 20 CFR 632.254 - Program startup.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Program startup. 632.254 Section 632.254 Employees' Benefits EMPLOYMENT AND TRAINING ADMINISTRATION, DEPARTMENT OF LABOR INDIAN AND NATIVE AMERICAN EMPLOYMENT AND TRAINING PROGRAMS Summer Youth Employment and Training Programs § 632.254 Program...

  19. 27 CFR 44.254 - Shipping containers.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 2 2010-04-01 2010-04-01 false Shipping containers. 44.254 Section 44.254 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU... Requirements § 44.254 Shipping containers. Each shipping case, crate, or other container, in which cigars...

  20. 36 CFR 254.25 - Survey.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Survey. 254.25 Section 254.25... National Forest Townsites § 254.25 Survey. The authorized Forest Service official shall conduct or provide for the necessary tract survey and boundary posting of National Forest System land....

  1. Separation of californium from actinides and lanthanides in aqueous solution by electrochemical formation of amalgams

    International Nuclear Information System (INIS)

    The electrochemical reduction of transneptunium elements (Pu to Cf) and rare earths (Eu, Tm) from aqueous complexing solutions to amalgams was studied over a wide range of cathodic potentials in order to achieve optimal separation of californium. The reduction in acetate media (pH 4.5-4.6) at potentials around -1.7 to -1.9 V1 leads to a quantitative extraction of californium into the mercury phase, while more negative potentials are required for the reduction of the lighter transuranium elements and of the lanthanides. Hence, the optimal conditions for the separation of californium from the investigated actinides and lanthanides were determined. Separation factors α between 25 and 90 were found except in the case of Cf/Eu, where poor values (α varying from 7 to 12) were observed. More negative cathodic potentials decrease the selectivity of the reduction process. A similar study with lithium citrate solutions (pH ∝6) shows that satisfactory separation of californium from lighter and heavier actinides is achievable. A separation factor of 88 is obtained for Cf/Am at -1.98 V. The anodic stripping of mixed amalgams (Pu, Am, Cm, Bk, Tm and Cf) Hg in nitric and acetic acid soultions at potentials ranging from +0.1 to -0.7 V proceeds slowly and proved to be ineffective for the separation of californium from light actinides under conditions described. (orig.)

  2. On-line slurry analyses by californium-252

    International Nuclear Information System (INIS)

    In chemical processing technology on-line activation methods gain an increasing importance for process monitoring and control. A method is described according to which the different fluorspar contents at various strategic points of a flotation plant are determined through neutron activation by 100 μg californium-252. A continuous analytical system for onstream process control of slurries was designed and constructed. A compact facility, called SUSAC, allows continuous application of the method on an industrial scale. The main components of the SUSAC facility are the irradiation and measurement cells. The cells are equipped with multistage countercurrent stirrers ensuring a proper radial and vertical distribution of the sample. The hollow shaft of the stirrer of the irradiation cell houses the Cf-source. The NaI-detector has been installed in a recess in the bottom of the measuring cell. The volumes are 9 dm3 for the irradiation cell, 7.5 dm3 for the measuring cell, 1/2 dm3 for the vonnection line and 4 dm3 for feed and drainage lines including the pump. Investigations on the following topics are discussed: selection of stirrers, residence time, flow rate, pulp density, calibration measurements. (T.G.)

  3. Biomedical neutron research at the Californium User Facility for neutron science

    International Nuclear Information System (INIS)

    The Californium User Facility for Neutron Science has been established at Oak Ridge National Laboratory (ORNL). The Californium User Facility (CUF) is a part of the larger Californium Facility, which fabricates and stores compact 252Cf neutron sources for worldwide distribution. The CUF can provide a cost-effective option for research with 252Cf sources. Three projects at the CUF that demonstrate the versatility of 252Cf for biological and biomedical neutron-based research are described: future establishment of a 252Cf-based neutron activation analysis system, ongoing work to produce miniature high-intensity, remotely afterloaded 252Cf sources for tumor therapy, and a recent experiment that irradiated living human lung cancer cells impregnated with experimental boron compounds to test their effectiveness for boron neutron capture therapy

  4. Biomedical neutron research at the Californium User Facility for neutron science

    Energy Technology Data Exchange (ETDEWEB)

    Martin, R.C. [Oak Ridge National Lab., TN (United States); Byrne, T.E. [Roane State Community College, Harriman, TN (United States); Miller, L.F. [Univ. of Tennessee, Knoxville, TN (United States)

    1997-04-01

    The Californium User Facility for Neutron Science has been established at Oak Ridge National Laboratory (ORNL). The Californium User Facility (CUF) is a part of the larger Californium Facility, which fabricates and stores compact {sup 252}Cf neutron sources for worldwide distribution. The CUF can provide a cost-effective option for research with {sup 252}Cf sources. Three projects at the CUF that demonstrate the versatility of {sup 252}Cf for biological and biomedical neutron-based research are described: future establishment of a {sup 252}Cf-based neutron activation analysis system, ongoing work to produce miniature high-intensity, remotely afterloaded {sup 252}Cf sources for tumor therapy, and a recent experiment that irradiated living human lung cancer cells impregnated with experimental boron compounds to test their effectiveness for boron neutron capture therapy.

  5. Proposed Californium-252 User Facility for Neutron Science at Oak Ridge National Laboratory

    International Nuclear Information System (INIS)

    The Radiochemical Engineering Development Center (REDC) at ORNL has petitioned to establish a Californium-252 User Facility for Neutron Science for academic, industrial, and governmental researchers. The REDC Californium Facility (CF) stores the national inventory of sealed 252Cf neutron source for university and research loans. Within the CF, the 252Cf storage pool and two uncontaminated hot cells currently in service for the Californium Program will form the physical basis for the User Facility. Relevant applications include dosimetry and experiments for neutron tumor therapy; fast and thermal neutron activation analysis of materials; experimental configurations for prompt gamma neutron activation analysis; neutron shielding and material damage studies; and hardness testing of radiation detectors, cameras, and electronics. A formal User Facility simplifies working arrangements and agreements between US DOE facilities, academia, and commercial interests

  6. Emergence of californium as the second transitional element in the actinide series.

    Science.gov (United States)

    Cary, Samantha K; Vasiliu, Monica; Baumbach, Ryan E; Stritzinger, Jared T; Green, Thomas D; Diefenbach, Kariem; Cross, Justin N; Knappenberger, Kenneth L; Liu, Guokui; Silver, Mark A; DePrince, A Eugene; Polinski, Matthew J; Van Cleve, Shelley M; House, Jane H; Kikugawa, Naoki; Gallagher, Andrew; Arico, Alexandra A; Dixon, David A; Albrecht-Schmitt, Thomas E

    2015-01-01

    A break in periodicity occurs in the actinide series between plutonium and americium as the result of the localization of 5f electrons. The subsequent chemistry of later actinides is thought to closely parallel lanthanides in that bonding is expected to be ionic and complexation should not substantially alter the electronic structure of the metal ions. Here we demonstrate that ligation of californium(III) by a pyridine derivative results in significant deviations in the properties of the resultant complex with respect to that predicted for the free ion. We expand on this by characterizing the americium and curium analogues for comparison, and show that these pronounced effects result from a second transition in periodicity in the actinide series that occurs, in part, because of the stabilization of the divalent oxidation state. The metastability of californium(II) is responsible for many of the unusual properties of californium including the green photoluminescence. PMID:25880116

  7. Fissile analysis of Hanford waste using Californium Multiplier/Delayed Neutron Counter system

    International Nuclear Information System (INIS)

    Measurement of low-level (10 ng/g or lower) fissile material (mainly plutonium) in Hanford waste and process samples is becoming increasingly important. A system has been designed consisting of a Californium Multiplier (CFX) and a Delayed Neutron Counter (DNC) to characterize these samples. This report describes hardware and analytical capability of the CFX/DNC system

  8. Study of the shielding for spontaneous fission sources of Californium-252

    International Nuclear Information System (INIS)

    A shielding study is made to attenuate, until maximum permissible levels, the neutrons radiation and photons emitted by spontaneous fission coming from a source of Californium-252. The compound package by a database (Library DLC-23) and the ANISNW code is used, in it version for personal computer. (Author)

  9. 48 CFR 53.303-DD-254 - Department of Defense DD Form 254, Contract Security Classification Specification.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Department of Defense DD Form 254, Contract Security Classification Specification. 53.303-DD-254 Section 53.303-DD-254 Federal... Illustrations of Forms 53.303-DD-254 Department of Defense DD Form 254, Contract Security...

  10. Californium (252Cf) and its use as neutron source in science medicine and technology

    International Nuclear Information System (INIS)

    The application of radionuclides in science and nuclear techniques basically is related to unstable isotopes, which are produced from stable elements in nuclear reactor. Their specifications are various from view point of application . Using of physical and chemical properties of radionuclides in chemistry, for with marking the organic compounds we can exactly explain the mechanism of chemical reactions in medical, biology and bio-chemistry. In these cases the behaviour of radionuclides is very important and the selection of the suitable radionuclides is determined between the elements for investigation aims. The special specification of radio-nuclides analysis such as, half-life, kind of ray and energy should be considered with an special accuracy as well as the laws security regulations from view point of ray-protection should be completely observed mean time working these radio-nuclides. It should be considered that application of radio-isotopes is very important from their special specifications point of view. Applying the radionuclides from technology point of view in sciences and nuclear techniques aren't only limited to three analyses of α, β, and γ, but we can use the share of neutron which are produced from spli ting of heavy nucleus such as Californium252 as a neutron source in the depths of the sea and also determining the concentration of low quantity elements on moon and other spheres. The radioisotope of Californium252 is a neutron useful radiator for investigation in nuclear medical and technology because of automatically rapid split to 3.2% Californium252 radiates 1.34 * 109N/m in each mil/GH which suitable replacement for neutron sources based on (a, n) reaction, for example, Radium-Brellium or Amersium-Brellium. The energy distribution of radiated neutrons from analyzing of Californium252 like the spectrum of neutron which is produced from splitting of U235, Pu239 nucleus has the maximum energy in quantity, En=1 MeV in the range of 1.5 MeV. The

  11. Contribution to clinical dosimetry of californium 252 sources used at Gustave Roussy institute

    International Nuclear Information System (INIS)

    The main characteristics of californium 252 sources are presented in the first part of the report. Dose measurements around Californium sources were performed with a pair of ionization multiplication chambers: the first one has an Aluminium wall and is filled with Argon, the second one a plastic tissue-equivalent gas. A set of experiments was performed in order to investigate the relative influence of beta rays on the response of both chambers. Besides the experimental work a computer program was written to calculate the dose distribution around the actual sources made of a series of small active sources placed in catheters. Theoretical data around small sources can be found in the litterature. The comparison between experimental results and theoretical ones has shown a good agreement. The computer program will be included as a sub-routine in the more general computer program used for patients treated with interstitial therapy

  12. Safety Analysis Report for Packaging (SARP) of the Oak Ridge National Laboratory TRU Californium Shipping Container

    International Nuclear Information System (INIS)

    An analytical evaluation of the Oak Ridge National Laboratory TRU Californium Shipping Container was made in order to demonstrate its compliance with the regulations governing off-site shipment of packages that contain radioactive material. The evaluation encompassed five primary categories: structural integrity, thermal resistance, radiation shielding, nuclear criticality safety, and quality assurance. The results of this evaluation demonstrate that the container complies with the applicable regulations

  13. Emergence of californium as the second transitional element in the actinide series

    OpenAIRE

    Cary, Samantha K.; Vasiliu, Monica; Baumbach, Ryan E.; Stritzinger, Jared T.; GREEN, THOMAS D.; Diefenbach, Kariem; Cross, Justin N.; Knappenberger, Kenneth L.; Liu, Guokui; Silver, Mark A.; DePrince, A. Eugene; Polinski, Matthew J.; Van Cleve, Shelley M.; House, Jane H.; Kikugawa, Naoki

    2015-01-01

    A break in periodicity occurs in the actinide series between plutonium and americium as the result of the localization of 5f electrons. The subsequent chemistry of later actinides is thought to closely parallel lanthanides in that bonding is expected to be ionic and complexation should not substantially alter the electronic structure of the metal ions. Here we demonstrate that ligation of californium(III) by a pyridine derivative results in significant deviations in the properties of the resu...

  14. Measurements of integral cross sections in the californium-252 fission neutron spectrum

    International Nuclear Information System (INIS)

    In a low-scattering arrangement cross sections averaged over the californium-252 spontaneous fission neutron spectrum were measured. The reactions 27Al(n,α)46Ti, 47Ti, 48Ti(n,p), 54Fe,56Fe(n,p), 58Ni(n,p), 64Zn(n,p), 115In(n,n') were studied in order to obtain a consistent set of threshold detectors used in fast neutron flux density measurements. Overall uncertainties between 2 and 2.5% could be achieved; corrections due to neutron scattering in source and samples are discussed

  15. Measurement of californium-252 gamma photons depth dose distribution in tissue equivalent material. Vol. 4

    International Nuclear Information System (INIS)

    Phantom of tissue equivalent material with and without bone was used measuring depth dose distribution of gamma-rays from californium-252 source. The source was positioned at center of perspex walled phantom. Depth dose measurements were recorded for X, Y and Z planes at different distances from source. TLD 700 was used for measuring the dose distribution. Results indicate that implantation of bone in tissue equivalent medium cause changes in the gamma depth dose distribution which varies according to variation in bone geometry. 9 figs

  16. 42 CFR 403.254 - Calculation of premiums.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 2 2010-10-01 2010-10-01 false Calculation of premiums. 403.254 Section 403.254... Ratio Provisions § 403.254 Calculation of premiums. (a) General provisions. To calculate the amount of “premiums”, calculate the present value on the initial calculation date of expected earned premiums for...

  17. 36 CFR 254.42 - Valuation of tracts.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Valuation of tracts. 254.42 Section 254.42 Parks, Forests, and Public Property FOREST SERVICE, DEPARTMENT OF AGRICULTURE LANDOWNERSHIP ADJUSTMENTS Conveyance of Small Tracts § 254.42 Valuation of tracts. (a) Approximately equal value shall...

  18. 7 CFR 868.254 - Broken kernels determination.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 7 2010-01-01 2010-01-01 false Broken kernels determination. 868.254 Section 868.254 Agriculture Regulations of the Department of Agriculture (Continued) GRAIN INSPECTION, PACKERS AND STOCKYARD... Governing Application of Standards § 868.254 Broken kernels determination. Broken kernels shall...

  19. Spontaneous Partitioning of Californium from Curium: Curious Cases from the Crystallization of Curium Coordination Complexes

    Energy Technology Data Exchange (ETDEWEB)

    Cary, Samantha K.; Silver, Mark A.; Liu, Guokui; Wang, Jamie C.; Bogart, Justin A.; Stritzinger, Jared T.; Arico, Alexandra A.; Hanson, Kenneth; Schelter, Eric J.; Albrecht-Schmitt, Thomas E.

    2015-12-07

    The reaction of 248CmCl3 with excess 2,6-pyridinedicarboxylic acid (DPA) under mild solvothermal conditions results in crystallization of the tris-chelate complex Cm(HDPA)3·H2O. Approximately half of the curium remains in solution at the end of this process, and evaporation of the mother liquor results in crystallization of the bis-chelate complex [Cm(HDPA)- (H2DPA)(H2O)2Cl]Cl·2H2O. 248Cm is the daughter of the α decay of 252Cf and is extracted in high purity from this parent. However, trace amounts of 249,250,251Cf are still present in all samples of 248Cm. During the crystallization of Cm(HDPA)3·H2O and [Cm(HDPA)(H2DPA)(H2O)2Cl]Cl·2H2O, californium(III) spontaneously separates itself from the curium complexes and is found doped within crystals of DPA in the form of Cf(HDPA)3. These results add to the growing body of evidence that the chemistry of californium is fundamentally different from that of earlier actinides.

  20. A multidetector scintillation camera with 254 channels

    DEFF Research Database (Denmark)

    Sveinsdottir, E; Larsen, B; Rommer, P;

    1977-01-01

    A computer-based scintillation camera has been designed for both dynamic and static radionuclide studies. The detecting head has 254 independent sodium iodide crystals, each with a photomultiplier and amplifier. In dynamic measurements simultaneous events can be recorded, and 1 million total counts...... per second can be accommodated with less than 0.5% loss in any one channel. This corresponds to a calculated deadtime of 5 nsec. The multidetector camera is being used for 133Xe dynamic studies of regional cerebral blood flow in man and for 99mTc and 197 Hg static imaging of the brain....

  1. Dicty_cDB: SLJ254 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLJ2-C/SLJ254Q.Seq.d/ Representati...ve seq. ID SLJ254P (Link to Original site) Representative DNA sequence >SLJ254 (SLJ254Q) /CSM/SL/SLJ2-C/SLJ2...---PPERKYSVWIGGSILASLSTFQQMWISKEEYDESGPSIVHRKCF*tiktsdesasht nkyi*mynnnki*lflmvvdlyptikkkk Translated Amino ...psntqlntvllptgmiwkksgi--- ---PPERKYSVWIGGSILASLSTFQQMWISKEEYDESGPSIVHRKCF*tiktsdesasht nkyi*mynnnki*lflmvvdl...3b: 0.00 m_ : 1.00 36.0 %: cytoplasmic 36.0 %: nuclear 24.0 %: cytoskeletal 4.0 %: mitochondrial >> predicti

  2. Dicty_cDB: CFF254 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFF254 (Link to dictyBase) - - - Contig-U16373-1 CFF254P (Link to Original ... -fnssfkf****y***w*y***rinkk*www**i**qi*kskttt**kr**skw ***q ****kfk*kpcck***iyitii*lssfr*irkgkretrl*nhl*y* ...

  3. Fast and efficient charge breeding of the Californium rare isotope breeder upgrade electron beam ion source

    Energy Technology Data Exchange (ETDEWEB)

    Ostroumov, P. N., E-mail: ostroumov@anl.gov; Barcikowski, A.; Dickerson, C. A.; Perry, A.; Sharamentov, S. I.; Vondrasek, R. C.; Zinkann, G. P. [Argonne National Laboratory, Argonne, Illinois 60439 (United States); Pikin, A. I. [Brookhaven National Laboratory, Upton, New York 11973 (United States)

    2015-08-15

    The Electron Beam Ion Source (EBIS), developed to breed Californium Rare Isotope Breeder Upgrade (CARIBU) radioactive beams at Argonne Tandem Linac Accelerator System (ATLAS), is being tested off-line. A unique property of the EBIS is a combination of short breeding times, high repetition rates, and a large acceptance. Overall, we have implemented many innovative features during the design and construction of the CARIBU EBIS as compared to the existing EBIS breeders. The off-line charge breeding tests are being performed using a surface ionization source that produces singly charged cesium ions. The main goal of the off-line commissioning is to demonstrate stable operation of the EBIS at a 10 Hz repetition rate and a breeding efficiency into single charge state higher than 15%. These goals have been successfully achieved and exceeded. We have measured (20% ± 0.7%) breeding efficiency into the single charge state of 28+ cesium ions with the breeding time of 28 ms. In general, the current CARIBU EBIS operational parameters can provide charge breeding of any ions in the full mass range of periodic table with high efficiency, short breeding times, and sufficiently low charge-to-mass ratio, 1/6.3 for the heaviest masses, for further acceleration in ATLAS. In this paper, we discuss the parameters of the EBIS and the charge breeding results in a pulsed injection mode with repetition rates up to 10 Hz.

  4. Fast and efficient charge breeding of the Californium rare isotope breeder upgrade electron beam ion source

    International Nuclear Information System (INIS)

    The Electron Beam Ion Source (EBIS), developed to breed Californium Rare Isotope Breeder Upgrade (CARIBU) radioactive beams at Argonne Tandem Linac Accelerator System (ATLAS), is being tested off-line. A unique property of the EBIS is a combination of short breeding times, high repetition rates, and a large acceptance. Overall, we have implemented many innovative features during the design and construction of the CARIBU EBIS as compared to the existing EBIS breeders. The off-line charge breeding tests are being performed using a surface ionization source that produces singly charged cesium ions. The main goal of the off-line commissioning is to demonstrate stable operation of the EBIS at a 10 Hz repetition rate and a breeding efficiency into single charge state higher than 15%. These goals have been successfully achieved and exceeded. We have measured (20% ± 0.7%) breeding efficiency into the single charge state of 28+ cesium ions with the breeding time of 28 ms. In general, the current CARIBU EBIS operational parameters can provide charge breeding of any ions in the full mass range of periodic table with high efficiency, short breeding times, and sufficiently low charge-to-mass ratio, 1/6.3 for the heaviest masses, for further acceleration in ATLAS. In this paper, we discuss the parameters of the EBIS and the charge breeding results in a pulsed injection mode with repetition rates up to 10 Hz

  5. Design of a homogeneous subcritical nuclear reactor based on thorium with a source of californium 252

    International Nuclear Information System (INIS)

    Full text: One of the energy alternatives to fossil fuels which do not produce greenhouse gases is the nuclear energy. One of the drawbacks of this alternative is the generation of radioactive wastes of long half-life and its relation to the generation of nuclear materials to produce weapons of mass destruction. An option to these drawbacks of nuclear energy is to use Thorium as part of the nuclear fuel which it becomes in U233 when capturing neutrons, that is a fissile material. In this paper Monte Carlo methods were used to design a homogeneous subcritical reactor based on thorium. As neutron reflector graphite was used. The reactor core is homogeneous and is formed of 70% light water as moderator, 12% of enriched uranium UO2(NO3)4 and 18% of thorium Th(NO3)4 as fuel. To start the nuclear fission chain reaction an isotopic source of californium 252 was used with an intensity of 4.6 x 107 s-1. In the design the value of the effective multiplication factor, whose value turned out keff <1 was calculated. Also, the neutron spectra at different distances from the source and the total fluence were calculated, as well as the values of the ambient dose equivalent in the periphery of the reactor. (Author)

  6. Fast and efficient charge breeding of the Californium rare isotope breeder upgrade electron beam ion source.

    Science.gov (United States)

    Ostroumov, P N; Barcikowski, A; Dickerson, C A; Perry, A; Pikin, A I; Sharamentov, S I; Vondrasek, R C; Zinkann, G P

    2015-08-01

    The Electron Beam Ion Source (EBIS), developed to breed Californium Rare Isotope Breeder Upgrade (CARIBU) radioactive beams at Argonne Tandem Linac Accelerator System (ATLAS), is being tested off-line. A unique property of the EBIS is a combination of short breeding times, high repetition rates, and a large acceptance. Overall, we have implemented many innovative features during the design and construction of the CARIBU EBIS as compared to the existing EBIS breeders. The off-line charge breeding tests are being performed using a surface ionization source that produces singly charged cesium ions. The main goal of the off-line commissioning is to demonstrate stable operation of the EBIS at a 10 Hz repetition rate and a breeding efficiency into single charge state higher than 15%. These goals have been successfully achieved and exceeded. We have measured (20% ± 0.7%) breeding efficiency into the single charge state of 28+ cesium ions with the breeding time of 28 ms. In general, the current CARIBU EBIS operational parameters can provide charge breeding of any ions in the full mass range of periodic table with high efficiency, short breeding times, and sufficiently low charge-to-mass ratio, 1/6.3 for the heaviest masses, for further acceleration in ATLAS. In this paper, we discuss the parameters of the EBIS and the charge breeding results in a pulsed injection mode with repetition rates up to 10 Hz. PMID:26329185

  7. Neutron activation analysis at the Californium User Facility for Neutron Science

    International Nuclear Information System (INIS)

    The Californium User Facility (CUF) for Neutron Science has been established to provide 252Cf-based neutron irradiation services and research capabilities including neutron activation analysis (NAA). A major advantage of the CUF is its accessibility and controlled experimental conditions compared with those of a reactor environment The CUF maintains the world's largest inventory of compact 252Cf neutron sources. Neutron source intensities of ≤ 1011 neutrons/s are available for irradiations within a contamination-free hot cell, capable of providing thermal and fast neutron fluxes exceeding 108 cm-2 s-1 at the sample. Total flux of ≥109 cm-2 s-1 is feasible for large-volume irradiation rabbits within the 252Cf storage pool. Neutron and gamma transport calculations have been performed using the Monte Carlo transport code MCNP to estimate irradiation fluxes available for sample activation within the hot cell and storage pool and to design and optimize a prompt gamma NAA (PGNAA) configuration for large sample volumes. Confirmatory NAA irradiations have been performed within the pool. Gamma spectroscopy capabilities including PGNAA are being established within the CUF for sample analysis

  8. Long-term effects of an intracavitary treatment with californium-252 on normal tissue

    International Nuclear Information System (INIS)

    About one hundred fifty swine were exposed to either radium-226 or californium-252 sources in the uterine cervix to determine an RBE for both acute and long-term effects. That value for early changes in the tissues at risk in the treatment of cervical cancer was between 6.2 and 6.8. The incidence of complications increased with time after exposure, especially among animals treated with 252Cf. Analysis of rectal injury showed that ulceration occurred frequently within a year postexposure at doses between 1600 and 2400 rad calculated at 2 cm lateral to the source midline. Fat necrosis and smooth muscle atrophy, resulting in a local rectal stricture, were delayed changes observed in some animals. The lower ureter was the site for a greater frequency of complications than the GI tract. Ureteral stricture often occurred at doses of 1200 rad from 252Cf and 7000 rad from 226Ra. Observation of delayed effects in the uterine-cervix in animals held up to 4 years postexposure indicate that the RBE for 252Cf may be increased to a value as high as 18, while repair may have even decreased it to about 5.6 in the rectum. Fifty swine are still being observed for long-term effects after doses above 800 rad from 252Cf and 5000 rad from 226Ra

  9. Manganese determination om minerals by activation analysis, using the californium-252 as a neutron source

    International Nuclear Information System (INIS)

    Neutron Activation Analysis, using a Californium-252 neutron source, has been applied for the determination of manganese in ores such as pyrolusite, rodonite (manganese silicate)' and blending used in dry-batteries The favorable nuclear properties of manganese, such as high thermal neutron cross-section for the reaction 55Mn (n.gamma)56 Mn, high concentration of manganese in the matrix and short half - life of 56Mn, are an ideal combination for non-destructive analysis of manganese in ores. Samples and standards of manganese dioxide were irradiated for about 20 minutes, followed by a 4 to 15 minutes decay and counted in a single channel pulse-height discrimination using a NaI(Tl) scintillation detector. Counting time was equal to 10 minutes. The interference of nuclear reactions 56Fe(n,p)56Mn and 59 Co (n, α)56 were studied, as well as problems in connection with neutron shadowing during irradiation, gamma-rays attenuation during counting and influence of granulometry of samples. One sample,was also analysed by wet-chemical method (sodium bismuthate) in order to compare results. As a whole, i t was shown that the analytical method of neutron activation for manganese in ores and blending, is a method simple, rapid and with good precision and accuracy. (author)

  10. Five-year cure of cervical cancer treated using californium-252 neutron brachytherapy

    International Nuclear Information System (INIS)

    Female pelvic carcinoma is one of the common malignancies seen at the University of Kentucky Medical Center and often presents in an advanced stage. In 1976, the authors began to test californium-252 neutron brachytherapy (NT) for its efficacy for control of primary and recurrent advanced uterine, cervix, and vaginal cancers. The first protocol used was 5000-5500 rad of whole pelvis irradiation followed by 1-2 Cf-252 insertions using a single tandem placed in the utero-cervico-vaginal region. Of 27 patients with primary carcinomas treated, 10 are alive and well 5 year later (37%). Two of two recurrent tumors were locally controlled but failed later. These patients had advanced cervical, vaginal, or endometrial carcinomas. In 1977, a transitional year, treatment of only unfavorable stages and presentations with NT was initiated. Similar results were obtained with NT as compared to conventional photon therapy (PT). Further improvement in treatment results can be anticipated as NT brachytherapy is used for advanced cancer therapy by more effective treatment schedules and radiation doses. Cf-252 can be used as a radium substitute and achieved similar rates of tumor control and 5-year survivals. 21 references, 2 tables

  11. Uptake and distribution of californium-252 chloride administered intraperitoneally, intravenously or intratracheally and the effect of in vivo DTPA chelation on intratracheal instillation in the rat

    International Nuclear Information System (INIS)

    The first phase of this investigation, comprising of three groups of animals, was designed to study the fate of californium-252 chloride administered intraperitoneally, intravenously or intratracheally. The second phase, which consisted of two groups of animals, was designed to examine the effectiveness of DTPA chelation therapy in accelerating the excretion and preventing the deposition of californium-252 chloride instilled into the lungs of rats. Immediately following the dose administration of 2 uCi of californium-252 chloride which was dissolved in 0.2 ml of 0.9% NaCl at pH 3.5, each rat was placed in a metabolism cage. Each rat in the first group of phase II was given intraperitoneal injection of CaNa3 DTPA (50 mg/kg) and each rat in the second group was given intraperitoneal injections of 0.9% NaCl. Injections of the DTPA or the NaCl sham were initiated immediately after the intratracheal administration of californium-252 chloride and were continued every three days until sacrifice. Following intraperitoneal, intravenous or intratracheal administration, the whole body retention of californium as a function of time was described by a three component exponential equation. For each mode of administration the short term component exhibited a biological half-life of between 5 and 10 hours; the intermediate component between 4 and 6 days; and the long term component between 200 and 300 days. The organ data obtained following intraperitoneal and intravenous administration were indistinguishable. On day one, the liver retained about 9% of the administered dose and the kidneys retained 2.4%. Retention for these organs decreased to about 1% by day 32. The femurs maintained an almost constant level of 4.5% of the injected dose over the 32 days. The lungs, spleen, heart, and testes showed significant retention of californium

  12. Dicty_cDB: CFC254 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ce kylflflfffiifqhnni*l*FGINSVIFVFFFFXKGGXWVX--- Translated Amino Acid sequence (All Frames) Frame A: iniyfyfyffl*fsnit...s) Value N L16578 |L16578.1 Dictyostelium discoideum HIV1 TAT-binding protein homologous protein mRNA, complete...CF (Link to library) CFC254 (Link to dictyBase) - - - Contig-U15589-1 CFC254F (Link to Original site...ctyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15589-1 Original site URL http://dict...ycdb.biol.tsukuba.ac.jp/CSM/CF/CFC2-C/CFC254Q.Seq.d/ Representative seq. ID CFC254F (Link to Original site

  13. Dicty_cDB: CHP254 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHP254 (Link to dictyBase) - - - Contig-U15541-1 - (Link to Original site) ... qvlf*rivftlkiakemkf*lnnghqlnqmletslkilfykv*dhqnmkh vtl *ll*fhvlvllkfhtqcgkn*sqhylktlkvvqkvlnnllfkhlvifvkkl ...

  14. 36 CFR 254.1 - Scope and applicability.

    Science.gov (United States)

    2010-07-01

    ...-521i) (36 CFR part 254, subpart C), and as otherwise noted. These rules also apply to other methods of... to all applicable exchange laws, except the cash equalization provisions of the Sisk Act of...

  15. Dicty_cDB: SSB254 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSB254 (Link to dictyBase) - - - Contig-U04520-1 SSB254F (Link to Original ... 154, com... 33 4.0 EU545988_1( EU545988 |pid:none) Zika ... virus polyprotein gene, compl... 32 5.3 AY632535_1 ... ( AY632535 |pid:none) Zika ... virus strain MR 766, complete... 32 5.3 AE014298_1 ...

  16. Dicty_cDB: SHF254 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SH (Link to library) SHF254 (Link to dictyBase) - - - Contig-U16371-1 SHF254P (Link to Original ... Oryzias latipes DNA, clone: ola1-242I19.F, genomic survey ... sequence. 54 0.004 1 DE092915 |DE092915.1 Oryzias ... latipes DNA, clone: ola1-209J09.R, genomic survey ... sequence. 54 0.004 1 DE086252 |DE086252.1 Oryzias ...

  17. ENEA results in the international comparison organized by BIPM for the measurament of neutron fluxes of a Californium source

    International Nuclear Information System (INIS)

    During the period between May 1978 and August 1984 under the auspices of Section III of CCEMRI of CIPM it has been carried out the international intercomparison of Californium neutron source emission rate. The previous intercomparison was based on Ra-Be (α -n) source measuraments, which took place between 1959 and 1965, and the results showed a total spread of +- 3%. Owing to the better accuracy achived over the following decade the Ra-Be intercomparison was no longer representative of the state of the art, therefore it was decided to arrange the intercomparison based on Californium which in the meantime reached a wide use in the world. Contributions to the intercomparison were received from fourteen laboratories representative of twelve Nations plus the BIPM. The results put into evidence a considerable advance on accuracy in the neutron source emission rate measuraments. The standard deviation of the residuals obtained from least square fit of normalized data resulted +- 0,57%. In the present report it is widely described the Manganese bath method used at ENEA, CRE Casaccia in Roma, and the experimental procedure followed for its absolute calibration. All measuraments are reported and analysed, including those effectuated for corrective factors determination. The final results obtained at ENEA for the circulated Californium source is (3,457 +- 0,013) 10*H7 neutron/s. The analysis of data from all partecipantes has been effectuated and concluded by J. Axton in March 1986 and the conclusions which have been showed in the present report put in evidence the satisfactory results achived by the ENEA

  18. Feasibility and market potential of protein determination of wheat using californium-252

    International Nuclear Information System (INIS)

    To evaluate the feasibility of protein determination by capture gamma-ray analysis using californium-252 neutrons, an in-situ protein analysis system for use by grain handlers has been examined. Three 227 kilogram (approximately) lots of wheat were used to determine the amount of nitrogen present. Protein analyses by the Kjeldahl method were obtained from samples taken before and after the capture gamma-ray analyses. The 5.267-MeV gamma-ray was selected for use in this study as a compromise between efficiency and interference from other elements. The associated counting equipment was a multichannel analyzer with pulse shaping electronic and analysis computing equipment. A linear regression program was used to compare the regions of interest to the Kjeldahl protein averages. The counts composing each peak were summed and normalized using the total count of the hydrogen peak. The normalized nitrogen percentages indicate a significant correlation between the spectral regions and the Kjeldahl analyses. To a first approximation, the value of wheat is the wheat protein. At the present time, protein testing of wheat is destructive, cumbersome, and time-consuming as compared to the potential for capture gamma-ray analysis testing. Assuming that such a protein analysis unit can analyze 42 tonne of wheat per hour, over 120 units would be needed to monitor one-half the U.S. annual wheat production. A 0.5% improvement in processor realizations and grain throughput value of $167.00 per tonne will result in a projected savings of $150,000 per year per unit

  19. Oxygen enhancement ratio (OER) and therapeutic gain factor (GF) for californium-252 at low dose rate

    International Nuclear Information System (INIS)

    The potential benefit of the introduction of californium-252 in interstitial and intracavitary therapy is related to the greater efficiency of its neutron emission against anoxic cancer cells. In that respect, the oxygen enhancement ratio (OER) of the 252Cf emission has been determined for a continuous low dose rate irradiation. The biological system is growth inhibition in Vicia faba bean roots. A new Vicia faba ''BelB'' strain has been used, which better tolerates long periods (up to about 10 hours) of anoxia. In a first series of experiments, for a 252Cf (Dsub(n+γ)) dose rate of 0.11 Gy.h-1, an OER of 1.4+-0.1 was observed (the γ contribution Dγ to the total absorbed dose Dsub(n+γ) was 0.35 at the position of the root tips). In a second series of experiments, in somewhat different geometrical conditions with a 252Cf (Dsub(n+γ)) dose rate of 0.13 Gy.h-1, an OER of 1.5+-0.1 was observed (Dγ/Dsub(n+γ)=0.42). The OER values observed for similar irradiation times, with iridium-192 γ-rays, were 2.3+-0.2 and 2.6+-0.1 respectively, which leads to therapeutic gain factors (GF) of 1.6 and 1.7 respectively. These GF values are slightly lower than those previously obtained (GF=1.8) on the same system, with d(50)-Be p(75)-Be and 15 MeV neutron beams

  20. Application of TSH bioindicator for studying the biological efficiency of neutrons from californium-252 source

    International Nuclear Information System (INIS)

    The effectiveness of neutrons from a Californium-252 source in the induction of various abnormalities in the Tradescantia clone 4430 stamen hair cells (TSH-assay) was studied. The special attention was paid to check whether any enhancement in effects caused by process of boron neutron capture is visible in the cells enriched with boron ions. Two chemicals (borax and BSH) were applied to introduce boron-10 ions into cells. Inflorescence, normal or pretreated with chemicals containing boron, were irradiated in the air with neutrons from a Cf-252 source at KAERI, Taejon, Korea. To estimate the relative biological effectiveness (RBE) in the induction of gene mutations of the neutron beam under the study, Tradescantia inflorescences, without any chemical pretreatment, were irradiated with various doses of X-rays. The ranges of radiation doses used were 0-0.1 Gy in neutrons and 0-0.5 Gy in X-rays. After the time needed to complete the postirradiation repair Tradescantia cuttings were transferred to Cracow, where screening of gene and lethal; mutations, cell cycle alterations in somatic cells have been done, and dose response relationships were figured. The maximal RBE values were estimated in the range of 4.6-6.8. Alterations of RBE value were observed; from 6.8 to 7.8 in the case of plants pretreated with 240 ppm of B-10 from borax, and 4.6 to 6.1 in the case of 400 ppm of B-10 from BSH. Results showed a slight, although statistically insignificant increase in biological efficacy of radiation from the Cf-252 source in samples pretreated with boron containing chemicals. (author)

  1. Divalent and trivalent gas-phase coordination complexes of californium: evaluating the stability of Cf(ii).

    Science.gov (United States)

    Dau, Phuong D; Shuh, David K; Sturzbecher-Hoehne, Manuel; Abergel, Rebecca J; Gibson, John K

    2016-08-01

    The divalent oxidation state is increasingly stable relative to the trivalent state for the later actinide elements, with californium the first actinide to exhibit divalent chemistry under moderate conditions. Although there is evidence for divalent Cf in solution and solid compounds, there are no reports of discrete complexes in which Cf(II) is coordinated by anionic ligands. Described here is the divalent Cf methanesulfinate coordination complex, Cf(II)(CH3SO2)3(-), prepared in the gas phase by reductive elimination of CH3SO2 from Cf(III)(CH3SO2)4(-). Comparison with synthesis of the corresponding Sm and Cm complexes reveals reduction of Cf(III) and Sm(III), and no evidence for reduction of Cm(III). This reflects the comparative 3+/2+ reduction potentials: Cf(3+) (-1.60 V) ≈ Sm(3+) (-1.55 V) ≫ Cm(3+) (-3.7 V). Association of O2 to the divalent complexes is attributed to formation of superoxides, with recovery of the trivalent oxidation state. The new gas-phase chemistry of californium, now the heaviest element to have been studied in this manner, provides evidence for Cf(II) coordination complexes and similar chemistry of Cf and Sm. PMID:27424652

  2. Hypoxic versus normoxic external-beam irradiation of cervical carcinoma combined with californium-252 neutron brachytherapy. Comparative treatment results of a 5-year randomized study

    Czech Academy of Sciences Publication Activity Database

    Tačev, T.; Vacek, Antonín; Ptáčková, B.; Strnad, V.

    2005-01-01

    Roč. 181, č. 5 (2005), s. 273-284. ISSN 0179-7158 Institutional research plan: CEZ:AV0Z50040507 Keywords : cervical carcinoma * hypoxyradiotherapy * californium-252 Subject RIV: BO - Biophysics Impact factor: 3.490, year: 2005

  3. Susceptibility to Stress Corrosion Cracking of 254SMO SS

    Directory of Open Access Journals (Sweden)

    De Micheli Lorenzo

    2002-01-01

    Full Text Available The susceptibility to stress corrosion cracking (SCC of solubilized and sensitized 254SMO SS was studied in sodium chloride, and sodium fluoride solutions at 80 °C and sulfuric acid solutions in presence of sodium chloride at 25 °C. The influence of salt concentration, pH values and the addition of thiosulfate was examined. The susceptibility to SCC was evaluated by Slow Strain Rate Tests (SSRT, at 1.5 x 10-6 s-1 strain rate. The behavior of 254SMO was compared to those of AISI 316L SS and Hastelloy C276. 254SMO showed an excellent resistance to SCC in all conditions, except in the more acidic solutions (pH <= 1 where, in the sensitized conditions, intergranular stress corrosion cracking occurred.

  4. Susceptibility to Stress Corrosion Cracking of 254SMO SS

    OpenAIRE

    De Micheli Lorenzo; Agostinho Silvia Maria Leite; Trabanelli Giordano; Zucchi Fabrizio

    2002-01-01

    The susceptibility to stress corrosion cracking (SCC) of solubilized and sensitized 254SMO SS was studied in sodium chloride, and sodium fluoride solutions at 80 °C and sulfuric acid solutions in presence of sodium chloride at 25 °C. The influence of salt concentration, pH values and the addition of thiosulfate was examined. The susceptibility to SCC was evaluated by Slow Strain Rate Tests (SSRT), at 1.5 x 10-6 s-1 strain rate. The behavior of 254SMO was compared to those of AISI 316L SS and ...

  5. Solving the Hydration Structure of the Heaviest Actinide Aqua Ion Known: The Californium(III) Case

    Energy Technology Data Exchange (ETDEWEB)

    Den Auwer, Ch.; Guillaumont, D. [CEA Marcoule, Nucl Energy Div, Radiochem Proc Dept, SCPS LILA, 30 (France); Galbis, E.; Pappalardo, Rafael R.; Marcos Sanchez, E. [Univ Seville, Dept Quim Fis, E-41012 Seville (Spain); Hernandez-Cobos, J. [Inst Ciencias Fis, Cuernavaca 62251, Morelos (Mexico); Le Naour, C.; Simoni, E. [Univ Paris Sud, Inst Phys Nucl Orsay, Paris (France)

    2010-07-01

    In summary, the first MC simulation of the trivalent cation of californium, based on an exchangeable hydrated ion-water intermolecular potential, has been shown to extend and improve the hydrated ion model. Likewise, the CfL{sub III}-edge EXAFS spectrum of an acidic 1 mm Cf(ClO{sub 4}){sub 3} aqueous solution recorded under optimized experimental conditions has greatly improved the signal/noise ratio of the only previously recorded spectrum. The comparison of the experimental EXAFS spectrum with the two computed ones, obtained from two different intermolecular potentials that predict eight (BP86) or nine (MP2) water molecules in the first coordination shell, leads to the conclusion that the lowest hydration number is preferred. Then, as Cf{sup III} is the heaviest actinide aqua ion for which there is experimental information, the actinide contraction is supported by the present study. (For U{sup III}, R{sub U-O}=2.56 Angstroms, and CN=9{+-}1; for Pu{sup III}, R{sub Pu-O}=2.51 Angstroms and CN=9{+-}1; for Cm{sup III}, R{sub Cm-O}=2.47 Angstroms and CN=9{+-}1). The role of the second hydration shell is important in defining the structure and dynamics of the Cf{sup III} aqua ion, but the contribution of second-shell water molecules to the EXAFS signal as back-scatters is marginal. Finally, this work gives an illustrative example of the benefits which can be achieved from the combination of experimental X-ray absorption spectroscopy and computer simulations. The usefulness of the simultaneous analysis of the results as well as the importance of the structural statistical average has been clearly demonstrated herein. Each technique independently was not adequate. We believe that this study traces out a still poorly explored combined methodology which may be extremely useful for many other complexes and chemical problems. A systematic theoretical and experimental examination of the other known actinide cations on the same basis should be undertaken to confirm the

  6. 40 CFR 180.254 - Carbofuran; tolerances for residues.

    Science.gov (United States)

    2010-07-01

    ... inadvertent residues. Editorial Note: For Federal Register citations affecting § 180.254, see the List of CFR... Parts per million (ppm) Expiration/Revocation date Alfalfa, forage (of which no more than 5 ppm are carbamates) 10 12/31/09 Alfalfa, hay (of which no more than 20 ppm are carbamates) 40 12/31/09 Banana 0.1...

  7. 7 CFR 1220.254 - Patents, copyrights, inventions, and publications.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 10 2010-01-01 2010-01-01 false Patents, copyrights, inventions, and publications... Miscellaneous § 1220.254 Patents, copyrights, inventions, and publications. (a) Any patents, copyrights..., franchising, or other uses of such patents, copyrights, inventions, or publications, inure to the benefit...

  8. Design, construction, and characterization of a facility for neutron capture gamma ray analysis of sulfur in coal using californium-252

    International Nuclear Information System (INIS)

    A study of neutron capture gamma ray analysis of sulfur in coal using californium-252 as a neutron source is reported. Both internal and external target geometries are investigated. The facility designed for and used in this study is described. The external target geometry is found to be inappropriate because of the low thermal neutron flux at the sample location, which must be outside the biological shielding. The internal target geometry is found to have a sufficient thermal neutron flux, but an excessive gamma ray background. A water filled plastic facility, rather than the paraffin filled steel one used in this study, is suggested as a means of increasing flexibility and decreasing the beackground in the internal target geometry

  9. Radiation trapping of the Hg 254 nm resonance line

    Energy Technology Data Exchange (ETDEWEB)

    Herd, M T [Department of Physics, University of Wisconsin, Madison, WI 53705 (United States); Lawler, J E [Department of Physics, University of Wisconsin, Madison, WI 53705 (United States); Menningen, K L [Department of Physics and Astronomy, University of Wisconsin, Stevens Point, WI 54481 (United States)

    2005-09-07

    The decay rate of Hg 6 {sup 3}P{sub 1} atoms, due primarily to the escape of trapped 254 nm resonance radiation, was measured as a function of both Hg and Ar density in cylindrical, sealed fused silica cells. Time-resolved laser-induced fluorescence at 254 nm was used to obtain the decay rates for Hg densities from 5 x 10{sup 13} to 7 x 10{sup 15} cm{sup -3} (22-101 deg. C cold spot temperatures) and Ar densities from 0 to 9.7 x 10{sup 17} cm{sup -3} in a cell of inner radius 1.05 cm. These new experimental data are compared to Monte Carlo results from a highly realistic code for simulating radiation trapping. This code includes Voigt profiles from a combination of Doppler, resonance, buffer gas and radiative line broadening, as well as hyperfine and isotopic structure with proper collisional redistribution. Upper limits on the rate constants for the quenching of Hg 6 {sup 3} P{sub 1} atoms by collisions with ground level Ar and Hg atoms were derived. Additional Monte Carlo simulations covering cell radii from 0.1 to 3.0 cm were performed. A broadly applicable engineering formula is derived from this study, which predicts the Hg 6 {sup 3}P{sub 1} decay rate from 254 nm resonance radiation trapping as a function of Hg and Ar densities and cell radius.

  10. 47 CFR 1.254 - Nature of the hearing; burden of proof.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 1 2010-10-01 2010-10-01 false Nature of the hearing; burden of proof. 1.254 Section 1.254 Telecommunication FEDERAL COMMUNICATIONS COMMISSION GENERAL PRACTICE AND PROCEDURE Hearing Proceedings Hearing and Intermediate Decision § 1.254 Nature of the hearing; burden of proof. Any hearing...

  11. Operational experience with the Argonne National Laboratory Californium Rare Ion Breeder Upgrade facility and electron cyclotron resonance charge breeder

    Science.gov (United States)

    Vondrasek, R.; Clark, J.; Levand, A.; Palchan, T.; Pardo, R.; Savard, G.; Scott, R.

    2014-02-01

    The Californium Rare Ion Breeder Upgrade (CARIBU) of the Argonne National Laboratory Argonne Tandem Linac Accelerator System (ATLAS) facility provides low-energy and accelerated neutron-rich radioactive beams to address key nuclear physics and astrophysics questions. A 350 mCi 252Cf source produces fission fragments which are thermalized and collected by a helium gas catcher into a low-energy particle beam with a charge of 1+ or 2+. An electron cyclotron resonance (ECR) ion source functions as a charge breeder in order to raise the ion charge sufficiently for acceleration in the ATLAS linac. The ECR charge breeder has achieved stable beam charge breeding efficiencies of 10.1% for 23Na7+, 17.9% for 39K10+, 15.6% for 84Kr17+, and 12.4% for 133Cs27+. For the radioactive beams, a charge breeding efficiency of 11.7% has been achieved for 143Cs27+ and 14.7% for 143Ba27+. The typical breeding times are 10 ms/charge state, but the source can be tuned such that this value increases to 100 ms/charge state with the best breeding efficiency corresponding to the longest breeding times—the variation of efficiencies with breeding time will be discussed. Efforts have been made to characterize and reduce the background contaminants present in the ion beam through judicious choice of q/m combinations. Methods of background reduction are being investigated based upon plasma chamber cleaning and vacuum practices.

  12. Long-term effects of an intracavitary treatment with californium-252 on normal tissue. [Swine, /sup 226/Ra

    Energy Technology Data Exchange (ETDEWEB)

    Sullivan, M.F.; Beamer, J.L.; Mahony, T.D.; Cross, F.T.; Lund, J.E.; Endres, G.W.R.

    1976-01-01

    About one hundred fifty swine were exposed to either radium-226 or californium-252 sources in the uterine cervix to determine an RBE for both acute and long-term effects. That value for early changes in the tissues at risk in the treatment of cervical cancer was between 6.2 and 6.8. The incidence of complications increased with time after exposure, especially among animals treated with /sup 252/Cf. Analysis of rectal injury showed that ulceration occurred frequently within a year postexposure at doses between 1600 and 2400 rad calculated at 2 cm lateral to the source midline. Fat necrosis and smooth muscle atrophy, resulting in a local rectal stricture, were delayed changes observed in some animals. The lower ureter was the site for a greater frequency of complications than the GI tract. Ureteral stricture often occurred at doses of 1200 rad from /sup 252/Cf and 7000 rad from /sup 226/Ra. Observation of delayed effects in the uterine-cervix in animals held up to 4 years postexposure indicate that the RBE for /sup 252/Cf may be increased to a value as high as 18, while repair may have even decreased it to about 5.6 in the rectum. Fifty swine are still being observed for long-term effects after doses above 800 rad from /sup 252/Cf and 5000 rad from /sup 226/Ra.

  13. Human Factors evaluation of LCS 254 and 255

    International Nuclear Information System (INIS)

    This report includes the results of the Human Factors evaluation of the local control stations (LCS) 254 and 255 performed by Savannah River Technology Center (SRTC) Human Factors. Recommendations are included in order that the panel designs will be upgraded to comply with human engineering design guidelines. Figures 1 and 2 are included as examples of recommended changes. Also, consideration was given to including the proposed engineering changes which are currently on-going for LCS 255. Appendix A identifies the human engineering requirements from NUREG-0700 which were used in the evaluation process, and the areas of the design which do not comply with the guidelines. Those areas of the panel design which fail to comply with the human engineering guidelines are label location, label content, location aids, panel layout, and control display integration. Each of these design deficiencies and proposed corrections are described in this report

  14. Exploring the stability of super heavy elements: First Measurement of the Fission Barrier of 254No

    Directory of Open Access Journals (Sweden)

    Henning G.

    2014-03-01

    Full Text Available The gamma-ray multiplicity and total energy emitted by the heavy nucleus 254No have been measured at 2 different beam energies. From these measurements, the initial distributions of spin I and excitation energy E∗ of 254No were constructed. The distributions display a saturation in excitation energy, which allows a direct determination of the fission barrier. 254No is the heaviest shell-stabilized nucleus with a measured fission barrier.

  15. Results with the electron cyclotron resonance charge breeder for the 252Cf fission source project (Californium Rare Ion Breeder Upgrade) at Argonne Tandem Linac Accelerator System

    International Nuclear Information System (INIS)

    The construction of the Californium Rare Ion Breeder Upgrade, a new radioactive beam facility for the Argonne Tandem Linac Accelerator System (ATLAS), is nearing completion. The facility will use fission fragments from a 1 Ci 252Cf source; thermalized and collected into a low-energy particle beam by a helium gas catcher. In order to reaccelerate these beams, an existing ATLAS electron cyclotron resonance (ECR) ion source was redesigned to function as an ECR charge breeder. Thus far, the charge breeder has been tested with stable beams of rubidium and cesium achieving charge breeding efficiencies of 9.7% into 85Rb17+ and 2.9% into 133Cs20+.

  16. Ab initio full-potential study of mechanical properties and magnetic phase stability of californium monopnictides (CfN and CfP)

    Science.gov (United States)

    Amari, S.; Bouhafs, B.

    2016-09-01

    Based on the first-principles methods, the structural, elastic, electronic, properties and magnetic ordering of californium monopnictides CfX (X = P) have been studied using the full-potential augmented plane wave plus local orbitals (FP-L/APW + lo) method within the framework of density functional theory (DFT). The electronic exchange correlation energy is described by generalized gradient approximation GGA and GGA+U (U is the Hubbard correction). The GGA+U method is applied to the rare-earth 5f states. We have calculated the lattice parameters, bulk modulii and the first pressure derivatives of the bulk modulii. The elastic properties of the studied compounds are only investigated in the most stable calculated phase. In order to gain further information, we have calculated Young's modulus, shear modulus, anisotropy factor and Kleinman parameter by the aid of the calculated elastic constants. The results mainly show that californium monopnictides CfX (X = P) have an antiferromagnetic spin ordering. Density of states (DOS) and charge densities for both compounds are also computed in the NaCl (B1) structure.

  17. 37 CFR 2.54 - Requirements for drawings submitted on paper.

    Science.gov (United States)

    2010-07-01

    ... submitted on paper. 2.54 Section 2.54 Patents, Trademarks, and Copyrights UNITED STATES PATENT AND TRADEMARK... drawings submitted on paper. The drawing must meet the requirements of § 2.52. In addition, in a paper submission, the drawing should: (a) Be on non-shiny white paper that is separate from the application; (b)...

  18. 30 CFR 254.46 - Whom do I notify if an oil spill occurs?

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Whom do I notify if an oil spill occurs? 254.46... Outer Continental Shelf Facilities § 254.46 Whom do I notify if an oil spill occurs? (a) You must immediately notify the National Response Center (1-800-424-8802) if you observe: (1) An oil spill from...

  19. 48 CFR 53.204-1 - Safeguarding classified information within industry (DD Form 254, DD Form 441).

    Science.gov (United States)

    2010-10-01

    ... information within industry (DD Form 254, DD Form 441). 53.204-1 Section 53.204-1 Federal Acquisition....204-1 Safeguarding classified information within industry (DD Form 254, DD Form 441). The following... specified in subpart 4.4 and the clause at 52.204-2: (a) DD Form 254 (Department of Defense (DOD)),...

  20. Anatomy of a controversy: Application of the Langevin technique to the analysis of the Californium-252 Source-Driven Noise Analysis method for subcriticality determination

    International Nuclear Information System (INIS)

    The expressions for the power spectral density of the noise equivalent sources have been calculated explicitly for the (a) stochastic transport equation, (b) the one-speed transport equaton, (c) the one-speed P1 equations, (d) the one-speed diffusion equation and (e) the point kinetic equation. The stochastic nature of Fick's law in (d) has been emphasized. The Langevin technique has been applied at various levels of approximation to the interpretation of the Californium-252 Source-Driven Noise Analysis (CSDNA) experiment for determining the reactivity in subcritical media. The origin of the controversy surrounding this method has been explained. The foundations of the CSDNA method as a viable experimental technique to infer subcriticality from a measured ratio of power spectral densities of the outputs of two neutron detectors and a third external source detector has been examined by solving the one-speed stochastic diffusion equation for a point external Californium-252 source and two detectors in an infinite medium. The expression relating reactivity to the measured ratio of PSDs was found to depend implicitly on k itself. Through a numerical analysis fo this expression, the authors have demonstrated that for a colinear detector-source-detector configuration for neutron detectors far from the source, the expression for the subcritical multiplication factor becomes essentially insensitive to k, hence, demonstrating some possibility for the viability of this technique. However, under more realistic experimental conditions, i.e., for finite systems in which diffusion theroy is not applicable, the measurement of the subcritical multiplication factor from a single measured ratio of PSDs, without extensive transport calculations, remains doubtful

  1. Application of SCGE assay, classical cytogenetics and FISH for studying in vitro californium-252 neutrons irradiations and BSH pretreatment on human lymphocytes

    International Nuclear Information System (INIS)

    Recently, there has been observed a tendency to apply various energy neutrons for tumor therapy and particularly low energy neutrons from various sources, including californium-252 source, for cancer radiotherapy based on the neutron capture. In this study peripheral blood lymphocytes were used as a model for human cells and three methods were applied to assess the effectiveness of californium-252 neutrons irradiations in vitro in normal cells or pre-treated with compound enriched in B-10 ion. Human blood samples or isolated lymphocytes were irradiated with neutrons from isotopic 252Cf source at the Faculty of Nuclear Physics and Technics at University of Mining and Metallurgy (both neutron source and samples were placed in polyethylene block). Chemical pretreatment with BSH (Na210B12H11SH) was done to introduce boron-10 ion into cells in order to check any enhancement effect due to the process of boron neutron capture. Comet assay was done to investigate the DNA damage. Classical cytogenetics was applied to assess the frequencies of unstable aberrations (dicentrics and rings). Fluorescence in situ hybridization (FISH) with probes for chromosomes 1, 4 (14.3% of whole genome) and pancentromeric probe was performed to evaluate the frequencies of stable aberrations. Linear (or close to linear) increase of DNA damage and aberration frequency was observed with dose of radiation both for lymphocytes untreated or pre-treated with BSH. Very little differences (statistically insignificant) due to radiation dose and BSH pretreatment were observed in the frequencies of SCEs detected in the second mitosis. There is no significant difference between boron pre-treated and not treated cells, and even slightly higher effects were observed in case of the highest dose without BSH pretreatment. The level of translocations observed is comparable with the frequencies of dicentrics and rings. (author)

  2. Californium-252 neutron sources

    International Nuclear Information System (INIS)

    Major production programs for the Savannah River reactors and the High Flux Isotopes Reactor at Oak Ridge have made 252Cf one of the most available and, at the USAEC's sales price of $10/μg, one of the least-expensive isotopic neutron sources. Reactor production has totaled approximately 2 g, and, based on expected demand, an additional 10 g will be produced in the next decade. The approximately 800 mg chemically separated to date has been used to prepare over 600 neutron sources. Most, about 500, have been medical sources containing 1 to 5 μg of 252Cf plated in needles for experimental cancer therapy studies. The remainder have generally been point sources containing 10 μg to 12 mg of oxide for activation, well logging, or radiography uses. Bulk sources have also been supplied to the commercial encapsulators. The latest development has been the production of 252Cf cermet wire which can be cut into almost contamination-free lengths of the desired 252Cf content. Casks are available for transport of sources up to 50 mg. Subcritical assemblies have been developed to multiply the source neutrons by a factor of 10 to 40, and collimators and thermalizers have also been extensively developed to shape the neutron flux and energy distributions for special applications. (U.S.)

  3. Calculations of Nuclear Astrophysics and Californium Fission Neutron Spectrum Averaged Cross Section Uncertainties Using ENDF/B-VII.1, JEFF-3.1.2, JENDL-4.0 and Low-fidelity Covariances

    International Nuclear Information System (INIS)

    Nuclear astrophysics and californium fission neutron spectrum averaged cross sections and their uncertainties for ENDF materials have been calculated. Absolute values were deduced with Maxwellian and Mannhart spectra, while uncertainties are based on ENDF/B-VII.1, JEFF-3.1.2, JENDL-4.0 and Low-Fidelity covariances. These quantities are compared with available data, independent benchmarks, EXFOR library, and analyzed for a wide range of cases. Recommendations for neutron cross section covariances are given and implications are discussed

  4. SMO254材料在硫酸镍生产工艺中的应用%Application of SMO254 in Nickel Sulphate Production Process

    Institute of Scientific and Technical Information of China (English)

    侯琼英; 龙梅; 李伟

    2008-01-01

    针对硫酸镍生产中板式换热器板片腐蚀严重的问题,通过对板式换热器几种材质板片耐腐蚀性能的分析与试验,选用SMO254材料取代原C-276材料,延长了板式换热器的板片寿命,降低了生产成本.

  5. Rotational properties of $^{252, 253, 254}$No. Influence of pairing correlations

    OpenAIRE

    Duguet, T.; Bonche, P.; Heenen, P. -H.

    2000-01-01

    Rotational bands of $^{252, 253, 254}$No and the fission barriers of $^{254}$No at spin 0$\\hbar$ and 20$\\hbar$ are calculated with the Hartree-Fock-Bogolyubov theory and the Lipkin-Nogami approximate particle number projection. The SLy4 Skyrme force is used in the particle-hole channel. A zero-range force with and without density-dependence is used in the particle-particle channel. The experimental ground state deformation (${\\cal{Q}}_{20}$ = 32.8 b) is reproduced as well as the increase of t...

  6. Oxidation-reduction properties of americium, curium, berkelium, californium, einsteinium and fermium, and thermodynamic consequences for the 5f series

    International Nuclear Information System (INIS)

    The amalgamation of 5f elements from Am to Fm has been studied by using 241Am, 244Cm, 249Bk, 249Cf, 252Cf, 253Es, 254Es, 252Fm and 255Fm with two electrochemical methods, radiocoulometry and radiopolarography, perfectly adapted to investigate extremely diluted solutions when the concentration of electroactive species is as low as 10-16M. The theory of radiocoulometry has been developed in the general cases of reversible and irreversible electrode process. It has been used to interpret the experimental data on the kinetic curves of amalgamation, and to estimate the standard rate constant of the electrode process in complexing medium (citric). On the other hand the radiopolarographic method has been applied to study the mechanism of reduction at the dropping mercury electrode of cations M3+ in aqueous medium to the metal M with formation of amalgam. The results are exploited into two directions: 1- Acquisition of some data concerning the oxidation-reduction properties of elements from Am to Fm. Therefore the standard electrode E0 [M(III-0)] potentials for Bk, Cf and Es, and the standard electrode E0 [M(II-0)] potential for Fm are estimated and the relative stability of each oxidation state (from II to VII) of 5f elements is discussed; 2- Acquisition of unknown thermodynamic data on transcalifornium elements. Correlations between 4f and 5f elements are precised and some divergences appear for the second half of 4f and 5f series (i.e. for 65<=Z<=71 and 97<=Z<=103)

  7. Californium interrogation prompt neutron (CIPN) instrument for non-destructive assay of spent nuclear fuel-Design concept and experimental demonstration

    Science.gov (United States)

    Henzlova, D.; Menlove, H. O.; Rael, C. D.; Trellue, H. R.; Tobin, S. J.; Park, Se-Hwan; Oh, Jong-Myeong; Lee, Seung-Kyu; Ahn, Seong-Kyu; Kwon, In-Chan; Kim, Ho-Dong

    2016-01-01

    This paper presents results of the first experimental demonstration of the Californium Interrogation Prompt Neutron (CIPN) instrument developed within a multi-year effort launched by the Next Generation Safeguards Initiative Spent Fuel Project of the United States Department of Energy. The goals of this project focused on developing viable non-destructive assay techniques with capabilities to improve an independent verification of spent fuel assembly characteristics. For this purpose, the CIPN instrument combines active and passive neutron interrogation, along with passive gamma-ray measurements, to provide three independent observables. This paper describes the initial feasibility demonstration of the CIPN instrument, which involved measurements of four pressurized-water-reactor spent fuel assemblies with different levels of burnup and two initial enrichments. The measurements were performed at the Post-Irradiation Examination Facility at the Korea Atomic Energy Institute in the Republic of Korea. The key aim of the demonstration was to evaluate CIPN instrument performance under realistic deployment conditions, with the focus on a detailed assessment of systematic uncertainties that are best evaluated experimentally. The measurements revealed good positioning reproducibility, as well as a high degree of insensitivity of the CIPN instrument's response to irregularities in a radial burnup profile. Systematic uncertainty of individual CIPN instrument signals due to assembly rotation was found to be orientation in the instrument.

  8. 16 CFR 254.6 - Deceptive use of diplomas, degrees, or certificates.

    Science.gov (United States)

    2010-01-01

    ... control the recognition that will be accorded the diploma by institutions of higher education, other schools, or prospective employers, and that such recognition is a matter solely within the discretion of... GUIDES FOR PRIVATE VOCATIONAL AND DISTANCE EDUCATION SCHOOLS § 254.6 Deceptive use of diplomas,...

  9. Reductive degradation of perfluoroalkyl compounds with aquated electrons generated from iodide photolysis at 254 nm

    OpenAIRE

    Park, Hyunwoong; vecitis, Chad D.; Cheng, Jie; Dalleska, Nathan F; Mader, Brian T.; Hoffmann, Michael R.

    2011-01-01

    The perfluoroalkyl compounds (PFCs), perfluoroalkyl sulfonates (PFXS) and perfluoroalkyl carboxylates (PFXA) are environmentally persistent and recalcitrant towards most conventional water treatment technologies. Here, we complete an in depth examination of the UV-254 nm production of aquated electrons during iodide photolysis for the reductive defluorination of six aquated perfluoroalkyl compounds (PFCs) of various headgroup and perfluorocarbon tail length. Cyclic voltammograms (CV) show tha...

  10. 6 CFR 25.4 - Designation of qualified anti-terrorism technologies.

    Science.gov (United States)

    2010-01-01

    ... 6 Domestic Security 1 2010-01-01 2010-01-01 false Designation of qualified anti-terrorism... REGULATIONS TO SUPPORT ANTI-TERRORISM BY FOSTERING EFFECTIVE TECHNOLOGIES § 25.4 Designation of qualified anti-terrorism technologies. (a) General. The Under Secretary may Designate as a Qualified...

  11. Biological Efficiency of Californium-252 Source Evaluated by Comet Assay, Classical Cytogenetics and FISH in Human Lymphocytes Irradiated without and with BSH Pretreatment

    International Nuclear Information System (INIS)

    Biological effectiveness of californium-252 source was evaluated after irradiations in vitro of normal or pre-treated with compound enriched in B-10 ion cells. Peripheral blood lymphocytes were used as a model for human cells. DNA and chromosomal damage were studied to compare biological effectiveness of irradiation. Human blood samples or isolated lymphocytes were irradiated with the isotopic source of 252Cf, at the Faculty of Physics and Nuclear Techniques at the University of Mining and Metallurgy (both neutron source and samples were placed in ''infinite'' polyethylene block). Chemical pretreatment with Na210B12H11SH (BSH) was performed to introduce boron-10 ion into cells in order to check any enhancement effect due to the process of boron neutron capture. Single cell gel electrophoresis also known as the Comet assay was done to investigate the DNA damage. Classical cytogenetic analysis was applied to assess the frequencies of unstable aberrations (dicentrics, rings and a centric fragments). To evaluate the frequencies of stable aberrations the fluorescence in situ hybridisation (FISH) with probes for chromosomes 1, 4 (14.3% of the whole genome) was performed. Linear (or close to linear) increase with radiation dose were observed for the DNA damage and aberration frequencies in lymphocytes both untreated or pre-treated with BSH. Levels of translocations evaluated for the whole genome were comparable with the frequencies of dicentrics and rings. No significant differences were detected due to radiation dose in the frequencies of sister chromatid exchanges (SCE) detected in the second mitosis. No statistically significant differences were observed in various biological end-points between normal or boron pre-treated cells. (author)

  12. Stability of 248-254^Cf isotopes against alpha and cluster radioactivity

    OpenAIRE

    Santhosh, K. P.; Biju, R. K.

    2013-01-01

    Stability of 248-254^Cf nuclei against alpha and cluster emission is studied within our Coulomb and proximity potential model (CPPM). It is found that these nuclei are stable against light clusters (except alpha particle) and instable against heavy cluster emissions. For heavy cluster emissions the daughter nuclei lead to doubly magic 208^Pb or neighbouring one. The effect of quadrapole and hexadecapole deformations of parent nuclei, daughter nuclei and emitted cluster on half lives are also ...

  13. Coulomb dissociation of {sup 8}B at 254 A MeV

    Energy Technology Data Exchange (ETDEWEB)

    Suemmerer, K.; Boue, F.; Baumann, T.; Geissel, H.; Hellstroem, M.; Koczon, P.; Schwab, E.; Schwab, W.; Senger, P.; Surowiecz, A. [Gesellschaft fuer Schwerionenforschung (GSI), Darmstadt (Germany); Iwasa, N.; Ozawa, A. [Gesellschaft fuer Schwerionenforschung (GSI), Darmstadt (Germany)]|[RIKEN Institute of Physical and Chemical Research, Saitama (Japan); Surowka, G. [Gesellschaft fuer Schwerionenforschung (GSI), Darmstadt (Germany)]|[Jagiellonian Univ., Krakow (Poland). Inst. of Physics; Blank, B.; Czajkowski, S.; Marchand, C.; Pravikoff, M.S. [Centre d`Etudes Nucleaires de Bordeaux-Gradignan, 33 (France); Foerster, A.; Lauer, F.; Oeschler, H.; Speer, J.; Sturm, C.; Uhlig, F.; Wagner, A. [Technische Univ. Darmstadt (Germany); Gai, M. [Connecticut Univ., Storrs, CT (United States). Dept. of Physics; Grosse, E. [Inst. fuer Kern- und Hadronenphysik, Forschungszentrum Rossendorf, Dresden (Germany); Kohlmeyer, B. [Philipps Univ., Marburg (Germany). Fachbereich Physik; Kulessa, R.; Walus, W. [Jagiellonian Univ., Krakow (Poland). Inst. of Physics; Motobayashi, T. [Rikkyo Univ., Tokyo (Japan). Dept. of Physics; Teranishi, T. [RIKEN Institute of Physical and Chemical Research, Saitama (Japan)

    1998-06-01

    As an alternative method for determining the astrophysical S-factor for the {sup 7}Be(p,{gamma}){sup 8}B reaction we have measured the Coulomb dissociation of {sup 8}B at 254 A MeV. From our preliminary results, we obtain good agreement with both the accepted direct-reaction measurements and the low-energy Coulomb dissociation study of Iwasa et al. performed at about 50 A MeV. (orig.)

  14. Ferric ion mediated photochemical decomposition of perfluorooctanoic acid (PFOA) by 254 nm UV light

    International Nuclear Information System (INIS)

    The great enhancement of ferric ion on the photochemical decomposition of environmentally persistent perfluorooctanoic acid (PFOA) under 254 nm UV light was reported. In the presence of 10 μM ferric ion, 47.3% of initial PFOA (48 μM) was decomposed and the defluorination ratio reached 15.4% within 4 h reaction time. While the degradation and defluorination ratio greatly increased to 80.2% and 47.8%, respectively, when ferric ion concentration increased to 80 μM, and the corresponding half-life was shortened to 103 min. Though the decomposition rate was significantly lowered under nitrogen atmosphere, PFOA was efficiently decomposed too. Other metal ions like Cu2+ and Zn2+ also slightly improved the photochemical decomposition of PFOA under irradiation of 254 nm UV light. Besides fluoride ion, other intermediates during PFOA decomposition including formic acid and five shorter-chain perfluorinated carboxylic acids (PFCAs) with C7, C6, C5, C4 and C3, respectively, were identified and quantified by IC or LC/MS. The mixture of PFOA and ferric ion had strong absorption around 280 nm. It is proposed that PFOA coordinates with ferric ion to form a complex, and its excitation by 254 nm UV light leads to the decomposition of PFOA in a stepwise way

  15. 《中图法》第5版G254类目体系浅议%Discussion on Classification System of G254 in The Fifth Edition of Chinese Library Clas-sification

    Institute of Scientific and Technical Information of China (English)

    尚新丽; 陈镁铧

    2016-01-01

    By comparing the fifth and fourth edition of the G254 classification system,the article makes a survey on the OPAC of Na-tional Library of China, then analyzes some problems in the classification system, finally it proposes some ideas and suggestion to solve the problems.%通过对《中图法》第5版与第4版 G254类目体系的比较及对国家图书馆馆藏目录 G254文献的调查、分析,发现《中图法》第5版G254类目体系中存在类目设置不合理问题,提出了整合的思路和解决问题的建议。

  16. Ultraviolet (193, 216 and 254 nm) photoinactivation of Escherichia coli strains with different repair deficiencies

    International Nuclear Information System (INIS)

    Escherichia coli K12 bacteria strains AB1157 (repair-deficient wild-type, uvrA+ recA+), AB1886 (uvrA-), AB2463 (recA-) and AB2480 (uvrA- recA-) were exposed to 254 nm germicidal UV and 216 or 193 nm laser radiation. The mean lethal incident dose (D37) for AB1157 does not change significantly with wavelength, whereas it increases for the other strains on going from λirr = 254 to 193 nm, e.g., eightfold for AB2480. Quantum yields for inactivation, due to light absorbed by the chromosomal DNA, have been estimated from the D37 values. The large differences in D37 between uvrA+ and uvrA- strains indicate a significant contribution of pyrimidine dimers and (6-4) photoproducts to photodamage of DNA in the cells. The formation of dimers even with λirr = 193 nm is supported by the result that the photoreactivable sector is larger than 63%. Inactivation of E. coli upon irradiation at 193 and 216 nm is therefore due to damage to intracellular DNA rather than to membrane or protein damage as is the case for mammalian cells. The ratio of the lethal doses for AB1157 vs AB2480 is ∼900 with λirr = 254 nm, but only 160 with λirr = 193 nm. We propose that this is due to the better repair of photodimers and (6-4) photoproducts than of damage induced by photoionization via upper excited states. Irradiation at 193 nm inactivates AB1157 mainly by damage due to photoionization and AB2480 by damage due to photodimers in the chromosomal DNA. 51 refs., 3 figs., 5 tabs

  17. Ultraviolet (193, 216 and 254 nm) photoinactivation of Escherichia coli strains with different repair deficiencies

    Energy Technology Data Exchange (ETDEWEB)

    Gurzadyan, G.G.; Goerner, H.; Schulte-Frohlinde, D. [Max-Planck-Institut fuer Strahlenchemie, Muelheim an der Ruhr (Germany)

    1995-03-01

    Escherichia coli K12 bacteria strains AB1157 (repair-deficient wild-type, uvrA{sup +} recA{sup +}), AB1886 (uvrA{sup {minus}}), AB2463 (recA{sup {minus}}) and AB2480 (uvrA{sup {minus}} recA{sup {minus}}) were exposed to 254 nm germicidal UV and 216 or 193 nm laser radiation. The mean lethal incident dose (D{sub 37}) for AB1157 does not change significantly with wavelength, whereas it increases for the other strains on going from {lambda}{sub irr} = 254 to 193 nm, e.g., eightfold for AB2480. Quantum yields for inactivation, due to light absorbed by the chromosomal DNA, have been estimated from the D{sub 37} values. The large differences in D{sub 37} between uvrA{sup +} and uvrA{sup {minus}} strains indicate a significant contribution of pyrimidine dimers and (6-4) photoproducts to photodamage of DNA in the cells. The formation of dimers even with {lambda}{sub irr} = 193 nm is supported by the result that the photoreactivable sector is larger than 63%. Inactivation of E. coli upon irradiation at 193 and 216 nm is therefore due to damage to intracellular DNA rather than to membrane or protein damage as is the case for mammalian cells. The ratio of the lethal doses for AB1157 vs AB2480 is {approx}900 with {lambda}{sub irr} = 254 nm, but only 160 with {lambda}{sub irr} = 193 nm. We propose that this is due to the better repair of photodimers and (6-4) photoproducts than of damage induced by photoionization via upper excited states. Irradiation at 193 nm inactivates AB1157 mainly by damage due to photoionization and AB2480 by damage due to photodimers in the chromosomal DNA. 51 refs., 3 figs., 5 tabs.

  18. Cycloheximide-sensitive recovery from 254 nm UV light damage in cultured marsupial cells

    Energy Technology Data Exchange (ETDEWEB)

    Hoy, C.A.; Rupert, C.S. (Texas Univ., Dallas (USA). Programs in Biology)

    1984-08-01

    Colony-forming ability of Potorous tridactylus-kidney (PtK-2) cells was measured after exposure to 254-nm ultraviolet (UV) light and cycloheximide. Addition of 5 ..mu..M cycloheximide after exposure of the cells to UV light greatly decreased cell survival. Maximum effect of the drug was obtained by 24-h exposure after irradiation. The cycloheximide sensitivity of irradiated cells was eliminated if addition of the drug was delayed for 8-10 h after irradiation, or if the cells received photoreactivating light treatment prior to cycloheximide exposure. Thus, a major component of pyrimidine dimer removal may involve a cycloheximide-sensitive mechanism.

  19. Cycloheximide-sensitive recovery from 254 nm UV light damage in cultured marsupial cells

    International Nuclear Information System (INIS)

    Colony-forming ability of Potorous tridactylus-kidney (PtK-2) cells was measured after exposure to 254-nm ultraviolet (UV) light and cycloheximide. Addition of 5 μM cycloheximide after exposure of the cells to UV light greatly decreased cell survival. Maximum effect of the drug was obtained by 24-h exposure after irradiation. The cycloheximide sensitivity of irradiated cells was eliminated if addition of the drug was delayed for 8-10 h after irradiation, or if the cells received photoreactivating light treatment prior to cycloheximide exposure. Thus, a major component of pyrimidine dimer removal may involve a cycloheximide-sensitive mechanism. (orig.)

  20. Stability of trans-fermium elements at high spin: Measuring the fission barrier of 254No

    International Nuclear Information System (INIS)

    Super heavy nuclei provide opportunities to study nuclear structure near three simultaneous limits: in charge Z, spin I and excitation energy E*. These nuclei exist only because of a fission barrier, created by shell effects. It is therefore important to determine the fission barrier and its spin dependence Bf(I), which gives information on the shell energy E(shell)(I). Theoretical calculations predict different fission barrier heights from Bf(I = 0) = 6.8 MeV for a macro-microscopic model to 8.7 MeV for Density Functional Theory calculations using the Gogny or Skyrme interactions. Hence, a measurement of Bf provides a test for theories.To investigate the fission barrier, an established method is to measure the rise of fission with excitation energy, characterized by the ratio of decay widths Γ(fission)/Γ(total), using transfer reactions. However, for heavy elements such as 254No, there is no suitable target for a transfer reaction. We therefore rely on the complementary decay widths ratio Γγ/Γ(fission) and its spin dependence, deduced from the entry distribution (I, E*).Measurements of the gamma-ray multiplicity and total energy for 254No have been performed with beam energies of 219 and 223 MeV in the reaction 208Pb(48Ca,2n) at ATLAS (Argonne Tandem Linac Accelerator System). The 254No gamma rays were detected using the Gammasphere array as a calorimeter - as well as the usual high resolution γ-ray detector. Coincidences with evaporation residues at the Fragment Mass Analyzer focal plane separated 254No gamma rays from those from fission fragments, which are ≥ 106 more intense. From this measurement, the entry distribution - i.e. the initial distribution of I and E* - is constructed. Each point (I,E*) of the entry distribution is a point where gamma decay wins over fission and, therefore, gives information on the fission barrier. The measured entry distributions show an increase in the maximum spin and excitation energy from 219 to 223 MeV of beam energy

  1. Yeast Interacting Proteins Database: YBR254C, YKR068C [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available on of ER to Golgi transport vesicles; component of the TRAPP (transport protein particle) complex Rows wit...njunction with SNARE proteins in targeting and fusion of ER to Golgi transport vesicles; compon...rt protein particle (TRAPP) complex of the cis-Golgi which mediates vesicle docking and fusi...rvening proteins (YPD) 1 IST hit 4 IST hit in the opposite bait/prey orientation - ... ...YBR254C TRS20 One of 10 subunits of the transport protein particle (TRAPP) complex

  2. Kinetics and mechanism investigation on the destruction of oxytetracycline by UV-254nm activation of persulfate.

    Science.gov (United States)

    Liu, Yiqing; He, Xuexiang; Fu, Yongsheng; Dionysiou, Dionysios D

    2016-03-15

    Oxytetracycline (OTC), an important broad-spectrum antibiotic, has been detected extensively in various environmental systems, which may have a detrimental impact on ecosystem and human health through the development of drug resistant bacteria and pathogens. In this study, the degradation of OTC was evaluated by UV-254nm activated persulfate (PS). The observed UV fluence based pseudo first-order rate constant (kobs) was found to be the highest at near neutral pH conditions (pH 5.5-8.5). Presence of various natural water constituents had different effects on OTC degradation, with a significant enhancement in the presence of bicarbonate or Cu(2+). Limited elimination of total organic carbon (TOC) and PS was observed during the mineralization of OTC. Transformation byproducts in the presence and absence of hydroxyl radical scavenging agent tert-butanol (t-BuOH) were identified using ultra-high definition accurate-mass quadrupole time-of-flight liquid chromatography/mass spectrometer (LC-QTOF/MS). Potential OTC degradation mechanism was subsequently proposed revealing four different reaction pathways by SO4(-) reaction including hydroxylation (+16Da), demethylation (-14Da), decarbonylation (-28Da) and dehydration (-18Da). This study suggests that UV-254nm/PS is a promising treatment technology for the control of water pollution caused by emerging contaminants such as OTC. PMID:26686482

  3. Repair of near (365 nm)- and far (254 nm)- UV damage to bacteriophage of Escherichia coli

    International Nuclear Information System (INIS)

    Intact bacteriophages were irradiated at 365 nm or 254 nm and then analyzed for DNA photoproducts or injected into their bacterial host to test susceptibility of the damage to both phage and host-cell mediated repair systems. Both thymine dimers and single-strand breaks were induced in the phage DNA by 365 nm radiation. The dimers appeared to be the major lethal lesion in both repair deficient bacteriophage T4 and bacteriophage lambda after 254 nm or 365 nm irradiation. Damage induced in T4 by either wavelength was equally susceptible to x-gene reactivation. v-gene reactivation acted on a larger fraction of the near-UV damage. The host-cell mediated photo-reactivation system was only slightly less effective for near-UV damage but host-cell reactivation (survival of phage lambda on uvr+ and uvr- host) was effective against a far smaller section of near-UV damage than far-UV damage. Weigle-reactivation (far-UV induced) of near-UV damage to phage lambda was not observed. The results suggested that unless the near-UV damaged phage DNA is repaired immediately after injection, the lesions rapidly lose their susceptibility to repair with a consequent loss of activity of the phage particles. (author)

  4. Substitution of Tyr254 with Phe at the active site of flavocytochrome b2: consequences on catalysis of lactate dehydrogenation

    Energy Technology Data Exchange (ETDEWEB)

    Dubois, J.; Chapman, S.K.; Mathews, F.S.; Reid, G.A.; Lederer, F. (INSERM U 25, CNRS UA 122, Hopital Necker, Paris (France))

    1990-07-10

    A role for Tyr254 in L-lactate dehydrogenation catalyzed by flavocytochrome b2 has recently been proposed on the basis of the known active-site structure and of studies that had suggested a mechanism involving the initial formation of a lactate carbanion. This role is now examined after replacement of Tyr254 with phenylalanine. The kcat is decreased about 40-fold, Km for lactate appears unchanged, and the mainly rate-limiting step is still alpha-hydrogen abstraction, as judged from the steady-state deuterium isotope effect. Modeling studies with lactate introduced into the active site indicate two possible substrate conformations with different hydrogen-bonding partners for the substrate hydroxyl. If the hydrogen bond is formed with Tyr254, as was initially postulated, the mechanism must involve removal by His373 of the C2 hydrogen, with carbanion formation. If, in the absence of the Tyr254 phenol group, the hydrogen bond is formed with His373 N3, the substrate is positioned in such a way that the reaction must proceed by hydride transfer. Therefore the mechanism of the Y254F enzyme was investigated so as to distinguish between the two mechanistic possibilities. 2-Hydroxy-3-butynoate behaves with the mutant as a suicide reagent, as with the wild-type enzyme. Similarly, the mutant protein also catalyzes the reduction and the dehydrohalogenation of bromopyruvate under transhydrogenation conditions.

  5. Induction of sister-chromatid exchanges in ICR 2A frog cells exposed to 254 nm UV wavelengths

    International Nuclear Information System (INIS)

    Exposure of ICR 2A frog cells to 254 nm UV induced the formation of sister-chromatid exchanges (SCEs) in a fluence-dependent manner. Cells were also exposed to the UV produced by a fluorescent sunlamp that was filtered through 8C Mylar in order to simulate the mid-UV (290-320 nm) portion of sunlight reaching the earth's surface. In this instance, SCEs were induced in a linear fashion at low fluences but reached a plateau at a low level of induced SCEs. In addition, pretreatment of cells with the solar UV followed by exposure to 254 nm UV resulted in a significantly lower level of SCEs than in cells exposed to 254 nm UV alone. (author)

  6. Printed wax masks for 254 nm deep-UV pattering of PMMA-based microfluidics

    KAUST Repository

    Fan, Yiqiang

    2012-01-13

    This paper reports a new technique for masking deep-UV exposure of poly(methyl methacrylate) (PMMA) using a printed wax mask. This technique provides an inexpensive and bulk fabrication method for PMMA structures. The technique involves the direct printing of the mask onto a polymer sheet using a commercial wax printer. The wax layer was then transferred to a PMMA substrate using a thermal laminator, exposed using deep-UV (with a wavelength of 254 nm), developed in an IPA:water solution, and completed by bonding on a PMMA cap layer. A sample microfluidic device fabricated with this method is also presented, with the microchannel as narrow as 50 μm. The whole process is easy to perform without the requirement for any microfabrication facilities. © 2012 IOP Publishing Ltd.

  7. Replication of adeno-associated virus in cells irradiated with UV light at 254 nm

    Energy Technology Data Exchange (ETDEWEB)

    Yakobson, B.; Hrynko, T.A.; Peak, M.J.; Winocour, E.

    1989-03-01

    Irradiation of simian virus 40 (ori mutant)-transformed Chinese hamster embryo cells (OD4 line) with UV light induced a cellular capacity which supported a full cycle of helper-independent adeno-associated virus replication. Monochromatic UV light at 254 nm was about 1,000-fold more effective than UV light at 313 nm, indicating that cellular nucleic acid is the primary chromophore in the UV-induced process leading to permissiveness for adeno-associated virus replication. The UV irradiation and the infection could be separated for up to 12 h without substantial loss of permissiveness. During this time interval, the induction process was partly sensitive to cycloheximide, suggesting a requirement for de novo protein synthesis.

  8. Radiochemical search for neutron-rich isotopes of nielsbohrium in the (16)O + (254)Es reaction

    International Nuclear Information System (INIS)

    We have used on-line gas chromatography to search for new isotopes of element 107 near the deformed sub-shell at N = 162 and Z = 108. Enhanced nuclear stability is predicted for this region. 254gEs was irradiated with 16O at barrier energies to minimize the fusion hindrance in the entrance channel and to reduce the excitation energy of the compound nucleus to a minimum value. For half-lives between roughly two seconds and two minutes no signal for a positive identification of a new isotope of element 107 was detected. Consequently, only an upper cross-section limit of a few nanobarns was obtained. While this cross-section limit was too high to probe the influence of the predicted enhanced nuclear ground-state stability on the survival probability in the fission/evaporation competition, a very large cross-section enhancement would have been detectable. (orig.)

  9. Pressure shift and broadening of the 254-nm intercombination line of mercury by N2

    International Nuclear Information System (INIS)

    We have used laser absorption spectroscopy to study the collisional broadening and shift of the 254-nm 6 1S0→6 3P1 intercombination line of Hg in the presence of N2 for pressures below 400 Torr. This study comprises the first measurements of the proportionality constants for pressure broadening and shift of Hg due to N2 in this pressure range, and the first high-precision measurements of these pressure effects on Hg for any foreign gas. We obtain -2.54(2) MHz/Torr for the shift and 9.01(4) MHz/Torr for the broadening (full width at half maximum) at 21 degree sign C (95% confidence interval). These results are important for ongoing experiments using optical pumping of mercury in tests of fundamental symmetries, as well as for characterization of interatomic forces and tests of the theory of collisional line broadening

  10. Californium Recovery from Palladium Wire

    Energy Technology Data Exchange (ETDEWEB)

    Burns, Jon D. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States)

    2014-08-01

    The recovery of 252Cf from palladium-252Cf cermet wires was investigated to determine the feasibility of implementing it into the cermet wire production operation at Oak Ridge National Laboratory’s Radiochemical Engineering Development Center. The dissolution of Pd wire in 8 M HNO3 and trace amounts of HCl was studied at both ambient and elevated temperatures. These studies showed that it took days to dissolve the wire at ambient temperature and only 2 hours at 60°C. Adjusting the ratio of the volume of solvent to the mass of the wire segment showed little change in the kinetics of dissolution, which ranged from 0.176 mL/mg down to 0.019 mL/mg. A successful chromatographic separation of 153Gd, a surrogate for 252Cf, from Pd was demonstrated using AG 50x8 cation exchange resin with a bed volume of 0.5 mL and an internal diameter of 0.8 cm.

  11. Corrective Action Plan for Corrective Action Unit 254: Area 25 R-MAD Decontamination Facility Nevada Test Site, Nevada

    International Nuclear Information System (INIS)

    The Area 25 Reactor Maintenance, Assembly, and Disassembly Decontamination Facility is identified in the Federal Facility Agreement and Consent Order (FFACO) as Corrective Action Unit (CAU) 254. CAU 254 is located in Area 25 of the Nevada Test Site and consists of a single Corrective Action Site CAS 25-23-06. CAU 254 will be closed, in accordance with the FFACO of 1996. CAU 254 was used primarily to perform radiological decontamination and consists of Building 3126, two outdoor decontamination pads, and surrounding soil within an existing perimeter fence. The site was used to decontaminate nuclear rocket test-car hardware and tooling from the early 1960s through the early 1970s, and to decontaminate a military tank in the early 1980s. The site characterization results indicate that, in places, the surficial soil and building materials exceed clean-up criteria for organic compounds, metals, and radionuclides. Closure activities are expected to generate waste streams consisting of nonhazardous construction waste. petroleum hydrocarbon waste, hazardous waste, low-level radioactive waste, and mixed waste. Some of the wastes exceed land disposal restriction limits and will require off-site treatment before disposal. The recommended corrective action was revised to Alternative 3- ''Unrestricted Release Decontamination, Verification Survey, and Dismantle Building 3126,'' in an addendum to the Correction Action Decision Document

  12. Corrective Action Plan for Corrective Action Unit 254: Area 25 R-MAD Decontamination Facility Nevada Test Site, Nevada

    Energy Technology Data Exchange (ETDEWEB)

    C. M. Obi

    2000-12-01

    The Area 25 Reactor Maintenance, Assembly, and Disassembly Decontamination Facility is identified in the Federal Facility Agreement and Consent Order (FFACO) as Corrective Action Unit (CAU) 254. CAU 254 is located in Area 25 of the Nevada Test Site and consists of a single Corrective Action Site CAS 25-23-06. CAU 254 will be closed, in accordance with the FFACO of 1996. CAU 254 was used primarily to perform radiological decontamination and consists of Building 3126, two outdoor decontamination pads, and surrounding soil within an existing perimeter fence. The site was used to decontaminate nuclear rocket test-car hardware and tooling from the early 1960s through the early 1970s, and to decontaminate a military tank in the early 1980s. The site characterization results indicate that, in places, the surficial soil and building materials exceed clean-up criteria for organic compounds, metals, and radionuclides. Closure activities are expected to generate waste streams consisting of nonhazardous construction waste. petroleum hydrocarbon waste, hazardous waste, low-level radioactive waste, and mixed waste. Some of the wastes exceed land disposal restriction limits and will require off-site treatment before disposal. The recommended corrective action was revised to Alternative 3- ''Unrestricted Release Decontamination, Verification Survey, and Dismantle Building 3126,'' in an addendum to the Correction Action Decision Document.

  13. A continuous wave 10 W cryogenic fiber amplifier at 1015 nm and frequency quadrupling to 254 nm

    OpenAIRE

    Steinborn, R.; Koglbauer, A; Bachor, P.; Diehl, T.; Kolbe, D.; Stappel, M.; Walz, J

    2013-01-01

    A stable, continuous wave, single frequency fiber amplifier system at 1015 nm with 10W output power is presented. It is based on a large mode double clad fiber cooled to liquid nitrogen temperature. The amplified light is frequency quadrupled to 254 nm and used for spectroscopy of the 6^1S - 6^3P transition in mercury.

  14. Complete Genome Sequence of Streptomyces albus SM254, a Potent Antagonist of Bat White-Nose Syndrome Pathogen Pseudogymnoascus destructans

    Science.gov (United States)

    Badalamenti, Jonathan P.; Erickson, Joshua D.

    2016-01-01

    We sequenced and annotated the complete 7,170,504-bp genome of a novel secondary metabolite-producing Streptomyces strain, Streptomyces albus SM254, isolated from copper-rich subsurface fluids at ~220-m depth within the Soudan Iron Mine (Soudan, MN, USA). PMID:27081146

  15. Complete Genome Sequence of Streptomyces albus SM254, a Potent Antagonist of Bat White-Nose Syndrome Pathogen Pseudogymnoascus destructans.

    Science.gov (United States)

    Badalamenti, Jonathan P; Erickson, Joshua D; Salomon, Christine E

    2016-01-01

    We sequenced and annotated the complete 7,170,504-bp genome of a novel secondary metabolite-producingStreptomycesstrain,Streptomyces albusSM254, isolated from copper-rich subsurface fluids at ~220-m depth within the Soudan Iron Mine (Soudan, MN, USA). PMID:27081146

  16. UV254 absorbance as real-time monitoring and control parameter for micropollutant removal in advanced wastewater treatment with powdered activated carbon.

    Science.gov (United States)

    Altmann, Johannes; Massa, Lukas; Sperlich, Alexander; Gnirss, Regina; Jekel, Martin

    2016-05-01

    This study investigates the applicability of UV absorbance measurements at 254 nm (UVA254) to serve as a simple and reliable surrogate parameter to monitor and control the removal of organic micropollutants (OMPs) in advanced wastewater treatment applying powdered activated carbon (PAC). Correlations between OMP removal and corresponding UVA254 reduction were determined in lab-scale adsorption batch tests and successfully applied to a pilot-scale PAC treatment stage to predict OMP removals in aggregate samples with good accuracy. Real-time UVA254 measurements were utilized to evaluate adapted PAC dosing strategies and proved to be effective for online monitoring of OMP removal. Furthermore, active PAC dosing control according to differential UVA254 measurements was implemented and tested. While precise removal predictions based on real-time measurements were not accurate for all OMPs, UVA254-controlled dynamic PAC dosing was capable of achieving stable OMP removals. UVA254 can serve as an effective surrogate parameter for OMP removal in technical PAC applications. Even though the applicability as control parameter to adjust PAC dosing to water quality changes might be limited to applications with fast response between PAC adjustment and adsorptive removal (e.g. direct filtration), UVA254 measurements can also be used to monitor the adsorption efficiency in more complex PAC applications. PMID:26963606

  17. Cold valleys in the radioactive decay of 248-254Cf isotopes

    Indian Academy of Sciences (India)

    R K Biju; Sabina Sahadevan; K P Santosh; Antony Joseph

    2008-04-01

    Based on the concept of cold valley in cold fission and fusion, we have investigated the cluster decay process in 248-254Cf isotopes. In addition to alpha particle minima, other deep minima occur for S, Ar and Ca clusters. It is found that inclusion of proximity potential does not change the position of minima but minima become deeper. Taking Coulomb and proximity potential as interacting barrier for post-scission region, we computed half-lives and other characteristics for various clusters from these parents. Our study reveals that these parents are stable against light clusters and unstable against heavy clusters. Computed half-lives for alpha decay agree with experimental values within two orders of magnitude. The most probable clusters from these parents are predicted to be 46Ar, 48,50Ca which indicate the role of doubly or near doubly magic clusters in cluster radioactivity. Odd A clusters are found to be favorable for emission from odd A parents. Cluster decay model is extended to symmetric region and it is found that symmetric fission is also probable which stresses the role of doubly or near doubly magic 132Sn nuclei. Geiger-Nuttal plots were studied for various clusters and are found to be linear with varying slopes and intercepts.

  18. 2-Hydroxypyridine photolytic degradation by 254 nm UV irradiation at different conditions.

    Science.gov (United States)

    Stapleton, David R; Konstantinou, Ioannis K; Karakitsou, Anastasia; Hela, Dimitra G; Papadaki, Maria

    2009-11-01

    The degradation and mineralisation of (400 mL, 3.15 mM) aqueous solutions of 2-hydroxypyridine (2-HPY), a primary intermediate formed during the photolytic degradation of 2-chloropyridine (2-CPY), 2-bromopyridine (2-BPY) and 2-iodopyridine (2-IPY), was studied at 50 degrees C, under 254 nm UV irradiation in a range of conditions. The rate of 2-HPY disappearance was found to heavily depend on agitation, dissolved oxygen, pH and hydroxyl radical scavenger presence. pH has a pronounced effect on the phototreatment of 2-HPY, i.e. 2-HPY removal is faster at lower pH, but except for their influence on the solution pH, Cl(-) or F(-) do not appear to affect 2-HPY rate of removal or mineralisation. 2-HPY removal rate increases with dissolved oxygen, thus indicating a prominent 2-HPY photooxidation pathway. Helium purging of the solution before and during the measurement reduced 2-HPY removal rate, thus supporting the existence of a photooxidation pathway. Pure photolytic 2-HPY removal, i.e. when photooxidation is limited, fits pseudo-first order kinetics, and a kinetic model was developed for 2-HPY formation and removal during 2-CPY, 2-BPY and 2-IPY photolytic degradation under laminar flow. The addition of radical scavenger (tert-butanol) had a detrimental effect on the photolytic degradation of 2-HPY. Complete total organic carbon removal was achieved. PMID:19772980

  19. A prospective study on time to recovery in 254 injured novice runners.

    Directory of Open Access Journals (Sweden)

    Rasmus Oestergaard Nielsen

    Full Text Available Describe the diagnoses and the time to recovery of running-related injuries in novice runners.Prospective cohort study on injured runners.This paper is a secondary data analysis of a 933-person cohort study (DANO-RUN aimed at characterizing risk factors for injury in novice runners. Among those sustaining running-related injuries, the types of injuries and time to recovery is described in the present paper. All injured runners were diagnosed after a thorough clinical examination and then followed prospectively during their recovery. If they recovered completely from injury, time to recovery of each injury was registered.A total of 254 runners were injured. The proportion of runners diagnosed with medial tibial stress syndrome was 15%, 10% for patellofemoral pain, 9% for medial meniscal injury, 7% for Achilles tendinopathy and 5% for plantar fasciitis. Among the 220 runners (87% recovering from their injury, the median time to recovery was 71 days (minimum  = 9 days, maximum  = 617 days.Medial tibial stress syndrome was the most common injury followed by patellofemoral pain, medial meniscal injury and Achilles tendinopathy. Half of the injured runners were unable to run 2×500 meters without pain after 10 weeks. Almost 5% of the injured runners received surgical treatment.

  20. Sensitivities to monochromatic 254-nm and 365-nm radiation of closely related strains of Saccharomyces cerevisiae with differing repair capabilities

    International Nuclear Information System (INIS)

    Sensitivity to monochromatic 254- and 365-nm radiation was compared in closely related yeast strains with defects in one or more of the excision-repair (rad1), error-prone repair (rad18), or recombinational-repair (rad51) pathways. At 254 nm, mutants defective in a single repair pathway exhibited slight to moderate UV sensitivity;,those defective in two separate pathways were somewhat more UV sensitive, while triple mutants defective in all three pathways exhibited extreme UV sensitivity with a lethal event corresponding to 0.05 J m-2. Repair defects also rendered mutants sensitive to 365-nm radiation: strains with single defects exhibited slight sensitivity, mutants with two defective pathways were more sensitive, and triple mutants exhibited maximal sensitivity with a lethal event corresponding to 2.4 x 104 J m-2. Evidence for dimer involvement in the yeast mutant was obtained by demonstrating that lethality at both 254 and 365 nm was photoreactivated by light at 405 nm. (author)

  1. Design of a homogeneous subcritical nuclear reactor based on thorium with a source of californium 252; Diseno de un reactor nuclear subcritico homogeneo a base de Torio con una fuente de Californio 252

    Energy Technology Data Exchange (ETDEWEB)

    Delgado H, C. E.; Vega C, H. R. [Universidad Autonoma de Zacatecas, Unidad Academica de Estudios Nucleares, Cipres No. 10, Fracc. La Penuela, 98068 Zacatecas, Zac. (Mexico); Sajo B, L., E-mail: ce_delgado89@hotmail.com [Universidad Simon Bolivar, Laboratorio de Fisica Nuclear, Apdo. 89000, 1080A Caracas (Venezuela, Bolivarian Republic of)

    2015-10-15

    Full text: One of the energy alternatives to fossil fuels which do not produce greenhouse gases is the nuclear energy. One of the drawbacks of this alternative is the generation of radioactive wastes of long half-life and its relation to the generation of nuclear materials to produce weapons of mass destruction. An option to these drawbacks of nuclear energy is to use Thorium as part of the nuclear fuel which it becomes in U{sup 233} when capturing neutrons, that is a fissile material. In this paper Monte Carlo methods were used to design a homogeneous subcritical reactor based on thorium. As neutron reflector graphite was used. The reactor core is homogeneous and is formed of 70% light water as moderator, 12% of enriched uranium UO{sub 2}(NO{sub 3}){sub 4} and 18% of thorium Th(NO{sub 3}){sub 4} as fuel. To start the nuclear fission chain reaction an isotopic source of californium 252 was used with an intensity of 4.6 x 10{sup 7} s{sup -1}. In the design the value of the effective multiplication factor, whose value turned out k{sub eff} <1 was calculated. Also, the neutron spectra at different distances from the source and the total fluence were calculated, as well as the values of the ambient dose equivalent in the periphery of the reactor. (Author)

  2. Manganese determination om minerals by activation analysis, using the californium-252 as a neutron source; Determinacao de manganes em minerios, por analise por ativacao, usando californio-252 como fonte de neutrons

    Energy Technology Data Exchange (ETDEWEB)

    Cardoso, Antonio

    1976-07-01

    Neutron Activation Analysis, using a Californium-252 neutron source, has been applied for the determination of manganese in ores such as pyrolusite, rodonite (manganese silicate)' and blending used in dry-batteries The favorable nuclear properties of manganese, such as high thermal neutron cross-section for the reaction {sup 55}Mn (n.gamma){sup 56} Mn, high concentration of manganese in the matrix and short half - life of {sup 56}Mn, are an ideal combination for non-destructive analysis of manganese in ores. Samples and standards of manganese dioxide were irradiated for about 20 minutes, followed by a 4 to 15 minutes decay and counted in a single channel pulse-height discrimination using a NaI(Tl) scintillation detector. Counting time was equal to 10 minutes. The interference of nuclear reactions {sup 56}Fe(n,p){sup 56}Mn and {sup 59} Co (n, {alpha}){sup 56} were studied, as well as problems in connection with neutron shadowing during irradiation, gamma-rays attenuation during counting and influence of granulometry of samples. One sample,was also analysed by wet-chemical method (sodium bismuthate) in order to compare results. As a whole, i t was shown that the analytical method of neutron activation for manganese in ores and blending, is a method simple, rapid and with good precision and accuracy. (author)

  3. Fission cross section measurements of Cm-247, Cf-250 and Es-254 from 0.1 eV to 80 keV

    International Nuclear Information System (INIS)

    Fission cross section measurements were made with the RINS system over the neutron energy range from approximately 0.1 eV to 80 keV upon samples of Cm-247, Cf-250 and Es-254. The Cm-247 measurement was undertaken to complete the RINS fission cross section measurement sequence of the curium isotopes, Es-254 was measured because it is a very heavy odd-odd nucleus which might show interesting nuclear structure effects in its fission cross section, and Cf-250 was measured to account for its buildup as a daughter product from the 276-day halflife Es-254. 6 refs., 3 figs

  4. Study on Removal Effect of Turbidity and UV254 from water by Enhanced Coagulation%强化混凝技术去除水体中浊度和UV254的试验研究

    Institute of Scientific and Technical Information of China (English)

    康孟新; 董琦; 张海亚

    2014-01-01

    通过静态烧杯试验,分析了聚合硫酸铁( PFS)和硫酸铝两种混凝剂在不同投加量、pH值和助凝剂投加量条件下,对水中浊度和UV254去除效果的影响。试验结果表明:对于去除水中的浊度而言,PFS的最佳投加量为60 mg/L,最佳pH值为7,最佳助凝剂的投加量为0.1mg/L;硫酸铝的最佳投加量为50 mg/L,最佳pH值为6.5,最佳助凝剂的投加量为0.05 mg/L。对于去除水中UV254而言,UV254的去除率均随着混凝剂和助凝剂投加量的增加而增加,最佳pH值为6.5;作为混凝剂PFS的总体性能要优于硫酸铝。最后通过正交试验确定了当混凝剂为PFS时,影响强化混凝处理效果的各因素的主次顺序依次为:PFS投加量、pH值、PAM投加量,强化混凝的最佳实验条件为PFS投加量为60 mg/L,水体的pH值为6.5,助凝剂的投加量为0.10 mg/L。%Through static simulation test,the impact of polymeric ferric sulfate( PFS) and aluminum sulfate on the enhanced coagulation for the removal of turbidity and UV254 was studied under the condition of different co-agulant dosage,pH values and coagulant aid dosage. The experimental results showed that for the turbidity,the optimum value of coagulant dosage for PFS was 60mg/L,the corresponding optimal value of pH was 7,the co-agulant aid dosage was 0. 1mg/L,and for aluminum sulfate the dosage was 50mg/L,the pH was 6. 5,the coag-ulant aid dosage was 0. 05mg/L;for the UV254 ,the rate of UV254 removal increased with the increasing of the co-agulant dosage and the coagulant aid dosage,the optimal pH was 6. 5;as to be coagulant,PFS was better than aluminum sulfate. At last,through the orthogonal test,the order of the key factors for the PFS were as follows:the dosage of PFS,the pH value and the dosage of coagulant aid. And the optimized experiment conditions were that the dosage of PFS was 60mg/L,the pH was 6. 5 and the dosage of coagulant aid was 0. 10mg/L.

  5. Measurements of absolute absorption cross sections of ozone in the 185- to 254-nm wavelength region and the temperature dependence

    Science.gov (United States)

    Yoshino, K.; Esmond, J. R.; Freeman, D. E.; Parkinson, W. H.

    1993-01-01

    Laboratory measurements of the relative absorption cross sections of ozone at temperatures 195, 228, and 295 K have been made throughout the 185 to 254 nm wavelength region. The absolute absorption cross sections at the same temperatures have been measured at several discrete wavelengths in the 185 to 250 nm region. The absolute cross sections of ozone have been used to put the relative cross sections on a firm absolute basis throughout the 185 to 255 nm region. These recalibrated cross sections are slightly lower than those of Molina and Molina (1986), but the differences are within a few percent and would not be significant in atmospheric applications.

  6. Induction of micronuclei by 2-hydroxypyridine in water and elimination of solution genotoxicity by UVC (254 nm) photolysis

    International Nuclear Information System (INIS)

    Highlights: ► 2-Hydroxypyridine (2-HPY) is the major metabolite of 2-halogenated pyridines photolysis. ► We examine the genotoxicity of 2-HPY in cultured human lymphocytes applying the micronucleus assay. ► 2-HPY was found to be genotoxic. ► Aqueous solutions of 2-HPY were irradiated by UV at 254 nm. ► Solution genotoxicity can be completely removed after prolonged phototreatment. - Abstract: 2-Hydroxypyridine (2-HPY) is a major first-stage product formed upon the photolytic destruction of 2-halogenated pyridines. Genotoxicity of 2-HPY in water was studied as a function of concentration. Aqueous solutions of 2-HPY were irradiated by ultraviolet (UV) at 254 nm. 2-HPY concentration, solution total organic carbon (TOC) concentration and solution genotoxicity were measured as a function of treatment time and their profile as a function of time is presented in this work. 2-HPY was found to be genotoxic at all concentrations in the range of 5–400 μg ml−1. 2-HPY mineralises completely upon prolonged UV irradiation. All untreated and irradiated solution samples, taken at different photo-treatment times, were tested in cultured human lymphocytes applying the cytokinesis block micronucleus (CBMN) assay. The genotoxicity of the solution was reduced near to the control level after prolonged UV irradiation.

  7. Addendum to the Corrective Action Decision Document for Corrective Action Unit 254: Area 25 R-MAD Decontamination Facility, Nevada Test Site, Nevada (Rev. 0, December 2000)

    International Nuclear Information System (INIS)

    This document is an addendum to the Corrective Action Decision Document (CADD) that has been prepared for Corrective Action Unit (CAU) 254, Area 25 Reactor Maintenance, Assembly, and Disassembly (R-MAD) Decontamination Facility. CAU 254 consists of Corrective Action Site (CAS) 25-23-06, Decontamination Facility. The purpose of this addendum is to provide a rationale for the recommendation of a revised preferred alternative corrective action for CAU 254. This preferred alternative corrective action, Alternative 3, consists of the removal of accessible soil/sediment and all building material above ground level from the CAU 254 Site. This alternative is being recommended because a cost-effective technology is now available to dismantle the contaminated building and ensure complete removal of all CAU 254 CADD-identified contaminants of concern and any associated contamination. This preferred closure method alternative reduces the potential for future exposure pathways. Procedures will be developed, presented in the Corrective Action Plan, and implemented to ensure worker health and safety, protection of human health and the environment, and to meet all unrestricted release requirements in accordance with applicable state and federal regulations

  8. Fission barrier of superheavy nuclei and persistence of shell effects at high spin: cases of 254No and 220Th.

    Science.gov (United States)

    Henning, Greg; Khoo, T L; Lopez-Martens, A; Seweryniak, D; Alcorta, M; Asai, M; Back, B B; Bertone, P F; Boilley, D; Carpenter, M P; Chiara, C J; Chowdhury, P; Gall, B; Greenlees, P T; Gürdal, G; Hauschild, K; Heinz, A; Hoffman, C R; Janssens, R V F; Karpov, A V; Kay, B P; Kondev, F G; Lakshmi, S; Lauritsen, T; Lister, C J; McCutchan, E A; Nair, C; Piot, J; Potterveld, D; Reiter, P; Rogers, A M; Rowley, N; Zhu, S

    2014-12-31

    We report on the first measurement of the fission barrier height in a heavy shell-stabilized nucleus. The fission barrier height of 254No is measured to be Bf=6.0±0.5  MeV at spin 15ℏ and, by extrapolation, Bf=6.6±0.9  MeV at spin 0ℏ. This information is deduced from the measured distribution of entry points in the excitation energy versus spin plane. The same measurement is performed for 220Th and only a lower limit of the fission barrier height can be determined: Bf(I)>8  MeV. Comparisons with theoretical fission barriers test theories that predict properties of superheavy elements. PMID:25615317

  9. Closure Report for Corrective Action Unit 254: Area 25, R-MAD Decontamination Facility, Nevada Test Site, Nevada

    Energy Technology Data Exchange (ETDEWEB)

    G. N. Doyle

    2002-02-01

    Corrective Action Unit (CAU) 254 is located in Area 25 of the Nevada Test Site (NTS), approximately 100 kilometers (km) (62 miles) northwest of Las Vegas, Nevada. The site is located within the Reactor Maintenance, Assembly and Disassembly (R-MAD) compound and consists of Building 3126, two outdoor decontamination pads, and surrounding areas within an existing fenced area measuring approximately 50 x 37 meters (160 x 120 feet). The site was used from the early 1960s to the early 1970s as part of the Nuclear Rocket Development Station program to decontaminate test-car hardware and tooling. The site was reactivated in the early 1980s to decontaminate a radiologically contaminated military tank. This Closure Report (CR) describes the closure activities performed to allow un-restricted release of the R-MAD Decontamination Facility.

  10. An investigation of inhibition effect of metronidazole before and after using advanced oxidation process (UV254/H2O2 on specific methanogenic activity of anaerobic biomass

    Directory of Open Access Journals (Sweden)

    S. A. Mirzaee

    2014-07-01

    Conclusion: Different concentrations of metronidazole had an inhibition effect on anaerobic digestions and therefore the efficient pretreatment method is needed to reduce this inhibition effect. The UV254/H2O2 process is an effective method for degradation and conversion of metronidazole to more biodegradable compounds for anaerobic bacteria consumption and, in turn, to increase biogasproduction in anaerobic digestions.

  11. Corrective Action Decision Document for Corrective Action Unit 254: Area 25 R-MAD Decontamination Facility, Nevada Test Site, Nevada

    International Nuclear Information System (INIS)

    This Corrective Action Decision Document identifies and rationalizes the US Department of Energy, Nevada Operations Office's selection of a recommended corrective action alternative (CAA) appropriate to facilitate the closure of Corrective Action Unit (CAU) 254, R-MAD Decontamination Facility, under the Federal Facility Agreement and Consent Order. Located in Area 25 at the Nevada Test Site in Nevada, CAU 254 is comprised of Corrective Action Site (CAS) 25-23-06, Decontamination Facility. A corrective action investigation for this CAS as conducted in January 2000 as set forth in the related Corrective Action Investigation Plan. Samples were collected from various media throughout the CAS and sent to an off-site laboratory for analysis. The laboratory results indicated the following: radiation dose rates inside the Decontamination Facility, Building 3126, and in the storage yard exceeded the average general dose rate; scanning and static total surface contamination surveys indicated that portions of the locker and shower room floor, decontamination bay floor, loft floor, east and west decon pads, north and south decontamination bay interior walls, exterior west and south walls, and loft walls were above preliminary action levels (PALs). The investigation-derived contaminants of concern (COCs) included: polychlorinated biphenyls, radionuclides (strontium-90, niobium-94, cesium-137, uranium-234 and -235), total volatile and semivolatile organic compounds, total petroleum hydrocarbons, and total Resource Conservation and Recovery Act (Metals). During the investigation, two corrective action objectives (CAOs) were identified to prevent or mitigate human exposure to COCs. Based on these CAOs, a review of existing data, future use, and current operations at the Nevada Test Site, three CAAs were developed for consideration: Alternative 1 - No Further Action; Alternative 2 - Unrestricted Release Decontamination and Verification Survey; and Alternative 3 - Unrestricted

  12. Corrective Action Decision Document for Corrective Action Unit 254: Area 25 R-MAD Decontamination Facility, Nevada Test Site, Nevada

    Energy Technology Data Exchange (ETDEWEB)

    U.S. Department of Energy, Nevada Operations Office

    2000-06-01

    This Corrective Action Decision Document identifies and rationalizes the US Department of Energy, Nevada Operations Office's selection of a recommended corrective action alternative (CAA) appropriate to facilitate the closure of Corrective Action Unit (CAU) 254, R-MAD Decontamination Facility, under the Federal Facility Agreement and Consent Order. Located in Area 25 at the Nevada Test Site in Nevada, CAU 254 is comprised of Corrective Action Site (CAS) 25-23-06, Decontamination Facility. A corrective action investigation for this CAS as conducted in January 2000 as set forth in the related Corrective Action Investigation Plan. Samples were collected from various media throughout the CAS and sent to an off-site laboratory for analysis. The laboratory results indicated the following: radiation dose rates inside the Decontamination Facility, Building 3126, and in the storage yard exceeded the average general dose rate; scanning and static total surface contamination surveys indicated that portions of the locker and shower room floor, decontamination bay floor, loft floor, east and west decon pads, north and south decontamination bay interior walls, exterior west and south walls, and loft walls were above preliminary action levels (PALs). The investigation-derived contaminants of concern (COCs) included: polychlorinated biphenyls, radionuclides (strontium-90, niobium-94, cesium-137, uranium-234 and -235), total volatile and semivolatile organic compounds, total petroleum hydrocarbons, and total Resource Conservation and Recovery Act (Metals). During the investigation, two corrective action objectives (CAOs) were identified to prevent or mitigate human exposure to COCs. Based on these CAOs, a review of existing data, future use, and current operations at the Nevada Test Site, three CAAs were developed for consideration: Alternative 1 - No Further Action; Alternative 2 - Unrestricted Release Decontamination and Verification Survey; and Alternative 3 - Unrestricted

  13. Biological responses on NIH 3T3 to 193 NM excimer laser irradiation comparison with 254 irradiation

    International Nuclear Information System (INIS)

    During conventional UV radiations, activation of genes is tightly linked to the presence of DNA damages. At 254 nm, the major cellular chromophore is the nuclear DNA, with cyclobutane pyrimidine dimers being the major photoproduct. At 193 nm, DNA is more strongly absorbing than at 254 nm. However, the quantum yields of the photoproducts induced at these two wavelengths are different and damage to cellular DNA in the form of pyrimidine dimers or single-strand breaks was reported to be only marginal or undetected. Peptide bonds, many amino acid side chains, insaturated lipids, esters, and other cellular molecules absorb at 193 nm. Consequently, the most of the energy is thought to be absorbed by proteins, leaving the DNA shielded. About 60 % of the radiation can apparently be blocked by 1 μm of cytoplasm. However, exposures of cultured human fibroblasts to subablative doses of 193 nm laser radiation resulted in changes of genes expression such as collagenase, metallothionein and c-fos. The mechanisms by which the 193 nm radiation affects gene expression are not known. The site of primary interaction of the radiation could be different from the site of the genetic response. Thus, the signal transfer could pass through the cytoplasm via the nucleus. One hypothesis is that cytokines may regulate the transduction pathway event. By example, the TNF-alpha which is induced by UV-radiations. More, it can activate transcription factors such as AP-1 or c-fos and stimulate the growth of normal fibroblasts. Moreover, TNF-alpha plays a major role in the inflammatory processes by enhancing the remodeling of extracellular matrix in which mainly matrix metalloproteinases and collagenase participate. Besides, matrix metalloproteinases are responsive to cytokines and particularly the 92 kDa gelatinate (gelatinase B or metalloproteinase 9 or MMP 9) is induced and regulated by TNF-alpha. To understand the cellular response to high energy laser radiation, we investigated cell

  14. Analysis of viral etiology of 254 acute respiratory infection cases%254例急性呼吸道感染病例病原学调查分析

    Institute of Scientific and Technical Information of China (English)

    杨霄星; 杨军勇; 王世斌; 董晓根; 王建芳; 李婧宇; 张建军; 赵建忠

    2013-01-01

    目的 分析急性呼吸道感染病例的病毒病原构成,掌握主要病原体活动水平及变化规律,了解丰台地区急性呼吸道感染病原谱.方法 以2010-2012年成人急性呼吸道感染病例为研究对象,收集病例基础信息,采集鼻咽拭子标本,使用多重PCR及RT-PCR对流感病毒、呼吸道合胞病毒、腺病毒、副流感病毒、偏肺病毒、冠状病毒、鼻病毒、博卡病毒和肺炎支原体等9种病原进行检测,数据分析使用SPSS 17.0软件.结果 254例标本中154例检测阳性,阳性率为60.63%,男女阳性检出率无统计学差异.冬春季致病病原体以流感病毒、副流感病毒及支原体为主,夏季仅检出副流感和支原体.流感样病例的主要病原体为流感病毒及副流感病毒;肺炎病例致病病原体主要为肺炎支原体.2010-2011年流感流行季甲型流感病毒为优势病原,2011-2012年流感流行季乙型流感病毒为优势病原.结论 2010-2012年间,北京丰台地区引起成人急性呼吸道感染的主要病原为流感病毒、支原体和副流感病毒.不同季节的优势病原不同.%Objective To analyze the viral etiology of acute respiratow infection,and to study the activity and epidemiological characteristic of main pathogens,so as to establish pathogen spectrum of acute respiratory infection in Fengtai district of Beijing.Methods Basic information and throat swabs of acute respiratory infection cases during 2010-2012 were collected.Influenza virus,respiratory syncytial virus,adenovirus,parainfluenza virus,metapneumovirus,coronavirus,rhinovirus,human Boca virus and mycoplasma pneumonia were detected by multiplex PCR and RT-PCR.SPSS 17.0 was used for data analysis.Results 154 were positive in all of the 254 samples,the positive ratio was 60.63%.Influenza viruses,parainfluenza virus and mycoplasma pneumoniae were the most frequently detected pathogens in winter and spring.Parainfluenza and mycoplasma were the only detected

  15. Determination of the total mercury in contaminated soils by direct solid sampling atomic absorption spectrometry using an AMA-254 device and radiochemical neutron activation analysis

    Czech Academy of Sciences Publication Activity Database

    Sysalová, J.; Kučera, Jan; Fikrle, Marek; Drtinová, B.

    2013-01-01

    Roč. 110, SEP (2013), s. 691-694. ISSN 0026-265X R&D Projects: GA ČR GAP503/12/0682; GA ČR(CZ) GBP108/12/G108 Institutional support: RVO:61389005 Keywords : Mercury * contaminated soils * AMA-254 * RNAA Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 3.583, year: 2013

  16. Chemical, optical and other data collected aboard the THOMAS G. THOMPSON during cruise TN254 in the Coastal Waters of SE Alaska and North Pacific Ocean from 2010-09-09 to 2010-10-11 (NODC Accession 0104359)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NODC Accession 0104359 includes chemical, optical and other data collected aboard the THOMAS G. THOMPSON during cruise TN254 in the Coastal Waters of SE Alaska and...

  17. Removal of benzoylecgonine from water matrices through UV254/H2O2 process: Reaction kinetic modeling, ecotoxicity and genotoxicity assessment.

    Science.gov (United States)

    Spasiano, D; Russo, D; Vaccaro, M; Siciliano, A; Marotta, R; Guida, M; Reis, N M; Li Puma, G; Andreozzi, R

    2016-11-15

    Benzoylecgonine (BE), the main cocaine metabolite, has been detected in numerous surface water and treatment plants effluents in Europe and there is urgent need for effective treatment methods. In this study, the removal of BE by the UV254/H2O2 process from different water matrices was investigated. By means of competition kinetics method, the kinetic constant of reaction between BE and the photogenerated hydroxyl radicals (OH) was estimated resulting in kOH/BE=5.13×10(9)M(-1)s(-1). By-products and water matrices scavengers effects were estimated by numerical modeling of the reaction kinetics for the UV254/H2O2 process and validated in an innovative microcapillary film (MCF) array photoreactor and in a conventional batch photoreactor. The ecotoxicity of the water before and after treatment was evaluated with four organisms Raphidocelis subcapitata, Daphnia magna, Caenorhabditis elegans, and Vicia faba. The results provided evidence that BE and its transformation by-products do not have significant adverse effects on R. subcapitata, while D. magna underwent an increase of lipid droplets. C. elegans was the most sensitive to BE and its by-products. Furthermore, a genotoxicity assay, using V. faba, showed cytogenic damages during the cell mitosis of primary roots. PMID:27450344

  18. Line width of parametric X-radiation type B measured in germanium at electron energy 25,4 MeV

    International Nuclear Information System (INIS)

    Parametric X-radiation (PXR) of type B has been produced with electron beam of energy 25.4 MeV from the 40 MeV-KIPT-linear accelerator (Kharkov) and germanium crystal with thickness 54 mkm. PXR spectra was measured for(220) plane and radiation angle θ = 305.9 mrad. Results of the work for the first time show the character of functional dependence of PXR (B) line width as a function of the crystal tilt angle. Verified the theory of PXR(B) radiation grounded on perturbative theory [6] and Monte-Carlo method of calculation which takes into account electron multiply scattering, photon absorption in a crystal largest, angular acceptance and efficiency of photon detector. 15 refs., 3 figs

  19. Elastic and Thermal Properties of Double Doped Orthovanadate: Eu1- x (La0.254Y0.746) x VO3

    Science.gov (United States)

    Parveen, Atahar; Gaur, N. K.

    2013-12-01

    We present the effect of A-site double doping (La0.254Y0.746) on elastic and thermal properties of EuVO3 in a wide doping range (0≤ x≤1), using a modified rigid ion model (MRIM). Various lattice distortions and their relation to bulk modulus has been investigated systematically. The effect of the lattice distortions on thermodynamic properties of Eu1- x (La0.25Y0.74) x VO3 has been explored by an atomistic approach. The computed results emphasize that the Debye temperature decreases while the specific heat increases with increase in doping concentration ( x). The computed temperature dependent (1 K≤ T≤300 K) specific heat trends are in accordance with the corresponding experimental data at various compositions. Future scope of MRIM has also been discussed.

  20. Abundancias químicas de la compañera visible del agujero negro binario V4641 Sgr (XTE J1819-254)

    Science.gov (United States)

    Cúneo, V. A.; Jofré, E.; Pintado, O. I.; Gómez, M. N.

    2015-08-01

    In this work we expose an analysis of the chemical abundances of the optical companion of the confirmed black hole binary V4641 Sgr (XTE J1819-254) from GMOS spectra obtained with the Gemini North telescope. This analysis allowed to observe an enhancement of N, O, Mg and Si, attributed to the contamination of heavy elements generated during the supernova explosion that gave birth to the black hole. It was also observed that Cr and Fe were subabundant. The aim of this study is to test the formation scenario of a binary system containing a black hole as remnant of the supernova explosion of a massive star, and to provide information to better understand the final stages in the evolution of massive stars and black hole progenitors.

  1. Degradation and mineralization of organic UV absorber compound 2-phenylbenzimidazole-5-sulfonic acid (PBSA) using UV-254 nm/H{sub 2}O{sub 2}

    Energy Technology Data Exchange (ETDEWEB)

    Abdelraheem, Wael H.M. [Chemistry Department, Faculty of Science, Sohag University, Sohag 82524 (Egypt); Environmental Engineering and Science Program, University of Cincinnati, Cincinnati, OH 45221-0012 (United States); He, Xuexiang; Duan, Xiaodi [Environmental Engineering and Science Program, University of Cincinnati, Cincinnati, OH 45221-0012 (United States); NIREAS-International Water Research Center, University of Cyprus, Nicosia 1678 (Cyprus); Dionysiou, Dionysios D., E-mail: dionysios.d.dionysiou@uc.edu [Environmental Engineering and Science Program, University of Cincinnati, Cincinnati, OH 45221-0012 (United States); NIREAS-International Water Research Center, University of Cyprus, Nicosia 1678 (Cyprus)

    2015-01-23

    Graphical abstract: - Highlights: • UV-254 nm/H{sub 2}O{sub 2} AOP was utilized for the degradation and mineralization of PBSA and BSA. • Promotion of k{sub obs} with [H{sub 2}O{sub 2}]{sub 0} ≤ 4 mM and inhibition at higher [H{sub 2}O{sub 2}]{sub 0} were observed. • The S and N were released and monitored as SO{sub 4}{sup 2−} and NH{sub 4}{sup +}, respectively. • Br{sup −} inhibited both the degradation and mineralization much more significantly than Cl{sup −}. • There was an increase in [NH{sub 4}{sup +}] at higher [H{sub 2}O{sub 2}]{sub 0} and its further destruction at higher UV fluence. - Abstract: Various studies have revealed the non-biodegradable and endocrine disrupting properties of sulfonated organic UV absorbers, directing people's attention toward their risks on ecological and human health and hence their removal from water. In this study, UV-254 nm/H{sub 2}O{sub 2} advanced oxidation process (AOP) was investigated for degrading a model UV absorber compound 2-phenylbenzimidazole-5-sulfonic acid (PBSA) and a structurally similar compound 1H-benzimidazole-2-sulfonic acid (BSA), with a specific focus on their mineralization. At 4.0 mM [H{sub 2}O{sub 2}]{sub 0}, a complete removal of 40.0 μM parent PBSA and 25% decrease in TOC were achieved with 190 min of UV irradiation; SO{sub 4}{sup 2−} was formed and reached its maximum level while the release of nitrogen as NH{sub 4}{sup +} was much lower (around 50%) at 190 min. Sulfate removal was strongly enhanced by increasing [H{sub 2}O{sub 2}]{sub 0} in the range of 0–4.0 mM, with slight inhibition in 4.0–12.0 mM. Faster and earlier ammonia formation was observed at higher [H{sub 2}O{sub 2}]{sub 0}. The presence of Br{sup −} slowed down the degradation and mineralization of both compounds while a negligible effect on the degradation was observed in the presence of Cl{sup −}. Our study provides important technical and fundamental results on the HO{sup ·} based degradation and

  2. Effects of UVC254 nm on the photosynthetic activity of photobionts from the astrobiologically relevant lichens Buellia frigida and Circinaria gyrosa

    Science.gov (United States)

    Meeßen, J.; Backhaus, T.; Sadowsky, A.; Mrkalj, M.; Sánchez, F. J.; de la Torre, R.; Ott, S.

    2014-10-01

    In the past decade, various astrobiological studies on different lichen species investigated the impairment of viability and photosynthetic activity by exposure to simulated or real space parameters (as vacuum, polychromatic ultraviolet (UV)-radiation and monochromatic UVC) and consistently found high post-exposure viability as well as low rates of photosynthetic impairment (de Vera et al. 2003, 2004a; 2004b; de la Torre et al. 2010; Onofri et al. 2012; Sánchez et al. 2012, 2014; Brandt et al. 2014). To achieve a better understanding of the basic mechanisms of resistance, the present study subdued isolated and metabolically active photobionts of two astrobiologically relevant lichens to UVC254 nm, examined its effect on photosynthetic activity by chlorophyll a fluorescence and characterized the UVC-induced damages by quantum yield reduction and measurements of non-photochemical quenching. The results indicate a strong impairment of photosynthetic activity, photoprotective mechanisms and overall photobiont vitality when being irradiated in the isolated and metabolically active state. In conclusion, the present study stresses the higher susceptibility of photobionts towards extreme environmental conditions as UVC-exposure, a stressor that does not occur on the Earth. By comparison with previous studies, the present results highlight the importance of protective mechanisms in lichens, such as morphological-anatomical traits (Meeßen et al. 2013), secondary lichen compounds (Meeßen et al. 2014) and the symbiont's pivotal ability to pass into anhydrobiosis when desiccating.

  3. Photo-removal of sulfamethoxazole (SMX) by photolytic and photocatalytic processes in a batch reactor under UV-C radiation ({lambda}{sub max} = 254 nm)

    Energy Technology Data Exchange (ETDEWEB)

    Nasuhoglu, Deniz; Yargeau, Viviane [Department of Chemical Engineering, McGill University, 3610 University Street, Montreal, Quebec, H3A 2B2 (Canada); Berk, Dimitrios, E-mail: dimitrios.berk@mcgill.ca [Department of Chemical Engineering, McGill University, 3610 University Street, Montreal, Quebec, H3A 2B2 (Canada)

    2011-02-15

    In this study, photolytic and photocatalytic removal of the antibiotic sulfamethoxazole (SMX) under UVC radiation ({lambda} = 254 nm) was investigated. The light intensity distribution inside the batch photoreactor was characterized by azoxybenzene actinometry. The intensity of incident radiation was found to be a strong function of position inside the reactor. 12 mg L{sup -1} of SMX was completely removed within 10 min of irradiation under UVC photolysis, compared to 30 min under TiO{sub 2} photocatalysis. COD measurement was used as an indication of the mineralization efficiency of both processes and higher COD removal with photocatalysis was shown. After 6 h of reaction with photolysis and photocatalysis, 24% and 87% removal of COD was observed, respectively. Two of the intermediate photo-products were identified as sulfanilic acid and 3-amino-5-methylisoxazole by direct comparison of the HPLC chromatograms of standards to those of treated solutions. Ecotoxicity of treated and untreated solutions of SMX towards Daphnia magna was also investigated. It was found that a 3:1 ratio of sample to standard freshwater and a high initial concentration of 60 mg L{sup -1} of SMX were used to obtain reliable and reproducible results. The photo-products formed during photocatalytic and photolytic processes were shown to be generally more toxic than the parent compound.

  4. The minimal domain of adipose triglyceride lipase (ATGL ranges until leucine 254 and can be activated and inhibited by CGI-58 and G0S2, respectively.

    Directory of Open Access Journals (Sweden)

    Irina Cornaciu

    Full Text Available Adipose triglyceride lipase (ATGL is the rate-limiting enzyme of lipolysis. ATGL specifically hydrolyzes triacylglycerols (TGs, thereby generating diacylglycerols and free fatty acids. ATGL's enzymatic activity is co-activated by the protein comparative gene identification-58 (CGI-58 and inhibited by the protein G0/G1 switch gene 2 (G0S2. The enzyme is predicted to act through a catalytic dyad (Ser47, Asp166 located within the conserved patatin domain (Ile10-Leu178. Yet, neither an experimentally determined 3D structure nor a model of ATGL is currently available, which would help to understand how CGI-58 and G0S2 modulate ATGL's activity. In this study we determined the minimal active domain of ATGL. This minimal fragment of ATGL could still be activated and inhibited by CGI-58 and G0S2, respectively. Furthermore, we show that this minimal domain is sufficient for protein-protein interaction of ATGL with its regulatory proteins. Based on these data, we generated a 3D homology model for the minimal domain. It strengthens our experimental finding that amino acids between Leu178 and Leu254 are essential for the formation of a stable protein domain related to the patatin fold. Our data provide insights into the structure-function relationship of ATGL and indicate higher structural similarities in the N-terminal halves of mammalian patatin-like phospholipase domain containing proteins, (PNPLA1, -2,- 3 and -5 than originally anticipated.

  5. Photo-removal of sulfamethoxazole (SMX) by photolytic and photocatalytic processes in a batch reactor under UV-C radiation (λmax = 254 nm)

    International Nuclear Information System (INIS)

    In this study, photolytic and photocatalytic removal of the antibiotic sulfamethoxazole (SMX) under UVC radiation (λ = 254 nm) was investigated. The light intensity distribution inside the batch photoreactor was characterized by azoxybenzene actinometry. The intensity of incident radiation was found to be a strong function of position inside the reactor. 12 mg L-1 of SMX was completely removed within 10 min of irradiation under UVC photolysis, compared to 30 min under TiO2 photocatalysis. COD measurement was used as an indication of the mineralization efficiency of both processes and higher COD removal with photocatalysis was shown. After 6 h of reaction with photolysis and photocatalysis, 24% and 87% removal of COD was observed, respectively. Two of the intermediate photo-products were identified as sulfanilic acid and 3-amino-5-methylisoxazole by direct comparison of the HPLC chromatograms of standards to those of treated solutions. Ecotoxicity of treated and untreated solutions of SMX towards Daphnia magna was also investigated. It was found that a 3:1 ratio of sample to standard freshwater and a high initial concentration of 60 mg L-1 of SMX were used to obtain reliable and reproducible results. The photo-products formed during photocatalytic and photolytic processes were shown to be generally more toxic than the parent compound.

  6. W-reactivation and W-mutagenesis in bacteriophages lambda and T7: comparison of action of ultraviolet irradiation (254nm) and furocouma photosensitization

    International Nuclear Information System (INIS)

    When treating bacteriophage lambda with 8-methoxypsoralen (8-MOP) and light (lambda>320 nm), two types of photoproducts are formed in DNA: monoadducts and diadducts or interstrand linkings. If a wild-type strain of Escherichia coli is used as horst, W-reactivation and W-mutagenesis (clear-mutation), approximately equal in magnitude to those of UV-irradiated phage lambda, are observed in the bacteriophage lambda treated with 8-MOP plus light. If mutant strains E coli uvrA-, recA- and lexA- are used as host W-reactivation and W-mutagenesis practically do not occur in phage lambda. Using the method of ''reirradiation'', it is shown that clear-mutations in 8-MOP plus light treated phage lambda are induced in the process of W-mutagenesis mainly due to the formation of diadducts (interstrand linking) in DNA. In the phage monoadducts of derived furocoumarins also have a mutageneous character but their mutagenesis effectiveness (mutation probability calculating on one photo product) is significantly inferior to that of diadducts (approximately 15-20 times). It has been demonstrated in the experiments on the determination of W-mutagenesis of phage lambda photosensitized with angelisine - an angular derivative of furocoumarins - that mainly formi monoadducts in DNA. It is also shown that W-reactivation and W-mutagenesis effects are observed when sowing UV-irradiated (254 nm) phage lambda on E coli uvrA- and wild-type strains treated with 8-MOP plus light. As to bacteriophage T7 treated with 8-MOP plus light, W-reactivation is not observed even on a wild strain E coli. Preliminary infection of cells with phage T7 that has been strongly inactivated using photosensitizer 8-MOP decreases repair's effectiveness of interstrand linkings in DNA of phage lambda

  7. Influence of pH on the passivation behavior of 254SMO stainless steel in 3.5% NaCl solution

    International Nuclear Information System (INIS)

    The potentiodynamic polarization measurement of 254SMO stainless steel (UNS 31254) was conducted in 3.5% NaCl solutions with pH ranging from 0.1 to 5. The results indicated that this stainless steel offered excellent pitting corrosion resistance in corrosive environments. Further, it also exhibited various features on the polarization curves in different pH solutions. The electrochemical constant-potential passivation treatment performed at different pH followed by XPS analysis revealed that the primary constituents of the outermost layer of the passive films formed in the weak (pH 5) and strong (pH 0.8) acid solutions are iron oxides and Cr2O3 and Cr(OH)3, respectively. Molybdenum oxides, primarily in the six-valence state, existed in the outermost layer of the passive film. Only very weak signals corresponding to that of nickel oxides were detected in the film formed in the weak acid (pH 5) solution. The ICP-MS analyses indicated selective dissolution of a significant amount of Fe and a few Mo and Ni ions during the passivation treatment in the strong acid (pH 0.8) solution. No Cr dissolution was observed; this indicated that the Cr in the film is relatively stable. XPS depth profiling results showed that a similar bilayer-structured film was formed in both the solutions (pH 0.8 and 5); the outer layer of this film is primarily composed of Cr(OH)3 and Mo(VI), and the inner layer, Cr2O3 and Mo(IV). The results of the examinations of passive film formations and dissolution by XPS and ICP-MS were consistent with the polarization curves

  8. Effect of Key Parameters on the Photocatalytic Oxidation of Toluene at Low Concentrations in Air under 254 + 185 nm UV Irradiation

    Energy Technology Data Exchange (ETDEWEB)

    Quici, Natalia; Vera, Maria L.; Choi, Hyeok; Puma, Gianluca Li; Dionysiou, Dionysios D.; Litter, Marta I.; Destaillats, Hugo

    2009-07-01

    The effect of key experimental parameters on the removal of toluene under 254 + 185 nm irradiation was investigated using a benchtop photocatalytic flow reactor. Toluenewas introduced at low concentrations between 10 and 500 ppbv, typical of indoorenvironments, and reacted on TiO2-coated Raschig rings. Two different TiO2-coated rings were prepared: in one case, by dip-coating using a P25 aqueous suspension and, on the other, using an organic/inorganic sol-gel method that produced thin films of mesoporous anatase. Flow rates in the photoreactor varied between 4 L min-1 and 125 mL min-1, leading to residence times in the range 100 ms< tau< 2 s. For these conditions, toluene removal efficiencies were between 30 and 90percent, indicating that the system did not achieve total conversion in any case. For each air flow rate, the conversion oftoluene was significantly higher when the reactor length was 10 cm, as compared with 5 cm; however, only marginal increases in conversions were achieved in the two reactor lengths at equal residence time and different concentration of toluene, suggesting that that the reactor is effectively behaving as an ideal reactor and that the reaction is first-order in the concentration of toluene. Experiments were carried out between 0 and 66percent relative humidity (RH), the fastest reaction rate being observed at moderately low humidity conditions (10percent RH), with respect to both dry air and higher humidity levels. Formaldehyde was formed as a partial oxidation byproduct at low and at high residence times (240 and 960 ms), although higher formaldehyde molar yields (up to 20percent) were observed at low tau (240 ms) and moderate humidity conditions (10 and 33percent), suggesting that both tau and RH can be optimized toreduce the formation of harmful intermediates. Toluene removal efficiency increased with the TiO2 thickness (i.e., mass) until a maximum value of 500 nm, beyond which the removal efficiency decreased. This should be

  9. Role of electrostatics at the catalytic metal binding site in xylose isomerase action: Ca(2+)-inhibition and metal competence in the double mutant D254E/D256E.

    Science.gov (United States)

    Fuxreiter, M; Böcskei, Z; Szeibert, A; Szabó, E; Dallmann, G; Naray-Szabo, G; Asboth, B

    1997-06-01

    The catalytic metal binding site of xylose isomerase from Arthrobacter B3728 was modified by protein engineering to diminish the inhibitory effect of Ca2+ and to study the competence of metals on catalysis. To exclude Ca2+ from Site 2 a double mutant D254E/D256E was designed with reduced space available for binding. In order to elucidate structural consequences of the mutation the binary complex of the mutant with Mg2+ as well as ternary complexes with bivalent metal ions and the open-chain inhibitor xylitol were crystallized for x-ray studies. We determined the crystal structures of the ternary complexes containing Mg2+, Mn2+, and Ca2+ at 2.2 to 2.5 A resolutions, and refined them to R factors of 16.3, 16.6, and 19.1, respectively. We found that all metals are liganded by both engineered glutamates as well as by atoms O1 and O2 of the inhibitor. The similarity of the coordination of Ca2+ to that of the cofactors as well as results with Be2+ weaken the assumption that geometry differences should account for the catalytic noncompetence of this ion. Kinetic results of the D254E/D256E mutant enzyme showed that the significant decrease in Ca2+ inhibition was accompanied by a similar reduction in the enzymatic activity. Qualitative argumentation, based on the protein electrostatic potential, indicates that the proximity of the negative side chains to the substrate significantly reduces the electrostatic stabilization of the transition state. Furthermore, due to the smaller size of the catalytic metal site, no water molecule, coordinating the metal, could be observed in ternary complexes of the double mutant. Consequently, the proton shuttle step in the overall mechanism should differ from that in the wild type. These effects can account for the observed decrease in catalytic efficiency of the D254E/D256E mutant enzyme. PMID:9188736

  10. Corrective Action Investigation Plan for Corrective Action Unit 254: Area 25 R-MAD Decontamination Facility, Nevada Test Site, Nevada (includes ROTC No. 1, date 01/25/1999)

    Energy Technology Data Exchange (ETDEWEB)

    DOE/NV

    1999-07-29

    This Corrective Action Investigation Plan contains the US Department of Energy, Nevada Operations Office's approach to collect the data necessary to evaluate corrective action alternatives appropriate for the closure of Corrective Action Unit (CAU) 254 under the Federal Facility Agreement and Consent Order. Corrective Action Unit 254 consists of Corrective Action Site (CAS) 25-23-06, Decontamination Facility. Located in Area 25 at the Nevada Test Site (NTS), CAU 254 was used between 1963 through 1973 for the decontamination of test-car hardware and tooling used in the Nuclear Rocket Development Station program. The CAS is composed of a fenced area measuring approximately 119 feet by 158 feet that includes Building 3126, an associated aboveground storage tank, a potential underground storage area, two concrete decontamination pads, a generator, two sumps, and a storage yard. Based on site history, the scope of this plan is to resolve the problem statement identified during the Data Quality Objectives process that decontamination activities at this CAU site may have resulted in the release of contaminants of concern (COCs) onto building surfaces, down building drains to associated leachfields, and to soils associated with two concrete decontamination pads located outside the building. Therefore, the scope of the corrective action field investigation will involve soil sampling at biased and random locations in the yard using a direct-push method, scanning and static radiological surveys, and laboratory analyses of all soil/building samples. Historical information provided by former NTS employees indicates that solvents and degreasers may have been used in the decontamination processes; therefore, potential COCs include volatile/semivolatile organic compounds, Resource Conservation and Recovery Act metals, petroleum hydrocarbons, polychlorinated biphenyls, pesticides, asbestos, gamma-emitting radionuclides, plutonium, uranium, and strontium-90. The results of this

  11. Survey of potential markets for devices using Californium-252

    International Nuclear Information System (INIS)

    Potential applications for devices or systems containing 252Cf in the years from 1975 to 1980 are estimated. The estimated number of devices and associated business value were derived from a survey of 46 industrial, educational and governmental organizations conducted from Jan. to May, 1975. Applications for devices and systems based on 252Cf are expected to increase by a factor of 7 in the 6-y period from 1975 to 1980. The annual business value of 252Cf devices should increase from 1.5 million dollars in 1975 to 10.8 million dollars in 1980. The potential European market should be several times as large as the US market, based on actual sales of 252Cf, which have been two to four times greater in Europe than in the US

  12. The protective cell petrus for the production of californium 252

    International Nuclear Information System (INIS)

    The alpha, beta, gamma, neutron cell which is described in the present paper is devoted to the transplutonium element production and study. It is located at the CEN in Fontenay-aux-Roses (France). The 4 feet ordinary concrete shielding made of stacked blocs allows the manipulation of radioactive sources as high as 1000 curies of 1 MeV gamma rays and with a fast neutrons flux of 109 n.cm-2.s-1. The airtight alpha containment box is equipped with two transfer systems, one consists of a parallelepiped shaped airtight box located in a turntable, the other uses standard cylindrical containers made of polyethylene. The general equipment and the main setting up are also described. (authors)

  13. Californium-252 neutron activation facility at the Savannah River Laboratory

    International Nuclear Information System (INIS)

    A neutron irradiation facility has been established to develop new analytical methods and for the support of research programs. A major component of this facility is a 252Cf source which provides both fission spectrum and thermal neutrons. (U.S.)

  14. Californium-252 brachytherapy for anal and ano-rectal carcinoma

    International Nuclear Information System (INIS)

    Surgery has historically been the standard treatment for anal, ano-rectal and rectal carcinoma but is prone to local or regional failure. Over the past 15 years there has been increasing interest in and success with radiation therapy and combined chemoradiotherapy for treatment of anal and ano-rectal cancers. Cf-252 brachytherapy combined with external beam teletherapy has been investigated for anal and ano-rectal lesions at the Univ. of Kentucky with encouraging results

  15. Mobile equipment for neutron radiography using a californium-252 source

    International Nuclear Information System (INIS)

    The basic requirements for successful neutron radiography are first summarised and the use of 252Cf is placed in perspective by comparing its properties with those of sources based on the Be (γ, n) and Be (α, n) reactions which have a broadly similar range of applications. The more essential design features of mobile neutron radiography equipment are next examined in some detail, to show how the often conflicting requirements of optimum beam production and adequate shielding may be reconciled. An assembly with a maximum dimension around 1 m with a source of 1 mg is used as an example. The design data used are reproduced in graphical form to permit designs to be scaled to suit the source available and the requirements. The selection of suitable image recorders for 252Cf radiography is discussed with the conclusion that the gadolinium foil-film combinations are likely to remain the normal choice. Demonstration radiographs are presented with particular reference to the location of residual casting sand in gas-cooled turbine blades. Finally, it is suggested that other applications for mobile 252Cf-based neutron radiography equipment will be found in the ordnance, aero-space, chemical and nuclear fuel manufacturing industries. (author)

  16. Automated absolute activation analysis with californium-252 sources

    Energy Technology Data Exchange (ETDEWEB)

    MacMurdo, K.W.; Bowman, W.W.

    1978-09-01

    A 100-mg /sup 252/Cf neutron activation analysis facility is used routinely at the Savannah River Laboratory for multielement analysis of many solid and liquid samples. An absolute analysis technique converts counting data directly to elemental concentration without the use of classical comparative standards and flux monitors. With the totally automated pneumatic sample transfer system, cyclic irradiation-decay-count regimes can be pre-selected for up to 40 samples, and samples can be analyzed with the facility unattended. An automatic data control system starts and stops a high-resolution gamma-ray spectrometer and/or a delayed-neutron detector; the system also stores data and controls output modes. Gamma ray data are reduced by three main programs in the IBM 360/195 computer: the 4096-channel spectrum and pertinent experimental timing, counting, and sample data are stored on magnetic tape; the spectrum is then reduced to a list of significant photopeak energies, integrated areas, and their associated statistical errors; and the third program assigns gamma ray photopeaks to the appropriate neutron activation product(s) by comparing photopeak energies to tabulated gamma ray energies. Photopeak areas are then converted to elemental concentration by using experimental timing and sample data, calculated elemental neutron capture rates, absolute detector efficiencies, and absolute spectroscopic decay data. Calculational procedures have been developed so that fissile material can be analyzed by cyclic neutron activation and delayed-neutron counting procedures. These calculations are based on a 6 half-life group model of delayed neutron emission; calculations include corrections for delayed neutron interference from /sup 17/O. Detection sensitivities of < or = 400 ppB for natural uranium and 8 ppB (< or = 0.5 (nCi/g)) for /sup 239/Pu were demonstrated with 15-g samples at a throughput of up to 140 per day. Over 40 elements can be detected at the sub-ppM level.

  17. Californium-based neutron radiography for corrosion detection in aircraft

    International Nuclear Information System (INIS)

    In support of an overall program aimed at minimizing disassembly and reducing inspection time during aircraft maintenance, a series of projects has been carried out to determine the feasibility of applying neutron radiographic techniques to the nondestructive (NDT) inspection of aircraft and aircraft components. These investigations have clearly demonstrated the superiority of neutron radiography over all other NDT techniques in its ability to detect surface and subsurface corrosion in aircraft structure. This capability is particularly significant where the corrosion is hidden behind thick metallic structural members. The neutron radiographic technique has been applied successfully to detect corrosion in the wing tank of E-2C, C-130, and DC-9 aircraft; rear stabilators of F-4 and F-111 aircraft; aft spar, starboard and port wing, and rudder of the F-8; fuselage skin of the 727; rotary blades of AH-1 and SH-3 helicopters; rotary tail flaps of the UH-2 helicopter; and nose landing gear of A-7 aircraft

  18. Automated absolute activation analysis with californium-252 sources

    International Nuclear Information System (INIS)

    A 100-mg 252Cf neutron activation analysis facility is used routinely at the Savannah River Laboratory for multielement analysis of many solid and liquid samples. An absolute analysis technique converts counting data directly to elemental concentration without the use of classical comparative standards and flux monitors. With the totally automated pneumatic sample transfer system, cyclic irradiation-decay-count regimes can be pre-selected for up to 40 samples, and samples can be analyzed with the facility unattended. An automatic data control system starts and stops a high-resolution gamma-ray spectrometer and/or a delayed-neutron detector; the system also stores data and controls output modes. Gamma ray data are reduced by three main programs in the IBM 360/195 computer: the 4096-channel spectrum and pertinent experimental timing, counting, and sample data are stored on magnetic tape; the spectrum is then reduced to a list of significant photopeak energies, integrated areas, and their associated statistical errors; and the third program assigns gamma ray photopeaks to the appropriate neutron activation product(s) by comparing photopeak energies to tabulated gamma ray energies. Photopeak areas are then converted to elemental concentration by using experimental timing and sample data, calculated elemental neutron capture rates, absolute detector efficiencies, and absolute spectroscopic decay data. Calculational procedures have been developed so that fissile material can be analyzed by cyclic neutron activation and delayed-neutron counting procedures. These calculations are based on a 6 half-life group model of delayed neutron emission; calculations include corrections for delayed neutron interference from 17O. Detection sensitivities of 239Pu were demonstrated with 15-g samples at a throughput of up to 140 per day. Over 40 elements can be detected at the sub-ppM level

  19. Investigation on the removal of the major cocaine metabolite (benzoylecgonine) in water matrices by UV254/H2O2 process by using a flow microcapillary film array photoreactor as an efficient experimental tool.

    Science.gov (United States)

    Russo, Danilo; Spasiano, Danilo; Vaccaro, Marianna; Cochran, Kristin H; Richardson, Susan D; Andreozzi, Roberto; Li Puma, Gianluca; Reis, Nuno M; Marotta, Raffaele

    2016-02-01

    A microcapillary film reactor (MCF) was adopted to evaluate and compare the removal efficiency of benzoylecgonine (BE), an emerging micropollutant deriving from illicit drug abuse (cocaine), in different aqueous matrices: milliQ water, synthetic and real wastewater and surface water. The removal processes investigated were the direct photolysis with UV radiation at 254 nm, and the advanced oxidation process (AOP) with the same UV radiation and hydrogen peroxide. As a result of the microfluidics approach developed through an innovative experimental apparatus, full conversion of BE was reached within a few seconds or minutes of residence time in the MCF depending on the process conditions adopted. The radiation dose was estimated to be approximately 5.5 J cm(-2). The innovative MCF reactor was found to be an effective tool for photochemical studies, especially when using highly priced, uncommon, or regulated substances. The removal efficiency was affected by the nature of the aqueous matrix, due to the presence of different xenobiotics and natural compounds that act primarily as HO(•) radical scavengers and secondly as inner UV254 filters. Moreover, nano-liquid chromatography (LC)-high resolution-mass spectrometry analysis was utilized to identify the main reaction transformation products, showing the formation of hydroxylated aromatics during the photochemical treatment. PMID:26735209

  20. Detection of variants of the pRAS3, pAB5S9, and pSN254 plasmids in Aeromonas salmonicida subsp. salmonicida: multidrug resistance, interspecies exchanges, and plasmid reshaping.

    Science.gov (United States)

    Vincent, Antony T; Trudel, Mélanie V; Paquet, Valérie E; Boyle, Brian; Tanaka, Katherine H; Dallaire-Dufresne, Stéphanie; Daher, Rana K; Frenette, Michel; Derome, Nicolas; Charette, Steve J

    2014-12-01

    The ubiquitous water-borne Gram-negative bacterium Aeromonas salmonicida subsp. salmonicida is the causative agent of furunculosis, a worldwide disease in fish farms. Plasmids carrying antibiotic resistance genes have already been described for this bacterium. The aim of the present study was to identify and characterize additional multidrug resistance plasmids in A. salmonicida subsp. salmonicida. We sequenced the plasmids present in two multiple antibiotic-resistant isolates using high-throughput technologies. We also investigated 19 other isolates with various multidrug resistance profiles by genotyping PCR and assessed their resistance to tetracycline. We identified variants of the pAB5S9 and pSN254 plasmids that carry several antibiotic resistance genes and that have been previously reported in bacteria other than A. salmonicida subsp. salmonicida, which suggests a high level of interspecies exchange. Genotyping analyses and the antibiotic resistance profiles of the 19 other isolates support the idea that multiple versions of pAB5S9 and pSN254 exist in A. salmonicida subsp. salmonicida. We also identified variants of the pRAS3 plasmid. The present study revealed that A. salmonicida subsp. salmonicida harbors a wide variety of plasmids, which suggests that this ubiquitous bacterium may contribute to the spread of antibiotic resistance genes in the environment. PMID:25267667

  1. 50 CFR 216.254 - Mitigation.

    Science.gov (United States)

    2010-10-01

    ... safety for marine mammals with a radius of no less than 5 nm (9.3 km) for single bombs and 10 nm (18.5 km) for double bombs and a buffer zone from the outer edge of the safety zone with a radius of at least 2.5 nm (4.6 km) for single bombs and 5 nm (18.5 km) for double bombs. (b) Prior to a JASSM or...

  2. 36 CFR 254.15 - Title standards.

    Science.gov (United States)

    2010-07-01

    ... subdivisions thereof (36 CFR part 251, subpart A). (iii) Any personal property owned by the non-Federal party... lands affected by a land exchange may be entitled to relocation benefits under 49 CFR 24.2. Unless otherwise provided by law or regulation (49 CFR 24.101(a)(1)), relocation benefits are not applicable...

  3. 36 CFR 254.2 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... Environmental Protection Agency regulations at 40 CFR part 302. Highest and best use means an appraiser's... public domain for national forest purposes and the Geothermal Steam Act of 1970 (30 U.S.C. 1001 et seq.), but not the Materials Act of 1947 (30 U.S.C. 601 et seq.). Outstanding interests are rights...

  4. 36 CFR 254.9 - Appraisals.

    Science.gov (United States)

    2010-07-01

    ... 1989 (FIRREA) (12 U.S.C. 3331). In the event a State or Territory does not have approved policies... summary of facts and conclusions; (2) The purpose and/or the function of the appraisal, a definition of...) Include historic, wildlife, recreation, wilderness, scenic, cultural, or other resource values...

  5. 7 CFR 1901.254 - Scope.

    Science.gov (United States)

    2010-01-01

    ... buildings, schools, transportation, traffic, and law enforcement. (5) Loans to develop community irrigation... assessment. However, when the State Director or County Supervisor finds or has had communication or obtains... improve: (i) Community water, sanitary sewage, solid waste disposal, and storm waste water...

  6. 36 CFR 254.10 - Bargaining; arbitration.

    Science.gov (United States)

    2010-07-01

    ... determine values. Bargaining or any other process must be based on an objective analysis of the valuation in... determine values. If arbitration occurs, it must be conducted in accordance with the real estate valuation... from the date of the arbitration decision. (b) Arbitration is limited to the disputed valuation of...

  7. Analysis of rubella virus infection among pregnant women in 36 254 cases%36254例妊娠期孕妇风疹病毒感染状况分析

    Institute of Scientific and Technical Information of China (English)

    索庆丽; 胡晞江; 姚婷

    2012-01-01

    Objective To investigate the rubella virus(RV) infection and susceptibility condition among pregnant women in Wuhan maternal and child health hospital for 10 years,and to provide references for the prevention of pregnancy RV infection and congenital rubella syndrome(CRS). Methods ELISA was used to measure the RV-IgM and RV-IgG in the serum samples of 36 254 cases of RV infected pregnant women,which were divided into a variety of infection models,and we used two or more group x2 test for statistical analysis. Results The positive rate of RV-IgM among pregnant women was 1. 52%,of which the primary RV infection during pregnancy was 1. 02% ;the RV susceptibility rate during middle pregnancy was significantly higher than early pregnancy, recent RV uninfected and immunized pregnant women in early pregnancy were significantly higher than middle and later pregnancy; RV susceptible rate in pregnant women increased significantly with increasing age trend. Conclusion The recent RV infection rate of pregnant women in that hospital for 10 years is at an intermediate level. RV natural infection rate was higher among childbearing aged and pregnant women. The health care institutions at all levels should strengthen the management of RV susceptible pregnant women during early and middle pregnancy and guide the susceptible women of childbearing age to accept vaccination and prevent aged pregnant women from RV infection.%目的 调查武汉市妇幼保健院10年妊娠期孕妇风疹病毒(RV)感染和易感状况,为预防妊娠期RV感染和胎儿先天性风疹综合征(CRS)提供参考依据.方法 用酶联免疫吸附法(ELISA)检测36 254例孕妇血清中RV-IgM和RV-IgG两项指标,将其分为多种感染模式,采用两组或多组比较的χ2检验进行统计分析.结果 孕妇RV-IgM阳性率为1.52%,其中,妊娠期RV原发感染孕妇为1.02%;中孕期RV易感率显著高于早孕;早孕期近期未感染RV且对其具有免疫力的孕妇显著高于中、晚孕期

  8. Degradation kinetics and mechanism of β-lactam antibiotics by the activation of H{sub 2}O{sub 2} and Na{sub 2}S{sub 2}O{sub 8} under UV-254 nm irradiation

    Energy Technology Data Exchange (ETDEWEB)

    He, Xuexiang [Environmental Engineering and Science Program, University of Cincinnati, Cincinnati, OH 45221-0012 (United States); Department of Civil and Environmental Engineering and Nireas-International Water Research Centre, School of Engineering, University of Cyprus, PO Box 20537, 1678 Nicosia (Cyprus); Mezyk, Stephen P. [Department of Chemistry and Biochemistry, California State University Long Beach, 1250 Bellflower Blvd., Long Beach, CA 90840 (United States); Michael, Irene; Fatta-Kassinos, Despo [Department of Civil and Environmental Engineering and Nireas-International Water Research Centre, School of Engineering, University of Cyprus, PO Box 20537, 1678 Nicosia (Cyprus); Dionysiou, Dionysios D., E-mail: dionysios.d.dionysiou@uc.edu [Environmental Engineering and Science Program, University of Cincinnati, Cincinnati, OH 45221-0012 (United States); Department of Civil and Environmental Engineering and Nireas-International Water Research Centre, School of Engineering, University of Cyprus, PO Box 20537, 1678 Nicosia (Cyprus)

    2014-08-30

    Graphical abstract: - Highlights: • Removal efficiency was comparable at different UV fluence rates but same fluence. • Reducing pH to 3 or 2 did not inhibit the removal of nitrobenzene by UV/S{sub 2}O{sub 8}{sup 2−}. • 1.84 × 10{sup −14} M [HO{sup •} ]{sub ss} and 3.10 × 10{sup −13} M [SO{sub 4}{sup •} {sup −}]{sub ss} in UV/S{sub 2}O{sub 8}{sup 2−} were estimated. • HO{sup •} reacted faster with the β-lactams than SO{sub 4}{sup •} {sup −} but sharing similar byproducts. • Transformation pathways included hydroxylation, hydrolysis and decarboxylation. - Abstract: The extensive production and usage of antibiotics have led to an increasing occurrence of antibiotic residuals in various aquatic compartments, presenting a significant threat to both ecosystem and human health. This study investigated the degradation of selected β-lactam antibiotics (penicillins: ampicillin, penicillin V, and piperacillin; cephalosporin: cephalothin) by UV-254 nm activated H{sub 2}O{sub 2} and S{sub 2}O{sub 8}{sup 2−} photochemical processes. The UV irradiation alone resulted in various degrees of direct photolysis of the antibiotics; while the addition of the oxidants improved significantly the removal efficiency. The steady-state radical concentrations were estimated, revealing a non-negligible contribution of hydroxyl radicals in the UV/S{sub 2}O{sub 8}{sup 2−} system. Mineralization of the β-lactams could be achieved at high UV fluence, with a slow formation of SO{sub 4}{sup 2−} and a much lower elimination of total organic carbon (TOC). The transformation mechanisms were also investigated showing the main reaction pathways of hydroxylation (+16 Da) at the aromatic ring and/or the sulfur atom, hydrolysis (+18 Da) at the β-lactam ring and decarboxylation (–44 Da) for the three penicillins. Oxidation of amine group was also observed for ampicillin. This study suggests that UV/H{sub 2}O{sub 2} and UV/S{sub 2}O{sub 8}{sup 2−} advanced

  9. Degradation kinetics and mechanism of β-lactam antibiotics by the activation of H2O2 and Na2S2O8 under UV-254 nm irradiation

    International Nuclear Information System (INIS)

    Graphical abstract: - Highlights: • Removal efficiency was comparable at different UV fluence rates but same fluence. • Reducing pH to 3 or 2 did not inhibit the removal of nitrobenzene by UV/S2O82−. • 1.84 × 10−14 M [HO• ]ss and 3.10 × 10−13 M [SO4• −]ss in UV/S2O82− were estimated. • HO• reacted faster with the β-lactams than SO4• − but sharing similar byproducts. • Transformation pathways included hydroxylation, hydrolysis and decarboxylation. - Abstract: The extensive production and usage of antibiotics have led to an increasing occurrence of antibiotic residuals in various aquatic compartments, presenting a significant threat to both ecosystem and human health. This study investigated the degradation of selected β-lactam antibiotics (penicillins: ampicillin, penicillin V, and piperacillin; cephalosporin: cephalothin) by UV-254 nm activated H2O2 and S2O82− photochemical processes. The UV irradiation alone resulted in various degrees of direct photolysis of the antibiotics; while the addition of the oxidants improved significantly the removal efficiency. The steady-state radical concentrations were estimated, revealing a non-negligible contribution of hydroxyl radicals in the UV/S2O82− system. Mineralization of the β-lactams could be achieved at high UV fluence, with a slow formation of SO42− and a much lower elimination of total organic carbon (TOC). The transformation mechanisms were also investigated showing the main reaction pathways of hydroxylation (+16 Da) at the aromatic ring and/or the sulfur atom, hydrolysis (+18 Da) at the β-lactam ring and decarboxylation (–44 Da) for the three penicillins. Oxidation of amine group was also observed for ampicillin. This study suggests that UV/H2O2 and UV/S2O82− advanced oxidation processes (AOPs) are capable of degrading β-lactam antibiotics decreasing consequently the antibiotic activity of treated waters

  10. Capture cross section measurement analysis in the Californium-252 spectrum with the Monte Carlo method

    International Nuclear Information System (INIS)

    Absolute average capture cross sections of gold, thorium, tantalum, molybdenum, copper and strontium in 252Cf spontaneous fission neutron spectrum were simulated for two types of experiment setups preformed by Z. Dezso and J. Csikai and by L. Green. The experiments were simulated with MCNP5 using cross section data from the ENDF/B-VII.0 library. The determination of neutron backscattering was calculated with the use of neutron flagging. Correction factors to experimentally measured values were determined to obtain average cross sections in a pure 252Cf spontaneous fission spectrum. Influence of concrete wall thickness, air moisture and room size on the average cross section was analyzed. Correction factors amounted to about 30%. Corrected values corresponding to average cross sections in a pure 252Cf spectrum were calculated for 197Au, 232Th, 181Ta, 98Mo, 65Cu and 84Sr. Average cross sections were also calculated with the RR-UNC software using IRDFF-v.1.05 and ENDF/B-VII.0 libraries. The revised average radiative capture cross sections are 75.5±0.1 mb for 197Au, 87.0±1.6 mb for 232Th , 98.0±4.5 mb for 181Ta, 21.2±0.5 mb for 98Mo, 10.3±0.3 mb for 63Cu, and 34.9±6.5 mb for 84Sr. - Highlights: • Average capture cross sections in 252Cf spontaneous fission spectrum were simulated. • Calculations were done using MCNP5 code and ENDF/B-VII.0 library. • Correction factors for self-shielding and room return effects were taken into account. • The revised average radiative capture cross sections for different materials are published

  11. Multi-element neutron activation analysis of sediment using a californium-252 source

    International Nuclear Information System (INIS)

    The application of a 252Cf source to the neutron activation analysis of several elements in small (approximately 1.5 in. in dia) cores was studied using high-resolution gamma ray spectroscopy and manual data reduction. (U.S.)

  12. OER of californium-252 at low dose rate for growth inhibition in Vicia faba

    International Nuclear Information System (INIS)

    OER of 252Cf, at low dose rate, has been determined for growth inhibition in Vicia faba roots. A new strain ''BelB'' was used; it was found to be more resistant to prolonged anoxia. Two sets of linear 252Cf sources were used (linear activity 0.31 and 0.47 (μg.cm-1)) in somewhat different geometrical arrangements. The (n+γ) 252Cf dose rates at the level of the root tips were 0.11 and 0.13 Gy.h-1 respectively. The relative contribution of the γ component Dsub(γ) to the total absorbed dose Dsub(n+γ) at the level of the root tips was evaluated Dsub(γ)/Dsub(n+γ)=0.35 for the first source-geometry and 0.42 for the second source-geometry. The reference radiation was the γ emission of 192Ir, used in the same geometrical conditions and for similar irradiation times. Irradiations performed in aerobic and anoxic conditions were alternated. OER values of 1.4 +- 0.1 and 1.5 +- 0.1 were observed for the 252Cf emission with the first and second source-geometry respectively. The corresponding OER values for 192Ir were 2.3 +- 0.2 and 2.6 +- 0.1; the derived oxygen gain factors were then equal to 1.6 and 1.7 repectively

  13. Dicty_cDB: VFM254 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available (All Frames) Frame A: ---xxxxxxxxxxxxxxxxvxxxxxxxrxxxxxxxxxxxxxxxkvxxxxxkxxfxxvxnx xmvvlxxittfkrnplsi*ssd*ev...vckflskpslvrllhxklkvlitlrmlkpksktkk vfhqinnvsfspvnnwrmvvlslittfkrnplsi*fsd*evvckfl*klslvkplhsklk vvttlrm*kqkfktkkvshq Frame B: ---xxx...xxxxxxxxxxxxwxxxxxxsxgxxxxxxcxxxxxxxxryxxxxxxxxfxw*xix x

  14. 29 CFR 1910.254 - Arc welding and cutting.

    Science.gov (United States)

    2010-07-01

    ... terminal which is intended to be used exclusively for connection to the work is connected to the grounded... is not carried through threaded joints, flanged bolted joints, or caulked joints and that special precautions are used to avoid sparking at connection of the work-lead cable. (iii) Chains, wire ropes,...

  15. 42 CFR 422.254 - Submission of bids.

    Science.gov (United States)

    2010-10-01

    ... (as defined § 422.102). (4) The projected number of enrollees in each MA local area used in... to verify actuarial bases and the projected number of enrollees. (6) A description of deductibles... premium for basic benefits under the original Medicare fee-for-service program option; (3) The amount...

  16. Dicty_cDB: SHD254 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available -16-2_G01_sjs2-16-2G01-T3 SJS Schistosoma japonicum cDNA, mRNA sequence. 56 0.001 1 CV682907 |CV682907.1 service...43_H06_sjs2-16-2B11-T3 SJS Schistosoma japonicum cDNA, mRNA sequence. 56 0.001 1 CV682854 |CV682854.1 service

  17. Intelligent integrated media communication techniques cost 254 & cost 276

    CERN Document Server

    Tasic, Jurij F; Ansorge, Michael

    2007-01-01

    List of Figures. List of Tables. Preface. I: Hypermedia Management. 1. Content and Presentation Adaptation in Hypermedia Systems; U. Burnik, M. Pogacnik. 1. Personalized Communication Services. 2. Personalized Information Search. 3. Adaptive Information Retrieval. 4. System Architecture and Functionality. 5. Conclusions. 2. Annotation, Storage, Retrieval and Analysis of Digital Video; Honglin Yi, et al. 1. Introduction. 2. Proposed System Architecture. 3. Video Query Applied to Fixed-View Motion Imagery. 4. Automatic Video Annotation - One Supervised Annotation Example. 5. Syntact

  18. Dicty_cDB: VFJ254 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available tsrcsrcitnpkssssftl**rirfnfhlwrlyql*ylhhq*m*lswrfmes*fi nksleatsl*cnqrtrk*r*cqihlfrskstflnwwk*lsihqlygcm...d Amino Acid sequence (All Frames) Frame A: ---drtqsnfiptkpcqsfs*srnrlqnr*ilcfqwfnfnltslhscsrcp*n*yhcf*f cqwma...af*fnyk*mdsi nhftis*srnlysnsnskynr*llfqtyqkm*crill*qrftq*nfrkfh*lm Frame B: ---TELN...l smdgnksm**vhhqpqeliiiytimkn*iqfspmaaipivvptppmnviilaiygvliyq qkfgsnislm*pkdqeieimpnsfipikinfs*lveviintptlw...0.0 1 ( AC116551 ) Dictyostelium discoideum chromosome 2 map complem... 1330 0.0 2 ( BJ431381 ) Dictyosteliu

  19. 24 CFR 92.254 - Qualification as affordable housing: Homeownership.

    Science.gov (United States)

    2010-04-01

    ... application under 24 CFR part 597 has incorporated the type of market data described above, that submission... unit subsidy amount established under § 92.250. Alternatively to charging the cost to the HOME program under § 92.206, the participating jurisdiction may charge the cost to the HOME program under § 92.207...

  20. 7 CFR 1710.254 - Alternative sources of power.

    Science.gov (United States)

    2010-01-01

    ... service, the short-term and long-term financial viability of the supplier, and the financial risk to the... facilities are set forth in 7 CFR part 1712. (h) At the request of a borrower, RUS, in its sole...

  1. Dicty_cDB: SSI254 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 2_F NXLV (Nsf Xylem Late wood Vertical) Pinus taeda cDNA clone NXLV130_B02 5', mRNA sequence. 36 1.2 2 CD018...464 |CD018464.1 NXLV_028_H10_F NXLV (Nsf Xylem Late wood Vertical) Pinus taeda cD

  2. 24 CFR 221.254 - Mortgage insurance premiums.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Mortgage insurance premiums. 221... HOUSING AND URBAN DEVELOPMENT MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES LOW COST AND MODERATE INCOME MORTGAGE INSURANCE-SAVINGS CLAUSE Contract Rights and...

  3. 24 CFR 236.254 - Termination of mortgage insurance.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Termination of mortgage insurance... HOUSING AND URBAN DEVELOPMENT MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES MORTGAGE INSURANCE AND INTEREST REDUCTION PAYMENT FOR RENTAL PROJECTS Contract Rights...

  4. Editorial [Malta Medical Journal, Vol.25(4)

    OpenAIRE

    Grech, Victor E.; Borg-Buontempo, Mariella

    2013-01-01

    The Merit Award Scheme was launched in November 2007 by the Malta Government with the intention of rewarding good practice. This is accordance with the Government-Medical Association of Malta agreement which “recognizes the need for specialists to keep abreast of the rapid progress made in the various fields of medical and health specialization and the effort it takes for such specialists to keep themselves abreast of developments, to improve professional standards and to provide quality assu...

  5. Dicty_cDB: CHN254 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available |CK808839.1 Rasgsc1686 Salivary Gland 4th instar 3rd period (spinning cocoon) Rhynchosciara americana cDNA, ...mRNA sequence. 34 4e-05 4 CK808739 |CK808739.1 Rasgsc1529 Salivary Gland 4th instar 3rd period (spinning...-04 2 CK808037 |CK808037.1 Rasgsc0316 Salivary Gland 4th instar 3rd period (spinning cocoon) Rhynchosciara a

  6. Dicty_cDB: SHK254 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available mplete sequence. 62 4e-05 1 CK808839 |CK808839.1 Rasgsc1686 Salivary Gland 4th instar 3rd period (spinning....1 Rasgsc1529 Salivary Gland 4th instar 3rd period (spinning cocoon) Rhynchosciara americana cDNA, mRNA sequ... discoideum, Genomic, 1918 nt]. 58 6e-04 1 CK808037 |CK808037.1 Rasgsc0316 Salivary Gland 4th instar 3rd period (spinning

  7. Dicty_cDB: AFI254 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available he genetic engineering technology. 86 9e-13 1 CD645756 |CD645756.1 SSPG103 SS pec..., gene of said catalase and composition containing said catalase, and process for preparing catalase using t

  8. Fission dynamics study in 243Am and 254Fm

    Science.gov (United States)

    Banerjee, K.; Ghosh, T. K.; Roy, P.; Bhattacharya, S.; Chaudhuri, A.; Bhattacharya, C.; Pandey, R.; Kundu, S.; Mukherjee, G.; Rana, T. K.; Meena, J. K.; Mohanto, G.; Dubey, R.; Saneesh, N.; Sugathan, P.; Guin, R.; Das, S.; Bhattacharya, P.

    2016-06-01

    Fission fragment mass distributions in the reactions 11B + 232Th and 11B + 243Am were measured in an energy range around the barrier. No sudden change in the width of the mass distribution as a function of center-of-mass energy was observed at near-barrier energies, indicating no quasifission transition in the near-barrier energies. Interestingly, the previous measurements of fission fragment angular anisotropies for the same systems showed significant departure from the statistical saddle-point model predictions at near-barrier energies, indicating the presence of nonequilibrium fission processes.

  9. 36 CFR 254.20 - Purpose and scope.

    Science.gov (United States)

    2010-07-01

    ..., needed by a community, may be sold under the Townsite Act, for fair market value if those lands would serve indigenous community objectives that outweigh the public objectives and values of retaining the... service industries, expansion of existing economic enterprises, new industries utilizing local...

  10. 山东临沂市254名农村婴幼儿血清视黄醇和类胡萝卜素水平及其与相关膳食因素的关系%Serum retinol and carotenoid of rural infants and young children in Linyi of Shangdong Province and analysis on their related influencing dietary factors

    Institute of Scientific and Technical Information of China (English)

    范萍; 沈遥; 李永华; 马爱勤; 孙忠清; 汪之顼

    2012-01-01

    目的 为了解农村婴幼儿血清维生素A(VA)营养状况和血清类胡萝卜素水平,以及两者关系和相关影响因素而开展本研究.方法 采用整群抽样方法,对山东省临沂市某镇辖区内254名6~24月龄健康婴幼儿进行健康体检和喂养状况调查.采集足背静脉血样,用高效液相色谱法测定血清视黄醇和β-胡萝卜素、α-胡萝卜素、β-隐黄素及叶黄素+玉米黄素含量.用膳食频率法回顾性调查婴幼儿最近一个月内的各类食物摄入状况,分析喂养状况与血清视黄醇和类胡萝卜素水平的关系.结果 被调查婴幼儿血清视黄醇浓度平均为(0.96±0.55)μmol/L,不同月龄段间没有明显差异(P>0.05);血清VA缺乏率为40.6%,边缘性VA缺乏率为32.6%.血清β-胡萝卜素、α-胡萝卜素、β-隐黄素和叶黄素+玉米黄素浓度的平均值分别为(0.056±0.088) μmol/L、(3.3±12.1) nmol/L、(27.0±45.2) nmol/L和(0.22±0.22) μmol/L.不同月龄段儿童血清叶黄素+玉米黄素浓度存在差异(P<0.05),13 ~18月龄段低于6~12月龄儿童.母乳喂养和配方奶粉是影响婴幼儿血清视黄醇和β-胡萝卜素水平的主要因素.母乳喂养频率与β-胡萝卜素水平呈负相关(P<0.05),而配方粉喂养频率与血清视黄醇和除α-胡萝卜素以外的类胡萝卜素水平呈正相关(均为P<0.05);水果蔬菜喂养频率则只与血清β-胡萝卜素、α-胡萝卜素和β-隐黄素浓度呈正相关.血清视黄醇与类胡萝卜素各组分,以及类胡萝卜素各组分之间,具有显著正相关关系(均为P <0.001).结论 调查的农村婴幼儿血清VA营养状况较差,血清β-胡萝卜素、α-胡萝卜素、β-隐黄素及叶黄素+玉米黄素浓度与母乳、配方奶粉、水果蔬菜添加等喂养状况关系密切.%Objective The study was carried out to determine serum retinol and carotenoid of infants and young children in rural areas, and to explore their related

  11. The determination of americium, curium and californium in biological samples by combined solvent extraction-liquid scintillation counting

    International Nuclear Information System (INIS)

    A method has been developed to extract Am, Cm and Cf from ashed biological samples dissolved in 8 M LiN03-10-2 M HN03 into a liquid/scintillation cocktail. This new method reduces tissue and instrument background and allows use of a larger sample for analysis than when using a commercial gelling cocktail. The extractant cocktail is 20% N,N,N-trioctyl-N-methylammonium chloride dissolved in toluene containing the scintillators p-terphenyl and 1,4-bis-2-(5-phenyl-oxazolyl)-benzene. Several different types of biological samples were analyzed and radionuclide recoveries greater than 90% were obtained in all cases. (author)

  12. Raman and absorption spectrophotometric studies of selected lanthanide, californium-doped lanthanide, and actinide trihalides in the solid state

    International Nuclear Information System (INIS)

    The solid-state absorption spectra of Cf(III) ions as a dopant in lanthanide trihalide hosts (LnCl3: Ln = Ce, Sm, and Y; LnBr3: Ln = Ce, Sm, Tb, and Y; LnI3: Ln = Ce and Y) have been recorded. The spectra of Cf(III) have been correlated with the various crystal structures. The phonon Raman spectra and solid-state absorption spectra of PmF3, PmCl3, PmBr3, and two crystal modifications of PmI3 have been recorded. Symmetry assignments have been made for the Raman-active bands for these trihalides and also the sesquioxide. The room-temperature absorption spectra have been correlated to crystal field effects. The symmetry assignments of the Raman-active phonon modes have been made based on polarized Raman spectra from single crystals of YF3-type orthorhombic TbF3 and PuBr3-type orthorhombic NdBr3. Raman spectra of other isostructural lanthanide compounds have been recorded and compared. Symmetry assignments for these compounds have been made by analogy to the single-crystal assignments. Raman spectra have been obtained and catalogued for a number of actinide compounds. Symmetry assignments have been made for the observed Raman-active phonon bands in this work based on the assignments made for isostructural lanthanide compounds. 29 figs., 22 tabs

  13. Optical Transitions in Highly Charged Californium Ions with High Sensitivity to Variation of the Fine-Structure Constant

    Science.gov (United States)

    Berengut, J. C.; Dzuba, V. A.; Flambaum, V. V.; Ong, A.

    2012-08-01

    We study electronic transitions in highly charged Cf ions that are within the frequency range of optical lasers and have very high sensitivity to potential variations in the fine-structure constant, α. The transitions are in the optical range despite the large ionization energies because they lie on the level crossing of the 5f and 6p valence orbitals in the thallium isoelectronic sequence. Cf16+ is a particularly rich ion, having several narrow lines with properties that minimize certain systematic effects. Cf16+ has very large nuclear charge and large ionization energy, resulting in the largest α sensitivity seen in atomic systems. The lines include positive and negative shifters.

  14. Optical transitions in highly-charged californium ions with high sensitivity to variation of the fine-structure constant

    CERN Document Server

    Berengut, J C; Flambaum, V V; Ong, A

    2012-01-01

    We study electronic transitions in highly-charged Cf ions that are within the frequency range of optical lasers and have very high sensitivity to potential variations in the fine-structure constant, alpha. The transitions are in the optical despite the large ionisation energies because they lie on the level-crossing of the 5f and 6p valence orbitals in the thallium isoelectronic sequence. Cf16+ is a particularly rich ion, having several narrow lines with properties that minimize certain systematic effects. Cf16+ has very large nuclear charge and large ionisation energy, resulting in the largest alpha-sensitivity seen in atomic systems. The lines include positive and negative shifters.

  15. AN INTEGRAL REACTOR PHYSICS EXPERIMENT TO INFER ACTINIDE CAPTURE CROSS-SECTIONS FROM THORIUM TO CALIFORNIUM WITH ACCELERATOR MASS SPECTROMETRY

    International Nuclear Information System (INIS)

    The principle of the proposed experiment is to irradiate very pure actinide samples in the Advanced Test Reactor (ATR) at INL and, after a given time, determine the amount of the different transmutation products. The determination of the nuclide densities before and after neutron irradiation will allow inference of effective neutron capture cross-sections. This approach has been used in the past and the novelty of this experiment is that the atom densities of the different transmutation products will be determined using the Accelerator Mass Spectroscopy (AMS) technique at the ATLAS facility located at ANL. It is currently planned to irradiate the following isotopes: 232Th, 235U, 236U, 238U, 237Np, 238Pu, 239Pu, 240Pu, 241Pu, 242Pu, 241Am, 243Am and 248Cm.

  16. Integral range, energy, residual range, and linear energy transfer distributions for Californium fission fragments in microelectronics materials

    International Nuclear Information System (INIS)

    This report discusses the advantages and limitations of using Cf-252 radiation sources for single event testing of microelectronics for space environments. Integral distributions for the range, energy, residual range, and linear energy transfer of Cf-252 fission fragments in absorber and microelectronic materials have been calculated. Techniques are suggested for determining when single event testing using Cf-252 is appropriate; also, techniques are given for estimating the saturation cross section and thresh old linear energy transfer from test data. 10 refs., 25 figs., 2 tabs

  17. Research and experimental work at Groote Schuur Hospital and the University of Cape Town using californium-252 sources

    International Nuclear Information System (INIS)

    Experiments have been undertaken to determine the high-LET and low-LET components of the absorbed dose from neutron beams. This is achieved by measuring the fluxes of the high-LET and low-LET radiations in a tissue-equivalent phantom individually and simultaneously using a scintillation probe fitted with a pulse shape discriminator. This system was successfully used with a 22 MeV neutron beam from the T(d,n) reaction and has been employed with 252Cf sources. Results obtained in the low-energy ranges (up to 3 MeV) indicate that the electron counts exceed the high-LET counts by a factor of 2 to 3. These results are related to the absorbed dose. Calculations have also been undertaken to establish whether the Paterson-Parker system could be used for the design of 252Cf treatments and the optimum needle activities to yield the desired dose. Experiments are under way to determine the variation of RBE and OER for 252Cf radiations around the source. The inhibition of root growth in Vicia Faba is being used to determine any such effects. Dose rates comparable to that employed in interstitial radiotherapy are being aimed at. A study of dose fractionation effects is also being undertaken. (author)

  18. К ВОПРОСУ О ПРЕДМЕТЕ ПРЕСТУПЛЕНИЯ, ПРЕДУСМОТРЕННОГО СТ. 254 УК «ПОРЧА ЗЕМЛИ»

    OpenAIRE

    Клочкова, Анна

    2009-01-01

    Являясь важнейший компонентом природы, земля это и одно из средств существования человека. Становится очевидным, что земля как природный объект нуждается в серьезной защите, в том числе и уголовно-правовой, где немаловажную роль играет Уголовный кодекс РФ. Соответственно, такое преступление, как «Порча земли», предусмотренное ст. 254 УК РФ, требует правильной квалификации на практике. А правильная квалификация невозможна без анализа и уяснения смысла понятий, изложенных в статье. В работе исс...

  19. Civic Education and Peacebuilding: Examples from Iraq and Sudan. Special Report 254

    Science.gov (United States)

    Levine, Daniel H.; Bishai, Linda S.

    2010-01-01

    Between 2006 and 2010, the United States Institute of Peace developed several civic education programs for Iraq and Sudan as part of broader efforts to promote postconflict stability and development and help prevent a return to violence. This report describes those programs after first examining the conceptual bases for civic education and how…

  20. Textural parameters distribution in sediments surface of the Uruguay river background between km 221 and 254

    International Nuclear Information System (INIS)

    The aim of this paper is to analyze the distribution of textural statistical parameters and spatial variation in the morphology of the sediment areas. The geology of the area comprises alluvial and alluvial deposits of variable thicknesses overlying deposits of Fray Bent os, Salto and Guichon formations that occasionally emerge in the river bed

  1. Nuclear Structure Measurements of Fermium-254 and Advances in Target Production Methodologies

    OpenAIRE

    Gothe, Oliver Ralf

    2014-01-01

    The Berkeley Gas-filled Separator (BGS) has been upgraded with a new gas control system. It allows for accurate control of hydrogen and helium gas mixtures. This greatly increases the capabilities of the separator by reducing background signals in the focal plane detector for asymmetric nuclear reactions. It has also been shown that gas mixtures can be used to focus the desired reaction products into a smaller area, thereby increasing the experimental efficiency.A new electrodeposition cell h...

  2. Determination of mercury species by using of AMA 254 and HPLC-ICP-MS

    International Nuclear Information System (INIS)

    Complete text of publication follows. To map the exposure of the Czech population with mercury, especially methylmercury (MeHg) has been started on the request of the Czech Science Committee for Foodstuffs. For this purpose, hair has been chosen as a suitable biomarker for MeHg exposure in human because concentration of this mercury specie once bonded in hair is stable. The procedure was based on the verified analytical method described previously. Various factors (sampling procedure, storage conditions, and sources of contamination) were studied using 203Hg radiotracer. It has been found that whole procedure ought to be strictly under control. The verification of the analytical method included all steps of procedure (cleaning of utensils, calibration, yield of the separation step, etc). The repeatability, internal reproducibility, distance from the scalp and other parameters were tested on control samples, the accuracy was proved by using a control reference material. The results confirmed the suitability of the method, which ought to be further used for different studies including biological monitoring. In the second part of this work a possibility of the determination of mercury species in fish tissue has been studied. HPLC technique coupled with ICP MS led to the development of the method for the determination of mercury species in biological materials. Liquid extraction of mercury by 2-mercaptoethanol was followed by separation of mercury species on reversed phase HPLC (column Spheri RP18 220 x 4,6 mm x 10 μm, Perkin Elmer) connected to ICP MS (Perkin Elmer Sciex Elan DRC-e). The method was validated by analysis of certified reference materials with declared concentration of mercury and MeHg. Results confirmed the suitability of proposed method.

  3. People and things. CERN Courier, May 1985, v. 25(4)

    International Nuclear Information System (INIS)

    The article reports on achievements of various people, staff changes and position opportunities within the CERN organization and contains news updates on upcoming or past events. A workshop is being arranged to discuss the potential of the CERN SPS proton-antiproton Collider for the early 90s in view of the then simultaneous operation of the Tevatron at Fermilab, LEP at CERN and HERA at DESY, and to evaluate the need for a new Collider detector

  4. TASK 2.5.4 DEVELOPMENT OF AN ENERGY SAVINGS CALCULATOR

    Energy Technology Data Exchange (ETDEWEB)

    Miller, William A [ORNL; New, Joshua Ryan [ORNL; Desjarlais, Andre Omer [ORNL; Huang, Joe [Lawrence Berkeley National Laboratory (LBNL); Erdem, Ender [Lawrence Berkeley National Laboratory (LBNL); Ronnen, Levinson [Lawrence Berkeley National Laboratory (LBNL)

    2010-03-01

    California s major energy utilities and the California Energy Commission (CEC) are seeking to allocate capital that yields the greatest return on investment for energy infrastructure that meets any part of the need for reliable supplies of energy. The utilities are keenly interested in knowing the amount of electrical energy savings that would occur if cool roof color materials are adopted in the building market. To meet this need the Oak Ridge National Laboratory and the Lawrence Berkeley National Laboratory (LBNL) have been collaborating on a Public Interest Energy Research (PIER) project to develop an industry-consensus energy-savings calculator. The task was coordinated with an ongoing effort supported by the DOE to develop one calculator to achieve both the DOE and the EPA objectives for deployment of cool roof products. Recent emphasis on domestic building energy use has made the work a top priority by the Department of Energy s (DOE) Building Technologies Program. The Roof Savings Calculator (RSC) tool is designed to help building owners, manufacturers, distributors, contractors and practitioners easily run complex simulations. The latest web technologies and usability design were employed to provide an easy input interface to an annual simulation of hour-by-hour, whole-building performance using the world-class simulation tools DOE-2.1E and AtticSim. Building defaults were assigned based on the best available statistical evidence and can provide energy and cost savings after the user selects nothing more than the building location. A key goal for the tool is to promote the energy benefits of cool color tile, metal and asphalt shingle roof products and other energy saving systems. The RSC tool focuses on applications for the roof and attic; however, the code conducts a whole building simulation that puts the energy and heat flows of the roof and attic into the perspective of the whole house. An annual simulation runs in about 30 sec. In addition to cool reflective roofs, the RSC tool will simulate high- medium- and low-slope roofs, and has a custom selection for the user whose house has a unique inclination. There is an option for above sheathing ventilation, which is prevalent in tile and stone-coated metal roof assemblies. The tool also accommodates the effects of radiant barriers and low-emittance surfaces in the inclined air space above the sheathing. The practitioner can select to have air-conditioning ducts either in the conditioned space or in the attic. If in the attic, the user can select one of three air leakage options. Option 1 is an inspected duct having 4% leakage and code level of duct insulation; option 2 is a poorly insulated duct having 14% air leakage; and option 3 is a custom leakage rate specified by the user. The practitioner can setup multiple layers of ceiling insulation. AtticSim is benchmarked against the field data acquired for Ft. Irwin located near Barstow, CA, first as a standalone simulation program and then again integrated within the DOE-2.1E program. The standalone benchmark was very useful to determining how well AtticSim replicates the building physics of an attic. The coupled benchmark was useful to verify that the DOE-2.1E/AtticSim code is modeling correctly the dynamic relationship between the attic and the occupied space below, as well as the interactions between the attic and the HVAC system, in particular when the ducts are located in the attic.

  5. Kuue kuuga on EAS toetanud uusi ideid 2,54 miljardi krooniga / Ülari Alamets

    Index Scriptorium Estoniae

    Alamets, Ülari, 1967-

    2009-01-01

    Ettevõtluse Arendamise Sihtasutus on enam arendanud tehnoloogia arenduskeskuseid, ettevõtete tootearendusprojekte, investeeringuid külakeskkonda ning kohalike avalike teenuste arendamist. Lisa: Põlvamaa suuremad projektid

  6. X-ray Emission from the Taffy (VV254) Galaxies and Bridge

    CERN Document Server

    Appleton, Philip; Bitsakis, Theodoros; Wang, Junfeng; Peterson, Bradley; Lisenfeld, Ute; Alatalo, Katherine; Guillard, Pierre; Boulanger, Francois; Cluver, Michelle; Gao, Yu; Helou, George; Ogle, Patrick; Struck, Curtis

    2015-01-01

    We present the first X-ray observations of the Taffy galaxies (UGC 12914/5) with the Chandra observatory, and detect soft X-ray emission in the region of the gas-rich, radio-continuum-emitting Taffy bridge. The results are compared to Herschel observations of dust and diffuse [CII] line-emitting gas. The diffuse component of the Taffy bridge has an X-ray luminosity of L(X) (0.5-8keV) =5.4 x 10^39 erg s^-1, which accounts for 19% of the luminosity of the sum for the two galaxies. The total mass in hot gas is (0.8--1.3) x 10^8 M_sun, which is approximately 1% of the total (HI~+~H2) gas mass in the bridge, and ~11% of the mass of warm molecular hydrogen discovered by Spitzer. The soft X-ray and dense CO-emitting gas in the bridge have offset distributions, with the X-rays peaking along the north-western side of the bridge in the region where stronger far-IR dust and diffuse [CII] gas is observed by Herschel. We detect nine Ultra Luminous X-ray sources (ULXs) in the system, the brightest of which is found in the ...

  7. 40 CFR 421.254 - Standards of performance for new sources.

    Science.gov (United States)

    2010-07-01

    ... cooling water. NSPS for the Primary Precious Metals and Mercury Subcategory Pollutant or pollutant... the range of 7.5 to 10.0 at all times. (i) Mercury cleaning bath water. NSPS for the Primary Precious... pollution control. NSPS for the Primary Precious Metals and Mercury Subcategory Pollutant or...

  8. Sterilization effect of 254 nm UV-C irradiation against cynaobacteria Microcystis aeruginosa

    Science.gov (United States)

    Harmful algal bloom (HAB) produced by several cyanobacterial species is a significant threat to many aquatic ecosystems around the world. Recently frequent occurrence of serious algal bloom in Lake Taihu, Lake Dianchi, and Lake Chaohu has become a serious concern in China. Although various methods a...

  9. Virulence of Listeria monocytogenes following repeated exposure to Ultraviolet (254nm) Light

    Science.gov (United States)

    The foodborne pathogen Listeria monocytogenes is an occasional contaminant of ready-to-eat meat products such as frankfurters. Frankfurters can be contaminated following cooking and prior to packaging by contact with contaminated surfaces such as conveyors and packaging equipment. Ultraviolet Ligh...

  10. Yeast Interacting Proteins Database: YGL154C, YGL254W [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available YGL154C LYS5 Phosphopantetheinyl transferase involved in lysine biosynthesis; converts inactive ... target is SSU1, overexpression suppresses sulfite-sensitivity ... of many unrelated mutants due to hyperactivation o ... target is SSU1, overexpression suppresses sulfite-sensitivity ... of many unrelated mutants due to hyperactivation o ...

  11. tert-Butyl 2-{[5-(4-cyanophenylpyridin-3-yl]sulfonyl}acetate

    Directory of Open Access Journals (Sweden)

    H. C. Devarajegowda

    2014-04-01

    Full Text Available In the title compound, C18H18N2O4S, the dihedral angle between the aromatic rings is 33.71 (9° and an intramolecular C—H...O hydrogen bond closes an S(6 ring. In the crystal, molecules are linked by C—H...O and C—H...N hydrogen bonds to generate a three-dimensional network. A very weak aromatic π–π stacking interction is also observed [centroid–centroid separation = 3.9524 (10 Å].

  12. Accurate determination of Curium and Californium isotopic ratios by inductively coupled plasma quadrupole mass spectrometry (ICP-QMS) in 248Cm samples for transmutation studies

    International Nuclear Information System (INIS)

    The French Atomic Energy Commission has carried out several experiments including the mini-INCA (INcineration of Actinides) project for the study of minor-actinide transmutation processes in high intensity thermal neutron fluxes, in view of proposing solutions to reduce the radiotoxicity of long-lived nuclear wastes. In this context, a Cm sample enriched in 248Cm (∼97 %) was irradiated in thermal neutron flux at the High Flux Reactor (HFR) of the Laue-Langevin Institute (ILL). This work describes a quadrupole ICP-MS (ICP-QMS) analytical procedure for precise and accurate isotopic composition determination of Cm before sample irradiation and of Cm and Cf after sample irradiation. The factors that affect the accuracy and reproducibility of isotopic ratio measurements by ICP-QMS, such as peak centre correction, detector dead time, mass bias, abundance sensitivity and hydrides formation, instrumental background, and memory blank were carefully evaluated and corrected. Uncertainties of the isotopic ratios, taking into account internal precision of isotope ratio measurements, peak tailing, and hydrides formations ranged from 0.3% to 1.3%. This uncertainties range is quite acceptable for the nuclear data to be used in transmutation studies.

  13. MANTRA: An Integral Reactor Physics Experiment to Infer Actinide Capture Cross-sections from Thorium to Californium with Accelerator Mass Spectrometry

    Energy Technology Data Exchange (ETDEWEB)

    G. Youinou; C. McGrath; G. Imel; M. Paul; R. Pardo; F. Kondev; M. Salvatores; G. Palmiotti

    2011-08-01

    The principle of the proposed experiment is to irradiate very pure actinide samples in the Advanced Test Reactor at INL and, after a given time, determine the amount of the different transmutation products. The determination of the nuclide densities before and after neutron irradiation will allow inference of effective neutron capture cross-sections. This approach has been used in the past and the novelty of this experiment is that the atom densities of the different transmutation products will be determined using the Accelerator Mass Spectrometry technique at the ATLAS facility located at ANL. It is currently planned to irradiate the following isotopes: 232Th, 235U, 236U, 238U, 237Np, 238Pu, 239Pu, 240Pu, 241Pu, 242Pu, 241Am, 243Am, 244Cm and 248Cm.

  14. Radiological Characterization Technical Report on Californium-252 Sealed Source Transuranic Debris Waste for the Off-Site Source Recovery Project at Los Alamos National Laboratory

    Energy Technology Data Exchange (ETDEWEB)

    Feldman, Alexander [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2014-04-24

    This document describes the development and approach for the radiological characterization of Cf-252 sealed sources for shipment to the Waste Isolation Pilot Plant. The report combines information on the nuclear material content of each individual source (mass or activity and date of manufacture) with information and data on the radionuclide distributions within the originating nuclear material. This approach allows for complete and accurate characterization of the waste container without the need to take additional measurements. The radionuclide uncertainties, developed from acceptable knowledge (AK) information regarding the source material, are applied to the summed activities in the drum. The AK information used in the characterization of Cf-252 sealed sources has been qualified by the peer review process, which has been reviewed and accepted by the Environmental Protection Agency.

  15. The development and medical applications of a simple facility for partial body in vivo neutron activation analysis using californium-252 sources

    International Nuclear Information System (INIS)

    A simple and cheap facility for partial body neutron activation analysis has been designed, based on the use of two 100 μg 252Cf neutron sources. The results reported show that calcium can be measured in parts of the body such as the tibia with a precision as good as +- 1.6 % for a radiation dose of 2 rem. The uniformity of the thermal neutron flux density is better than +- 3 % over 10 cm. Some applications of this irradiation facility for studies of trace elements, in particular cadmium in liver and aluminium in liver or brain, have also been explored. However, the sensitivity attainable is not yet sufficient for the study of normal levels, but could be of interest in toxicological investigations

  16. Accurate determination of Curium and Californium isotopic ratios by inductively coupled plasma quadrupole mass spectrometry (ICP-QMS) in Cm-248 samples for transmutation studies

    International Nuclear Information System (INIS)

    The French Atomic Energy Commission has carried out several experiments including the mini-INCA (Incineration of Actinides) project for the study of minor-actinide transmutation processes in high intensity thermal neutron fluxes, in view of proposing solutions to reduce the radiotoxicity of long-lived nuclear wastes. In this context, a Cm sample enriched in 248Cm (similar to 97%) was irradiated in thermal neutron flux at the High Flux Reactor (HFR) of the Laue-Langevin Institute (ILL). This work describes a quadrupole ICP-MS (ICP-QMS) analytical procedure for precise and accurate isotopic composition determination of Cm before sample irradiation and of Cm and Cf after sample irradiation. The factors that affect the accuracy and reproducibility of isotopic ratio measurements by ICP-QMS, such as peak centre correction, detector dead time, mass bias, abundance sensitivity and hydrides formation, instrumental background, and memory blank were carefully evaluated and corrected. Uncertainties of the isotopic ratios, taking into account internal precision of isotope ratio measurements, peak tailing, and hydrides' formations ranged from 0. 3% to 1. 3%. This uncertainties' range is quite acceptable for the nuclear data to be used in transmutation studies. (authors)

  17. MANTRA: An Integral Reactor Physics Experiment to Infer Actinide Capture Cross-sections from Thorium to Californium with Accelerator Mass Spectrometry

    International Nuclear Information System (INIS)

    The principle of the proposed experiment is to irradiate very pure actinide samples in the Advanced Test Reactor at INL and, after a given time, determine the amount of the different transmutation products. The determination of the nuclide densities before and after neutron irradiation will allow inference of effective neutron capture cross-sections. This approach has been used in the past and the novelty of this experiment is that the atom densities of the different transmutation products will be determined using the Accelerator Mass Spectrometry technique at the ATLAS facility located at ANL. It is currently planned to irradiate the following isotopes: 232Th, 235U, 236U, 238U, 237Np, 238Pu, 239Pu, 240Pu, 241Pu, 242Pu, 241Am, 243Am, 244Cm and 248Cm.

  18. SU-E-J-254: Utility of Pinnacle Dynamic Planning Module Utilizing Deformable Image Registration in Adaptive Radiotherapy

    International Nuclear Information System (INIS)

    Purpose For certain highly conformal treatment techniques, changes in patient anatomy due to weight loss and/or tumor shrinkage can result in significant changes in dose distribution. Recently, the Pinnacle treatment planning system added a Dynamic Planning module utilizing Deformable Image Registration (DIR). The objective of this study was to evaluate the effectiveness of this software in adapting to altered anatomy and adjusting treatment plans to account for it. Methods We simulated significant tumor response by changing patient thickness and altered chin positions using a commercially-available head and neck (H and N) phantom. In addition, we studied 23 CT image sets of fifteen (15) patients with H and N tumors and eight (8) patients with prostate cancer. In each case, we applied deformable image registration through Dynamic Planning module of our Pinnacle Treatment Planning System. The dose distribution of the original CT image set was compared to the newly computed dose without altering any treatment parameter. Result was a dose if we did not adjust the plan to reflect anatomical changes. Results For the H and N phantom, a tumor response of up to 3.5 cm was correctly deformed by the Pinnacle Dynamic module. Recomputed isodose contours on new anatomies were within 1 mm of the expected distribution. The Pinnacle system configuration allowed dose computations resulting from original plans on new anatomies without leaving the planning system. Original and new doses were available side-by-side with both CT image sets. Based on DIR, about 75% of H and N patients (11/15) required a re-plan using new anatomy. Among prostate patients, the DIR predicted near-correct bladder volume in 62% of the patients (5/8). Conclusions The Dynamic Planning module of the Pinnacle system proved to be an accurate and useful tool in our ability to adapt to changes in patient anatomy during a course of radiotherapy

  19. The dose-response-relation of erythema of the domestic pig induced by UVC-radiation (254 nm)

    International Nuclear Information System (INIS)

    For domestic pigs the time-course and the dose-response-relationship of erythemal effective UVC-radiation was investigated. By the chromameter CR 300 (Minolta) the redness of the skin was measured, using the international L*a*b*-system. As UVC-source a germicidal lamp (TUV, Philips) was housed in a tube. The irradiance of the 10 zylindric holes were attenuated by a wire mash, changing the intensity along a logarithmic decrement. For the experiment 10 pigs were used. Each pig could be irradiated with 40 dose-steps. The redness of the marked skin-areas was not only determined once before the irradiation but also several times within 36 hours. The reaction of the skin of the pigs to UVC-radiation was different to human's. The time-course of the UVC-erythema was biphasical. The second erythema-maximum could not be explained by the pigmentation, which had just begun, but by an new increase of the reddening of the skin. No dose-response-correlation like the human's UVC-erythema could be detected. Therefore, the domestic pig can not be used as a human's photo-biological model for UVC. (author)

  20. Sweig E. Julia, Inside The Cuban Revolution, Cambridge, Massachusetts, London, England, Harvard University Press, 2002, 254 p.

    OpenAIRE

    Burgos, Elizabeth

    2005-01-01

    Sin duda se trata de un hito en la historiografía de la revolución cubana. Primeramente por tratarse de la primera investigación rigurosa sobre el periodo previo a la revolución, y por que la autora - y en ello se debe poner  énfasis -, contó con el raro privilegio de consultar los archivos oficiales cubanos, lo que le agrega a la calidad académica que de por sí ya tiene la obra, un  valor adicional. Disponer de fuentes de primera mano, - cartas, documentos emitidos por los diferentes actores...

  1. Stanovení rtuti a methylrtuti ve vlasech pomocí AMA 254 a radioindikátorovou metodou

    Czech Academy of Sciences Publication Activity Database

    Čejchanová, M.; Wranová, K.; Spěváčková, V.; Korunová, Vlasta; Vobecký, Miloslav

    Lednice : Spektroskopická společnost Jana Marka Marci, 2007. s. 90. ISBN 80-903732-2-4. [Spektroskopická konference /13./. 18.06.2007-21.06.2007, Lednice] R&D Projects: GA MZd NR8955 Institutional research plan: CEZ:AV0Z40310501 Keywords : methylmercury * inorganic mercury * hair Subject RIV: CB - Analytical Chemistry, Separation

  2. Mercury determination in whole blood: Containers and stability study with radio-indicator and AMA 254 AAS

    Czech Academy of Sciences Publication Activity Database

    Korunová, Vlasta; Vobecký, Miloslav; Spěváčková, V.; Čejchanová, M.

    Zaragoza : GEAS, Dept. Anal. Chem., Faculty of Sciences, Univ. Zaragoza, 2003, s. 51. [Colloquium Spectroscopicum Internationale Presymposium on Sample Introduction in Atomic Spectrometry: New Strategies /33./. Zaragoza (ES), 03.09.2003-06.09.2003] R&D Projects: GA ČR GA203/01/0453 Institutional research plan: CEZ:AV0Z4031919 Keywords : Mercury * blood stability Subject RIV: CB - Analytical Chemistry, Separation

  3. The Development of Project Information Packages for Effective Approaches in Compensatory Education. Final Report. Report No. UR-254.

    Science.gov (United States)

    Tallmadge, G. Kasten

    The project described herein represents an attempt by the U. S. Office of Education to take a more active role in the national dissemination and replication of those programs which have achieved the greatest success in producing reliably measured achievement benefits in reading and mathematical skills. With this general objective in mind, the U.…

  4. No 2965, No 254. Report on new energy technologies and carbon dioxide sequestration: scientifical and technical aspects

    International Nuclear Information System (INIS)

    The abatement of CO2 emissions is a huge technical and economical challenge. Fossil fuels, which represent 88% of the world primary energy consumption, are the main source of the 25 billions of CO2 released each year in the atmosphere. The mastery of CO2 emissions cannot come from a single technology but must result from the simultaneous implementation of several means, like the development of carbon-free energies and the mastery of fossil fuel emissions. The opportunities of progress are numerous and compatible with the economic development. This document presents, first, the different greenhouse gases, the CO2 emissions per country and the main sources of CO2 emissions (power and heat generation, transports). Then it presents different ways of abatement of CO2 emissions: clean coal technologies, gas combined cycles, CO2 sequestration, reduction of fuel consumption in transports, development of carbon-free energies: wind power, solar photovoltaic for decentralized power generation, nuclear energy for a competitive power generation and for CO2 abatement, biofuels of 2. generation and fuel cells. The conclusion stresses on the investments needed for the renewal and increase of energy capacities, and on the necessary visibility and moderation of emission abatement mechanisms (carbon trading and CO2 prices). (J.S.)

  5. Freeze drying method for preparing radiation source material

    International Nuclear Information System (INIS)

    Fabrication of a neutron source is specifically claimed. A palladium/californium solution is freeze dried to form a powder which, through conventional powder metallurgy, is shaped into a source containing the californium evenly distributed through a palladium metal matrix. (E.C.B.)

  6. Review of RBE and OER values for Cf-neutrons

    International Nuclear Information System (INIS)

    Californium-252, an isotope emitting neutrons, gamma photons and alpha particles, is being investigated for its practical use in intracavitary and interstitial brachytherapy. A review of published RBE and OER values for californium neutrons as a function of dose rate for a variety of biological endpoints is given. (Auth.)

  7. Nr 254 - Opinion on the behalf of the Commission of foreign affairs in the finance bill project for 2013 (nr 235), Volume 5 - ecology, sustainable development and planning

    International Nuclear Information System (INIS)

    After an introduction evoking the different parts of the finance bill project, its main programs and endowments, this report sets the associated national strategy within the context of the European and world agenda with respect to the protection of the environment, to climate change, and to international negotiations (Rio protocol, Durban conference, biodiversity). It outlines three main challenges: the international conference on climate of 2015 France has proposed to organize, the creation of European community on energy, and solving the current difficulties of the carbon trading scheme

  8. Comments to " Retrieval of source parameters of an event of the 2000 West Bohemia earthquake swarm assuming an anisotropic crust", Stud. geophys. geod., 51, 231-254

    Czech Academy of Sciences Publication Activity Database

    Rössler, D.; Krüger, F.; Pšenčík, Ivan; Rümpker, G.

    2008-01-01

    Roč. 52, č. 2 (2008), s. 285-286. ISSN 0039-3169 Institutional research plan: CEZ:AV0Z30120515 Keywords : West Bohemia * tensile faulting * seismic anisotropy * seismic source Subject RIV: DC - Siesmology, Volcanology, Earth Structure Impact factor: 0.770, year: 2008

  9. Speciace rtuti a methylrtuti v biologickém materiálu za použití AMA 254 a HPLC-ICP-MS

    Czech Academy of Sciences Publication Activity Database

    Wranová, K.; Spěváčková, V.; Kašparová, L.; Čejchanová, M.; Korunová, Vlasta

    2009. s. 13. [Workshop Speciační analýza. 22.06.2009-25.06.2009, Nová Olešná] Institutional research plan: CEZ:AV0Z40310501 Keywords : mercury speciation * fishes * hair Subject RIV: CB - Analytical Chemistry, Separation

  10. (E)-tert-Butyl 2-(5-{[4-(dimethylamino)phenyl]diazenyl}-2,6-dioxo-1H-pyrimid­in-3-yl)acetate dichloromethane monosolvate

    Science.gov (United States)

    Hudson, Robert H. E.; Moustafa, Mohamed E.; Boyle, Paul D.

    2014-01-01

    In the title compound, C18H23N5O4·CH2Cl2, the di­chloro­methane solvent mol­ecule is disordered over two sets of sites in a 0.630 (13):0.370 (13) ratio. The dihedral angle between the uracil and phenyl rings is 30.2 (1)°. In the crystal, the principal inter­actions are N—H⋯O hydrogen bonds, which link uracil units across centres of symmetry, forming eight-membered rings with an R 2 2(8) graph-set motif. The structure also displays C—H⋯O and C—H⋯Cl hydrogen bonds. Intra­molecular C—H⋯O short contacts are also observed. PMID:24860364

  11. Preliminary Data Analysis of a National Merged Database as Applied to Implementation of the School and Library Discount Matrix in Section 254 of the Telecommunications Act of 1996.

    Science.gov (United States)

    Missouri Univ., Columbia. Rural Policy Research Inst.

    This document aims to assist understanding of the Telecommunications Act of 1996 and to insure the implementation of a school discount methodology that is rational, equitable, and methodologically defensible. Based on a merged database containing data from 8,814 schools, 5,670,452 students, and 18 telecommunication companies in 7 states, this…

  12. N-(2-Chlorophenyl-2-({5-[4-(methylsulfanylbenzyl]-4-phenyl-4H-1,2,4-triazol-3-yl}sulfanylacetamide

    Directory of Open Access Journals (Sweden)

    Hoong-Kun Fun

    2011-08-01

    Full Text Available In the title molecule, C24H21ClN4OS2, the central 1,2,4-triazole ring forms dihedral angles of 89.05 (9, 86.66 (9 and 82.70 (10° with the chloro-substituted benzene ring, the methylsulfanyl-substituted benzene ring and the phenyl ring, respectively. In the crystal, molecules are linked into sheets parallel to (100 by intermolecular N—H...N and weak C—H...O hydrogen bonds.

  13. 48 CFR 215.403-1 - Prohibition on obtaining cost or pricing data (10 U.S.C. 2306a and 41 U.S.C. 254b).

    Science.gov (United States)

    2010-10-01

    ... METHODS AND CONTRACT TYPES CONTRACTING BY NEGOTIATION Contract Pricing 215.403-1 Prohibition on obtaining... clearly established on the basis of price analysis (see FAR 15.404-1(b)). (3) Commercial items. (A) Follow the procedures at PGI 215.403-1(c)(3)(A) for pricing commercial items. (B) By November 30th of...

  14. Collecting high-order interactions in an effective pairwise intermolecular potential using the hydrated ion concept: The hydration of Cf{sup 3+}

    Energy Technology Data Exchange (ETDEWEB)

    Galbis, Elsa; Pappalardo, Rafael R.; Marcos, Enrique Sánchez, E-mail: sanchez@us.es [Departmento de Química Física, Universidad de Sevilla, 41012 Seville (Spain); Hernández-Cobos, Jorge [Instituto de Ciencias Físicas, UNAM, Apartado Postal 48-3, 62251 Cuernavaca (Mexico)

    2014-06-07

    This work proposes a new methodology to build interaction potentials between a highly charged metal cation and water molecules. These potentials, which can be used in classical computer simulations, have been fitted to reproduce quantum mechanical interaction energies (MP2 and BP86) for a wide range of [M(H{sub 2}O){sub n}]{sup m+}(H{sub 2}O){sub ℓ} clusters (n going from 6 to 10 and ℓ from 0 to 18). A flexible and polarizable water shell model (Mobile Charge Density of Harmonic Oscillator) has been coupled to the cation-water potential. The simultaneous consideration of poly-hydrated clusters and the polarizability of the interacting particles allows the inclusion of the most important many-body effects in the new polarizable potential. Applications have been centered on the californium, Cf(III) the heaviest actinoid experimentally studied in solution. Two different strategies to select a set of about 2000 structures which are used for the potential building were checked. Monte Carlo simulations of Cf(III)+500 H{sub 2}O for three of the intermolecular potentials predict an aquaion structure with coordination number close to 8 and average R{sub Cf−−O} in the range 2.43–2.48 Å, whereas the fourth one is closer to 9 with R{sub Cf−−O} = 2.54 Å. Simulated EXAFS spectra derived from the structural Monte Carlo distribution compares fairly well with the available experimental spectrum for the simulations bearing 8 water molecules. An angular distribution similar to that of a square antiprism is found for the octa-coordination.

  15. No 2965, No 254. Report on new energy technologies and carbon dioxide sequestration: scientifical and technical aspects; N. 2965, N. 254. Rapport sur les nouvelles technologies de l'energie et la sequestration du dioxyde de carbone: aspects scientifiques et techniques

    Energy Technology Data Exchange (ETDEWEB)

    Bataille, Ch.; Birraux, C

    2006-03-15

    The abatement of CO{sub 2} emissions is a huge technical and economical challenge. Fossil fuels, which represent 88% of the world primary energy consumption, are the main source of the 25 billions of CO{sub 2} released each year in the atmosphere. The mastery of CO{sub 2} emissions cannot come from a single technology but must result from the simultaneous implementation of several means, like the development of carbon-free energies and the mastery of fossil fuel emissions. The opportunities of progress are numerous and compatible with the economic development. This document presents, first, the different greenhouse gases, the CO{sub 2} emissions per country and the main sources of CO{sub 2} emissions (power and heat generation, transports). Then it presents different ways of abatement of CO{sub 2} emissions: clean coal technologies, gas combined cycles, CO{sub 2} sequestration, reduction of fuel consumption in transports, development of carbon-free energies: wind power, solar photovoltaic for decentralized power generation, nuclear energy for a competitive power generation and for CO{sub 2} abatement, biofuels of 2. generation and fuel cells. The conclusion stresses on the investments needed for the renewal and increase of energy capacities, and on the necessary visibility and moderation of emission abatement mechanisms (carbon trading and CO{sub 2} prices). (J.S.)

  16. 论海上保险代位求偿权制度--兼谈对我国《海商法》第252~254条的修改%On the System of Right of Subrogation in Marine Insurance--Revision of the Art.252~254 of CMC

    Institute of Scientific and Technical Information of China (English)

    张贤伟

    2001-01-01

    文中结合实体法和程序法有关海上保险代位求偿权的具体规定,力求将二者融会贯通,指出实践中出现或可能出现的问题,明确立法存在的缺陷并提出修改意见,试图更加完善我国海上保险代位求偿权制度.

  17. A new shipping container for an intense neutron emitter

    International Nuclear Information System (INIS)

    Californium-252 is an intense neutron emitter (2.34 x 1012 n/s·g) used in medicine, research, and industry. The western world's sole source of this rare radioisotope is the Californium Facility at Oak Ridge National Laboratory's Radiochemical Engineering Development Center (REDC). A project has been initiated at the REDC to design a new Type B Californium Shipping Container. This effort is essential for future transportation of californium to meet the needs of users all over the world. The shipping container must meet all requirements for transport by motor freight, air, vessel, and rail, both domestic and foreign. There are unique problems in the design, fabrication, and licensing of a new Type B shipping container that will accommodate up to 60 milligrams of californium-252. One of the first challenges in the design phase of the project is the selection of a material to shield the high neutron flux. The more stringent safety precautions of today's world impel us to consider more exotic materials for such a purpose. The candidate materials must be examined not just for their neutron shielding properties, but also in conjunction with other properties such as thermal and structural requirements to withstand the hypothetical accident conditions. The design and building of such a container is a formidable task requiring much planning. The licensing process, with the complex, interactive federal codes, is a special challenge and may be the biggest on the project in terms of time and money

  18. Application of Cf for the quantitative measurement of nuclear reactor fuel materials

    International Nuclear Information System (INIS)

    Sensitive and rapid measurements of the quantity and geometric distribution of nuclear reactor fuel materials can be made using neutrons from californium. The neutron-induced fission rate in these materials may be measured by detection of either prompt radiations from fission or delayed radiations from radioactive fission products. A number of californium-based instruments are presently in use by the nuclear industry for purposes of process control, quality control, nuclear materials safeguards, and environmentl assessment. An Automated Fuel Rod Scanner (AFRS) is used for high-speed measurement of the uniformity of loading and total fissile content of reactor fuel rods. The fuel rods are moved first through an irradiator containing about 1 mg of californium, and subsequently through high-efficiency detectors for the measurement of fission-product gamma-rays. Multiple detectors on each of two irradiation channels are used to reduce the californium source strength requirement. The fuel loading of each 15-mm-long pellet is tested to +-10% on 100% of the plant throughput. By summing the response over length, the total fissile material content of the fuel rod is measured to better than 0.5%. An on-line computer for data processing allows the instrument to measure about 150 rods per hour with a single operator. The same activation concept is used with a 25-μg californium source in a Small Sample Assay System (SSAS) which measures the fissile content of fuel pellet sized samples with a precision of 0.5%

  19. A complexa convivência humana e os processos educativos libertadores (The human coexistence and the process of the liberating education - DOI: 10.5752/P.2175-5841.2013v11n29p254

    Directory of Open Access Journals (Sweden)

    Sergio Rogerio Junqueira

    2013-03-01

    Full Text Available Este artigo objetiva traçar o itinerário da educação libertadora na realidade social brasileira e refletir sobre a necessidade de se repensar a ação dessa modalidade de educação nos dias atuais. Ao se articular a realidade da época do surgimento da educação libertadora, que pretendia  responder aos apelos de libertação dos povos Latino-Americanos, com a realidade dos tempos atuais e suas implicações, este artigo busca respostas às questões postas por essa educação libertadora na atualidade. Para abordar as funções do processo educativo dentro do contexto de uma sociedade, é preciso situar as abordagens em sua realidade, contemporizando e adequando as suas ações. Essa temática representa um grande desafio, pois a concepção libertadora de educação extrapola os ambientes acadêmicos, visando sobretudo o bem comum do ser humano e o seu pleno desenvolvimento. Para a realização deste trabalho foram realizadas pesquisas bibliográficas e estudo da realidade desta época informatizada em que estamos inseridos, assim como suas consequências. Palavras-chave: Conscientização. Emancipação. Informatização. Educação Libertadora. Abstract This article aims to trace the route of liberating education in Brazilian social reality and reflect on the need to rethink the action of this type of education these days. In order to articulate the onset of liberating education that intended to respond to calls for liberation of Latin American peoples with the reality of the present time and its implications, this article seeks to answer to the questions posed by this liberating education today. To address the functions of the educational process within the context of a society, one must situate the approaches in their reality, compromising and adapting their actions. This theme represents a great challenge because the conception of such liberating education goes beyond the academic environments, seeking above all, the common good of the human being and its full development. The methodology used in this paper consisted of bibliographical research and a study of the reality of this computerized era in which we operate. Keywords: Awareness Empowerment. Information Technology. Liberating Education. 

  20. A Faceted Catalogue Aids Doctoral-Level Searchers. A Review of: Olson, Tod A. “Utility of a Faceted Catalog for Scholarly Research” Library Hi Tech 25.4 (2007: 550-61.

    Directory of Open Access Journals (Sweden)

    Kurt Blythe

    2008-09-01

    Full Text Available Objective – To learn whether a faceted catalogue and word cloud aids in the discovery process. Design – User study.Setting – Large academic research library in the United States.Subjects – Twelve PhD candidates in the humanities, the majority of whom are engaged with researching, proposing, or writing their dissertations.Methods – The library’s entire catalogue of 5.2 million records was loaded into the AquaBrowser OPAC search interface. A pilot study was conducted using three humanities graduate students employed by the library. Following the pilot, the main study was conducted using graduate students in the humanities. Graduate students in the social sciences were desired for the study, but were not able to be contacted due to time constraints. Once selected, the test subjects were asked to use an interface that offered both facets and tag clouds for enhanced search quality. Test subjects were allowed to choose the topic they would like to research; all chose to research their dissertation topic. A moderator and recorder facilitated research conducted with the faceted catalogue. The moderator ensured that students commented on their findings, cleared up any confusion with using the interface, and kept the students on task. Only when students remarked that a new discovery had been made were those discoveries noted. The impact to the discovery process of faceted navigation and AquaBrowser’s word cloud was studied while the impact of relevance ranking was not.Main Results – The article asserts that results from both the pilot and main study were sufficiently similar to justify combining them for the paper, but the advantage that students employed by thelibrary might have over other students is not discussed. Nine of the twelve students used in the study found new results using the faceted catalogue and word cloud. The responses of the user group to the faceted catalogue and word cloud were “overwhelmingly positive” (555. However, since students were allowed to move freely between the word cloud and faceted navigation tool, it is difficult to attribute new discoveries solely to one or the other. However, when a new discovery could be “attributed primarily to one factor or another” (555 it was noted. The faceted navigation tool aided discovery at least four times and the word cloud aided discovery at least six.Conclusion – A faceted catalogue interface with a word cloud feature clearly aids in the discovery process for more advanced researchers — those with specialized subject knowledge, familiarity with their library’s collection, and experience in researching their area. However, facets and word clouds have limitations: records with limited cataloguing have little to offer faceted navigation; catalogue records from diverse providers introduce controlled vocabularies beyond LCSH and MeSH into searchreturns, resulting in the same word potentially appearing multiple times in the same return albeit with different meanings; the word cloud may contain certain words that researchers feel to be irrelevant. Despite these issues, the use of word clouds and faceted navigation (and relevance ranking appears to be beneficial to research conducted by experienced subject searchers in the humanities.

  1. A Faceted Catalogue Aids Doctoral-Level Searchers. A Review of: Olson, Tod A. “Utility of a Faceted Catalog for Scholarly Research” Library Hi Tech 25.4 (2007): 550-61.

    OpenAIRE

    Kurt Blythe

    2008-01-01

    Objective – To learn whether a faceted catalogue and word cloud aids in the discovery process. Design – User study.Setting – Large academic research library in the United States.Subjects – Twelve PhD candidates in the humanities, the majority of whom are engaged with researching, proposing, or writing their dissertations.Methods – The library’s entire catalogue of 5.2 million records was loaded into the AquaBrowser OPAC search interface. A pilot study was conducted using three humanities gra...

  2. Geological and petrophysical characterization of the Ferron Sandstone for 3-D simulation of a fluvial-deltaic reservoir. Deliverable 2.5.4, Ferron Sandstone lithologic strip logs, Emergy & Sevier Counties, Utah: Volume I

    Energy Technology Data Exchange (ETDEWEB)

    Allison, M.L.

    1995-12-08

    Strip logs for 491 wells were produced from a digital subsurface database of lithologic descriptions of the Ferron Sandstone Member of the Mancos Shale. This subsurface database covers wells from the parts of Emery and Sevier Counties in central Utah that occur between Ferron Creek on the north and Last Chance Creek on the south. The lithologic descriptions were imported into a logging software application designed for the display of stratigraphic data. Strip logs were produced at a scale of one inch equals 20 feet. The strip logs were created as part of a study by the Utah Geological Survey to develop a comprehensive, interdisciplinary, and qualitative characterization of a fluvial-deltaic reservoir using the Ferron Sandstone as a surface analogue. The study was funded by the U.S. Department of Energy (DOE) under the Geoscience/Engineering Reservoir Characterization Program.

  3. 48 CFR 15.403-1 - Prohibition on obtaining certified cost or pricing data (10 U.S.C. 2306a and 41 U.S.C. 254b).

    Science.gov (United States)

    2010-10-01

    ... in substantial quantities in the commercial marketplace, but are of a type offered and sold... (c)(2) of this subsection); (3) When a commercial item is being acquired (see standards in paragraph... this subsection); or (5) When modifying a contract or subcontract for commercial items (see...

  4. SU-E-J-254: Evaluating the Role of Mid-Treatment and Post-Treatment FDG-PET/CT in Predicting Progression-Free Survival and Distant Metastasis of Anal Cancer Patients Treated with Chemoradiotherapy

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, H; Wang, J; Chuong, M; D’Souza, W; Choi, W; Lu, W [University of Maryland School of Medicine, Baltimore, MD (United States); Latifi, K; Hoffe, S; Moros, E [Moffitt Cancer Center, Tampa, FL (United States); Saeed, Nadia [Brwon University, Providence, RI (United States); Tan, S [Huazhong University of Science & Technology, Wuhan (China); Shridhar, R [Florida Hospital, Orlando, FL (United States)

    2015-06-15

    Purpose: To evaluate the role of mid-treatment and post-treatment FDG-PET/CT in predicting progression-free survival (PFS) and distant metastasis (DM) of anal cancer patients treated with chemoradiotherapy (CRT). Methods: 17 anal cancer patients treated with CRT were retrospectively studied. The median prescription dose was 56 Gy (range, 50–62.5 Gy). All patients underwent FDG-PET/CT scans before and after CRT. 16 of the 17 patients had an additional FDG-PET/CT image at 3–5 weeks into the treatment (denoted as mid-treatment FDG-PET/CT). 750 features were extracted from these three sets of scans, which included both traditional PET/CT measures (SUVmax, SUVpeak, tumor diameters, etc.) and spatialtemporal PET/CT features (comprehensively quantify a tumor’s FDG uptake intensity and distribution, spatial variation (texture), geometric property and their temporal changes relative to baseline). 26 clinical parameters (age, gender, TNM stage, histology, GTV dose, etc.) were also analyzed. Advanced analytics including methods to select an optimal set of predictors and a model selection engine, which identifies the most accurate machine learning algorithm for predictive analysis was developed. Results: Comparing baseline + mid-treatment PET/CT set to baseline + posttreatment PET/CT set, 14 predictors were selected from each feature group. Same three clinical parameters (tumor size, T stage and whether 5-FU was held during any cycle of chemotherapy) and two traditional measures (pre- CRT SUVmin and SUVmedian) were selected by both predictor groups. Different mix of spatial-temporal PET/CT features was selected. Using the 14 predictors and Naive Bayes, mid-treatment PET/CT set achieved 87.5% accuracy (2 PFS patients misclassified, all local recurrence and DM patients correctly classified). Post-treatment PET/CT set achieved 94.0% accuracy (all PFS and DM patients correctly predicted, 1 local recurrence patient misclassified) with logistic regression, neural network or support vector machine model. Conclusion: Applying radiomics approach to either midtreatment or post-treatment PET/CT could achieve high accuracy in predicting anal cancer treatment outcomes. This work was supported in part by the National Cancer Institute Grant R01CA172638.

  5. Multibeam collection for TN254: Multibeam data collected aboard Thomas G. Thompson from 2010-09-09 to 2010-10-11, departing from Astoria, OR and returning to Seattle, WA

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set is part of a larger set of data called the Multibeam Bathymetry Database (MBBDB) where other similar data can be found at...

  6. Henri Peyronie, Le mouvement Freinet : du fondateurcharismatique à l’intellectuel collectif.Caen : Presses Universitaires de Caen, 2013, 254 p.Sylvain Wagnon, Ovide Decroly, un pédagogue de l’Education nouvell

    OpenAIRE

    Riondet, Xavier

    2015-01-01

    Qu’il s’agisse de l’ouvrage d’Henri Peyronie ou de celui de Sylvain Wagnon, nous sommes ici en présence de deux approches assez différentes portant néanmoins sur des objets proches : le cas de “figures” souvent célébrées de l’Éducation nouvelle (Freinet et Decroly), la réception et le prolongement possible de leur pensée.Spécialiste de Decroly (1871-1932), Wagnon a régulièrement publié sur le pédagogue belge, sa pédagogie et ses réalisations. Cet ouvrage représente le point d’orgue des multip...

  7. Application of PGNAA to preincineration assay of combustible waste for chlorine

    Energy Technology Data Exchange (ETDEWEB)

    Gehrke, R.J.; Pawelko, R.J.; Greenwood, R.C. [Idaho National Engineering Lab., Idaho Falls, ID (United States)

    1995-12-31

    A prompt gamma neutron activation analysis method is being developed for on-stream pre-incineration assay of low level radioactive combustible waste for it`s chlorine content. The assay system consists of three californium 252 sources and a germanium or scintillation gamma-ray spectrometer.

  8. Magnetic measurements of the transuranium elements. Progress report, January 1, 1984-December 31, 1984

    International Nuclear Information System (INIS)

    Measurements of the magnetic properties of dhcp californium-249 metal indicated the presence of three regions of differing magnetic character. Additional measurements are also reported. Magnetic moments and valence states of terbium in TbF3, BaTbO3, and TbO18 are discussed. Progress on high-field operation of the micro-magnetic susceptometer is reported

  9. Source storage and transfer cask: Users Guide

    International Nuclear Information System (INIS)

    The storage and shield cask for the dual californium source is designed to shield and transport up to 3.7 mg (2 Ci) of 252Cf. the cask meets Department of Transportation (DOT) license requirements for Type A materials (DOT-7A). The cask is designed to transfer sources to and from the Flourinel and Fuel Storage (FAST) facility delayed-neutron interrogator. Californium sources placed in the cask must be encapsulated in the SR-CF-100 package and attached to Teleflex cables. The cask contains two source locations. Each location contains a gear box that allows a Teleflex cable to be remotely moved by a hand crank into and out of the cask. This transfer procedure permits sources to be easily removed and inserted into the delayed-neutron interrogator and reduces personnel radiation exposure during transfer. The radiation dose rate with the maximum allowable quantity of californium (3.7 mg) in the cask is 30 mR/h at the surface and less than 2 mR/h 1 m from the cask surface. This manual contains information about the cask, californium sources, describes the method to ship the cask, and how to insert and remove sources from the cask. 28 figs

  10. Discovery of Isotopes of the Transuranium Elements with 93 <= Z <= 98

    OpenAIRE

    Fry, C; Thoennessen, M

    2012-01-01

    One hundred and five isotopes of the transuranium elements neptunium, plutonium, americium, curium, berkelium and californium have so far been observed; the discovery of these isotopes is discussed. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  11. Dicty_cDB: Contig-U10401-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ntantccntcna 253 Query: 254 tcnatgttangaaccnattagngaattcnttnaattnnnnnnnnaagatcnat...tganttc 313 |||||||||||||||||||||||||||||||||||| |||||||||||||||| Sbjct: 254 tcnatgttangaaccnattagngaattcntt...tatcaatctattccttcaa 932 Query: 254 tcnatgttangaaccnattagngaattcnttnaatt 289 || |||||| ||||| ||||| ||||| || |...ancaatntantccntcna 105 Query: 254 tcnatgttangaaccnattagngaattcnttnaatt 289 |||||||||||||||||||||||||||||||||...||| Sbjct: 104 tcnatgttangaaccnattagngaattcnttnaatt 69 Lambda K H 1.37 0.711 1.31 Matrix: blastn matrix:1 -3

  12. Comment on "Nanosecond laser textured superhydrophobic metallic surfaces and their chemical sensing applications" by Duong V. Ta, Andrew Dunn, Thomas J. Wasley, Robert W. Kay, Jonathan Stringer, Patrick J. Smith, Colm Connaughton, Jonathan D. Shephard (Appl. Surf. Sci. 357 (2015) 248-254)

    Science.gov (United States)

    Boinovich, L. B.; Emelyanenko, A. M.; Emelyanenko, K. A.; Domantovsky, A. G.; Shiryaev, A. A.

    2016-08-01

    Nowadays the problem of design of durable ecologically friendly superhydrophobic surfaces is of great importance for science and technology. A recent paper in Applied Surface Science reports the method of fabricating the superhydrophobic metallic surfaces by infrared nanosecond laser surface texturing without using hydrophobic agents. Since this method of surface texturing can be considered as one of the most suitable for various industrial applications, the nature of superhydrophobic state of surfaces produced by laser texturing in the abovementioned paper deserves to be analyzed in detail. Authors of the commented paper attributed the change in wettability to the partial deoxidation of CuO into Cu2O on the surface during storage in atmosphere. However, such interpretation of the results contradicts to the basic notions in the theory of wetting and to more accurate and detailed data. In our Comment we discuss these contradictions point by point.

  13. Oxidation of microquantities of transplutonium elements to tetravalent state in mineral acid solutions and their stability

    International Nuclear Information System (INIS)

    Kinetics of americium(3) microquantity oxidation and stability of forming americium(4), as well as possibility of curium and californium oxidation to tetravalent state in solutions of sulfuric and nitric acids depending on the concentration of mineral acid, potassium tungstophosphate and ammonium persulfate are studied by the extraction method. It is shown that curium(3) and californium(3) in solutions of 0.05-2.5 mol/l H2SO4 and HNO3 containing 10-3 mol/l potassium tungstophosphate is not practically oxidized by the mixture of silver nitrate and ammonium persulfate. Americium(3) is oxidized to the utmost to Am(4) for 2-3 min at room temperature, but stability of Am(4) depends on the concentration of sulfuric acid and potassium tungstophosphate

  14. Characterization of berkelium(III) dipicolinate and borate compounds in solution and the solid state.

    Science.gov (United States)

    Silver, Mark A; Cary, Samantha K; Johnson, Jason A; Baumbach, Ryan E; Arico, Alexandra A; Luckey, Morgan; Urban, Matthew; Wang, Jamie C; Polinski, Matthew J; Chemey, Alexander; Liu, Guokui; Chen, Kuan-Wen; Van Cleve, Shelley M; Marsh, Matthew L; Eaton, Teresa M; van de Burgt, Lambertus J; Gray, Ashley L; Hobart, David E; Hanson, Kenneth; Maron, Laurent; Gendron, Frédéric; Autschbach, Jochen; Speldrich, Manfred; Kögerler, Paul; Yang, Ping; Braley, Jenifer; Albrecht-Schmitt, Thomas E

    2016-08-26

    Berkelium is positioned at a crucial location in the actinide series between the inherently stable half-filled 5f(7) configuration of curium and the abrupt transition in chemical behavior created by the onset of a metastable divalent state that starts at californium. However, the mere 320-day half-life of berkelium's only available isotope, (249)Bk, has hindered in-depth studies of the element's coordination chemistry. Herein, we report the synthesis and detailed solid-state and solution-phase characterization of a berkelium coordination complex, Bk(III)tris(dipicolinate), as well as a chemically distinct Bk(III) borate material for comparison. We demonstrate that berkelium's complexation is analogous to that of californium. However, from a range of spectroscopic techniques and quantum mechanical calculations, it is clear that spin-orbit coupling contributes significantly to berkelium's multiconfigurational ground state. PMID:27563098

  15. Neutron activation determination of gold in technogenic raw materials with different mineral composition

    OpenAIRE

    Yudakov Aleksandr A.; Ivannikov Sergey I.; Zheleznov Veniamin V.; Taskin Andrei V.; Tsybulskaya Oksana N.

    2015-01-01

    The methods used to determine the gold content in the technogenic objects of gold mining were analyzed regarding their non-homogeneity and complexity of chemical and mineral compositions. A possible application of the neutron activation analysis with the use of the californium source of neutrons for determining the content of fine-grained and extra-fine-grained gold in the technogenic objects, including the bottom-ash waste of energy providers, is considere...

  16. Jak bylo objeveno spontánní štěpení

    Czech Academy of Sciences Publication Activity Database

    Vobecký, Miloslav

    Praha: Spektroskopická společnost J.M. Marci, 2010 - (Vobecký, M.), s. 5-10 ISBN 978-80-904539-0-6. [Seminář Radioanalytické metody IAA 10. Praha (CZ), 30.06.2010-01.07.2010] Institutional research plan: CEZ:AV0Z40310501 Keywords : spontaneous fission * fission -track dating method * californium 252 neutron source Subject RIV: CB - Analytical Chemistry, Separation

  17. Study of heavy particle decay from superheavy elements by SK model

    International Nuclear Information System (INIS)

    Heavy nuclei usually decay by alpha decay or spontaneous fission. These two decay modes are generally the most probable competing processes. Another less probable decay process is cluster radioactivity in which nuclei from carbon to silicon are emitted from Radium to Californium leading to the most stable daughter nucleus, lead. This work reports such a study using the cubic plus Yukawa plus exponential model of Shanmugam and Kamalaharan (SK)

  18. Measurement of the energy spectra of fission fragments using nuclear track detectors and digital image processing

    International Nuclear Information System (INIS)

    Energy spectra of fission fragments were determined using a Nuclear Track Methodology (NTM) supported by digital image analysis and numerical data processing using a standard personal computer. The analysis of a californium (252Cf) spectrum with this approach shows improvement compared with the values reported previously using the standard procedure, in terms of resolution and accuracy. This new method adds full automation to the technical advantages and cost effectiveness of an NTM.

  19. Heavy ion tests on programmable VLSI

    International Nuclear Information System (INIS)

    The radiation from space environment induces operation damages in onboard computers systems. The definition of a strategy, for the Very Large Scale Integrated Circuitry (VLSI) qualification and choice, is needed. The 'upset' phenomena is known to be the most critical integrated circuit radiation effect. The strategies for testing integrated circuits are reviewed. A method and a test device were developed and applied to space applications candidate circuits. Cyclotron, synchrotron and Californium source experiments were carried out

  20. Properties of neutron sources

    International Nuclear Information System (INIS)

    The Conference presentations were divided into sessions devoted to the following topics: white neutron sources, primarily pulsed (6 papers); fast neutron fields (5 papers); Californium-252 prompt fission neutron spectra (14 papers); monoenergetic sources and filtered beams (11 papers); 14 MeV neutron sources (10 papers); selected special application (one paper); and a general interest session (4 papers). Individual abstracts were prepared separately for the papers

  1. Neutron multiplicities for the transplutonium nuclides

    International Nuclear Information System (INIS)

    This paper continues, with respect to the transplutonium nuclides, earlier efforts to collate and evaluate data from the scientific literature on the prompt neutron multiplicity distribution from fission and its first moment = ΣnuPnu. The isotopes considered here for which P/sub nu/ and or data (or both) were found in the literature are of americium (Am), curium (Cm), berkelium (Bk), californium (Cf), einsteinium (Es), fermium (Fm), and nobelium (No)

  2. Dicty_cDB: VSH364 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ome 2 map 5515173... 254 2e-73 2 ( AU284312 ) Dictyostelium discoideum gamete cDNA clone:FC-AK1... 254 2e-73... 2 ( C23652 ) Dictyostelium discoideum gamete cDNA, clone FC-AG13. 254 2e-73 2 ( AU284996 ) Dictyostelium discoideum gamete... cDNA clone:FC-BS1... 254 2e-73 2 ( AU284930 ) Dictyostelium discoideum gamete... cDNA clone:FC-BQ0... 254 2e-73 2 ( AU284889 ) Dictyostelium discoideum gamete cDNA clone:FC-BO1...... 254 2e-73 2 ( C92427 ) Dictyostelium discoideum slug cDNA, clone SSE533. 254 2e-73 2 ( AU284467 ) Dictyostelium discoideum gamete

  3. AcEST: BP918662 [AcEST

    Lifescience Database Archive (English)

    Full Text Available GIAVKPRKGDALLFFNLHPDAIPDPLSLHGGCPVIEGEKWSATKWIHVDSFDRIVTP 254 Query: 181 VGDCKDEDESCGEWAAYGECQKNPTYMIGTSEQPG...PVIEGEKWSATKWIHVDSFDRIVTP 254 Query: 181 VGDCKDEDESCGEWAAYGECQKNPTYMIGTSEQPGY 288 G+C D +ESC WA GEC KNP YM+G...AFEKPRPKN 220 Query: 184 GDCKDEDESCGEWAAYGECQKNPTYMIGTSEQPGY 288 G C +E +SC EWAAYGECQKNP YM+GT E PGY Sbjct: ...LKP 254 Query: 181 VGDCKDEDESCGEWAAYGECQKNPTYMIGTSEQPG 285 G+C DE++SC WAA GEC KNP YM+G+S+ PG Sbjct: 255 GGNC...ATPDPLSLHGGCPVIQGEKWSATKWIHVDSFDKTVDT 250 Query: 181 VGDCKDEDESCGEWAAYGECQKNPTYMIGTSEQPGY 288 G+C D DE+C WAA

  4. Dependence of metal partition coefficients in D2EHPA capacity on extraction from acid solutions

    International Nuclear Information System (INIS)

    In devising solvent-extraction schemes for extracting the transplutonium elements (TPE), one usually employs the partition coefficients K/sub p/ for trace amounts; when the results are transferred to weighable amounts of the elements, there are difficulties because one lacks capacity characteristics for the extractants under the conditions used. They have determined the capacity of D2EHPA over a wide range in acidity (0.001-2 mole/liter) in relation to dysprosium (the analog of californium) in the system formed by D2EHPA with nitric acid by saturating a set volume of the extractant with dysprosium in nitric acid containing the necessary amount of free acid

  5. TOWARD AN IMPROVED UNDERSTANDING OF STRUCTURE AND MAGNETISM IN NEPTUNIUM AND PLUTONIUM PHOSPHONATES AND SULFONATES

    Energy Technology Data Exchange (ETDEWEB)

    Albrecht-Schmitt, Thomas

    2012-03-01

    This grant supported the exploratory synthesis of new actinide materials with all of the actinides from thorium to californium with the exceptions of protactinium and berkelium. We developed detailed structure-property relationships that allowed for the identification of novel materials with selective ion-exchange, selective oxidation, and long-range magnetic ordering. We found novel bonding motifs and identified periodic trends across the actinide series. We identified structural building units that would lead to desired structural features and novel topologies. We also characterized many different spectroscopic trends across the actinide series. The grant support the preparation of approximately 1200 new compounds all of which were structurally characterized.

  6. NONDESTRUCTIVE IDENTIFICATION OF CHEMICAL WARFARE AGENTS AND EXPLOSIVES BY NEUTRON GENERATOR-DRIVEN PGNAA

    International Nuclear Information System (INIS)

    Prompt gamma-ray neutron activation analysis (PGNAA) is now a proven method for the identification of chemical warfare agents and explosives in military projectiles and storage containers. Idaho National Laboratory is developing a next-generation PGNAA instrument based on the new Ortec Detective mechanically-cooled HPGe detector and a neutron generator. In this paper we review PGNAA analysis of suspect chemical warfare munitions, and we discuss the advantages and disadvantages of replacing the californium-252 radioisotopic neutron source with a compact accelerator neutron generator

  7. NONDESTRUCTIVE IDENTIFICATION OF CHEMICAL WARFARE AGENTS AND EXPLOSIVES BY NEUTRON GENERATOR-DRIVEN PGNAA

    Energy Technology Data Exchange (ETDEWEB)

    T. R. Twomey; A. J. Caffrey; D. L. Chichester

    2007-02-01

    Prompt gamma-ray neutron activation analysis (PGNAA) is now a proven method for the identification of chemical warfare agents and explosives in military projectiles and storage containers. Idaho National Laboratory is developing a next-generation PGNAA instrument based on the new Ortec Detective mechanically-cooled HPGe detector and a neutron generator. In this paper we review PGNAA analysis of suspect chemical warfare munitions, and we discuss the advantages and disadvantages of replacing the californium-252 radioisotopic neutron source with a compact accelerator neutron generator.

  8. Composition containing transuranic elements for use in the homeopathic treatment of aids

    International Nuclear Information System (INIS)

    A homeopathic remedy consisting of a composition containing one or more transuranic elements, particularly plutonium, for preventing and treating acquired immunodeficiency syndrome (AIDS) in humans, as well as seropositivity for human immunodeficiency virus (HIV). Said composition is characterized in that it uses any chemical or isotopic form of one or more transuranic elements (neptunium, plutonium, americium, curium, berkelium, californium or einsteinium), particularly plutonium, said form being diluted and dynamized according to conventional homeopathic methods, particularly the so-called Hahnemann and Korsakov methods, and provided preferably but not exclusively in the form of lactose and/or saccharose globules or granules impregnated with the active principle of said composition. (author)

  9. Neutron nondestructive essay of the plutonium metal parts

    International Nuclear Information System (INIS)

    Based on the principle of neutron multiplicity and data unfolding mathematics, this paper developed the software which can execute the neutron multiplicity analysis, neutron attenuation analysis, parameter calibration, Pu mass solution with the neutron pulse sequence acquisition method. The measurement system consisted of detector,nuclear electronic apparatus, pulsed sequence acquisition and analysis software was tested and calibrated by californium source. Three mental plutonium components with different mass were used for experimental assay and validation, which showed that the assay bias was within 15% against the nominal value of the samples. (authors)

  10. Physical-chemical studies of transuranium elements. Progress report, April 1, 1982-March 31, 1983

    International Nuclear Information System (INIS)

    Progress is reported on the following topics: electrochemical and spectroscopic studies of less-stable higher oxidation states of transuranium elements in complexing aqueous media; spectroscopic and electrochemical studies of selected lanthanides and actinides in molten dimethyl sulfone; spectroelectronchemical studies of the Ce(IV)/Ce(III) couple in aqueous carbonate solutions; characterization of actinide orthophosphates by Raman and absorption spectrophotometries and by x-ray diffraction; relativistic multiple scattering calculations on transuranium element compounds; Raman spectroscopic studies of natural minerals containing the uranyl ion; and solution calorimetry of californium metal

  11. Transuranium element production. II. Chemical processing of targets

    International Nuclear Information System (INIS)

    The chemical processing described concerns small experimental targets irradiated in OSIRIS or EL-III and industrial targets irradiated in the CELESTIN reactors. In view of the difficulties encountered when processing highly irradiated targets (760MWd.kg-1) by liquid-liquid extraction (interface sludges leading to stable emulsion) the new processes developed are based on inverse phase chromatography. This technique applied to targets of americium 241, plutonium 239 and a plutonium mixture rich in isotope 242 has given tens of milligrams of curium 242, grams of americium 243 and curium 244 and micrograms of californium 252

  12. Detection of rare earth elements in Powder River Basin sub-bituminous coal ash using laser-induced breakdown spectroscopy (LIBS)

    Energy Technology Data Exchange (ETDEWEB)

    Tran, Phuoc [National Energy Technology Lab. (NETL), Pittsburgh, PA, (United State; Mcintyre, Dustin [National Energy Technology Lab. (NETL), Pittsburgh, PA, (United State

    2015-10-01

    We reported our preliminary results on the use of laser-induced breakdown spectroscopy to analyze the rare earth elements contained in ash samples from Powder River Basin sub-bituminous coal (PRB-coal). We have identified many elements in the lanthanide series (cerium, europium, holmium, lanthanum, lutetium, praseodymium, promethium, samarium, terbium, ytterbium) and some elements in the actinide series (actinium, thorium, uranium, plutonium, berkelium, californium) in the ash samples. In addition, various metals were also seen to present in the ash samples

  13. Radiation protection data sheet. Radiation protection data sheets for the use of radionuclides in unsealed sources

    International Nuclear Information System (INIS)

    These radiation protection data sheet are devoted to responsible persons and employees of various laboratories or medical, pharmaceutical, university and industrial departments where radionuclides are handled as well as all the persons who attend to satisfy in this field. They contain the essential radiation protection data for the use of unsealed sources: physical characteristics, risk assessment, administrative procedures, recommendations, regulations and bibliography. This new series includes the following radionuclides: californium 252, curium 244, gallium 67, indium 113m, plutonium 238, plutonium 239, polonium 210, potassium 42, radium 226, thorium 232, uranium 238 and zinc 65. (O.M.)

  14. Study by thermochromatography of fluorides of transuranium elements

    International Nuclear Information System (INIS)

    Thermochromatography was made suitable for fluoride study. So, an investigation of actinide tetrafluorides was accomplished from uranium to californium. Pentavalent and hexavalent fluorospecies of uranium, neptunium, plutonium and ruthenium were studied. Some new compounds have been identified in gaseous phase, whose: PuF5, PuOF3 and PaOF3. Furthermore, some presomptions as for the existence in gaseous phase of EsF4 and of an heptavalent fluorospecies of plutonium have been established. An important analogy between plutonium and ruthenium behaviour with fluorine have been shown, these results could explain the difficulties encountered in the fluoride-volatility processes

  15. PROCEEDINGS OF THE SYMPOSIUM COMMEMORATING THE 25th ANNIVERSARY OF ELEMENTS 97 and 98 HELD ON JAN. 20, 1975

    Energy Technology Data Exchange (ETDEWEB)

    Seaborg, Glenn T.; Street Jr., Kenneth; Thompson, Stanley G.; Ghiorso, Albert

    1976-07-01

    This volume includes the talks given on January 20, 1975, at a symposium in Berkeley on the occasion of the celebration of the 25th anniversary of the discovery of berkelium and californium. Talks were given at this symposium by the four people involved in the discovery of these elements and by a number of people who have made significant contributions in the intervening years to the investigation of their nuclear and chemical properties. The papers are being published here, without editing, in the form in which they were submitted by the authors in the months following the anniversary symposium, and they reflect rather faithfully the remarks made on that occasion.

  16. Method for measuring multiple scattering corrections between liquid scintillators

    Science.gov (United States)

    Verbeke, J. M.; Glenn, A. M.; Keefer, G. J.; Wurtz, R. E.

    2016-07-01

    A time-of-flight method is proposed to experimentally quantify the fractions of neutrons scattering between scintillators. An array of scintillators is characterized in terms of crosstalk with this method by measuring a californium source, for different neutron energy thresholds. The spectral information recorded by the scintillators can be used to estimate the fractions of neutrons multiple scattering. With the help of a correction to Feynman's point model theory to account for multiple scattering, these fractions can in turn improve the mass reconstruction of fissile materials under investigation.

  17. Surface fission tracks in diamond

    International Nuclear Information System (INIS)

    Scanning Probe Microscope (SPM) images reveal important fingerprint features of latent tracks induced in diamond by fission fragments from a californium source. Collimated fission fragments with a binary distribution of the predominant energies of 79.4 and 103.8 MeV, are assumed. Cavities, reticular formations around these cavities, and black spots of graphite were found. A brief discussion on the possible track formation mechanism is given on the basis of the explosion spike theory; an attempt to determine latent track core and halo parameters is included

  18. Use of trioctylphosphine oxide for transplutonium element extraction and purification

    International Nuclear Information System (INIS)

    Investigated was extraction of tri-valent curium, berkelium, californium, einsteinium as well as cerium and europium with trioctylphosphin oxide from lactic acid solutions, containing DTPA and aluminium nitrate depending on the aluminium nitrate and TOPO concentrations and nitric acid solutions of variable concentration as well. Under optimum conditions of extraction chromatography of berkelium studied was the distribution of cobalt, nickel, chromium, iron, aluminium, titanium, zirconium and niobium ions, and the coefficients of berkelium purification from cations investigated were determined. The effect of weight quantities of cation impurities on extraction chromatographic yield of berkelium has been investigated. Examples of practice application of the extraction chromatography with the use of TOPO are given

  19. Neutron beam experiments using nuclear research reactors: honoring the retirement of professor Bernard W. Wehring -II. 5. Testing Moderating Detection Systems with 252Cf-Based Reference Neutron Fields

    International Nuclear Information System (INIS)

    In recent years, Georgia Institute of Technology (Georgia Tech) has been involved in a number of neutron dosimetry research projects. Several reference neutron fields are now available for such projects. They are all based on the use of a 252Cf source. The source can be used by itself to create a reference un-moderated 252Cf neutron field, or it can be placed inside several different moderating assemblies. The spectra created by placing the source inside these assemblies and the un-moderated source are employed to investigate detector and dosimeter responses. Currently, the set of moderators available includes a 30-cm diam cadmium-covered D2O spherical shell, a 30-cm-thick iron spherical shell, a 30-cm-diam polyethylene spherical shell, an 18.3-cm-thick tungsten spherical shell, a 16-cm-thick lead spherical shell, and a 9-cm-thick tantalum spherical shell. In addition, the 252Cf source can be placed inside a neutron howitzer recently constructed at Georgia Tech. The howitzer is a WEP cylinder loaded with boron that has a 10.16-cm-diam cylindrical opening. When the source is placed in the cylindrical penetration of the howitzer, a neutron field ∼30 cm in diameter is created at a distance of 50 cm from the californium source. Over the last few years, Bonner sphere spectrometers using LiI(Eu) scintillators and LiF thermoluminescence dosimeters have been calibrated using this facility at Georgia Tech. Recently, the Neely Nuclear Research Center (NNRC) acquired an LB 6411 neutron probe (product of EG and G Berthold). This probe is designed to measure ambient dose equivalent in accordance with International Commission on Radiological Protection Publication 60 recommendations. It consists of a cylindrical 3He proportional counter surrounded by a 25-cm-diam spherical polyethylene moderator. Its neutron response is optimized for dose rate measurements of neutrons between thermal energies and 20 MeV (Ref. 5). As a test of the instrument's ability to measure ambient dose

  20. Monte Carlo aided enhanced design of an neutron scatterometer

    International Nuclear Information System (INIS)

    This paper will present a particular example for the use of the Monte Carlo Method to enhance the performance of a neutron scatterometer, currently employed to detect the void fraction in fast-transient high-pressure water-vapour flow in a rod-bundle channel. The scatterometer relies on measuring the slowing-down of californium-252 neutrons by the hydrogen in the water to determine the liquid, hence vapour (void) content. However, californium-252 is a relatively fast-decaying source and alternative isotopic sources are typically too energetic to provide sufficient moderation given the small amount of liquid in the channel. Monte Carlo simulation were utilized to examine various design enhancement possibilities, including: filtering out unthermalized fast neutrons, amplifying by a fissionable material the amount of detected thermal neutrons, adding a dissolvable contrast material to the liquid phase, or relying on the scattering of fast neutrons by oxygen in water. In addition, methods to determine the distribution of the pattern of liquid-vapour phase in the channel are devised

  1. Dicty_cDB: Contig-U13159-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ntities = 254/254 (100%) Strand = Plus / Plus Query: 13 aaaaagggacttgngagtttgntgatttngatccnaaaccnttnntttgnaa...aactgntg 72 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 13 aaaaagggacttgngagtttgntgatttngatccna...ttttggtggnaaaaaaggttntgnctactggaaancaagtcaaggngntncna 192 Query: 193 nggccncntnaaangccna...||||| Sbjct: 193 nggccncntnaaangccnatcccctttangaaancnatccntcaggnggngaaaanncna 252 Query: 253 tttntnctagcccc .../235 (97%) Strand = Plus / Plus Query: 13 aaaaagggacttgngagtttgntgatttngatccnaaaccnttnntttgnaaaactgntg 72 ||

  2. Book Review: John M. Hobson and Leonard Seabrooke (2007) (eds) Everyday Politics of the World Economy

    DEFF Research Database (Denmark)

    Strange, Michael Stewart

    2009-01-01

    Book Review: John M. Hobson and Leonard Seabrooke (2007) (eds) Everyday Politics of the World Economy (Cambridge: Cambridge University Press), 254pp. Udgivelsesdato: 2009......Book Review: John M. Hobson and Leonard Seabrooke (2007) (eds) Everyday Politics of the World Economy (Cambridge: Cambridge University Press), 254pp. Udgivelsesdato: 2009...

  3. Bacterial components protects against experimentaly induced intestinal inflammation by stabilizing the gut microflora composition and changing the cytokine production

    Czech Academy of Sciences Publication Activity Database

    Kverka, Miloslav; Sokol, Dan; Zákostelská, Zuzana; Frolová, Lenka; Hudcovic, Tomáš; Hrnčíř, Tomáš; Jelen, P.; Mrázek, Jakub; Kopečný, Jan; Tlaskalová, Helena

    Tokyo: Elsevier, 2007, s. 254-254. [International Congress of Mucosal Immunology. Tokyo (JP), 09.08.2007-12.08.2007] R&D Projects: GA ČR GD310/03/H147 Institutional research plan: CEZ:AV0Z50200510; CEZ:AV0Z50450515 Keywords : inflammatory bowel disease Subject RIV: EC - Immunology

  4. EST Table: FY745537 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available 028 11/11/04 77 %/254 aa gnl|Amel|GB19403-PA 11/11/04 78 %/254 aa gi|91085659|ref|XP_971350.1| PREDICTED: similar to Intro...n-binding protein aquarius (Intron-binding protein of 160 kDa) (IBP160) [Tribolium castaneum] FY745710 famL ...

  5. Gclust Server: 119747 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available 119747 CEL_R05H5.2_17532605 Cluster Sequences Related Sequences(24) 372 cdc-25.4: Cell Division...nces Related Sequences(24) Sequence length 372 Representative annotation cdc-25.4: Cell Division

  6. 75 FR 43115 - National Oil and Hazardous Substances Pollution Contingency Plan; National Priorities List...

    Science.gov (United States)

    2010-07-23

    ... AGENCY 40 CFR Part 300 National Oil and Hazardous Substances Pollution Contingency Plan; National..., and Liability Act (CERCLA) of 1980, as amended, is an appendix of the National Oil and Hazardous... partial deletion pertains to the soil and groundwater of parcels 24, 27, 28, 2-53, 2-53L, 2-54, 2-54L,...

  7. Using ultraviolet absorbance and color to assess pharmaceutical oxidation during ozonation of wastewater.

    Science.gov (United States)

    Wert, Eric C; Rosario-Ortiz, Fernando L; Snyder, Shane A

    2009-07-01

    The reduction of ultraviolet (UV) absorbance at 254 nm (UV254) and true color were identified as appropriate surrogates to assess the oxidation of six pharmaceuticals (i.e., carbamazepine, meprobamate, dilantin, primidone, atenolol, and iopromide) during ozonation of wastewater. Three tertiary-treated wastewaters were evaluated during oxidation with ozone (O3) and O3 coupled with hydrogen peroxide (O3/H2O2). The correlation between pharmaceutical oxidation and removal of UV254 was dependent upon the reactivity of each specific compound toward ozone, as measured by the second-order rate constant (k'(O3)). Oxidation of compounds with k'(O3) > 10(3) M(-1) s(-1) correlated well (R2 > 0.73) with UV254 reduction between 0-50%. Oxidation of compounds with apparent k'(O3) 0.80) with the UV254 reduction of 15-85%. The removal of true color also correlated well (R2 > 0.85) with the oxidation of pharmaceuticals during the ozonation of two wastewaters. These correlations demonstrate that UV254 reduction and true color removal may be used as surrogates to evaluate pharmaceutical oxidation in the presence or absence of dissolved ozone residual during advanced wastewater treatment with O3 or O3/H2O2. The use of online UV254 measurements would allow wastewater utilities to optimize the ozone dose required to meet their specific treatment objectives. PMID:19673276

  8. Prompt neutron multiplicities for the transplutonium nuclides

    International Nuclear Information System (INIS)

    The direct determination of the average prompt neutron emission values is reviewed, and a method of comparing different sites of neutron emission multiplicity distribution values is described. Measured and recommended values are tabulated for these nuclides: 241Am, 242Am, 242Cm, 243Cm, 244Cm, 246Cm, 247Cm, 248Cm, 250Cm, 245Cm, 249Bk, 246Cf, 249Cf, 250Cf, 252Cf, 254Cf, 251Cf, 253Es, 254Es, 244Fm, 246Fm, 255Fm, 252No, 254Fm, 256Fm, 257Fm. 59 refs., 24 tabs

  9. Communications dated 15 and 22 March 1994 received from the permanent mission of South Africa to the International Atomic Energy Agency

    International Nuclear Information System (INIS)

    The Director General received notes verbales dated 15 and 22 March 1994 from the Permanent Mission of South Africa providing information on the nuclear export policies and practices of the Government of South Africa. These notes verbales contain, in their attachments, copies of the relevant legislation and other documentation pertaining to South Africa's policy to act in accordance with the provisions of INFCIRC/254/Rev.1/Part 1 and INFCIRC/254/Rev.1/Part 1/Mod.1 and INFCIRC/254/Rev.1/Part 2 as amended. The documents are available on request from the Secretariat of the IAEA

  10. Neutron radiography for nondestructive testing

    International Nuclear Information System (INIS)

    Neutron radiography is similar to X-ray inspection in that both depend upon use of radiation that penetrates some materials and is absorbed by others to provide a contrast image of conditions not readily available for visual inspection. X-rays are absorbed by dense materials, such as metals, whereas neutrons readily penetrate metals, but are absorbed by materials containing hydrogen. The neutron radiography has been successfully applied to a number of inspection situations. These include the inspection of explosives, advanced composites, adhesively bonded structures and a number of aircraft engine components. With the availability of Californium-252, it has become feasible to construct mobile neutron radiography systems suitable for field use. Such systems have been used for in-situ inspection of flight line aircraft, particularly to locate and measure hidden corrosion

  11. Preparation of actinide targets by electrodeposition

    Science.gov (United States)

    Trautmann, N.; Folger, H.

    1989-10-01

    Actinide targets with varying thicknesses on different substrates have been prepared by electrodeposition either from aqueous solutions or from solutions of their nitrates in isopropyl alcohol. With these techniques the actinides can be deposited almost quantitatively on various backing materials within 15 to 30 min. Targets of thorium, uranium, neptunium, plutonium, americium, curium and californium with areal densities from almost carrier-free up to 1.4 mg/cm 2 on thin beryllium, carbon, titanium, tantalum and platinum foils have been prepared. In most cases, prior to the deposition, the actinides had to be purified chemically and for some of them, due to the limited amount of material available, recycling procedures were required. Applications of actinide targets in heavy-ion reactions are briefly discussed.

  12. An atomic beam source for actinide elements: concept and realization

    International Nuclear Information System (INIS)

    For ultratrace analysis of actinide elements and studies of their atomic properties with resonance ionization mass spectroscopy (RIMS), efficient and stable sources of actinide atomic beams are required. The thermodynamics and kinetics of the evaporation of actinide elements and oxides from a variety of metals were considered, including diffusion, desorption, and associative desorption. On this basis various sandwich-type filaments were studied. The most promising system was found to consist of tantalum as the backing material, an electrolytically deposited actinide hydroxide as the source of the element, and a titanium covering layer for its reduction to the metal. Such sandwich sources were experimentally proven to be well suited for the production of atomic beams of plutonium, curium, berkelium and californium at relatively low operating temperatures and with high and reproducible yields. (orig.)

  13. Environmental assessment of the thermal neutron activation explosive detection system for concourse use at US airports

    International Nuclear Information System (INIS)

    This document is an environmental assessment of a system designed to detect the presence of explosives in checked airline baggage or cargo. The system is meant to be installed at the concourse or lobby ticketing areas of US commercial airports and uses a sealed radioactive source of californium-252 to irradiate baggage items. The major impact of the use of this system arises from direct exposure of the public to scattered or leakage radiation from the source and to induced radioactivity in baggage items. Under normal operation and the most likely accident scenarios, the environmental impacts that would be created by the proposed licensing action would not be significant. 44 refs., 19 figs., 18 tabs

  14. A comparative study of bulk etch rate measurement methods in polycarbonate detectors

    International Nuclear Information System (INIS)

    The response of a plastic detector to an incoming charged particle is given by the ratio of track etch rate vt to bulk etch rate vg along its path. Although the accurate determination of vt offers no difficulty as cone length can be comfortably measured, there seems to be a certain ambiguity as how to measure vg. Several LEXAN and TUFFAK polycarbonate plates have been exposed to normally incident Californium-252 fission fragments, etched in a stirred aqueous NaOH solution saturated with etch products and with a 0.05% of Dowfax surfactant, for different etching times, concentrations and temperatures. We have used three methods to measure vg and we obtain consistent results in agreement with those published in the literature. Surface quality and, consequently, ellipses neatness, are far superior in TUFFAK than in LEXAN. (author)

  15. A Novel Approach to β-delayed Neutron Spectroscopy Using the Beta-decay Paul Trap

    International Nuclear Information System (INIS)

    A new approach to β-delayed neutron spectroscopy has been demonstrated that circumvents the many limitations associated with neutron detection by instead inferring the decay branching ratios and energy spectra of the emitted neutrons by studying the nuclear recoil. Using the Beta-decay Paul Trap, fission-product ions were trapped and confined to within a 1-mm3 volume under vacuum using only electric fields. Results from recent measurements of 137I+ and plans for development of a dedicated ion trap for future experiments using the intense fission fragment beams from the Californium Rare Isotope Breeder Upgrade (CARIBU) facility at Argonne National Laboratory are summarized. The improved nuclear data that can be collected is needed in many fields of basic and applied science such as nuclear energy, nuclear astrophysics, and stockpile stewardship

  16. Devices for rapid protein determination in grain products and mixed feeds by the neutron method

    International Nuclear Information System (INIS)

    Protein determination should be carried out using rapid techniques so that each truckful of grain can be checked for protein while mixed feeds can be checked for protein directly in the product flow lines with automatic correction of their work. The existing methods of protein determination do not meet the above requirements. In this connection, the Azot analyzer has beem developed based on the reaction of capture of thermal neutrons by the nuclei of the nitrogen present in the analyzed product and the registration of the resulting gamma-quanta emission of 10.8 Mev. Readings of the nitrogen will be converted to those of protein with the help of standard conversion coefficients. Alongside with protein content, the Azot can measure the test weight of the grain by absorbing californium 252 neutrons

  17. Probe for the exploration of deposits

    International Nuclear Information System (INIS)

    The exploration probes work by means of a prompt (n,γ) analysis, activation analysis or X-ray fluorescence analysis. The neutrons or gamma radiation are provided by a californium-252 source or a cobalt-57 source which are placed in the probe. The probe is in the form of a pipe consisting of single modules. Each module contains a part of the whole radiation producing, shielding, detector, detector cooling and detector electronic system. They can be screwed onto one another and can be exchanged for other parts. A melt cryostatat or a compressor is used as cooling device, a germanium-(Li) detector as detector, and bismuth and heavy water as shielding. All measuring process can thus be carried out in situ in a relatively short measuring time. (DG)

  18. Robotics and remote systems applications

    International Nuclear Information System (INIS)

    This article is a review of numerous remote inspection techniques in use at the Savannah River (and other) facilities. These include: (1) reactor tank inspection robot, (2) californium waste removal robot, (3) fuel rod lubrication robot, (4) cesium source manipulation robot, (5) tank 13 survey and decontamination robots, (6) hot gang valve corridor decontamination and junction box removal robots, (7) lead removal from deionizer vessels robot, (8) HB line cleanup robot, (9) remote operation of a front end loader at WIPP, (10) remote overhead video extendible robot, (11) semi-intelligent mobile observing navigator, (12) remote camera systems in the SRS canyons, (13) cameras and borescope for the DWPF, (14) Hanford waste tank camera system, (15) in-tank precipitation camera system, (16) F-area retention basin pipe crawler, (17) waste tank wall crawler and annulus camera, (18) duct inspection, and (19) deionizer resin sampling

  19. Utilization of radiation facilities at TNRC for shielding researches and related topics

    International Nuclear Information System (INIS)

    This paper presents the running shielding research activities at Tajura Nuclear research center. The main area of researches are concentrated on the investigation of different types of concrete made from local materials such as conventional concrete, Magnetite-Limonite concrete, and heat resistant concrete. The measuring techniques used were neutron-gamma spectrometry, and activation foils. The measurements were performed using collimated beam of reactor neutrons emitted from one of the horizontal channels, as well as from californium-252 neutron source. The transmitted neutron spectra through concrete barriers of different thicknesses were measured by a scintillation spectrometer with NE-213 liquid organic scintillator. A non-destructive testing of some reactor materials were also carried out using neutron and gamma ray computerized tomography technique (CT). Some experiments were also carried out related to measurements of neutron depth dose distributions inside tissue equivalent materials. 10 figs

  20. Nuclear fission and the transuranium elements

    International Nuclear Information System (INIS)

    Many of the transuranium elements are produced and isolated in large quantities through the use of neutrons furnished by nuclear fission reactions: plutonium (atomic number 94) in ton quantities; neptunium (93), americium (95), and curium (96) in kilogram quantities; berkelium (97) in 100 milligram quantities; californium (98) in gram quantities; and einsteinium (99) in milligram quantities. Transuranium isotopes have found many practical applications---as nuclear fuel for the large-scale generation of electricity, as compact, long-lived power sources for use in space exploration, as means for diagnosis and treatment in the medical area, and as tools in numerous industrial processes. Of particular interest is the unusual chemistry and impact of these heaviest elements on the periodic table. This account will feature these aspects. 9 refs., 5 figs

  1. Potential nuclear safeguards applications for neutron generators

    International Nuclear Information System (INIS)

    Many nuclear safeguards inspection instruments use neutron sources to interrogate the fissile material (commonly 235U and 239Pu) to be measured. The neutron sources currently used in these instruments are isotopics such as Californium-252, Americium-Lithium, etc. It is becoming increasingly more difficult to transport isotopic sources from one measurement location to another. This represents a significant problem for the International Atomic Energy Agency (IAEA) safeguards inspectors because they must take their safeguards instruments with them to each nuclear installation to make an independent measurement. Purpose of this paper is to review the possibility of replacing isotopic neutron sources now used in IAEA safeguards instruments with electric neutron sources such as deuterium-tritium (D-T, 14-MeV neutrons) or deuterium-deuterium (D-D, 2-MeV neutrons). The potential for neutron generators to interrogate spent-light water reactor fuel assemblies in storage pools is also reviewed

  2. Reliability of semiconductor and gas-filled diodes for over-voltage protection exposed to ionizing radiation

    Directory of Open Access Journals (Sweden)

    Stanković Koviljka

    2009-01-01

    Full Text Available The wide-spread use of semiconductor and gas-filled diodes for non-linear over-voltage protection results in a variety of possible working conditions. It is therefore essential to have a thorough insight into their reliability in exploitation environments which imply exposure to ionizing radiation. The aim of this paper is to investigate the influence of irradiation on over-voltage diode characteristics by exposing the diodes to californium-252 combined neutron/gamma radiation field. The irradiation of semiconductor over-voltage diodes causes severe degradation of their protection characteristics. On the other hand, gas-filled over-voltage diodes exhibit a temporal improvement of performance. The results are presented with the accompanying theoretical interpretations of the observed changes in over-voltage diode behaviour, based on the interaction of radiation with materials constituting the diodes.

  3. Measurements of the neutron capture cross sections and incineration potentials of minor-actinides in high thermal neutron fluxes: Impact on the transmutation of nuclear wastes

    International Nuclear Information System (INIS)

    This thesis comes within the framework of minor-actinide nuclear transmutation studies. First of all, we have evaluated the impact of minor actinide nuclear data uncertainties within the cases of 241Am and 237Np incineration in three different reactor spectra: EFR (fast), GT-MHR (epithermal) and HI-HWR (thermal). The nuclear parameters which give the highest uncertainties were thus highlighted. As a result of fact, we have tried to reduce data uncertainties, in the thermal energy region, for one part of them through experimental campaigns in the moderated high intensity neutron fluxes of ILL reactor (Grenoble). These measurements were focused onto the incineration and transmutation of the americium-241, the curium-244 and the californium-249 isotopes. Finally, the values of 12 different cross sections and the 241Am isomeric branching ratio were precisely measured at thermal energy point. (author)

  4. Multi-purpose neutron radiography system

    International Nuclear Information System (INIS)

    A conceptual design is given for a low cost, multipurpose radiography system suited for the needs of the Los Alamos National Laboratory (LANL). The proposed neutron source is californium-252. One purpose is to provide an in-house capability for occasional, reactor quality, neutron radiography thus replacing the recently closed Omega-West Reactor. A second purpose is to provide a highly reliable standby transportable neutron radiography system. A third purpose is to provide for transportable neutron probe gamma spectroscopy techniques. The cost is minimized by shared use of an existing x-ray facility, and by use of an existing transport cask. The achievable neutron radiography and radioscopy performance characteristics have been verified. The demonstrated image qualities range from high resolution gadolinium - SR film, with L:D = 100:1, to radioscopy using a LIXI image with L:D = 30:1 and neutron fluence 3.4 x 105 n/cm2

  5. Measurements of the neutron capture cross sections and incineration potentials of minor-actinides in high thermal neutron fluxes: Impact on the transmutation of nuclear wastes; Mesures des sections efficaces de capture et potentiels d'incineration des actinides mineurs dans les hauts flux de neutrons: Impact sur la transmutation des dechets

    Energy Technology Data Exchange (ETDEWEB)

    Bringer, O

    2007-10-15

    This thesis comes within the framework of minor-actinide nuclear transmutation studies. First of all, we have evaluated the impact of minor actinide nuclear data uncertainties within the cases of {sup 241}Am and {sup 237}Np incineration in three different reactor spectra: EFR (fast), GT-MHR (epithermal) and HI-HWR (thermal). The nuclear parameters which give the highest uncertainties were thus highlighted. As a result of fact, we have tried to reduce data uncertainties, in the thermal energy region, for one part of them through experimental campaigns in the moderated high intensity neutron fluxes of ILL reactor (Grenoble). These measurements were focused onto the incineration and transmutation of the americium-241, the curium-244 and the californium-249 isotopes. Finally, the values of 12 different cross sections and the {sup 241}Am isomeric branching ratio were precisely measured at thermal energy point. (author)

  6. Triton and alpha-particle contribution from LiF converter for neutron dosimeter

    CERN Document Server

    Camacho, M E; Balcazar, M

    1999-01-01

    A personnel neutron dosimeter prototype based on chemical and electrochemical etched CR-39 detector, combined with LiF converter, has been calibrated using an ICRP-like phantom, under a heavy-water moderated Californium source neutron spectra; A conversion factor of 1.052+-126 spots cm sup - sup 2 mSv sup - sup 1 was obtained. The sealing properties of the detector holder showed a ten-fold reduction in radon background when it was tested in a high radon atmosphere. A convenient mechanical shock resistance was achieved in LiF converters by sintering to 11 tons pressure LiF powder at 650 deg. C, during one hour.

  7. Nuclear fission and the transuranium elements

    Energy Technology Data Exchange (ETDEWEB)

    Seaborg, G.T.

    1989-02-01

    Many of the transuranium elements are produced and isolated in large quantities through the use of neutrons furnished by nuclear fission reactions: plutonium (atomic number 94) in ton quantities; neptunium (93), americium (95), and curium (96) in kilogram quantities; berkelium (97) in 100 milligram quantities; californium (98) in gram quantities; and einsteinium (99) in milligram quantities. Transuranium isotopes have found many practical applications---as nuclear fuel for the large-scale generation of electricity, as compact, long-lived power sources for use in space exploration, as means for diagnosis and treatment in the medical area, and as tools in numerous industrial processes. Of particular interest is the unusual chemistry and impact of these heaviest elements on the periodic table. This account will feature these aspects. 9 refs., 5 figs.

  8. General purpose nuclear irradiation chamber

    International Nuclear Information System (INIS)

    Nuclear technology has found a great need for use in medicine, industry, and research. Smoke detectors in our homes, medical treatments and new varieties of plants by irradiating its seeds are just a few examples of the benefits of nuclear technology. Portable neutron source such as Californium-252, available at Industrial Technology Division (BTI/ PAT), Malaysian Nuclear Agency, has a 2.645 year half-life. However, 252Cf is known to emit gamma radiation from the source. Thus, this chamber aims to provide a proper gamma shielding for samples to distinguish the use of mixed neutron with gamma-rays or pure neutron radiation. The chamber is compatible to be used with other portable neutron sources such as 241Am-Be as well as the reactor TRIGA PUSPATI for higher neutron dose. This chamber was designed through a collaborative effort of Kulliyyah Engineering, IIUM with the Industrial Technology Division (BTI) team, Malaysian Nuclear Agency. (Author)

  9. Experimental survey of the potential energy surfaces associated with fission

    International Nuclear Information System (INIS)

    Progress in the experimental determination of the properties of the potential energy surface associated with fission is reviewed. The importance of nuclear symmetry effects on the calculation of fission widths is demonstrated. Evidence is presented for the fragmentation of the mass-asymmetric second barrier in the thorium region and the axial asymmetric first barrier in the californium region. Detailed analyses of experimental data suggest the presence of two parallel second barriers; the normal mass-asymmetric, axial-symmetric barrier and a slightly higher mass-symmetric, axial-asymmetric barrier. Experimental barrier parameters are determined systematically and compared with calculations from various theoretical models. Techniques for expanding fission probability measurements to higher energies are discussed. (author)

  10. Separation of 248Cm (III) from 252Cf (III) and its use in time resolved fluorescence spectroscopic (TRFS) studies

    International Nuclear Information System (INIS)

    The present report gives a description of the methodology for the separation of 248Cm(III) from decayed 252Cf (III) waste solution. The waste solution was first assayed for 252Cf content by neutron counting using a neutron well coincidence counter. The sample was subjected to the chemical separation of 248Cm (III) from 252Cf (III) following anion and cation exchange chromatography. The alpha spectrum of the separated curium fraction showed peaks due to 246Cm and 248Cm while the corresponding alpha spectrum of californium fraction showed 249,250,251,252Cf. The gamma ray abundances of 249Cf were determined with respect to its gamma rays of 387 keV and the data agreed well with that in literature. Separated Cm(III) was further characterized by recording its time resolved fluorescence spectrum (TRFS) in aqueous medium. (author)

  11. Effects of 252Cf neutrons, transmitted through an iron block on human lymphocyte chromosome

    International Nuclear Information System (INIS)

    Chromosome aberration of human peripheral blood lymphocytes exposed to californium-252 (252Cf) neutrons transmitted through a 15 cm thick iron block was analysed. The spectrum of the filtered neutrons ranged from 0.1 to 2MeV with a peak at 0.7 MeV, simulating the Hiroshima atomic bomb neutron spectrum as shown in the Dosimetry System 1986 (DS86). Chromosome aberration frequencies after exposure to filtered and unfiltered 252Cf radiation were compared. Acentric ring chromosomes were significantly increased (p 0.1). The relative biological effectiveness (RBE) of the neutrons with respect to the formation of dicentrics and centric rings was 10.9 and 12.3 in the filtered and unfiltered conditions respectively, but the difference was not statistically significant. These results provide useful information for the re-evaluation of the biological effect of the Hiroshima atomic bomb radiations. (Author)

  12. Test and evaluation results of the 252Cf shuffler at the Savannah River Plant

    International Nuclear Information System (INIS)

    The 252Cf Shuffler, a nondestructive assay instrument employing californium neutron source irradiation and delayed-neutron counting, was developed for measuring 235U content of scrap and waste items generated at the Savannah River Plant (SRP) reactor fuel fabrication facility. The scrap and waste items include high-purity uranium-aluminum alloy ingots as well as pieces of castings, saw and lathe chips from machining operations, low-purity items such as oxides of uranium or uranium intermixed with flux materials found in recovery operations, and materials not recoverable at SRP such as floor sweepings or residues from the uranium scrap recovery operation. The uranium contains about 60% 235U with the remaining isotopes being 236U, 238U, and 234U in descending order. The test and evaluation at SRP concluded that the accuracy, safety, reliability, and ease of use made the 252Cf Shuffler a suitable instrument for routine use in an industrial, production-oriented plant

  13. Highly charged ions for atomic clocks and search for variation of the fine structure constant

    CERN Document Server

    Dzuba, V A

    2015-01-01

    We review a number of highly charged ions which have optical transitions suitable for building extremely accurate atomic clocks. This includes ions from Hf$^{12+}$ to U$^{34+}$, which have the $4f^{12}$ configuration of valence electrons, the Ir$^{17+}$ ion, which has a hole in almost filled $4f$ subshell, the Ho$^{14+}$, Cf$^{15+}$, Es$^{17+}$ and Es$^{16+}$ ions. Clock transitions in most of these ions are sensitive to variation of the fine structure constant, $\\alpha$ ($\\alpha = e^2/\\hbar c$). E.g., californium and einsteinium ions have largest known sensitivity to $\\alpha$-variation while holmium ion looks as the most suitable ion for experimental study. We study the spectra of the ions and their features relevant to the use as frequency standards.

  14. The CARIBU EBIS control and synchronization system

    Science.gov (United States)

    Dickerson, Clayton; Peters, Christopher

    2015-01-01

    The Californium Rare Isotope Breeder Upgrade (CARIBU) Electron Beam Ion Source (EBIS) charge breeder has been built and tested. The bases of the CARIBU EBIS electrical system are four voltage platforms on which both DC and pulsed high voltage outputs are controlled. The high voltage output pulses are created with either a combination of a function generator and a high voltage amplifier, or two high voltage DC power supplies and a high voltage solid state switch. Proper synchronization of the pulsed voltages, fundamental to optimizing the charge breeding performance, is achieved with triggering from a digital delay pulse generator. The control system is based on National Instruments realtime controllers and LabVIEW software implementing Functional Global Variables (FGV) to store and access instrument parameters. Fiber optic converters enable network communication and triggering across the platforms.

  15. Neutrons in cancer therapy

    Science.gov (United States)

    Allen, Barry J.

    1995-03-01

    The role of neutrons in the management of cancer has a long history. However, it is only in recent years that neutrons are beginning to find an accepted place as an efficacious radiation modality. Fast neutron therapy is already well established for the treatment of certain cancers, and clinical trials are ongoing. Californium neutron sources are being used in brachytherapy. Boron neutron capture therapy has been well tested with thermal neutrons and epithermal neutron dose escalation studies are about to commence in the USA and Europe. Possibilities of neutron induced auger electron therapy are also discussed. With respect to chemotherapy, prompt neutron capture analysis is being used to study the dose optimization of chemotherapy in the management of breast cancer. The rationales behind these applications of neutrons in the management of cancer are examined.

  16. Gender differences in seasonal movement of dice snakes in Histria, southeastern Romania

    Czech Academy of Sciences Publication Activity Database

    Kärvemo, S.; Carlsson, M.; Tudor, M.; Sloboda, M.; Mihalca, A. D.; Ghira, I.; Bel, L.; Modrý, David

    2011-01-01

    Roč. 18, 20 September 2011 (2011), s. 245-254. ISSN 0934-6643 Institutional support: RVO:60077344 Keywords : Squamata * Natrix tessellata * dice snake * seasonal movements * activity patterns * sex ratio Subject RIV: EG - Zoology

  17. Vegetation strategy of Vellozia crinita (Velloziaceae)

    Czech Academy of Sciences Publication Activity Database

    Alves, R. J. V.; Kolbek, Jiří

    2010-01-01

    Roč. 65, č. 2 (2010), s. 254-264. ISSN 0006-3088 Institutional research plan: CEZ:AV0Z6005908 Keywords : campo rupestre * cerrado * Brazil Subject RIV: EF - Botanics Impact factor: 0.609, year: 2010

  18. Dicty_cDB: Contig-U10492-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available d = Plus / Plus Query: 14 aaaacncttggtttnaacatgcttcaaangccnttcatcatttatccnttcannnnnnna 7...gccnttcatcatttatccnttcattttntta 73 Query: 74 cgtcaattaagnggnganacaaatntactcgttgangntggngccctttggnttaana...at 133 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 74 cgtcaattaagnggnganacaaatntactcgttgan...ggccgatccntattatattttaccnttagnatnttcaattttccaanatggn 193 Query: 194 tccgttngtttntcaangnctgatganactagnccaatgatgaaaacna...gnctgatganactagnccaatgatgaaaacnattangncttcn 253 Query: 254 ttttgntttttacccttagnttttac

  19. Shorelines Extracted from 1984-2015 Landsat Imagery: Horn Island, Mississippi (Polygon: Individual Dates)

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — Shorelines Extracted from 1984-2015 Landsat Imagery: Horn Island, Mississippi (Polygon: Individual Dates) is a dataset consisting of 254 polygon shapefiles...

  20. Je to neobyčejně milý člověk, ten znamenitý Einstein! (Reflexe Viktora Trkala ze studijního pobytu na univerzitě v Leidenu v letech 1919-1920)

    Czech Academy of Sciences Publication Activity Database

    Těšínská, Emilie

    2015-01-01

    Roč. 60, č. 3 (2015), s. 239-254. ISSN 0032-2423 Institutional support: RVO:68378114 Keywords : general theory of relativity * Albert Einstein * history of science * Viktor Trkal Subject RIV: AB - History

  1. Dicty_cDB: Contig-U10738-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ) Peperomia caperata RNA polymerase II second large... 80 7e-38 7 ( AY699209 ) Cephalotaxus fortunei RNA po...se... 254 5e-75 AY699209_1( AY699209 |pid:none) Cephalotaxus fortunei RNA polymer

  2. KWIC Index of nuclear codes (1975 edition)

    International Nuclear Information System (INIS)

    It is a KWIC Index for 254 nuclear codes in the Nuclear Code Abstracts (1975 edition). The classification of nuclear codes and the form of index are the same as those in the Computer Programme Library at Ispra, Italy. (auth.)

  3. Intact brown seaweed (Ascophyllum nodosum) in diets of weaned piglets: Effects on performance, gut bacteria and morphology and plasma oxidative status

    Czech Academy of Sciences Publication Activity Database

    Michiels, J.; Skřivanová, E.; Missotten, J.; Ovyn, A.; Mrázek, Jakub; De Smet, S.; Dierick, N.

    2012-01-01

    Roč. 96, č. 6 (2012), s. 1101-1111. ISSN 0931-2439 Institutional support: RVO:67985904 Keywords : antioxidant * gut function * weaning piglets Subject RIV: FB - Endocrinology, Diabetology, Metabolism, Nutrition Impact factor: 1.254, year: 2012

  4. Joint analysis of Rayleigh-wave dispersion and HVSR of lunar seismic data from the Apollo 14 and 16 sites

    Czech Academy of Sciences Publication Activity Database

    Dal Moro, Giancarlo

    2015-01-01

    Roč. 254, JUL 1 (2015), s. 338-349. ISSN 0019-1035 Institutional support: RVO:67985891 Keywords : moon * Regoliths * geophysics * surface- wave Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 3.038, year: 2014

  5. Glia: the fulcrum of brain diseases

    Czech Academy of Sciences Publication Activity Database

    Giaume, C.; Kirchhoff, F.; Matute, C.; Reichenbach, A.; Verkhratsky, Alexei

    2007-01-01

    Roč. 14, - (2007), s. 1324-1335. ISSN 1350-9047 Institutional research plan: CEZ:AV0Z50390512 Keywords : Glia * Astrocyte * Oligodendrocyte Subject RIV: FH - Neurology Impact factor: 8.254, year: 2007

  6. Stát se kentaurem

    Czech Academy of Sciences Publication Activity Database

    Sarkissian, Alena

    Brno : Městské divadlo Brno, 2008, s. 131-148. ISBN 978-80-254-2057-7 Institutional research plan: CEZ:AV0Z90090514 Keywords : deep psychology * Sigmund Freud * mythology Subject RIV: AA - Philosophy ; Religion

  7. Reconstruction of effective cloud field geometry from series of sunshine number

    Czech Academy of Sciences Publication Activity Database

    Badescu, V.; Paulescu, M.; Brabec, Marek

    176-177, 1 July - 1 August ( 2016 ), s. 254-266. ISSN 0169-8095 Institutional support: RVO:67985807 Keywords : cloud field geometry * sunshine number * point cloudiness Impact factor: 2.844, year: 2014

  8. Doslov k českému vydání : Tim Flannery, Bjorn Lomborg a česká realita

    Czech Academy of Sciences Publication Activity Database

    Mikuláš, Radek

    Praha: Dokořán, 2007, s. 254-256 ISBN 978-80-7363-121-5 Institutional research plan: CEZ:AV0Z30130516 Keywords : climate change * nature protection Subject RIV: DG - Athmosphere Sciences, Meteorology

  9. Pobladoras, Indígenas, and the State: Difference, Equality, and Women’s Rights in Chile [book review

    OpenAIRE

    Valiente Fernández, Celia

    2004-01-01

    Este artículo reseña: Patricia Richards. Pobladoras, Indígenas, and the State: Difference, Equality, and Women’s Rights in Chile. New Brunswick: Rutgers University Press, 2004. p. 254. ISBN 0813534232

  10. Carotenoid-protein interaction alters the S1 energy of hydroxyechinenone in the Orange Carotenoid Protein

    Czech Academy of Sciences Publication Activity Database

    Polívka, Tomáš; Chábera, P.; Kerfeld, C.A.

    2013-01-01

    Roč. 1827, č. 3 (2013), s. 248-254. ISSN 0005-2728 Institutional support: RVO:60077344 Keywords : orange-carotenoid protein * excited states * photoprotection Subject RIV: BO - Biophysics Impact factor: 4.829, year: 2013

  11. Filosofie a společnost v českých zemích I

    Czech Academy of Sciences Publication Activity Database

    Hermann, Tomáš

    Pardubice : Univerzita Pardubice, 2011 - (Hejduk, T.), s. 241-254 ISBN 978-80-7395-383-6 Institutional research plan: CEZ:AV0Z80630520 Keywords : Czech philosophy * philosophy and culture * Czech history and Europe Subject RIV: AB - History

  12. Zpráva o stavu migračních studií na půdě veřejné výzkumné instituce

    Czech Academy of Sciences Publication Activity Database

    Leontiyeva, Yana; Vojtková, Michaela

    Praha : Ministerstvo vnitra ČR, 2010, s. 97-106. ISBN 978-80-254-8008-3 Institutional research plan: CEZ:AV0Z70280505 Keywords : migration * policy making * scientific research Subject RIV: AO - Sociology, Demography

  13. Small molecule inhibitors of protein interaction with glycosaminoglycans (SMIGs), a novel class of bioactive agents with anti-inflammatory properties

    Czech Academy of Sciences Publication Activity Database

    Harris, N.; Kogan, F. Y.; Ilková, G.; Juhás, Štefan; Lahmy, O.; Gregor, Y. I.; Koppel, J.; Zhuk, R.; Gregor, P.

    2014-01-01

    Roč. 1840, č. 1 (2014), s. 245-254. ISSN 0304-4165 Institutional support: RVO:67985904 Keywords : heparan sulfate * heparin binding protein * glycosaminoglycan Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 4.381, year: 2014

  14. Adjustment under trade liberalization, labor market segmentation, and informal employment: A dynamic general equilibrium analysis of a three-sector-open economy

    OpenAIRE

    D. Sirin Saracoglu

    2009-01-01

    Mazumdar, D. (1983), "Segmented Labor Markets in LCDs", The American Economic Review (Papers and Proceedings of the Ninety-fifth Annual Meeting of the American Economic Association), 73 (2), pp. 254-259.

  15. 78 FR 73697 - New Animal Drugs; Hyaluronate Sodium; Hydrogen Peroxide; Imidacloprid and Moxidectin; Change of...

    Science.gov (United States)

    2013-12-09

    ... dogs and the treatment and control of sarcoptic mange caused by Sarcoptes scabiei var. canis. 141-254... heartworm-positive dogs and the treatment and control of sarcoptic mange caused by Sarcoptes scabiei...

  16. Detection and molecular analysis of Hop latent virus and Hop latent viroid in hop samples from Poland

    Czech Academy of Sciences Publication Activity Database

    Ziegler, A.; Kawka, M.; Przybys, M.; Doroszewska, T.; Skomra, U.; Kastirr, U.; Matoušek, Jaroslav; Schubert, J.

    2014-01-01

    Roč. 66, č. 7 (2014), s. 248-254. ISSN 1867-0911 Institutional support: RVO:60077344 Keywords : real-time PCR diagnosis * hop virus * Humulus lupulus * viroid Subject RIV: EB - Genetics ; Molecular Biology

  17. A new macrocyclic trichochecene from soil fungus

    Institute of Scientific and Technical Information of China (English)

    2002-01-01

    From fermentation broth of soil fungus 254-2 obtained from Yunnan province,a new macrocylic trichochecene was isolated.The structure was determined on the basis of spectroscopic evidences especially the 2-D NMR spectra.

  18. Study of reproducibility of measurements with the spectrometer of Bonner multispheres

    Energy Technology Data Exchange (ETDEWEB)

    Azevedo, G.A.; Pereira, W.W.; Patrao, K.C.S.; Fonseca, E.S., E-mail: geisadeazevedo@gmail.com, E-mail: walsan@ird.gov.br, E-mail: karla@ird.gov.br, E-mail: evaldo@ird.gov.br [Instituto de Radionprotecao e Dosimetria (IRD/CNEN-RJ), Rio de Janeiro, RJ (Brazil)

    2013-07-01

    This work aims to study the metrological behavior of the Bonner Multisphere Spectrometer (BMS) of the LN / LNMRI / IRD - Laboratorio Metrologia de Neutrons / Laboratorio Nacional de Metrologia e Radiacao Ionizante / Instituto de Radioprotecao e Dosimetria, for measurements in repeatability and reproducibility conditions. Initially, a simulation was done by applying the Monte Carlo method, using the MCNP code and respecting the ISO 8529-1 (2001), using the sources of Californium ({sup 252} Cf), Americium-Beryllium ({sup 241} AmBe) and californium in heavy water (Cf + D{sub 2}O), all located at a distance of 100 cm from the neutron detector ({sup 6}Li (Eu) - crystal scintillator). In this program, the counting of neutrons that are captured by the detector was made. The source is located in the center of a sphere of radius 300 cm. Analyzes the impact of these neutrons in a point of the sphere wall, which in this case acted as a neutron detector and from there, it is estimated the number of neutrons that collide in the whole sphere. The purpose is to obtain the neutron count for different energy bands in a solid field of neutrons, since they have a spectrum ranging from a low to a high energy that can also vary within a particular environment. Wishes to obtain new fields with different sources and moderators materials to be used as new reference fields. Measurements are being conducted for these fields, with the aim of analyzing the variability conditions of the measurement (repeatability and reproducibility) in LEN - Laboratorio de Espectrometria de Neutrons of the LN/LMNRI/IRD. Thus, the spectrometer will be used to improve both the knowledge of the spectrum as the standard of neutrons of the lab, proving that a spectrometry is essential for correct measurement.

  19. Clip-On Extensometer

    Science.gov (United States)

    Holmes, A. M. C.; Duggan, M. C.

    1986-01-01

    Flexural clamp eliminates problems of operator variability. Extensometer opens and closes like clothespin and placed easily on specimen. Dimensions of block specimen are 1 by 1 by 2.2 inches (2.54 by 2.54 by 5.59 centimeters). By constructing central flexure units of various widths, one adapts extensometer to handle specimens ranging from thin strips to those many inches thick. New design reduces measurement errors caused by variability among test operators.

  20. Milnor open books of links of some rational surface singularities

    OpenAIRE

    Özbağcı, Burak; Bhupal, Mohan

    2011-01-01

    Pacific Journal of Mathematics MILNOR OPEN BOOKS OF LINKS OF SOME RATIONAL SURFACE SINGULARITIES MOHAN BHUPAL AND BURAK OZBAGCI Volume 254 No. 1 November 2011 PACIFIC JOURNAL OF MATHEMATICS Vol. 254, No. 1, 2011 MILNOR OPEN BOOKS OF LINKS OF SOME RATIONAL SURFACE SINGULARITIES MOHAN BHUPAL AND BURAK OZBAGCI We determine Legendrian surgery diagrams for the canonical contact struc-tures of links of rational surface singularities that are also small Seifert...

  1. AcEST: BP914613 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ICFAGYVLHYL 176 Query: 368 INNLDTTEFYIALLVFLFATVTALTILGRLYLGMHSPIDVTA 493 L + A LF V L I GRLYLGMHSPIDV A Sbjct: 177 NGQLVEPRAF-ATTAVLFTIVVLLVISGRLYLGMHSPIDVLA 217 ... ... PSS+T N +S L LY I + Sbjct: 123 LSGFFKDYWCLPRPRAPPLHRITLSEYT---TKEYGAPSSHTANATGVS-LLFLYNIWRM 178 Query: 380 DTTEFYIALL---VFLFAT...PFTHWNIDPNLSRRLVVIWVLVMYIGQVAKDILKWPRPSFP- 102 Query: 254 XXXFTATESEKDFALEYGLPSSYTINTICLSGYLLLYLINNLDTTEFYIALLVFLFAT... 124 Query: 245 XXXXXXFTATESEKDFALEYGLPSSYTINTICLSGYLLLYLINNLDTTE-----FYIALL 409 T + D EYG P...PSSP- 147 Query: 254 XXXFTATESEKDFALEYGLPSSYTINTICLSGYLLLYLINNLDTTEFYIALLVFLFATVT 433 + EK EYG+PS++ +

  2. UV-radiation and the flavonoid content in callus culture of Ononis arvensis L

    International Nuclear Information System (INIS)

    The paper discussed a possible influence on the production of secondary metabolites - the flavonoids, by the method of elicitation in the callus cultures of Ononis arvensis L., the elicitor employed being the UV 254 and 366 nm and the sun-lamp. In some cases there was an increase in the production of flavonoids particularly 60, 120, 240 and 300 s after sun-lamp irradiation and in case of 15 and 30 min irradiation with UV-254 nm

  3. Domain Modeling: NP_001234.2 [SAHG[Archive

    Lifescience Database Archive (English)

    Full Text Available NP_001234.2 chr1 HUMAN NOTCH-1 EGFS 11-13 c1toza_ chr1/NP_001234.2/NP_001234.2_apo_...254-367.pdb c2vj3a_ chr1/NP_001234.2/NP_001234.2_holo_254-367.pdb psi-blast 447L,448R,449S,465S,466Q,467P,46

  4. Drug: D00132 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D00132 Drug Ketoprofen ... (JP16/USP/INN); Orudis (TN) C16H14O3 254.0943 254.2806 D00132.gif Anti-in ... esics, anti-inflammatory agents 1149 Others D00132 Ketoprofen ... (JP16/USP/INN) 2 Agents affecting individual organ ... gents, anti-inflammatory agents 2649 Others D00132 Ketoprofen ... (JP16/USP/INN) Anatomical Therapeutic Chemical (AT ...

  5. AcEST: DK962200 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST39A01NGRL0013_D15 584 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0013_D15. 5' end seq ... uery: 254 RNPDMYSWHILLRAYGQNGHVDDAYTTFLQMPLLNNVSWNTMIS TFAQNGHGRRALDVFH 433 PD SW+ +++ Y + G +D A T F +M N ... +SW TMIS ... + Q + AL +FH Sbjct: 177 PEPDDVSWNSVIKGYVKAGKMDIALT ... LFRKMAEKNAISWTTMIS GYVQADMNKEALQLFH 236 Query: 434 QMQLTDTHPNRITLVSVLD ... uery: 254 RNPDMYSWHILLRAYGQNGHVDDAYTTFLQMPLLNNVSWNTMIS TFAQNGHGRRALDVFH 433 + + +W L+ Y +GH GR A+ F Sbjct: ...

  6. Dicty_cDB: VHA104 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ycprkrywwyllctqss*rycyw*rtsyrfpiilcqssftsirilrf hr*ftfphcrssfptmclrslgfnwccqqr*esh*srfshqkekrfsprnprs*qiprkt lnnlsrtlsfqx**snlkkil...ATKEGVVCDENMRGIRFNLYDVTLHT*chpqrwwsnhpncssctlcc*inc lpnslrtnllsrnycprkrywwyllctqss*rycyw*rtsyrfpiilcqssftsiril.... 255 2e-66 DQ357217_1( DQ357217 |pid:none) Leishmania braziliensis elongation...... 254 3e-66 AM494972_26( AM494972 |pid:none) Leishmania braziliensis chromosom... 254 3e-66 CT005272_19( CT00...fnqsyrfprsr*fq frsnccppcy*wcfsryrlrrrclrtnrncitssrr*tyqtslirqqsrsflirtpikh* rslslfp*sy*irq

  7. Monoazo and diazo dye decolourisation studies in a methanogenic UASB reactor

    OpenAIRE

    Gomes, Arlindo Caniço; Gonçalves, Isolina Cabral; Pinheiro, H. M.; Ferra, M .I. A.

    2010-01-01

    Mixed anaerobic bacterial consortia have been show to reduce azo dyes and batch decolourisation tests have also demonstratedthat predominantly methanogenic cultures also perform azo bond cleavage. The anaerobic treatment of wool dyeing effluents, which contain acetic acid, could thus be improved with a better knowledge of methanogenic dye degradation. Therefore, the decolourisation of two azo textile dyes, a monoazo dye (Acid Orange 7, AO7) and a diazo dye (Direct Red 254, DR254), was investi...

  8. Removal of fluorescence and ultraviolet absorbance of dissolved organic matter in reclaimed water by solar light.

    Science.gov (United States)

    Wu, Qianyuan; Li, Chao; Wang, Wenlong; He, Tao; Hu, Hongying; Du, Ye; Wang, Ting

    2016-05-01

    Storing reclaimed water in lakes is a widely used method of accommodating changes in the consumption of reclaimed water during wastewater reclamation and reuse. Solar light serves as an important function in degrading pollutants during storage, and its effect on dissolved organic matter (DOM) was investigated in this study. Solar light significantly decreased the UV254 absorbance and fluorescence (FLU) intensity of reclaimed water. However, its effect on the dissolved organic carbon (DOC) value of reclaimed water was very limited. The decrease in the UV254 absorbance intensity and FLU excitation-emission matrix regional integration volume (FLU volume) of reclaimed water during solar light irradiation was fit with pseudo-first order reaction kinetics. The decrease of UV254 absorbance was much slower than that of the FLU volume. Ultraviolet light in solar light had a key role in decreasing the UV254 absorbance and FLU intensity during solar light irradiation. The light fluence-based removal kinetic constants of the UV254 and FLU intensity were independent of light intensity. The peaks of the UV254 absorbance and FLU intensity with an apparent molecular weight (AMW) of 100Da to 2000Da decreased after solar irradiation, whereas the DOC value of the major peaks did not significantly change. PMID:27155416

  9. Estimating organic micro-pollutant removal potential of activated carbons using UV absorption and carbon characteristics.

    Science.gov (United States)

    Zietzschmann, Frederik; Altmann, Johannes; Ruhl, Aki Sebastian; Dünnbier, Uwe; Dommisch, Ingvild; Sperlich, Alexander; Meinel, Felix; Jekel, Martin

    2014-06-01

    Eight commercially available powdered activated carbons (PAC) were examined regarding organic micro-pollutant (OMP) removal efficiencies in wastewater treatment plant (WWTP) effluent. PAC characteristic numbers such as B.E.T. surface, iodine number and nitrobenzene number were checked for their potential to predict the OMP removal of the PAC products. Furthermore, the PAC-induced removal of UV254 nm absorption (UVA254) in WWTP effluent was determined and also correlated with OMP removal. None of the PAC characteristic numbers can satisfactorily describe OMP removal and accordingly, these characteristics have little informative value on the reduction of OMP concentrations in WWTP effluent. In contrast, UVA254 removal and OMP removal correlate well for carbamazepine, diclofenac, and several iodinated x-ray contrast media. Also, UVA254 removal can roughly describe the average OMP removal of all measured OMP, and can accordingly predict PAC performance in OMP removal. We therefore suggest UVA254 as a handy indicator for the approximation of OMP removal in practical applications where direct OMP concentration quantification is not always available. In continuous operation of large-scale plants, this approach allows for the efficient adjustment of PAC dosing to UVA254, in order to ensure reliable OMP removal whilst minimizing PAC consumption. PMID:24651017

  10. Combination of UV absorbance and electron donating capacity to assess degradation of micropollutants and formation of bromate during ozonation of wastewater effluents.

    Science.gov (United States)

    Chon, Kangmin; Salhi, Elisabeth; von Gunten, Urs

    2015-09-15

    In this study, the changes in UV absorbance at 254 nm (UVA254) and electron donating capacity (EDC) were investigated as surrogate indicators for assessing removal of micropollutants and bromate formation during ozonation of wastewater effluents. To measure the EDC, a novel method based on size exclusion chromatography followed by a post-column reaction was developed and calibrated against an existing electrochemical method. Low specific ozone doses led to a more efficient abatement of EDC than of UVA254. This was attributed to the abatement of phenolic moieties in the dissolved organic matter (DOM), which lose their EDC upon oxidation, but are partially transformed into quinones, which still absorb in the measured UV range. For higher specific ozone doses, the relative EDC abatement was lower than the relative UVA abatement, which can be explained by the oxidation of UV absorbing moieties (e.g. non-activated aromatic compounds), which contribute less to EDC. The abatement of the selected micropollutants (i.e., 17α-ethinylestradiol (EE2), carbamazepine (CBZ), atenolol (ATE), bezafibrate (BZF), ibuprofen (IBU), and p-chlorobenzoic acid (pCBA)) varied significantly depending on their reactivity with ozone in the examined specific ozone dose range of 0-1.45 mgO3/mgDOC. The decrease of EE2 and CBZ with high ozone reactivity was linearly proportional to the reduction of the relative residuals of UVA254 and EDC. The abatement of ATE, BZF, IBU, and pCBA with intermediate to low ozone reactivities was not significant in a first phase (UVA254/UVA254,0 = 1.00-0.70; EDC/EDC0 = 1.00-0.56) while their abatement was more efficient than the degradation of the relative residual UVA254 and much more noticeable than the degradation of the relative residual EDC in a second phase (UVA254/UVA254,0 = 0.70-0.25; EDC/EDC0 = 0.56-0.25) because the partially destroyed UV absorbing and electron donating DOM moieties become recalcitrant to ozone attack. Bromate formation was

  11. Study on Health Safety of Fine Drinking Water by Reverse Osmosis Membrane%反渗透膜制终端直饮水的健康安全性考察

    Institute of Scientific and Technical Information of China (English)

    庞小燕; 宿程远; 黄小玲; 吕明; 陈晶; 黄意

    2011-01-01

    通过动态试验,考察了反渗透膜制终端直饮水系统对有机物、TDS、氨氮、UV254以及硝酸盐等的去除效果;同时分析了进水UV254与CODMn的相关性。试验表明:该系统对CODMnTDS与硝酸盐氮的平均去除率分别为60%、95%和86%,出水的氨氮浓度基本为0;该系统对UV25。的平均去除率为90%,可保证饮水水质安全;同时试验表明进水UV254与CODMn之间有一定的相关性。%The removal effects for organic matters, TDS, NH4 -N, UV254 and nitrate nitrogen by reverse osmosis (RO) system were reviewed through dynamic experiments. This paper also analyzes the correlation between the inflow CODMn and UV254. The results showed that the removal rates of CODM., TDS and nitrate nitrogen by RO system were 60%, 95% and 86% respectively. The NH4 - N concentration of effluent was nearly zero. The average UV254 removal rate was 90%. The health safety of the drinking water is secured and the experiments also proved a certain degree of correlation between the inflow UV254 and CODMn.

  12. Predicting trace organic compound breakthrough in granular activated carbon using fluorescence and UV absorbance as surrogates.

    Science.gov (United States)

    Anumol, Tarun; Sgroi, Massimiliano; Park, Minkyu; Roccaro, Paolo; Snyder, Shane A

    2015-06-01

    This study investigated the applicability of bulk organic parameters like dissolved organic carbon (DOC), UV absorbance at 254 nm (UV254), and total fluorescence (TF) to act as surrogates in predicting trace organic compound (TOrC) removal by granular activated carbon in water reuse applications. Using rapid small-scale column testing, empirical linear correlations for thirteen TOrCs were determined with DOC, UV254, and TF in four wastewater effluents. Linear correlations (R(2) > 0.7) were obtained for eight TOrCs in each water quality in the UV254 model, while ten TOrCs had R(2) > 0.7 in the TF model. Conversely, DOC was shown to be a poor surrogate for TOrC breakthrough prediction. When the data from all four water qualities was combined, good linear correlations were still obtained with TF having higher R(2) than UV254 especially for TOrCs with log Dow>1. Excellent linear relationship (R(2) > 0.9) between log Dow and the removal of TOrC at 0% surrogate removal (y-intercept) were obtained for the five neutral TOrCs tested in this study. Positively charged TOrCs had enhanced removals due to electrostatic interactions with negatively charged GAC that caused them to deviate from removals that would be expected with their log Dow. Application of the empirical linear correlation models to full-scale samples provided good results for six of seven TOrCs (except meprobamate) tested when comparing predicted TOrC removal by UV254 and TF with actual removals for GAC in all the five samples tested. Surrogate predictions using UV254 and TF provide valuable tools for rapid or on-line monitoring of GAC performance and can result in cost savings by extended GAC run times as compared to using DOC breakthrough to trigger regeneration or replacement. PMID:25792436

  13. Toxicity DNA damage and inhibition of DNA repair synthesis in human melanoma cells by concentrated sunlight

    International Nuclear Information System (INIS)

    A water lens was used to focus solar radiation, giving an 8-fold concentration of the total spectrum and a cytocidal flux similar to that of laboratory UV sources. Survival curves for human melanoma cells were similar for sunlight and 254 nm UV. An xeroderma pigmentosum lymphoblastoid line was equally sensitive to both agents and human cell lines sensitive to ionizing radiation (lymphoblastoid lines), crosslinking agents or monofunctional alkylating agents (melanoma lines) had the same 254 nm UV and solar survival responses as appropriate control lines. Two melanoma sublines derived separately by 16 cycles of treatment with sunlight or 254 nm UV were crossresistant to both agents. In one melanoma cell line, DNA strand breaks and DNA protein crosslinking were induced in melanoma cells by sunlight but pyrimidine dimers and DNA interstrand crosslinking could not be detected. The solar fluence response of DNA repair synthesis was much less than that from equitoxic 254 nm UV, reaching a maximum near the D0 value and then declining; but semiconservative DNA synthesis remained high. These effects were not due to changes in thymidine pool sizes. Solar exposure did not have a major effect on 254 nm UV-induced repair synthesis. (author)

  14. Effect of the semi-conductive properties of the passive layer on the current provided by stainless steel microbial cathodes

    International Nuclear Information System (INIS)

    Geobacter sulfurreducens biofilms were formed under constant polarisation at -0.6 V vs. Ag/AgCl on stainless steel cathodes to catalyse the reduction of fumarate. The time-evolution of the current strongly depended on the quality of the inoculum. Inoculating with young cells significantly shortened the initial lag-phase and using the same inoculum improved the reproducibility of the current-time curves. The whole set of experiments showed that 254SMO stainless steel provided higher current densities (on average 14.1 A/m2) than biofilms formed on 316L stainless steel (on average 4.5 A/m2). Biofilm coverage assessed by epifluorescent microscopy showed that coverage ratios were generally higher for 316L than for 254SMO. It must be concluded that 254SMO is more efficient in transferring electrons to bacterial cells than 316L. Mott-Schottky diagrams recorded on both materials under conditions of electrolysis in the absence of microorganisms showed that the surface oxide layers had similar n-type semi-conductive behaviour for potential values higher than the flat band potential. In contrast, 316L exhibited slight p-type behaviour at potential lower than the flat band potential, while 254SMO did not. The higher electrochemical performances of biocathodes formed on 254SMO are explained by semi-conductive properties of its passive layer, which prevented the p-type behaviour occurring in cathodic electrolysis conditions.

  15. Effect of the semi-conductive properties of the passive layer on the current provided by stainless steel microbial cathodes

    Energy Technology Data Exchange (ETDEWEB)

    Pons, Liz; Delia, Marie-Line; Basseguy, Regine [Laboratoire de Genie Chimique, CNRS - Universite de Toulouse, 4 allee Emile Monso BP 84234, 31030 Toulouse (France); Bergel, Alain, E-mail: alain.bergel@ensiacet.f [Laboratoire de Genie Chimique, CNRS - Universite de Toulouse, 4 allee Emile Monso BP 84234, 31030 Toulouse (France)

    2011-02-15

    Geobacter sulfurreducens biofilms were formed under constant polarisation at -0.6 V vs. Ag/AgCl on stainless steel cathodes to catalyse the reduction of fumarate. The time-evolution of the current strongly depended on the quality of the inoculum. Inoculating with young cells significantly shortened the initial lag-phase and using the same inoculum improved the reproducibility of the current-time curves. The whole set of experiments showed that 254SMO stainless steel provided higher current densities (on average 14.1 A/m{sup 2}) than biofilms formed on 316L stainless steel (on average 4.5 A/m{sup 2}). Biofilm coverage assessed by epifluorescent microscopy showed that coverage ratios were generally higher for 316L than for 254SMO. It must be concluded that 254SMO is more efficient in transferring electrons to bacterial cells than 316L. Mott-Schottky diagrams recorded on both materials under conditions of electrolysis in the absence of microorganisms showed that the surface oxide layers had similar n-type semi-conductive behaviour for potential values higher than the flat band potential. In contrast, 316L exhibited slight p-type behaviour at potential lower than the flat band potential, while 254SMO did not. The higher electrochemical performances of biocathodes formed on 254SMO are explained by semi-conductive properties of its passive layer, which prevented the p-type behaviour occurring in cathodic electrolysis conditions.

  16. Degradation of emergent contaminants by UV, UV/H2O2 and neutral photo-Fenton at pilot scale in a domestic wastewater treatment plant.

    Science.gov (United States)

    De la Cruz, N; Esquius, L; Grandjean, D; Magnet, A; Tungler, A; de Alencastro, L F; Pulgarín, C

    2013-10-01

    This study focuses on the removal of 22 selected micropollutants in an effluent from a municipal wastewater treatment plant (MWTP) at pilot scale. A reactor of 37 L with five low pressure mercury lamps emitting at 254 nm (UV254) was used. The 22 micropollutants include 15 pharmaceuticals, 2 X-Ray contrast medias, 1 corrosion inhibitor and 4 biocides/pesticides. Five of these 22 compounds were used as indicative substances as proposed by the Swiss Federal Office for the Environment (FOEN) (carbamazepine, diclofenac, sulfamethoxazole, benzotriazole and mecoprop). Treatments included UV254 light alone, UV254 + H2O2 and UV254 + H2O2+Fe(3+). Wastewater coming from the MWTP already contained iron with an average total iron of 1.6 mg L(-1). Original pH was not modified and remained between 6 and 7. The parameters changed during the experiments to find the optimal conditions were: wastewater flow rate (2-14 m(3) h(-1)), H2O2 concentration (20-50 mg L(-1)) and Fe (III) concentration (0-4 mg L(-1)). Chemicals removal rates were greater than 80% for the majority of the flow rates tested. Operating costs for the different conditions evaluated were also estimated and compared. PMID:23910229

  17. A new type-B cask design for transporting 252Cf

    International Nuclear Information System (INIS)

    A project to design, certify, and build a new US Department of Energy (DOE) Type B container for transporting >5 mg of 252Cf is more than halfway to completion. This project was necessitated by the fact that the existing Oak Ridge National Laboratory (ORNL) Type B containers were designed and built many years ago and thus do not have the records and supporting data that current regulations require. Once the new cask is available, it will replace the existing Type B containers. The cask design is driven by the unique properties of 252Cf, which is a very intense spontaneous fission neutron source and necessitates a large amount of neutron shielding. The cask is designed to contain up to 60 mg of 252Cf in the form of californium oxide or californium oxysulfate, in pellet, wire, or sintered material forms that are sealed inside small special-form capsules. The new cask will be capable of all modes of transport (land, sea, and air). The ORNL team, composed of technical and purchasing personnel and using rigorous selection criteria, chose NAC, International (NAC), as the subcontractor for the project. In January 1997, NAC started work on developing the conceptual design and performing the analyses. The original design concept was for a tungsten alloy gamma shield surrounded by two concentric shells of NS-4-FR neutron shield material. A visit to US Nuclear Regulatory Commission (NRC) regulators in November 1997 to present the conceptual design for their comments resulted in a design modification when the question of potential straight-line cracking in the NS-4-FR neutron shield material arose. NAC's modified design includes offset, wedgelike segments of the neutron shield material. The new geometry eliminates concerns about straight-line cracking but increases the weight of the packaging and makes the fabrication more complex. NAC has now completed the cask design and performed the analyses (shielding, structural, thermal, etc.) necessary to certify the cask. The cask

  18. Stretchable microelectrode array using room-temperature liquid alloy interconnects

    International Nuclear Information System (INIS)

    In this paper, we present a stretchable microelectrode array for studying cell behavior under mechanical strain. The electrode array consists of gold-plated nail-head pins (250 µm tip diameter) or tungsten micro-wires (25.4 µm in diameter) inserted into a polydimethylsiloxane (PDMS) platform (25.4 × 25.4 mm2). Stretchable interconnects to the outside were provided by fusible indium-alloy-filled microchannels. The alloy is liquid at room temperature, thus providing the necessary stretchability and electrical conductivity. The electrode platform can withstand strains of up to 40% and repeated (100 times) strains of up to 35% did not cause any failure in the electrodes or the PDMS substrate. We confirmed biocompatibility of short-term culture, and using the gold pin device, we demonstrated electric field pacing of adult murine heart cells. Further, using the tungsten microelectrode device, we successfully measured depolarizations of differentiated murine heart cells from embryoid body clusters

  19. Activated Carbon Adsorption Properties of the Residual Matters in Textile Dyeing and Printing Secondary Effluent

    Institute of Scientific and Technical Information of China (English)

    TIAN Qing; LI Fang; LIU Fang; YANG Bo; CHEN Ji-hua

    2008-01-01

    The research employed the adsorption isotherm measurement, the batch kinetic adsorption and the rapid small-scale carbon column test (RSSCT) to find out the characteristics and main impacting factors of granular activated carbon (GAC) adsorption, in treating the textile dyeing-printing/polyester alkali de-weighting secondary effluent (TSE). The adsorption affinities and capacities for the organics surrogated by CODCr, color and UV254 (UV absorbency at λ= 254 nm) predicted by isotherm, small-scale-fixed bed were discussed. Adsorption rates for CODCr, color and UV254 are much different and carbon particle size dependent. The color adsorption rate and capacity should be taken as the main consideration factors in designing bio-activated carbon filter(BACF). The breakthrough of GAC adsorption column is mainly influenced by the low MW readily adsorbable organics in TSE. UVm is a good adsorption breakthrough indicator. The study provides References for BACFs' design and operation control in textile secondary effluent (TSE) tertiary treatment.

  20. Dicty_cDB: Contig-U16527-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available S... 1285 0.0 3 ( AM168032 ) Dictyostelium capitatum 18S rRNA gene, isolate...ne, co... 254 0.0 17 ( AF316545 ) Acanthamoeba sp. KA/E12 18S ribosomal RNA gene, c... 254 0.0 17 ( EF025003 ) Uncultured eukaryote...ar... 262 0.0 18 ( EF025035 ) Uncultured eukaryote clone Elev_18S_7101 18S ribo... 254 0.0 17 ( AF333608 ) Aca.... 89 1e-15 AB116235_1( AB116235 |pid:none) Rosellinia sp. PF1022 tef1 gene fo... 89 1e-15 D45837_1( D45837 |pid:none) Neur...tavvyrsewpi*rgsftgsvvagwrapnrhshllyceq whespdvasa*ktcatn*swsvrrpflgmhalshprrrqqcrlsrrvkatrpmq*vteeq *gdllakc

  1. False positivity of Serological tests for hepatitis C virus

    International Nuclear Information System (INIS)

    Background: Hepatitis C virus infection is now one the common infection in Pakistan. Patients are routinely screened by antibody assays. Objective of this study was to assess the viremia in patients labelled as anti-HCV positive by ELISA. Methods: It this retrospective study patients labelled as anti HCV positive by ELISA were assessed for HCV RNA by polymerase chain reaction. The 254 HCV positive cases which were analysed by MEIA method on AxSYM System were selected for RNA extraction by RT-PCR upon Cepheid thermal cycler using TaqMan technology and subsequent for amplification. Results: Out of 254 anti HCV positive by ELISA, viremia was shown in 211 patients; the remaining 43 (16.92%) samples were false positive. Conclusion: Out of a total 254 anti HCV positive patients, 211 had viremia by RT-PCR. The false positivity noted was 16.9%. (author)

  2. Action spectrum for phototherapy of psoriasis

    International Nuclear Information System (INIS)

    Using a monochromator the action spectrum for ultraviolet phototherapy of psoriasis was determined for radiation between 254 and 313 nm and compared to the action spectrum for erythema of uninvolved adjacent skin. Daily exposures of different doses of 254, 280, 290, 296, 300, 304 and 313 nm radiation were observed. Wavelengths of 254, 280, 290 nm were erythemogenic but not therapeutic even at 10 to 50 times the minimal erythema dose. At the other wavelengths studied, the 2 action spectra were similar. In general, fixed daily doses cleared at lower cumulative dose than did incrementally increased daily doses. The small number of suberythemogenic exposure doses required suggests that monochromatic radiation may have advantages over broadband sources

  3. The importance of Pyr(6-4)Pyo adducts for survival and mutation induction in mammalian cells

    International Nuclear Information System (INIS)

    The biological consequences of a variety of DNA photoproducts are being studied in Chinese hamster ovary cells. By comparing the rate of induction of resistance to 6-thioguanine following irradiation at 254 nm and 313 nm, the authors find a similar mutation rate at equitoxic doses. Thus, enhanced mutation frequency does not appear to be a consequence of Pyr(6-4)Pyo adducts, which are produced at 254 nm but not at 313 nm. When the level of dimerised photoproducts is measured in a radioimmunoassay, Pyr(6-4)Pyo adducts, which are highly antigenic, are readily detected. By comparing the kinetics of removal of antibody-binding sites following irradiation at 254mn and 313 nm, it is evident that these lesions are repaired at the same rate as cyclobutane dimers

  4. Preparation and characterization of BaMgAl10O17:Eu phosphor coated with MgF2 by sol-gel process

    Institute of Scientific and Technical Information of China (English)

    LI Feng; WANG Yu-hua

    2005-01-01

    In order to prevent BaMgAl10 O17 : Eu (BAM) phosphor from thermal degradation, MgF2-coatings on the surface of BAM were prepared by a sol-gel process. The coatings were characterized by X-ray photoelectron spectroscopy and scanning electron microscopy. The results indicate that BAM is successfully coated with homogenous, close MgF2 coatings. The photoluminescence and anti-thermal degradation properties of coated BAM were investigated under 254 and 147 nm excitations. The optimum anti-thermal degradation properties are obtained at the mass ratio of MgF2 to BAM 0. 2% under 254 nm excitation and 0. 5% under 147 nm excitation, respectively. It is considered that trace MgO formed after baked would cause different optimum coating thicknesses under 254 and 147 nm excitations.

  5. Removal of humic substances for coagulation with Alum

    International Nuclear Information System (INIS)

    In the search of better conditions to remove precursory material in the formation of disinfections sub-products with free chlorine, was found that the absorbance to the ultraviolet to 254 nm (AUV 254 nm) it is a parameter that can be used as non-specific measure, to estimate concentrations of precursory material, specifically humic substances, and also, like control instrument in the operations and previous processes to the disinfections with free chlorine. The study tries the importance so that in the handling essays of potable water is included the AUV 254 nm like control parameter. In essays of coagulation with alum was found that the removal of these substances depends on the dose of coagulation and the pH of coagulation

  6. Evaluating the ameliorative effect of natural dissolved organic matter (DOM) quality on copper toxicity to Daphnia magna: improving the BLM.

    Science.gov (United States)

    Al-Reasi, Hassan A; Smith, D Scott; Wood, Chris M

    2012-03-01

    Various quality predictors of seven different natural dissolved organic matter (DOM) and humic substances were evaluated for their influence on protection of Daphnia magna neonates against copper (Cu) toxicity. Protection was examined at 3 and 6 mg l(-1) of dissolved organic carbon (DOC) of each DOM isolate added to moderately hard, dechlorinated water. Other water chemistry parameters (pH, concentrations of DOC, calcium, magnesium and sodium) were kept relatively constant. Predictors included absorbance ratios Abs(254/365) (index of molecular weight) and Abs-octanol(254)/Abs-water(254) (index of lipophilicity), specific absorption coefficient (SAC(340); index of aromaticity), and fluorescence index (FI; index of source). In addition, the fluorescent components (humic-like, fulvic-like, tryptophan-like, and tyrosine-like) of the isolates were quantified by parallel factor analysis (PARAFAC). Up to 4-fold source-dependent differences in protection were observed amongst the different DOMs. Significant correlations in toxicity amelioration were found with Abs(254/365), Abs-octanol(254)/Abs-water(254), SAC(340), and with the humic-like fluorescent component. The relationships with FI were not significant and there were no relationships with the tryptophan-like or tyrosine-like fluorescent components at 3 mg C l(-1), whereas a negative correlation was seen with the fulvic-like component. In general, the results indicate that larger, optically dark, more lipophilic, more aromatic DOMs of terrigenous origin, with higher humic-like content, are more protective against Cu toxicity. A method for incorporating SAC(340) as a DOM quality indicator into the Biotic Ligand Model is presented; this may increase the accuracy for predicting Cu toxicity in natural waters. PMID:22072428

  7. The Development of Neutron Radiography and Tomography on a SLOWPOKE-2 Reactor

    Science.gov (United States)

    Bennett, L. G. I.; Lewis, W. J.; Hungler, P. C.

    Development of neutron radiography at the Royal Military College of Canada (RMC) started by trying to interest the Royal Canadian Air Force (RCAF) in this new non-destructive testing (NDT) technique. A Californium-252 based device was ordered and then installed at RMC for development of applicable techniques for aircraft by the first author. A second and transportable device was then designed, modified and used in trials at RCAF Bases and other locations for one year. This activity was the only foreign loan of the U.S. Californium Loan Program. Around this time, SLOWPOKE-2 reactors were being installed at four Canadian universities, while a new science and engineering building was being built at RMC. A reactor pool was incorporated and efforts to procure a reactor succeeded a decade later with a SLOWPOKE-2 reactor being installed at RMC. The only modification by the vendor for RMC was a thermal column replacing an irradiation site inside the reactor container for a later installation of a neutron beam tube (NBT). Development of a working NBT took several years, starting with the second author. A demonstration of the actual worth of neutron radiography took place with a CF-18 Hornet aircraft being neutron and X-radiographed at McClellan Air Force Base, Sacramento, CA. This inspection was followed by one of the rudders that had indications of water ingress being radiographed successfully at RMC just after the NBT became functional. The next step was to develop a neutron radioscopy system (NRS), initially employing film and then digital imaging, and is in use today for all flight control surfaces (FCS). With the third author, a technique capable of removing water from affected FCS was developed at RMC. Heating equipment and a vacuum system were utilized to carefully remove the water. This technique was proven using a sequence of near real time neutron images obtained during the drying process. The results of the drying process were correlated with a relative humidity

  8. Selective isolation of UV-sensitive Rhodopseudomonas sphaeroides mutants

    International Nuclear Information System (INIS)

    Application of penicillin selection method after UV irradiation (λ=254 nm) increases by an order efficiency of mutant selection sensible to ulraviolet radiation (uvs mutants), phototrophic bacterium Rhodopseudomonas sphaeroides induced with nitrosomethylurea (NMM). Over 30% of uvs mutants produced by means of this method possessed increased sensitivity not only to short-wave (sUV, λ=254 nm) but also to long-wave (lUV, λ>280 nm) UV radiations. No correlation in the degree of sensitivity of uvs mutants to sUV and lUV irradiations is discovered. Mutants, which are high-sensitive to lethal effect of lUV, are separated

  9. Irreversible inhibition of epithelial sodium channels by ultraviolet irradiation.

    OpenAIRE

    Cuthbert, A W; Fanestil, D. D.; Herrera, F. C.; Pryn, S. J.

    1982-01-01

    1 The effects of u.v. irradiation at 254 nm and 350 nm on sodium transport across frog skin epithelium have been investigated. 2 Irradiation at 254 nm but not at 350 nm produces a dose-dependent, functionally selective blockade of sodium transport. The effect is apparently due to the irreversible closure of apical sodium channels. 3 The amiloride-sensitive conductance was directly related to sodium transport as measured by short circuit current (SCC) both in normal and irradiated tissues, alt...

  10. EST Table: FY744453 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available FY744453 E_FL_famL_24C03_F_0 11/11/04 82 %/255 aa ref|XP_002424214.1| Arsenical pump-driving... ATPase, putative [Pediculus humanus corporis] gb|EEB11476.1| Arsenical pump-driving ATPase, putati... 81 %/254 aa gnl|Amel|GB18636-PA 11/11/04 77 %/254 aa gi|91081505|ref|XP_974589.1| PREDICTED: similar to arsenical pump-driving atpase [Tribolium castaneum] FS918630 famL ...

  11. AcEST: BP915076 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000066_C02 360 Adiantum capillus-veneris mRNA. clone: YMU001_000066_C02. BP915076 - Show ... Frame = +1 Query: 22 LYLDIGQSADLLRRI-VSDFTIIWPRFYQMIS KQATCK 132 ++LDI ++++ L + V+ FT++WP+FYQMIS + K Sbjct ... : 254 IHLDIMETSESLEVVDVNHFTMVWPKFYQMIS RSQKLK 291 TrEMBL (release 39.9) Link to BlastX Res ... Frame = +1 Query: 22 LYLDIGQSADLLRRI-VSDFTIIWPRFYQMIS KQATCK 132 ++LDIG+S + L + VS+FTI+WP+FY MIS + + K Sbj ... ct: 254 IHLDIGESTENLEVVDVSNFTIMWPKFYHMIS RSSKLK 291 >tr|A9TVZ3|A9TVZ3_PHYPA Predicted protei ...

  12. Communication Received from the Permanent Mission of Mexico to the International Atomic Energy Agency Regarding Guidelines for the Export of Nuclear Material, Equipment and Technology and the Guidelines for Transfers of Nuclear-related Dual-use Equipment, Materials, Software and Related Technology

    International Nuclear Information System (INIS)

    The Director General has received a note verbale dated 15 June 2012 from the Permanent Mission of Mexico to the International Atomic Energy Agency providing information on the decision of the Government of Mexico to act in accordance with the 'Guidelines for the Export of Nuclear Material, Equipment and Technology', issued as document INFCIRC/254/Rev.10/Part 1, including its Annexes, and with the 'Guidelines for Transfers of Nuclear-Related Dual-Use Equipment, Material, Software and Related Technology', issued as document INFCIRC/254/Rev.8/Part 2

  13. Normal and Reversed-Phase HPTLC Methods for Simultaneous Estimation of Telmisartan and Metoprolol Succinate in Pharmaceutical Formulation

    OpenAIRE

    Nawale, Prajakta S.; Shirkhedkar, Atul A.; Surana, Sanjay J.; Patil, Amod S.

    2012-01-01

    Two simple precise normal-phase (Method I) and reversed-phase (Method II) HPTLC/densitometry method have been developed for simultaneous determination of telmisartan and metoprolol succinate in bulk and in combined tablet formulation. Method I was developed with aluminium plates precoated with silica gel 60F254S, and toluene : propanol : methanol : triethylamine (8 : 1 : 1 : 0.5 v/v) was used as as mobile phase. Method II was carried out using aluminium coated with RP-18 silica gel 60 F254S H...

  14. Les localisations corticales vues par la gamma-caméra dynamique

    DEFF Research Database (Denmark)

    Lassen, N A; Larsen, B; Orgogozo, J M

    1978-01-01

    improved by the design of a special system using 254 scintillation detectors with individual collimation, each 8 mm ø, connected to individual ratemeters (Sveinsdottir et al., 1975). This allows the simultaneous processing of the 254 clearance curves by a small on-line Varian computer. The results are...... displayed as functional colour pictures of the brain on a T.B. screen, less than 3 min. after isotope injection. The studies have been performed to date in more than 200 patients, usually in connection with carotid angiography. 84 subjects could be classified as "normals+ because of lack of detectable brain...

  15. A first search of excited states double beta and double electron capture decays of Pd110 and Pd102

    CERN Document Server

    Lehnert, Bjoern

    2011-01-01

    A search for double beta decays of the palladium isotopes Pd110 and Pd102 into excited states of their daughters was performed. New half-life limits for the 2nubb and 0nubb decays into first excited 0+ and 2+ states of 2.54e19 yr and 2.14e19 yr (95% CL) for the Pd110 decay were obtained improving limits by two orders of magnitude. The corresponding half-lives for double electron capture transition of Pd102 are 1.73e18 yr and 2.54e18 yr (95% CL) respectively. These are the first measurements for Pd102.

  16. Dicty_cDB: VHI769 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available *fq frsnccppcy*wcfsryrlrrrclrtnrncitssrr*tyqtslirqqsrsflirtpikh* rslslfp*sy*irqchcw--- ---ssftsirilrfhr*ftfp...(Q874B9) RecName: Full=Elongation factor 2; Short=EF-2;... 256 9e-67 DQ357217_1( DQ357217 |pid:none) Leishmania brazili...ensis elongation... 254 2e-66 AM494972_26( AM494972 |pid:none) Leishmania braziliensis chromosom....qsikfvplwtvvkiseicllllmsitvkplyqil*skelvllpik flvi*dichvvlmnksvvsplnlhlyhftskcqrktnyqlvvlhtnf*silsipqvtlis vqk*llpsvllmvl*slsia..... 254 2e-66 CT005272_19( CT005272 |pid:none) Leishmania major strain Friedlin,..

  17. Communication Received from the PermanentMission of Mexico to the International Atomic Energy Agency Regarding Guidelines for the Export of Nuclear Material, Equipment and Technology and the Guidelines for Transfers of Nuclear-related Dual-use Equipment, Materials, Software and Related Technology

    International Nuclear Information System (INIS)

    The Director General has received a note verbale dated 15 June 2012 from the Permanent Mission of Mexico to the International Atomic Energy Agency providing information on the decision of the Government of Mexico to act in accordance with the 'Guidelines for the Export of Nuclear Material, Equipment and Technology', issued as document INFCIRC/254/Rev.10/Part 1, including its Annexes, and with the 'Guidelines for Transfers of Nuclear-Related Dual-Use Equipment, Material, Software and Related Technology', issued as document INFCIRC/254/Rev.8/Part 2

  18. Use of plasma desorption time-of-flight mass spectrometry to screen for products of prohormone processing in crude tissue extracts

    International Nuclear Information System (INIS)

    Californium-252 plasma desorption mass spectrometry (252Cf PDMS) of a crude, desalted, extract of piscine endocrine pancreas provided mass information for the major biologically active peptide hormones present in this tissue. An extraction procedure compatible with 252Cf PDMS analysis was developed. In extracts of catfish pancreas, strong molecular ions were identified in the positive mode for somatostatin-14 (1638 amu), O-glycosylated somatostatin-22 (2944 amu), glucagon (3512 amu), glucagon-like peptide (3785 amu), insulin (ca. 5550 amu), and other prohormone-derived peptides. Both protonated species and sodium adducts were apparent in the mass spectrum. A number of other molecular ions were observed including somatostatin-26, 1-10 (1014 amu) and the entire portion of prosomatostatin-22 remaining after removal of somatostatin-22 (6465 amu). The data obtained by this method also resulted in the identification of the third major product of proglucagon processing in catfish pancreas, glicentin-related polypeptide. Subtractive Edman degradation analyzed by 252Cf PDMS was also used to confirm a mass assignment

  19. Nuclear Chemistry Institute, Mainz University. Annual Report 1995

    International Nuclear Information System (INIS)

    The annual report of the Institut fuer Kernchemie addresses inter alia three main research activities. The first belongs to the area of basic research, covering studies in the fields of nuclear fission, chemistry of the super-heavy elements and of heavy-ion reactions extending from the Coulomb barrier to relativistic energies, and nuclear astrophysics in connection with the ''r process''. By means of laser technology, high-precision data could be measured of the ionization energies of berkelium and californium. Studies of atomic clusters in the vacuum of an ionization trap revealed interesting aspects. The second major activity was devoted to the analysis of environmental media, applying inter alia neutron activation analysis and resonance ionization mass spectroscopy (RIMS). The third activity resulted in the development of novel processes, or the enhancement of existing processes or methods, for applications in basic research work and in environmental analytics. Another item of interest is the summarizing report on the operation of the TRIGA research reactor. (orig./SR)

  20. Evolution of the Argonne Tandem Linear Accelerator System (ATLAS) control system

    International Nuclear Information System (INIS)

    Given that the Argonne Tandem Linear Accelerator System (ATLAS) recently celebrated its 25. anniversary, this paper will explore the past, present, and future of the ATLAS Control System, and how it has evolved along with the accelerator and control system technology. ATLAS as we know it today, originated with a Tandem Van de Graff in the sixties. With the addition of the Booster section in the late seventies, came the first computerized control. ATLAS itself was placed into service on June 25, 1985, and was the world's first superconducting linear accelerator for ions. Since its dedication as a National User Facility, more than a thousand experiments by more than 2,000 users worldwide, have taken advantage of the unique capabilities it provides. Today, ATLAS continues to be a user facility for physicists who study the particles that form the heart of atoms. Its most recent addition, CARIBU (Californium Rare Isotope Breeder Upgrade), creates special beams that feed into ATLAS. ATLAS is similar to a living organism, changing and responding to new technological challenges and research needs. As it continues to evolve, so does the control system: from the original days using a DEC PDP-11/34 computer and two CAMAC crates, to a DEC Alpha computer running Vsystem software and more than twenty CAMAC crates, to distributed computers and VME systems. Future upgrades are also in the planning stages that will continue to evolve the control system. (authors)

  1. B(E2) ↑ (01+ -> 21+) predictions for even–even nuclei in the differential equation model

    International Nuclear Information System (INIS)

    We use the recently developed differential equation model (DEM) for the reduced electric quadrupole transition probability B(E2)↑ for the transition from the ground to the first 2+ state for predicting its values for a wide range of even–even nuclides almost throughout the nuclear landscape from Neon to Californium. This is made possible as the principal equation in the model, namely, the differential equation connecting the B(E2)↑ value of a given even–even nucleus with its derivatives with respect to the neutron and proton numbers, provides two different recursion relations, each connecting three different neighboring even–even nuclei from lower- to higher-mass numbers and vice versa. These relations are primarily responsible in extrapolating from known to unknown terrain of the B(E2)↑-landscape and thereby facilitate the predictions throughout. As a result, we have succeeded in predicting its hitherto unknown value for the adjacent 251 isotopes lying on either side of the known B(E2)↑ database. (author)

  2. Time-of-flight mass spectrometry with desorption-ionization multiprobes (UV photons and KeV and MeV particles). Cluster atoms are used as projectiles

    International Nuclear Information System (INIS)

    A new time-of-flight mass spectrometer, Super-Depil, is used to study secondary ion emission from solid surfaces bombarded by various kinds of primary particles. Three different desorption probes were set up on this machine: a 252 californium source, providing by spontaneous fission about 1 MeV/u energy heavy ions, a 5 to 30 keV energy pulsed caesium ion gun and a pulsed nitrogen laser, which wavelength is 337 mm. A two stages electrostatic mirror was added to the spectrometer. The time spread due to the initial kinetic energy of secondary ions leaving the surface was minimized. The mass resolution is greater than 5000. The analysis of glycosidic terpenes showed the complementarity of the three probes. The study of such metastable ions, with the electrostatic mirror, showed that some fragment ions may conserve the memory of the stereochemistry of the neutral lost. Clusters ions were used as projectiles in the energy range 5-60 keV. A strong non linear enhancement was observed in the secondary ion yield from various targets

  3. γ -soft 146Ba and the role of nonaxial shapes at N ≈90

    Science.gov (United States)

    Mitchell, A. J.; Lister, C. J.; McCutchan, E. A.; Albers, M.; Ayangeakaa, A. D.; Bertone, P. F.; Carpenter, M. P.; Chiara, C. J.; Chowdhury, P.; Clark, J. A.; Copp, P.; David, H. M.; Deo, A. Y.; DiGiovine, B.; D'Olympia, N.; Dungan, R.; Harding, R. D.; Harker, J.; Hota, S. S.; Janssens, R. V. F.; Kondev, F. G.; Liu, S. H.; Ramayya, A. V.; Rissanen, J.; Savard, G.; Seweryniak, D.; Shearman, R.; Sonzogni, A. A.; Tabor, S. L.; Walters, W. B.; Wang, E.; Zhu, S.

    2016-01-01

    Low-spin states in the neutron-rich, N =90 nuclide 146Ba were populated following β decay of 146Cs, with the goal of clarifying the development of deformation in barium isotopes through delineation of their nonyrast structures. Fission fragments of 146Cs were extracted from a 1.7-Ci 252Cf source and mass selected using the CAlifornium Rare Ion Breeder Upgrade (CARIBU) facility. Low-energy ions were deposited at the center of a box of thin β detectors, surrounded by a highly efficient high-purity Ge array. The new 146Ba decay scheme now contains 31 excited levels extending up to ˜2.5 MeV excitation energy, double what was previously known. These data are compared to predictions from the interacting boson approximation (IBA) model. It appears that the abrupt shape change found at N =90 in Sm and Gd is much more gradual in Ba and Ce, due to an enhanced role of the γ degree of freedom.

  4. Neutron activation determination of gold in technogenic raw materials with different mineral composition

    Directory of Open Access Journals (Sweden)

    Yudakov Aleksandr A.

    2015-01-01

    Full Text Available The methods used to determine the gold content in the technogenic objects of gold mining were analyzed regarding their non-homogeneity and complexity of chemical and mineral compositions. A possible application of the neutron activation analysis with the use of the californium source of neutrons for determining the content of fine-grained and extra-fine-grained gold in the technogenic objects, including the bottom-ash waste of energy providers, is considered. It was demonstrated that the chemical composition of the sample affects the neuron flux distribution in the sample, which can essentially distort the results of the neutron activation analysis. In order to eliminate possible systematic errors investigations of the effect of the sample mineral composition on the results of the gold determination using the neutron activation analysis were carried out. Namely, a large mass of rock (3-5 kg was loaded into an activation zone using four matrix types such as silicate, carbon-containing, iron-containing, and titanium magnetite. It was shown that there wereno significant difference between the dispersal of the fluxes of thermal and resonance neutrons emitted from 252Cf during activation of the gold-containing technogenic samples with different mineral compositions.

  5. About possibilities of obtaining focused beams of thermal neutrons of radionuclide source

    International Nuclear Information System (INIS)

    Full text: In the last years significant progress is achieved in development of neutron focusing methods (concentrating neutrons in a given direction and a small area). In this, main attention is given to focusing of neutron beams of reactor, particularly cold neutrons and their applications. [1,2]. However, isotope sources also let obtain intensive neutron beams and solve quite important (tasks) problems (e.g. neutron capture therapy for malignant tumors) [3], and an actual problems is focusing of neutrons. We developed a device on the basis of californium source of neutrons, allowing to obtain focused (preliminarily) beam of thermal neutrons with the aid of respective choice of moderators, reflectors and geometry of their disposition. Here, fast neutrons and gamma rays in the beam are minimized. With the aid of the model we developed on the basis of Monte-Carlo method, it is possible to modify aforementioned device and dynamics of output neutrons in wide energy range and analyze ways of optimization of neutron beams of isotope sources with different neutron outputs. Device of preliminary focusing of thermal neutrons can serve as a basis for further focus of neutrons using micro- and nano-capillar systems. It is known that, capillary systems performed with certain technology can form beam of thermal neutrons increasing its density by more than two orders of magnitude and effectively divert beams up to 20o with length of system 15 cm

  6. Alternative irradiation system for efficiency manganese bath determination

    International Nuclear Information System (INIS)

    The Manganese Sulphate Bath (MSB) is the main method used in most metrological laboratories to measure the neutron sources emission rate Q(t) . The MSB technique consists, basically, in dipping a neutron source in the center of a large tank (∼500 L) containing a concentrated aqueous solution of manganese sulphate. The neutron source emission rate is determined through the activity solution measurement produced by captured neutrons in manganese nuclei. In order to obtain the value of Q(t) it must be taken into account the detection system efficiency and still determine some corrections. The MSB system efficiency is usually determined by irradiating a solution sample from MSB system in a reactor or accelerator. This paper proposes an alternative irradiation system (Irradiation Bath), which works with a radionuclide neutron source and manganese sulphate solution volume for efficiency determination of MSB system. This irradiation system was designed by simulation with MCNP code, considering a californium neutron source in several manganese sulphate volumes and different neutron reflectors. The goal of this simulation was to determine the materials and dimensions of Irradiation Bath which will derive the maximum manganese neutron capture. Although the specific activated irradiated samples are less than those in reactors, the simulation results for optimized Irradiation Bath have showed a manganese neutron capture increase up to 100 times with dimensions less than 15 cm in diameter when it compared to manganese neutron capture in a MSB System whose diameter is about 100 cm . (author)

  7. Neutron spectra at the outlet from the labyrinths in the IHEP proton synchrotron biological shield

    International Nuclear Information System (INIS)

    Neutron spectra in transport and cable labyrinths of concrete shielding were measured. It was related with planned increase of proton beam intensity in the IHEP synchrotron and the necessity of searching isotope radiation sources suitable for simulation of fields of neutron radiation in the accelerator biological shield. Multisphere Bonner spectrometer with 6LiI(Eu) monocrystal of 10x10 mm size as thermal neutron detector and a set of seven cadmium-plated polyethylene thermalizing spheres 2, 3, 5, 8, 10, 12 and 18 inch in diameter was used for measurement. Measurements were conducted at 100 MeV, 8 and 70 GeV proton energies. Analysis of obtained data shows that the average energy of neutron spectra increases at the outlet from the labyrinths from 110 up to 390 keV with growth of accelerated proton energy from 100 MeV up to 70 GeV. Neutron spectra are similar with respect to form and component composition at one and the same energy of accelerated particles and the same shield material regardless of labyrinth configuration. The shares of fast and interiediate neutrons equal about 10 and 90% respectively. It was concluded that neutron radiation fields typical for the labyrinths of the IHEP synchrotron yield can be simulated in model labyrinths with the use of californium-252 source

  8. Compensated bismuth-loaded plastic scintillators for neutron detection using low-energy pseudo-spectroscopy

    Science.gov (United States)

    Dumazert, Jonathan; Coulon, Romain; Bertrand, Guillaume H. V.; Normand, Stéphane; Méchin, Laurence; Hamel, Matthieu

    2016-05-01

    Gadolinium-covered modified plastic scintillators show a high potential for the deployment of cost-effective neutron detectors. Taking advantage of the low-energy photon and electron signature of thermal neutron captures in gadolinium-155 and gadolinium-157 however requires a background correction. In order to display a trustable rate, dual compensation schemes appear as an alternative to Pulse Shape Discrimination. This paper presents the application of such a compensation scheme to a two-bismuth loaded plastic scintillator system. A detection scintillator interacts with incident photon and fast neutron radiations and is covered with a gadolinium converter to become thermal neutron-sensitive as well. In the meantime, an identical compensation scintillator, covered with terbium, solely interacts with the photon and fast neutron part of incident radiations. After the acquisition and the treatment of the counting signals from both sensors, a hypothesis test determines whether the resulting count rate after subtraction falls into statistical fluctuations or provides a robust image of neutron activity. A laboratory prototype is tested under both photon and neutron radiations, allowing us to investigate the performance of the overall compensation system. The study reveals satisfactory results in terms of robustness to a cesium-137 background and in terms of sensitivity in presence of a californium-252 source.

  9. Design of the low energy beam transport line between CARIBU and the EBIS charge breeder

    International Nuclear Information System (INIS)

    An Electron Beam Ion Source Charge Breeder (EBIS-CB) has been developed to breed radioactive beams from the CAlifornium Rare Isotope Breeder Upgrade (CARIBU) facility at ATLAS. The EBIS-CB will replace the existing ECR charge breeder to increase the intensity and improve the purity of reaccelerated radioactive ion beams. The EBIS-CB is in the final stage of off-line commissioning. Currently, we are developing a low energy beam transport (LEBT) system to transfer CARIBU beams to the EBIS-CB. As was originally planned, an RFQ cooler-buncher will precede the EBIS-CB. Recently, it was decided to include a multi-reflection time-of-flight (MR-TOF) mass-spectrometer following the RFQ. MR-TOF is a relatively new technology used to purify beams with a mass-resolving power up to 3×105 as was demonstrated in experiments at CERN/ISOLDE. Very high purity singly-charged radioactive ion beams will be injected into the EBIS for charge breeding and due to its inherent properties, the EBIS-CB will maintain the purity of the charge bred beams. Possible contamination of residual gas ions will be greatly suppressed by achieving ultra-high vacuum in the EBIS trap. This paper will present and discuss the design of the LEBT and the overall integration of the EBIS-CB into ATLAS

  10. Report on the workshop "Decay spectroscopy at CARIBU: advanced fuel cycle applications, nuclear structure and astrophysics". 14-16 April 2011, Argonne National Laboratory, USA.

    Energy Technology Data Exchange (ETDEWEB)

    Kondev, F.; Carpenter, M.P.; Chowdhury, P.; Clark, J.A.; Lister, C.J.; Nichols, A.L.; Swewryniak, D. (Nuclear Engineering Division); (Univ. of Massachusetts); (Univ. of Surrey)

    2011-10-06

    A workshop on 'Decay Spectroscopy at CARIBU: Advanced Fuel Cycle Applications, Nuclear Structure and Astrophysics' will be held at Argonne National Laboratory on April 14-16, 2011. The aim of the workshop is to discuss opportunities for decay studies at the Californium Rare Isotope Breeder Upgrade (CARIBU) of the ATLAS facility with emphasis on advanced fuel cycle (AFC) applications, nuclear structure and astrophysics research. The workshop will consist of review and contributed talks. Presentations by members of the local groups, outlining the status of relevant in-house projects and availabile equipment, will also be organized. time will also be set aside to discuss and develop working collaborations for future decay studies at CARIBU. Topics of interest include: (1) Decay data of relevance to AFC applications with emphasis on reactor decay heat; (2) Discrete high-resolution gamma-ray spectroscopy following radioactive decya and related topics; (3) Calorimetric studies of neutron-rich fission framgents using Total ABsorption Gamma-Ray Spectrometry (TAGS) technique; (4) Beta-delayed neutron emissions and related topics; and (5) Decay data needs for nuclear astrophysics.

  11. Review of the accomplishments and promise of US transplutonium research, 1940-1981

    International Nuclear Information System (INIS)

    It has been just over 40 years since the identification of plutonium by Seaborg, McMillan, Kennedy, and Wahl at the University of California, Berkeley. This discovery, and the isolation of plutonium-239 a year later by Kennedy, Seaborg, Segre, and Wahl, laid the cornerstone of one of the most exciting and productive eras of research in American history - research on the transplutonium elements. This research was to span all fields of natural science, and indeed was to have many implications and applications in the biological sciences. In this brief document, we have attempted to touch on only some of the many achievements of the US heavy element program. Many of those whose work has been at the heart of this research have contributed to this report. They have summarized some of what was scientifically important and exciting and they have suggested some of the topics of important research remaining to be done. The following topics are covered in this review: historical account; plutonium; synthesis of transplutonium isotopes; nuclear fission and stability, heavy ion reactions and nuclear structure; chemistry of the transplutonium elements; optical and magnetic properties; electronic structure and solid state properties; environmental and biological behavior of transplutonium elements; heavy element production; application of californium-252

  12. Neutron radiographic nondestructive inspection for bonded composite structures

    International Nuclear Information System (INIS)

    Neutron radiography was found to be effective as a nondestructive inspection technique for detection of bondline voids/defects in a variety of composite structures. Radiographic data are presented from typical structures for which the neutron radiographic inspection technique offers advantages over more conventional inspection techniques. Complex composite joints such as box beam members, for example, are difficult to inspect by ultrasonic techniques, and the X-ray attenuation coefficients of the different materials in composite/metal combinations differ in such a manner as to yield very little nondestructive inspection information regarding the integrity of the bond. Accurate bondline defect information was achieved in such structures utilizing a transportable californium-252 (Cf-252) neutron radiography system containing approximately 2 mg of the CF-252 isotope. Through techniques developed at Vought Corp. Advanced Technology Center, resolution of simulated bondline voids as small as 0.127 mm diameter in laminated graphite/epoxy specimens was achieved. It is expected that continuing improvements in imaging techniques, and in mobility of neutron sources for radiography, will spawn wide usage of the neutron technique for nondestructive inspection of complex wing joints, control surfaces, and other airframe structures

  13. On-line charge breeding using ECRIS and EBIS

    Science.gov (United States)

    Vondrasek, Richard

    2016-06-01

    The efficient and rapid production of a high-quality, pure beam of highly charged ions is at the heart of any radioactive ion beam facility. Whether an electron cyclotron resonance (ECR) ion source or an electron beam ion source (EBIS) is used to produce these highly charged ions, their operating characteristics will set the boundaries on the range of experiments which can be performed. In addition, time structure and duty cycle have to be considered when defining the operating parameters of the accelerator system as a whole. At Argonne National Laboratory (ANL), an ECR charge breeder was developed as part of the Californium Rare Ion Breeder Upgrade (CARIBU) program. The charge breeding efficiency and high charge state production of the source is at the forefront of ECR charge breeders, but its overall performance as part of the accelerator system is limited by pervasive background and relatively long breeding times. As such, an EBIS charge breeder has been developed and is running in an off-line configuration. It has already demonstrated good breeding efficiencies, shorter residence times, and reduced background and is scheduled to replace the ECR charge breeder in late 2015. The resultant change in duty cycle and time structure necessitates changes to the overall operation of the facility. The experiences with these breeders, as well as from several other facilities which already utilize an ECR or EBIS for charge breeding, help to define the operational characteristics of each technology - their strengths, their weaknesses, and the possible paths to improvement.

  14. An Account of Oak Ridge National Laboratory's Thirteen Research Reactors

    Energy Technology Data Exchange (ETDEWEB)

    Rosenthal, Murray Wilford [ORNL

    2009-08-01

    The Oak Ridge National Laboratory has built and operated 13 nuclear reactors in its 66-year history. The first was the graphite reactor, the world's first operational nuclear reactor, which served as a plutonium production pilot plant during World War II. It was followed by two aqueous-homogeneous reactors and two red-hot molten-salt reactors that were parts of power-reactor development programs and by eight others designed for research and radioisotope production. One of the eight was an all-metal fast burst reactor used for health physics studies. All of the others were light-water cooled and moderated, including the famous swimming-pool reactor that was copied dozens of times around the world. Two of the reactors were hoisted 200 feet into the air to study the shielding needs of proposed nuclear-powered aircraft. The final reactor, and the only one still operating today, is the High Flux Isotope Reactor (HFIR) that was built particularly for the production of californium and other heavy elements. With the world's highest flux and recent upgrades that include the addition of a cold neutron source, the 44-year-old HFIR continues to be a valuable tool for research and isotope production, attracting some 500 scientific visitors and guests to Oak Ridge each year. This report describes all of the reactors and their histories.

  15. Production of Medical Radioisotopes in the ORNL High Flux Isotope Reactor (HFIR) for Cancer Treatment and Arterial Restenosis Therapy after PTCA

    Science.gov (United States)

    Knapp, F. F. Jr.; Beets, A. L.; Mirzadeh, S.; Alexander, C. W.; Hobbs, R. L.

    1998-06-01

    The High Flux Isotope Reactor (HFIR) at the Oak Ridge National Laboratory (ORNL) represents an important resource for the production of a wide variety of medical radioisotopes. In addition to serving as a key production site for californium-252 and other transuranic elements, important examples of therapeutic radioisotopes which are currently routinely produced in the HFIR for distribution include dysprosium-166 (parent of holmium-166), rhenium-186, tin-117m and tungsten-188 (parent of rhenium-188). The nine hydraulic tube (HT) positions in the central high flux region permit the insertion and removal of targets at any time during the operating cycle and have traditionally represented a major site for production of medical radioisotopes. To increase the irradiation capabilities of the HFIR, special target holders have recently been designed and fabricated which will be installed in the six Peripheral Target Positions (PTP), which are also located in the high flux region. These positions are only accessible during reactor refueling and will be used for long-term irradiations, such as required for the production of tin-117m and tungsten-188. Each of the PTP tubes will be capable of housing a maximum of eight HT targets, thus increasing the total maximum number of HT targets from the current nine, to a total of 57. In this paper the therapeutic use of reactor-produced radioisotopes for bone pain palliation and vascular brachytherapy and the therapeutic medical radioisotope production capabilities of the ORNL HFIR are briefly discussed.

  16. γ -soft Ba146 and the role of nonaxial shapes at N90

    Energy Technology Data Exchange (ETDEWEB)

    Mitchell, A. J.; Lister, C. J.; McCutchan, E. A.; Albers, M.; Ayangeakaa, A. D.; Bertone, P. F.; Carpenter, M. P.; Chiara, C. J.; Chowdhury, P.; Clark, J. A.; Copp, P.; David, H. M.; Deo, A. Y.; DiGiovine, B.; D' Olympia, N.; Dungan, R.; Harding, R. D.; Harker, J.; Hota, S. S.; Janssens, R. V. F.; Kondev, F. G.; Liu, S. H.; Ramayya, A. V.; Rissanen, J.; Savard, G.; Seweryniak, D.; Shearman, R.; Sonzogni, A. A.; Tabor, S. L.; Walters, W. B.; Wang, E.; Zhu, S.

    2016-01-01

    Low-spin states in the neutron-rich, N=90 nuclide Ba146 were populated following β decay of Cs146, with the goal of clarifying the development of deformation in barium isotopes through delineation of their nonyrast structures. Fission fragments of Cs146 were extracted from a 1.7-Ci Cf252 source and mass selected using the CAlifornium Rare Ion Breeder Upgrade (CARIBU) facility. Low-energy ions were deposited at the center of a box of thin β detectors, surrounded by a highly efficient high-purity Ge array. The new Ba146 decay scheme now contains 31 excited levels extending up to ~2.5 MeV excitation energy, double what was previously known. These data are compared to predictions from the interacting boson approximation (IBA) model. It appears that the abrupt shape change found at N=90 in Sm and Gd is much more gradual in Ba and Ce, due to an enhanced role of the γ degree of freedom.

  17. An Account of Oak Ridge National Laboratory's Thirteen Research Reactors

    International Nuclear Information System (INIS)

    The Oak Ridge National Laboratory has built and operated 13 nuclear reactors in its 66-year history. The first was the graphite reactor, the world's first operational nuclear reactor, which served as a plutonium production pilot plant during World War II. It was followed by two aqueous-homogeneous reactors and two red-hot molten-salt reactors that were parts of power-reactor development programs and by eight others designed for research and radioisotope production. One of the eight was an all-metal fast burst reactor used for health physics studies. All of the others were light-water cooled and moderated, including the famous swimming-pool reactor that was copied dozens of times around the world. Two of the reactors were hoisted 200 feet into the air to study the shielding needs of proposed nuclear-powered aircraft. The final reactor, and the only one still operating today, is the High Flux Isotope Reactor (HFIR) that was built particularly for the production of californium and other heavy elements. With the world's highest flux and recent upgrades that include the addition of a cold neutron source, the 44-year-old HFIR continues to be a valuable tool for research and isotope production, attracting some 500 scientific visitors and guests to Oak Ridge each year. This report describes all of the reactors and their histories.

  18. Efficiency of interaction between various radiation and chemicals

    International Nuclear Information System (INIS)

    KAERI and INP (Poland) have been carried out parallel study and joint experiments on the major topics according to MOU about their cooperative project. Major experimental techniques were TSH assay, comet assay, and synergism assay. The research consisted of the following workscopes. 1) Application of TSH bioindicator for studying the biological efficiency of radiation, 2) Relative biological efficiency of californium-252 neutrons in the induction of gene and lethal mutations in TSH cells normal and enriched with boron compound, 3) Effect of pesticide on radiation-induced mutations in TSH cells, 4) Interaction of radiation with pesticide on DNA damage in human peripheral blood lymphocytes, 5) Radiomodifying effect of boron and gadolinium compounds in human peripheral blood lymphocytes, 6) Mathematical description of synergistic interactions, 7) General regularities of synergistic interactions, and 8) Determinant of synergistic interaction between radiation, heat and chemicals in cell killing. Both institutes have established wide variety of research techniques applicable to various radiation research through the cooperation. The results of research can make the role of fundamental basis for the better relationship between Korea and Poland

  19. A carbon cluster ion source for mass calibration at TRIGA-TRAP

    International Nuclear Information System (INIS)

    TRIGA-TRAP is a high-precision penning trap mass spectrometer installed at the research reactor TRIGA Mainz in order to determine the masses of short-lived fission products and - in addition to that - also the masses of actinide elements ranging from uranium up to californium. In order to determine precisely the masses of the nuclides of interest, the superconducting magnet providing the strong magnetic field for the Penning trap has to be calibrated by measuring the cyclotron frequency of an ion with well-known mass, which is, if possible, an isobaric nuclide of the ion of interest. Therefore, the best possible choice for mass calibration is to use carbon clusters as mass references, as demonstrated at the ISOLTRAP facility at ISOLDE/CERN. A laser ablation ion source for the production of carbon clusters has been developed using a frequency-doubled Nd:YAG laser. The design, current status, and results of the production of carbon cluster ions, using C60 and Sigradure registered samples, as well as other ions are presented

  20. An n-type high-purity germanium detector-based on-line rapid coal analysis system

    International Nuclear Information System (INIS)

    This paper describes an n-type high-purity germanium (HPGe) detector-based coal analysis system that is capable of providing a real-time (200-second update time) analysis of sulfur and other elemental constituents of coal. The analysis system consists of a 234-μg californium-252 neutron source with suitable moderation and shielding,state-of-the-art pulse-shaping and processing electronics coupled to a 23.4% n-type HPGe detector, a 7000-series EGandG ORTEC multichannel analyzer, and a PDP/11 computer. This system is capable of processing very high input pulse rates with low dead time. System input rates of 75 kHz to a gated amplifier were processed with a live-to-real-time ratio of greater than 0.55 for the pulses in the range of interest of this measurement (i.e., from 2 MeV to 10 MeV). Results are also presented which compare the measured and predicted throughput pulse rates for different spectroscopy systems

  1. Perspectives for online analysis of raw material by pulsed neutron irradiation

    Science.gov (United States)

    Bach, Pierre; Le Tourneur, P.; Poumarede, B.

    1997-02-01

    On-line analysis by pulsed neutron irradiation is an example of an advanced technology application of nuclear techniques, concerning real problems in the cement, mineral and coal industries. The most significant of these nuclear techniques is their capability of continuous measurement without contact and without sampling, which can lead to improved control of processes and resultant large financial savings. Compared to Californium neutron sources, the use of electrical pulsed neutron generators allows to obtain a higher signal/noise ratio for a more sensitive measurement, and allows to overcome a number of safety problems concerning transportation, installation and maintenance. An experiment related to a possible new on-line raw material analyzer is described, using a pulsed neutron generator. The key factors contributing to an accurate measurement are related to a suitable generator, to a high count rate gamma ray spectroscopy electronics, and to computational tools. Calculation and results for the optimization of the neutron irradiation time diagram are reported. One of the operational characteristics of such an equipment is related to neutron flux available: it is possible to adjust it to the requested accuracy, i.e. for a high accuracy during a few hours/day and for a lower accuracy the rest of the time. This feature allows to operate the neutron tube during a longer time, and then to reduce the cost of analysis.

  2. Developments in precison mass measurements of short-lived r-process nuclei with CARIBU

    Science.gov (United States)

    Marley, S. T.; Aprahamian, A.; Mumpower, M.; Nystrom, A.; Paul, N.; Siegl, K.; Strauss, S.; Surman, R.; Clark, J. A.; Perez Galvan, A.; Savard, G.; Morgan, G.; Orford, R.

    2013-10-01

    The confluence of new radioactive beam facilities and modern precision mass spectrometry techniques now make it possible to measure masses of many neutron-rich nuclei important to nuclear structure and astrophysics. A recent mass sensitivity study (S. Brett et al., Eur. Phys. J., A 48, 184 (2012)) identified the nuclear masses that are the most influential to the final rapid-neutron capture process abundance distributions under various astrophysical scenarios. This work motivated a campaign of precision mass measurements using the Canadian Penning Trap (CPT) installed at the Californium Rare Isotope Breeder Upgrade (CARIBU) facility at Argonne National Laboratory. In order to measure the weakest and most short-lived (t1/2 < 150 ms) of these influential nuclei, a series of upgrades to the CARIBU and CPT systems have been developed. The implementation of these upgrades, the r-process mass measurements, and the status of CARIBU facilty will be discussed. This work performed under the auspices of NSERC, Canada, appl. # 216974, the U.S. DOE, Office of Nuclear Physics, under contracts DE-AC02-06CH11357, DE-FG02-91ER-40609, DE-FG02-98ER41086, & DE-AC52-07NA27344, and NSF Grants PHY08-22648 and PHY-106819.

  3. Neutrons flux distribution in a 252Cf irradiation cell for neutron activation analysis

    International Nuclear Information System (INIS)

    A 100 microgram Californium-252 (252Cf) neutron source was embedded in a pure paraffin moderator surrounded by neutron and gamma ray shields to be used as an irradiation cell facility for NAA experiments. The cell is provided with a direct horizontal channel and a Vertical Tangential Irradiation Channel (VTIC) that are parallel to the source axis. The cadmium difference method was used in determining the thermal and epithermal neutron flux distributions along the axis of the (VTIC). For this purpose, 10 pairs of bare and cadmium covered pure gold foils were irradiated at the same positions along the axis of the (VTIC) in two separate runs. The absolute efficiency of the HPGe detector at the gamma ray energy 411.8 keV of 198 Au, was found to be 0.0318 ± 0.0025.The obtained distributions of thermal and epithermal neutron fluxes were tabulated and graphically presented. An evidence for contributions from 252Cf fission by epithermal neutrons was noticed. As an application on this facility the concentration of gold in an ore sample from gold - bearing ivory vein of wady Allaqui (at south west of eastern desert) was determined. It was found to be 612 ± 6 ppm

  4. Magnetic susceptibility of CfCl3 and its dependence on crystal structure

    International Nuclear Information System (INIS)

    Magnetic measurements are presented for polycrystalline samples of californium trichloride in both a hexagonal (UCl3 type; Cf(III) C.N. = 9) and orthorhombic (PuBr3 type; Cf(III) C.N. = 8) crystal form. In the Curie-Weiss temperature region the Weiss constant, theta/sub p/, is significantly larger for the orthorhombic form. The susceptibility of the orthorhombic form deviates from Curie-Weiss behavior at a higher temperature than the hexagonal form indicating a larger crystal field splitting in the former. At temperatures below 15 K a field dependent transition is observed. In a field of 5 kG an antiferromagnetic maximum in the susceptibility is observed at 7 K and 13 K for the hexagonal and orthorhombic forms, respectively. For 30 kG both types exhibit monotonically increasing susceptibilities with lower temperature and the hexagonal form shows saturation behavior in the susceptibility versus temperature plots with a saturation moment of approx.7 μ/sub B//atom. 6 refs., 3 figs

  5. Production of medical radioisotopes in the ORNL High Flux Isotope Reactor (HFIR) for cancer treatment and arterial restenosis therapy after PTCA

    International Nuclear Information System (INIS)

    The High Flux Isotope Reactor (HFIR) at the Oak Ridge National Laboratory (ORNL) represents an important resource for the production of a wide variety of medical radioisotopes. In addition to serving as a key production site for californium-252 and other transuranic elements, important examples of therapeutic radioisotopes which are currently routinely produced in the HFIR for distribution include dysprosium-166 (parent of holmium-166), rhenium-186, tin-117m and tungsten-188 (parent of rhenium-188). The nine hydraulic tube (HT) positions in the central high flux region permit the insertion and removal of targets at any time during the operating cycle and have traditionally represented a major site for production of medical radioisotopes. To increase the irradiation capabilities of the HFIR, special target holders have recently been designed and fabricated which will be installed in the six Peripheral Target Positions (PTP), which are also located in the high flux region. These positions are only accessible during reactor refueling and will be used for long-term irradiations, such as required for the production of tin-117m and tungsten-188. Each of the PTP tubes will be capable of housing a maximum of eight HT targets, thus increasing the total maximum number of HT targets from the current nine, to a total of 57. In this paper the therapeutic use of reactor-produced radioisotopes for bone pain palliation and vascular brachytherapy and the therapeutic medical radioisotope production capabilities of the ORNL HFIR are briefly discussed

  6. Detection of thermal neutrons with a CMOS pixel sensor for a future dosemeter

    Energy Technology Data Exchange (ETDEWEB)

    Vanstalle, M.; Husson, D.; Higueret, S.; Le, T. D.; Nourreddine, A. M. [Institut Pluridisciplinaire Hubert Curien, Univ. of Strasbourg, CNRS, 67037 Strasbourg (France)

    2011-07-01

    The RaMsEs group (Radioprotection et Mesures Environnementales) is developing a new compact device for operational neutron dosimetry. The electronic part of the detector is made of an integrated active pixel sensor, originally designed for tracking in particle physics. This device has useful features for neutrons, such as high detection efficiency for charged particles, good radiation resistance, high readout speed, low power consumption and high rejection of photon background. A good response of the device to fast neutrons has already been demonstrated [1]. In order to test the sensibility of the detector to thermal neutrons, experiments have been carried out with a 512 x 512 pixel CMOS sensor on a californium source moderated with heavy water (Cf.D{sub 2}O) on the Van Gogh irradiator at the LMDN, IRSN, Cadarache (France)). A thin boron converter is used to benefit from the significant cross section of the {sup 10}B (n,{alpha}) {sup 7}Li reaction. Results show a high detection efficiency (around 10{sup -3}) of the device to thermal neutrons. Our measurements are in good agreement with GEANT4 Monte Carlo simulations. (authors)

  7. 1982 US-CEC neutron personnel dosimetry intercomparison study

    International Nuclear Information System (INIS)

    A neutron personnel dosimetry intercomparison study was conducted during April 19-23, 1982, as a joint effort between the United States and the Commission of European Communities. Dosimeters from 48 participating agencies were mounted on cylindrical phantoms and exposed to a range of low-level dose equivalents (0.48-13.91 mSv neutron and 0.02-1.32 mSv gamma) in nine different radiation fields. Exposure conditions considered in this study included four mixed-field spectra produced using the Health Physics Research Reactor, four monoenergetic neutron fields generated by accelerators, and one 15-cm D2O-moderated californium source spectrum. In general, neutron results reported by the participating agencies were consistent with expected dosimeter performance based on energy response characteristics of the detection systems. Albedo dosimeters, which were the most popular neutron monitoring systems used in this study, provided the best overall accuracy for all exposure conditions. Film, Cr-39 recoil track, and Th-232 fission track systems generally underestimated dose equivalents relative to reference values. Associated gamma measurements showed that TLD monitors produced more accurate results than film dosimeters although both systems overestimated gamma dose equivalents in mixed radiation fields. 24 references, 10 figures, 19 tables

  8. Heavy weight concrete with special mixes for neutron attenuation

    International Nuclear Information System (INIS)

    This work is concerned with the study of the attenuation properties of special mixes of magnetite concrete for fast and thermal neutrons. Investigations were carried out using a collimated beam of neutrons emitted from Pu-α-Be and Californium-252 neutron sources. The fast spectra of neutrons were measured by a scintillation spectrometer with stilbene crystal. Discrimination against undesired pulses of neutrons or gamma -rays was achieved by a zero crossover method. The thermal neutron fluxes were measured by a BF3 detector. The obtained data are displayed in the form of spectra for fast neutrons and attenuation relations for thermal neutrons.The thermal neutron fluxes were measured using bare beam and beams filtered by 113 Cd and B4 C filters to discuss the origin of thermal neutrons interacting with the concrete samples. The obtained results were also used to derive the attenuation coefficients for total thermal neutrons and for newly produced thermal neutrons resulting from neutron beams filtered by 113 Cd and B4 C in the different magnetite concrete shields of different thicknesses.

  9. THERMODYNAMICS OF THE ACTINIDES

    Energy Technology Data Exchange (ETDEWEB)

    Cunningham, Burris B.

    1962-04-01

    Recent work on the thermodynamic properties of the transplutonium elements is presented and discussed in relation to trends in thermodynamic properties of the actinide series. Accurate values are given for room temperature lattice parameters of two crystallographic forms, (facecentred cubic) fcc and dhcp (double-hexagonal closepacked), of americium metal and for the coefficients of thermal expansion between 157 and 878 deg K (dhcp) and 295 to 633 deg K (fcc). The meiting point of the metal, and its magnetic susceptibility between 77 and 823 deg K are reported and the latter compared with theoretical values for the tripositive ion calculated from spectroscopic data. Similar data (crystallography, meiting point and magnetic susceptibility) are given for metallic curium. A value for the heat of formation of americium monoxide is reported in conjunction with crystallographic data on the monoxide and mononitride. A revision is made in the current value for the heat of formation of Am/O/sub 2/ and for the potential of the Am(III)-Am(IV) couple. The crystal structures and lattice parameters are reported for the trichloride, oxychloride and oxides of californium. (auth)

  10. Odd-even effects in the nuclear fission

    International Nuclear Information System (INIS)

    By the adopted way it succeeded without a completely free parameter to reproduce the experimental values for the odd-even effect for all those nuclei for which data were present. These are all even-charged nuclei from thorium to californium. Partly the OE-effect was studied in spontaneous fission, partly in neutron induced fission with thermal, 1.9-, and 3.0- MeV neutrons. It was shown that the calculated values depend very strongly from the one-particle model which is assumed in order to calculate the probabilities for pairing excitations. Thereby not only the steepness plays a role with which the one-particle energies cross the Fermi edge, but also the deformation velocity, and finally the remaining time until the scission point. That means that the whole procedure depends extremely from details of the one-particle model. Different one-particle models can be excluded because they contain simply too many crossings and then the OE effect tends to O. (orig./HSI)

  11. Calculated NWIS signatures for enriched uranium metal

    International Nuclear Information System (INIS)

    Nuclear Weapons Identification System (NWIS) signatures have been calculated using a Monte Carlo transport code for measurement configurations of a 252Cf source, detectors, and a uranium metal casting. NWIS signatures consist of a wide variety of time-and frequency-analysis signatures such as the time distribution of neutrons after californium fission, the time distribution of counts in a detector after a previous count, the number of times n pulses occur in a time interval, and various frequency-analysis signatures, such as auto-power and cross-power spectral densities, coherences, and a ratio of spectral densities. This ratio is independent of detection efficiency. The analysis presented here, using the MCNP-DSP code, evaluates the applicability of this method for measurement of the 235U content of 19-kg castings of depleted uranium and uranium with enrichments of 20, 40, 60, 80, 90, and 93.2 wt % 235U. The dependence of the wide variety of NWIS signatures on 235U content and possible configurations of a measurement system are presented. These preliminary calculations indicate short measurement times. Additional calculations are being performed to optimize the source-detector-moderator-casting configuration for the shortest measurement time. Although the NWIS method was developed for nuclear weapons identification, the development of a small processor now allows it to be also applied in a practical way to subcriticality measurements, nuclear fuel process monitoring and qualitative nondestructive assay of special nuclear material

  12. Fission-fragment attachment to aerosols and their transport through capillary tubes

    International Nuclear Information System (INIS)

    The transport of radioactive aerosols was studied using equipment, collectively called the Helium jet, that has been constructed to provide basic nuclear physics data on fission product nuclides. The transport of the fission products in the system depends on their attachment to aerosol particles. The system consists of 1) a tube furnace which generates aerosols by the sublimation or evaporation of source material, 2) a helium stream used to transport the aerosols, 3) a 25 m settling tube to eliminate the larger aerosols and smaller aerosols that would deposit in the capillary, 4) a Californium-252 self-fissioning source of fission product nuclides, and 5) a small capillary to carry the radioactive aerosols from the hot cell to the laboratory. Different source materials were aerosolized but NaCl is generally used because it yielded the highest transport efficiencies through the capillary. Particle size measurments were made with NaCl aerosols by using a cascade impactor, an optical light scattering device, and the capillary itself as a diffusion battery by performing radiation measurements and/or electrical conductivity measurements. Both radioactive and nonradioactive aerosols were measured in order to investigate the possibility of a preferential size range for fission product attachment. The measured size distributions were then used to calculate attachment coefficients and finally an attachment time

  13. Vyhodnocení individuálních frekvencí segmentovaného EEG signálu

    Czech Academy of Sciences Publication Activity Database

    Chládek, Jan; Halámek, Josef; Jurák, Pavel; Bočková, M.; Robert, R.

    Brno : LF MU, 2007. s. 18. ISBN 978-80-254-0420-1. [Společný sjezd České a Slovenské společnosti klinické neurofyziologie /54./. 25.10.2007-26.10.2007, Brno] Institutional research plan: CEZ:AV0Z20650511 Keywords : EEG * segmentation * individual frequencies * automatic processing Subject RIV: FH - Neurology

  14. Paths to subreplacement fertility : the empirical evidence / Tomas Frejka, John Ross

    Index Scriptorium Estoniae

    Frejka, Tomas

    2001-01-01

    Autorid väidavad, et paljudes riikides jääb sündimus ka edaspidi väga madalaks. Vaadeldakse 54 riigis abielude sõlmimist, rasestumisvastaste vahendite kasutamist ja abortide arvu. Diagrammid ja tabelid. Lisa lk. 213-254

  15. Integrating Moral and Social Development within Middle School Social Studies: A Social Cognitive Domain Approach

    Science.gov (United States)

    Nucci, Larry; Creane, Michael W.; Powers, Deborah W.

    2015-01-01

    Eleven teachers and 254 urban middle-school students comprised the sample of this study examining the social and moral development outcomes of the integration of social cognitive domain theory within regular classroom instruction. Participating teachers were trained to construct and implement history lessons that stimulated students' moral…

  16. EST Table: FS804892 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available PREDICTED: similar to neutral sphingomyelinase (n-smase) activation associated factor fan [Nasonia vitripenn...0 68 %/254 aa gi|91082881|ref|XP_971631.1| PREDICTED: similar to neutral sphingomyelinase (n-smase) activation associated factor fan [Tribolium castaneum] FS804892 fmgV ...

  17. Německé politické strany v českých zemích 1861-1918

    Czech Academy of Sciences Publication Activity Database

    Šebek, Jaroslav

    Olomouc : Katedra politologie a evropských studií Filozofické fakulty Univerzity Palackého v Olomouci, 2000 - (Marek, P.), s. 254-265 ISBN 80-86200-25-6 Institutional research plan: CEZ:AV0Z8015903 Subject RIV: AB - History

  18. Simultaneous Elimination of Formaldehyde and Ozone Byproduct Using Noble Metal Modified TiO2 Films in the Gaseous VUV Photocatalysis

    Directory of Open Access Journals (Sweden)

    Pingfeng Fu

    2012-01-01

    Full Text Available Simultaneous removal of low concentration formaldehyde (HCHO and ozone byproduct was investigated in the gaseous VUV (vacuum ultraviolet photocatalysis by using noble metal modified TiO2 films. Noble metal (Pt, Au, or Pd nanoparticles were deposited on TiO2 films with ultrafine particle size and uniform distribution. Under 35 h VUV irradiation, the HCHO gas (ca. 420 ppbv was dynamically degraded to a level of 10~45 ppbv without catalyst deactivation, and over 50% O3 byproduct was in situ decomposed in the reactor. However, under the same conditions, the outlet HCHO concentration remained at 125~178 ppbv in the O3 + UV254 nm photocatalysis process and 190~260 ppbv in the UV254 nm photocatalysis process. And the catalyst deactivation also appeared under UV254 nm irradiation. Metallic Pt or Au could simultaneously increase the elimination of HCHO and ozone, but the PdO oxide seemed to inhibit the HCHO oxidation in the UV254 nm photocatalysis. Deposition of metallic Pt or Au reduces the recombination of h+/e− pairs and thus increases the HCHO oxidation and O3 reduction reactions. In addition, adsorbed O3 may be partly decomposed by photogenerated electrons trapped on metallic Pt or Au nanoparticles under UV irradiation.

  19. Parent Ratings of ADHD Symptoms: Differential Symptom Functioning across Malaysian Malay and Chinese Children

    Science.gov (United States)

    Gomez, Rapson; Vance, Alasdair

    2008-01-01

    This study examined differential symptom functioning (DSF) in ADHD symptoms across Malay and Chinese children in Malaysia. Malay (N = 571) and Chinese (N = 254) parents completed the Disruptive Behavior Rating Scale, which lists the DSM-IV ADHD symptoms. DSF was examined using the multiple indicators multiple causes (MIMIC) structural equation…

  20. Photoacoustic Spectroscopy

    Czech Academy of Sciences Publication Activity Database

    Zelinger, Zdeněk; Střižík, Michal

    Weinheim : Wiley-VCH Verlag GmbH & Co. KGaA, 2008 - (Lackner, M.), s. 227-254 ISBN 978-3-527-31997-8 Institutional research plan: CEZ:AV0Z40400503 Keywords : lasers * chemistry * photoacoustic spectroscopy Subject RIV: CF - Physical ; Theoretical Chemistry

  1. Electrode coating by chemical mediator: The atomic force microscopy study of surface nanomorphology

    Czech Academy of Sciences Publication Activity Database

    Mansfeldová, Věra; Janda, Pavel; Tarábková, Hana

    Ústí nad Labem: BEST servis, 2010 - (Navrátil, T.; Barek, J.), s. 80-84 ISBN 978-80-254-6710-7. [Modern Electroanalytical Methods /30./. Jetřichovice (CZ), 24.05.2010-28.05.2010] Institutional research plan: CEZ:AV0Z40400503 Keywords : atomic force microscopy * carbon electrode * surface modification Subject RIV: CG - Electrochemistry

  2. Assessing the carcinogenic potential of low-dose exposures to chemical mixtures in the environment: the challenge ahead

    Czech Academy of Sciences Publication Activity Database

    Goodson, W.H.; Vondráček, Jan

    2015-01-01

    Roč. 36, JUN 2015 (2015), s. 254-296. ISSN 0143-3334 R&D Projects: GA ČR(CZ) GA13-07711S Keywords : BREAST - CANCER CELLS * ESTROGEN-RECEPTOR-ALPHA * EPITHELIAL-MESENCHYMAL TRANSITION Subject RIV: BO - Biophysics Impact factor: 5.334, year: 2014

  3. Ultra-Violet Light Treatment Lowers Numbers of Listeria monocytogenes on Raw Chicken Fillets without Changing Antibiotic Resistance or Meat Color

    Science.gov (United States)

    Listeria monocytogenes is an important foodborne pathogen and raw poultry meat has been shown to be a vector for its entrance into a poultry further-processing plant. Reduction of L. monocytogenes in these plants is a high priority for the industry. Ultra-violet (UV) light at a wavelength of 254 n...

  4. Does Lecture Capturing Impact Student Performance and Attendance in an Introductory Accounting Course?

    Science.gov (United States)

    Aldamen, Husam; Al-Esmail, Rajab; Hollindale, Janice

    2015-01-01

    The study empirically examines the interplay between lecture capturing viewership, performance and attendance for students in the Middle Eastern country of Qatar. The sample consists of 254 students enrolled in an introductory accounting class either in the Fall semester or in the Spring semester. We show a weak positive relationship between…

  5. Speleogenesis of selected caves in the Lunan shilins and caves of the Fenglin Karst in Qiubei

    Czech Academy of Sciences Publication Activity Database

    Šebela, S.; Slabe, T.; Liu, H.; Pruner, Petr

    Postojna : Inštitut za raziskovanjekrasa, ZRC SAZU=Karst Research Institute ZRC SAZU, 2011 - (Knez, M.; Liu, H.; Slabe, T.), s. 139-152 ISBN 978-961-254-241-2. - (Carsologica. 12) Institutional research plan: CEZ:AV0Z30130516 Keywords : speleogenesis * paleomagnetic analyses * caves * Lunan shilins and Fenglin Karst in Qiube (China) Subject RIV: DB - Geology ; Mineralogy

  6. 76 FR 50759 - Applications and Amendments to Facility Operating Licenses Involving Proposed No Significant...

    Science.gov (United States)

    2011-08-16

    ... NRC E-Filing rule (72 FR 49139, August 28, 2007). The E-Filing process requires participants to submit...\\ Requestors should note that the filing requirements of the NRC's E-Filing Rule (72 FR 49139; August 28, 2007... Company, LLC (EGC), Docket No. 50-254, Quad Cities Nuclear Power Station (QCNPS), Unit 1, Rock...

  7. ... jak se někteří oblékají

    Czech Academy of Sciences Publication Activity Database

    Kosíková, Jiřina

    Brno: Etnologický ústav AV ČR Brno, 2003 - (Pospíšilová, J.), s. 215-254 ISBN 80-7239-146-1 R&D Projects: GA AV ČR ICE9058202 Institutional research plan: CEZ:AV0Z9058907 Keywords : clothing * youth groups * subculture Subject RIV: AC - Archeology, Anthropology, Ethnology

  8. Rostlinné mikrofosilie z vrtu L7J Rokytnice

    Czech Academy of Sciences Publication Activity Database

    Svobodová, Marcela; Čech, S.

    Turnov : Muzeum Českého ráje, 2009, s. 125-132. ISBN 978-80-254-6150-1. - (Sborník Muzea Českého ráje=Acta Musei Turnoviensis. 4) Keywords : UNESCO European Geopark Bohemian Paradise * palynology * Cenomanian * Rokytnice borehole Subject RIV: DB - Geology ; Mineralogy

  9. Jinačovice od poloviny 19. století do konce první světové války

    Czech Academy of Sciences Publication Activity Database

    Řepa, Milan

    Jinačovice: Obecní úřad Jinačovice, 2008 - (Kocman, P.), s. 44-62 ISBN 978-80-254-3403-1 Institutional research plan: CEZ:AV0Z80150510 Keywords : History 1948-1918 * Moravian countryside * municipal self-government Subject RIV: AB - History

  10. Invisible Religion in a "Non-believing" Country: The Case of the Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Hamplová, Dana; Nešpor, Zdeněk

    2009-01-01

    Roč. 56, č. 4 (2009), s. 581-597. ISSN 0037-7686 R&D Projects: GA ČR GA403/08/0720 Institutional research plan: CEZ:AV0Z70280505 Keywords : economic behavior * money management marriage * cohabitation Subject RIV: AO - Sociology, Demography Impact factor: 0.254, year: 2009

  11. In-Hospital Paternity Establishment and Father Involvement in Fragile Families

    Science.gov (United States)

    Mincy, Ronald; Garfinkel, Irwin; Nepomnyaschy, Lenna

    2005-01-01

    This article assesses the effectiveness of in-hospital paternity establishment, a federal requirement since 1993. We avoid biases in previous studies by using a national sample of nonmarital births (N= 3,254), by including detailed controls for characteristics of unwed mothers and previously unavailable controls for characteristics of fathers, and…

  12. The Supreme Court of Estonia constitutional judgement 3-3-1-35-10: judgment of the Supreme Court en banc : date of decision 31 August 2011

    Index Scriptorium Estoniae

    2013-01-01

    Kohtulahendi 3-3-1-35-10 (Riigiprokuratuuri ning Politsei- ja Piirivalveameti kassatsioonkaebused Tallinna Ringkonnakohtu 16. veebruari 2010. a otsuse peale haldusasjas nr 3-08-265 Ülar Kaasi (Kaas) kaebuses Eesti Vabariigi tekitatud 254 087 krooni suuruse kahju hüvitamise nõudes) tekst inglise keeles

  13. Chemical composition of flesh of diploid and triploid population of tench (Tinca tinca, Linnaeus 1758)

    Czech Academy of Sciences Publication Activity Database

    Buchtová, H.; Vorlová, L.; Svobodová, Z.; Flajšhans, Martin

    2005-01-01

    Roč. 50, č. 5 (2005), s. 213-219. ISSN 1212-1819 Institutional research plan: CEZ:AV0Z50450515 Keywords : tench * genome polyploidy * dry matter Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 0.254, year: 2005

  14. First data on the parasites of Hoplias aimara (Characiformes): description of two new species of gill monogeneans (Dactylogyridae)

    Czech Academy of Sciences Publication Activity Database

    Moreira, J.; Scholz, Tomáš; Luque, J.L.

    2015-01-01

    Roč. 60, č. 2 (2015), s. 254-260. ISSN 1230-2821 R&D Projects: GA ČR GBP505/12/G112 Institutional support: RVO:60077344 Keywords : Monogenea * Dactylogyridae * Urocleidoides * Erythrinidae * Hoplias aimara * Xingu River * Brazil Subject RIV: EG - Zoology Impact factor: 0.905, year: 2014

  15. AcEST: DK956989 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ST4_HUMAN Microtubule-associated serine/threonine-pr... 30 8.2 sp|O02491|HMEN_ANOGA Segmentation...PGPPKTKHPDRSLSSQKPSV 2222 Query: 277 GKTLALSP 254 G T P Sbjct: 2223 GATKGKEP 2230 >sp|O02491|HMEN_ANOGA Segmentation

  16. Pesticide exposure in the Czech TIC from 1997 to 2005

    Czech Academy of Sciences Publication Activity Database

    Rakovcová, H.; Navrátil, Tomáš; Říčařová, B.; Afshari, R.; Ghodsi, E.; Pelclová, D.

    Athens : European Association of Poisons Centres and Clinical Toxicologists, 2007. s. 254. [International Congress EAPCCT /27./. 01.05.2007-04.05.2007, Athens] Institutional research plan: CEZ:AV0Z40400503 Keywords : pesticide exposure * Roxicological Information Centre Subject RIV: CF - Physical ; Theoretical Chemistry

  17. Influence of the surface structure on the filtration performance of UV-modified PES membranes

    DEFF Research Database (Denmark)

    Kæselev, Bozena Alicja; Kingshott, P.; Jonsson, Gunnar Eigil

    2002-01-01

    Poly (ether sulfone) (PES) 50 kDa membranes were surface modified by irradiation with UV light (254 nm) in the presence of N-vinyl-2-pyrrolidine (NVP), 2-acrylamidoglycolic acid monohydrate (AAG) and 2-acrylamido-2-methyl-1-propanesulfonic acid (AAP). The surfaces of the modified membranes were c...

  18. Brno (k.ú. Bystrc, okr. Brno-město). Rokle. Neolit. Ojedinělý nález. Povrchový průzkum

    Czech Academy of Sciences Publication Activity Database

    Kirchner, Karel; Kuča, M.

    2009-01-01

    Roč. 50, 1-2 (2009), s. 253-254. ISSN 1211-7250 R&D Projects: GA ČR GA205/06/1024 Institutional research plan: CEZ:AV0Z30860518 Keywords : Brno Reservoir * neolithic * surface survey Subject RIV: AC - Archeology, Anthropology, Ethnology

  19. Antická mytologie po novořecku

    Czech Academy of Sciences Publication Activity Database

    Šípová, Pavlína

    Praha : Kabinet pro klasická studia, Filozofický ústav AV ČR, 2008 - (Silagiová, Z.; Šedinová, H.; Kitzler, P.), s. 392-401 ISBN 978-80-254-1863-5 Institutional research plan: CEZ:AV0Z90090514 Keywords : ancient mythology * modern-greek folklore Subject RIV: AL - Art, Architecture, Cultural Heritage

  20. An Analysis of Organizational Behavior Management Research in Terms of the Three-Contingency Model of Performance Management

    Science.gov (United States)

    Weatherly, Nicholas L.; Malott, Richard W.

    2008-01-01

    The three-contingency model of performance management (Malott, 1992, 1993, 1999) was used to analyze interventions in the "Journal of Organizational Behavior Management (JOBM)" from the years 1990 through 2005 (Volume 11[1]-Volume 25[4]). The current article extends previous reviews (Malott, Shimamune, & Malott, 1992; Otto & Malott, 2004) by…

  1. Counseling Depressed Female Religious Professionals: Nuns and Clergywomen.

    Science.gov (United States)

    Rayburn, Carole A.

    1991-01-01

    Studied stress, strain, depression, and coping resources in nuns and clergywomen (n=254). Found nuns had less stress and strain, less depression, and better coping resources than female clergywomen. Female Reform rabbis experienced most stress, strain, and possible depression, with lowest coping resources. (Author/ABL)

  2. Relevant market, economic analysis and information

    Czech Academy of Sciences Publication Activity Database

    Zemplinerová, Alena

    Praha: Czech Association for Competition Law, 2008, s. 28-39. ISBN 978-80-254-3276-1 R&D Projects: GA MŠk LC542 Institutional research plan: CEZ:AV0Z70850503 Keywords : relevant market definition * competition law * economic analysis Subject RIV: AH - Economics

  3. Measurements of phytoplankton of sub-nanomolar chlorophyll concentrations by a modified double-modulation fluorometer

    Czech Academy of Sciences Publication Activity Database

    Dijkman, N.; Kaftan, David; Trtílek, M.; Nedbal, Ladislav

    1999-01-01

    Roč. 37, č. 2 (1999), s. 249-254. ISSN 0300-3604. [Regional Photosynthesis Workshop /2./. Lipno, 31.01.1999-03.02.1999] R&D Projects: GA MŠk OK 271 Grant ostatní: INCO-COPERNICUS(EC) IC15CT95-0105 Subject RIV: BO - Biophysics Impact factor: 0.734, year: 1999

  4. Assessment of the radio 3H-CH4 tracer technique to measure aerobic methane oxidation in the water column

    Czech Academy of Sciences Publication Activity Database

    Bussmann, I.; Matoušů, Anna; Osudar, R.; Mau, S.

    2015-01-01

    Roč. 13, č. 6 (2015), s. 312-327. ISSN 1541-5856 R&D Projects: GA ČR(CZ) GA13-00243S Institutional support: RVO:60077344 Keywords : methane * aerobic methane oxidation * methods * radiotracer Subject RIV: DA - Hydrology ; Limnology Impact factor: 2.254, year: 2014

  5. Spolkový život ve Víru

    Czech Academy of Sciences Publication Activity Database

    Altman, Karel

    Vír : Obec Vír, 2008, s. 187-216. ISBN 978-80-254-3430-7 Institutional research plan: CEZ:AV0Z90580513 Keywords : everyday in village * the Czech-moravian Highlands * unions * clubs * public houses * touris, * hiking Subject RIV: AC - Archeology, Anthropology, Ethnology

  6. Coping a rezistencia voči mobbingu v kontexte paradigmatického prístupu

    Czech Academy of Sciences Publication Activity Database

    Vitková, M.; Zábrodská, Kateřina

    2014-01-01

    Roč. 58, č. 3 (2014), s. 254-269. ISSN 0009-062X R&D Projects: GA ČR GA14-02098S Institutional support: RVO:68081740 Keywords : coping * rezistencia * mobbing Subject RIV: AN - Psychology Impact factor: 0.239, year: 2014

  7. Joint research using small tokamaks

    Czech Academy of Sciences Publication Activity Database

    Gryaznevich, M.P.; Del Bosco, E.; Malaquias, A.; Mank, G.; Van Oost, G.; He, Yexi; Hegazy, H.; Hirose, A.; Hron, Martin; Kuteev, B.; Ludwig, G.O.; Nascimento, I.C.; Silva, C.; Vorobyev, G.M.

    2005-01-01

    Roč. 45, č. 10 (2005), S245-S254. ISSN 0029-5515. [Fusion Energy Conference contributions. Vilamoura, 1.11.2004-6.11.2004] Institutional research plan: CEZ:AV0Z20430508 Keywords : small tokamaks * thermonuclear fusion Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 3.418, year: 2005

  8. Method for removal of mercury from various gas streams

    Energy Technology Data Exchange (ETDEWEB)

    Granite, E.J.; Pennline, H.W.

    2003-06-10

    The invention provides for a method for removing elemental mercury from a fluid, the method comprising irradiating the mercury with light having a wavelength of approximately 254 nm. The method is implemented in situ at various fuel combustion locations such as power plants and municipal incinerators.

  9. Comparative ecophysiology of cold-tolerance-related traits: Assessing range expansion potential for an invasive insect at high latitude

    Czech Academy of Sciences Publication Activity Database

    Lehmann, P.; Kaunisto, S.; Košťál, Vladimír; Margus, A.; Zahradníčková, Helena; Lindström, L.

    2015-01-01

    Roč. 88, č. 3 (2015), s. 254-265. ISSN 1522-2152 R&D Projects: GA MŠk LH12103 Grant ostatní: Academy of Finland(FI) 118456; Academy of Finland(FI) 128888 Institutional support: RVO:60077344 Keywords : Leptinotarsa decemlineata Subject RIV: ED - Physiology Impact factor: 2.398, year: 2014

  10. Rickettsia bellii in ticks Amblyomma varium Koch, 1844, from birds in Peru

    Czech Academy of Sciences Publication Activity Database

    Ogrzewalska, M.; Literák, I.; Cárdenas-Callirgos, J. M.; Čapek, Miroslav; Labruna, M. B.

    2012-01-01

    Roč. 3, č. 4 (2012), s. 254-256. ISSN 1877-959X R&D Projects: GA AV ČR IAA601690901; GA MŠk LC06073 Institutional support: RVO:68081766 Keywords : Rickettsia bellii * ticks * Amblyomma calcaratum * birds * Peru Subject RIV: EG - Zoology Impact factor: 2.353, year: 2012

  11. Reading Interests of High School Students.

    Science.gov (United States)

    Diaz-Rubin, C.

    1996-01-01

    Investigates the reading genre preferences of 254 male and female high school students in Pennsylvania. Draws comparisons with similar research done 10 years earlier. Finds a substantial change in reading interests. Notes the top 10 areas of interest are adventure, horror, mysteries, humor, murder, love, fantasy, crime, sports, and movies. (RS)

  12. Critical behavior of nanoparticle-containing binary liquid mixtures

    Czech Academy of Sciences Publication Activity Database

    Štěpánek, Petr; Bakaeva, Zulfiya; Černoch, Peter; Nallet, F.; Noirez, L.

    Pisa : European Polymer Federation, 2013. O2-54. [European Polymer Congress - EPF 2013. 16.06.2013-21.06.2013, Pisa] R&D Projects: GA ČR GA202/09/2078 Institutional support: RVO:61389013 Keywords : nanoparticles * hydrogen bonds Subject RIV: BO - Biophysics

  13. Focal cerebral ischemia measured by the intra-arterial 133xenon method. Limitations of 2-dimensional blood flow measurements

    DEFF Research Database (Denmark)

    Skyhøj Olsen, T; Larsen, B; Bech Skriver, E; Enevoldsen, E; Lassen, N A

    1981-01-01

    The limitations of 2-dimensional isotope techniques in the study of focal cerebral ischemia were investigated using the intra-carotid 133 xenon injection method and a 254 multidetector scintillation camera. To make sure that the detectors "look" directly on infarcted areas, only patients with inf...

  14. 40 CFR 30.16 - Resource Conservation and Recovery Act (RCRA).

    Science.gov (United States)

    2010-07-01

    ... materials identified in guidelines developed by EPA (40 CFR parts 247 through 254). Accordingly, State and... EPA award of assistance double sided on recycled paper. This requirement does not apply to Standard Forms. These forms are printed on recycled paper as available through the General...

  15. Gamma radiation-sterilized, triple-lumen catheters coated with a low concentration of chlorhexidine were not efficacious at preventing catheter infections in intensive care unit patients.

    OpenAIRE

    Sherertz, R J; Heard, S O; Raad, I I; Gentry, L; Bowton, D; Scuderi, P; Hu, J.; Carruth, W; Satishchandra, B; J. Pepe; Mosenthal, A; Burke, T.; Dupuis, J.

    1996-01-01

    In a randomized, double-blind trial, gamma radiation-sterilized, chlorhexidine-coated triple-lumen catheters were compared with uncoated control catheters for their ability to prevent catheter infection in 254 intensive care unit patients. The chlorhexidine coating was not efficacious, and a rabbit model demonstrated that reduction of chlorhexidine activity by gamma radiation sterilization was the likely explanation for the failure.

  16. „Doufám, že moje nepřítomnost nebude pozorována.“ Stanislav Špaček a prezentace Československa na jubilejní výstavě ve Filadelfii v roce 1926

    Czech Academy of Sciences Publication Activity Database

    Hálek, Jan

    Praha : Filozofická fakulta Univerzity Karlovy, 2015 - (Tumis, S.; Koura, J.; Soukup, J.), s. 254-265 ISBN 978-80-7308-574-2. - (Fontes. 16) Institutional support: RVO:67985921 Keywords : Czechoslovakia, 1920s * Špaček, Stanislav * history Subject RIV: AB - History

  17. Sensitivity analysis of 1−d steady forced scalar conservation laws

    Czech Academy of Sciences Publication Activity Database

    Ersoy, M.; Feireisl, Eduard; Zuazua, E.

    2013-01-01

    Roč. 254, č. 9 (2013), s. 3817-3834. ISSN 0022-0396 R&D Projects: GA ČR GA201/09/0917 Institutional support: RVO:67985840 Keywords : sensitivity * scalar conservation law * control Subject RIV: BA - General Mathematics Impact factor: 1.570, year: 2013 http://www.sciencedirect.com/science/article/pii/S0022039613000892#

  18. Experience of autotransfusion application of UV-irradiated blood in children dermatology

    International Nuclear Information System (INIS)

    Autotransfusion of blood, irradiated by medium doses of UV radiation (254 nm), causes a stable clinical effect in children with chronic pyodermatitis and psoriasis in progressing stage, but not with allergodermatitis. Simultaneously the equilibrium in the links of vegetative nervous system is normalized, humoral immunity is activated

  19. Bondyho ontologická útěcha

    Czech Academy of Sciences Publication Activity Database

    Kužel, Petr

    Praha : Univerzita Karlova v Praze, Pedagogická fakulta, 2011 - (Pelcová, N.; Hogenová, A.), s. 232-254 ISBN 978-80-7290-515-7 Institutional support: RVO:67985955 Keywords : ontological substance * non-substantial ontology * philosophy of Egon Bondy * axiology * causality * determination * artificial creature * auto-motion of ontological reality Subject RIV: AA - Philosophy ; Religion

  20. Znovuobjevený Georg Placzek

    Czech Academy of Sciences Publication Activity Database

    Gottvald, Aleš

    Předklášteří : Muzeum Brněnska, 2007 - (Hanák, J.), s. 32-47 ISBN 978-80-254-0372-3 Institutional research plan: CEZ:AV0Z20650511 Keywords : Georg Placzek * theoretical physics * history of nuclear physics * Manhattan project * famous scientists of Brno origin Subject RIV: AB - History

  1. Linkage and association analysis of CACNG3 in childhood absence epilepsy

    DEFF Research Database (Denmark)

    Everett, Kate V; Chioza, Barry; Aicardi, Jean;

    2007-01-01

    Childhood absence epilepsy (CAE) is an idiopathic generalised epilepsy characterised by absence seizures manifested by transitory loss of awareness with 2.5-4 Hz spike-wave complexes on ictal EEG. A genetic component to aetiology is established but the mechanism of inheritance and the genes...

  2. Regional cerebral blood flow in focal cortical epilepsy

    DEFF Research Database (Denmark)

    Hougaard, Kristina Dupont; Oikawa, T; Sveinsdottir, E;

    1976-01-01

    Regional cerebral blood flow (rCBF) was studied in ten patients with focal cortical epilepsy. The blood flow was measured by the intra-arterial injection of xenon 133 (133Xe), and the isotope clearance was recorded by a multidetector scintillation camera with 254 detectors. Three patients were...

  3. Minimization of the formation of disinfection by-products.

    Science.gov (United States)

    Badawy, Mohamed I; Gad-Allah, Tarek A; Ali, Mohamed E M; Yoon, Yeoman

    2012-09-01

    The drinking water industry is required to minimize DBPs levels while ensuring adequate disinfection. In this study, efficient and appropriate treatment scheme for the reduction of disinfection by-product (DBPs) formation in drinking water containing natural organic matter has been established. This was carried out by the investigation of different treatment schemes consisting of enhanced coagulation, sedimentation, disinfection by using chlorine dioxide/ozone, filtration by sand filter, or granular activated carbon (GAC). Bench scale treatment schemes were applied on actual samples from different selected sites to identify the best conditions for the treatment of water. Samples were collected from effluent of each step in the treatment train in order to analyze pH, UV absorbance at 254 nm (UVA(254)), specific UV absorbance at 254 nm (SUVA(254)), dissolved organic carbon (DOC), haloacetic acids (HAAs) and trihalomethanes (THMs). The obtained results indicated that using pre-ozonation/enhanced coagulation/activated carbon filtration treatment train appears to be the most effective method for reducing DBPs precursors in drinking water treatment. PMID:22591848

  4. Mitmetahulisele kultuuripärandile tuleb läheneda terviklikult : pärand / Peeter Mauer, Anton Pärn, Marju Reismaa

    Index Scriptorium Estoniae

    Mauer, Peeter

    2008-01-01

    Kultuuripärandi säilitamisest ja kasutamisest. Vabariigi valitsuse 2008. a. 6. juuni korraldusega nr. 254 kiideti heaks "Eesti kultuuripärandi hoidmise ja väärtustamise arengukava aastani 2030" koostamise ettepanek. Tulevasest arengukavast, mis koondab olemasolevad kultuuripärandiga seotud programmid ja arengukavad ning mille koostamise eest vastutab kultuuriministeerium

  5. 24 CFR 91.315 - Strategic plan.

    Science.gov (United States)

    2010-04-01

    ... moderate-income families to whom the state will provide affordable housing as defined in 24 CFR 92.252 for rental housing and 24 CFR 92.254 for homeownership over a specific time period. (c) Public housing. With... to obtain the additional flexibility available as provided in 24 CFR part 570, subpart I. A...

  6. 24 CFR 91.215 - Strategic plan.

    Science.gov (United States)

    2010-04-01

    ... jurisdiction will provide affordable housing as defined in 24 CFR 92.252 for rental housing and 24 CFR 92.254... public housing agency is designated as “troubled” by HUD under 24 CFR part 902, the jurisdiction must... the use of the CDBG funds in the revitalization area(s) as described in 24 CFR part 570, subpart...

  7. Analysis of Textual Data in Psychology

    Czech Academy of Sciences Publication Activity Database

    Urbánek, Tomáš; Czekóová, Kristína

    New York: Nova Science Publishers, 2014 - (Urbánek, T.; Kreitler, h.), s. 243-254 ISBN 978-1-63321-241-1 R&D Projects: GA ČR(CZ) GAP407/12/2432 Institutional support: RVO:68081740 Keywords : textual data * content analysis * semiotic analysis Subject RIV: AN - Psychology

  8. 20 CFR 655.1102 - What are the definitions of terms that are used in these regulations?

    Science.gov (United States)

    2010-04-01

    ... Certification Appeals established by 20 CFR part 656. BALCA consists of administrative law judges assigned to... weighed with no one factor being decisive.” NLRB v. United Ins. Co. of America, 390 U.S. 254, 258 (1968...(a), 1161(a), or 1255a(a)(1); is admitted as a refugee under 8 U.S.C. 1157; or is granted...

  9. Severe Pain Predicts Greater Likelihood of Subsequent Suicide

    Science.gov (United States)

    Ilgen, Mark A.; Zivin, Kara; Austin, Karen L.; Bohnert, Amy S. B.; Czyz, Ewa K.; Valenstein, Marcia; Kilbourne, Amy M.

    2010-01-01

    Using data from the 1999 Large Health Survey of Veterans, Veterans Affairs' medical records, and the National Death Index (N = 260,254), the association between self-reported pain severity and suicide among veterans as examined, after accounting for demographic variables and psychiatric diagnoses. A Cox proportional hazards regression demonstrated…

  10. School Principals' Leadership Behaviours and Its Relation with Teachers' Sense of Self-Efficacy

    Science.gov (United States)

    Mehdinezhad, Vali; Mansouri, Masoumeh

    2016-01-01

    The aim of this study was to investigate the relationship between school principals' leadership behaviours and teachers' sense of self-efficacy. The research method was descriptive and correlational. A sample size of 254 teachers was simply selected randomly by proportional sampling. For data collection, the Teachers' Sense of Efficacy Scale of…

  11. LOUISIANA STUDY OF MANPOWER AND TRAINING NEEDS IN FINANCE, INSURANCE, AND REAL ESTATE OCCUPATIONS.

    Science.gov (United States)

    WOFFORD, T.B.

    TO DETERMINE THE EMPLOYMENT OPPORTUNITIES AND TRAINING NEEDS IN THE FINANCE, INSURANCE, AND REAL ESTATE INDUSTRY OF LOUISIANA, DATA WERE OBTAINED FROM PERSONAL INTERVIEWS OF 102 FIRMS REPRESENTING 25.4 PERCENT OF THE INDUSTRY AND EMPLOYING 7,849 WORKERS. FINDINGS INCLUDED--(1) IN 1965, 30,843 PERSONS WERE EMPLOYED IN 56 DIFFERENT JOBS OR…

  12. Shyness and Vocabulary: The Roles of Executive Functioning and Home Environmental Stimulation

    Science.gov (United States)

    Blankson, A. Nayena; O'Brien, Marion; Leerkes, Esther M.; Marcovitch, Stuart; Calkins, Susan D.

    2011-01-01

    Although shyness has often been found to be negatively related to vocabulary, few studies have examined the processes that produce or modify this relation. The present study examined executive functioning skills and home environmental stimulation as potential mediating and moderating mechanisms. A sample of 3 1/2-year-old children (N = 254) was…

  13. 76 FR 62330 - Radio Broadcasting Services; Alamo, GA; Alton, MO; Boscobel, WI; Buffalo, OK; Cove, AR; Clayton...

    Science.gov (United States)

    2011-10-07

    ... From the Federal Register Online via the Government Publishing Office FEDERAL COMMUNICATIONS COMMISSION 47 CFR Part 73 Radio Broadcasting Services; Alamo, GA; Alton, MO; Boscobel, WI; Buffalo, OK; Cove..., under Montana, Channel 254C2. h. Remove Buffalo, under Oklahoma, Channel 224C2; Erick, Channel...

  14. Dikobraz

    Czech Academy of Sciences Publication Activity Database

    Winter, Tomáš

    Praha : Národní galerie, 2015 - (Pravdová, A.; Winter, T.), s. 254 ISBN 978-80-7035-573-2 R&D Projects: GA ČR GAP409/12/0133 Institutional support: RVO:68378033 Keywords : Dikobraz * satirical weekly Subject RIV: AL - Art, Architecture, Cultural Heritage

  15. Astrochronology of the Late Turonian: implications for the behavior of the carbon cycle at the demise of peak greenhouse

    Czech Academy of Sciences Publication Activity Database

    Laurin, Jiří; Čech, S.; Uličný, David; Štaffen, Z.; Svobodová, Marcela

    2014-01-01

    Roč. 394, May (2014), s. 254-269. ISSN 0012-821X R&D Projects: GA ČR GAP210/10/1991; GA MŠk LH12041 Institutional support: RVO:67985530 ; RVO:67985831 Keywords : Turonian * Coniacian * Milankovitch * astrochronology * carbon isotopes * carbon cycle Subject RIV: DB - Geology ; Mineralogy Impact factor: 4.734, year: 2014

  16. Methods for Determination of Bioaccessibility and Bioavailability of Hydrophobic Organic Pollutants

    Czech Academy of Sciences Publication Activity Database

    Čvančarová, Monika; Cajthaml, Tomáš

    2015-01-01

    Roč. 109, č. 4 (2015), s. 254-268. ISSN 0009-2770 R&D Projects: GA TA ČR TE01020218; GA ČR GA13-28283S Institutional support: RVO:61388971 Keywords : bioremediation * bioaccumulation * environmental risk assessment Subject RIV: EE - Microbiology, Virology Impact factor: 0.272, year: 2014

  17. 78 FR 42532 - Cooperative Research and Development Agreement (CRADA) Opportunity With the Department of...

    Science.gov (United States)

    2013-07-16

    ... validating an ELISA diagnostic kit for detection of Foot and Mouth Disease Virus (FMDV) non-structural... INFORMATION CONTACT: Angela Ervin, 202-254-5624. Correction In the Federal Register of May 16, 2013, in FR Doc... proposals on or before August 8, 2013. Correction In the Federal Register of May 16, 2013, in FR Doc....

  18. Using small punch testing method for the analysis of creep behaviour of Al-Al4C3 composites

    Czech Academy of Sciences Publication Activity Database

    Besterci, M.; Dobeš, Ferdinand; Kulu, P.; Sülleiová, K.

    2010-01-01

    Roč. 16, č. 3 (2010), s. 243-254. ISSN 1736-6038 Grant ostatní: Science Grant Agency of Slovakia(SK) VEGA 2/0105/08 Institutional research plan: CEZ:AV0Z20410507 Keywords : dispersion-strengthened Al-Al4C3 composite * mechanical alloying * creep * small punch Subject RIV: JI - Composite Materials

  19. On the Formation of Thymine Photodimers in Thymine Single Strands and Calf Thymus DNA

    DEFF Research Database (Denmark)

    Baggesen, Lisbeth Munksgård; Hoffmann, S.V.; Nielsen, Steen Brøndsted

    2014-01-01

    Solar light leads to thymine dimers that are mutagenic and primary cause of skin cancer. Here, we report absorption and synchrotron radiation circular dichroism (CD) spectra of Tn single strands with different number n of bases (n = 2–7, 10, 11) recorded after various 254 nm irradiation times. Fr...

  20. Family Structure and Psychosocial Correlates among Urban African-American Adolescent Males.

    Science.gov (United States)

    Zimmerman, Marc A.; And Others

    1995-01-01

    Substance use and delinquency, well-being, and social support were compared across 5 family constellations among 254 adolescent black males. The only difference found was that subjects living in single-mother households reported more parental support than those from other family structures. Data on father/male role model relationships challenged…

  1. Between Religion and Atheism: Hidden Religiosity of the Contemporary Czech Society

    Czech Academy of Sciences Publication Activity Database

    Nešpor, Zdeněk

    Bratislava : Ústav pre vzťahy štátu a cirkví, 2005 - (Jozefčiaková, S.), s. 254-274 ISBN 80-89096-23-9 Institutional research plan: CEZ:AV0Z70280505 Keywords : Sociology of Religion * Czech Republic * 1993- * Religion Subject RIV: AO - Sociology, Demography

  2. 76 FR 39156 - R. J. Corman Railroad Company/Bardstown Line-Lease and Operation Exemption-R. J. Corman Railroad...

    Science.gov (United States)

    2011-07-05

    ... Register on April 9, 2010 (75 FR 18,254), and became effective on April 25, 2010. On May 28, 2010, RJC... Surface Transportation Board R. J. Corman Railroad Company/Bardstown Line--Lease and Operation Exemption--R. J. Corman Railroad Property, LLC R. J. Corman Railroad Company/Bardstown Line (RJC...

  3. Choosing Adolescent Smokers as Friends: The Role of Parenting and Parental Smoking

    Science.gov (United States)

    Mercken, L.; Sleddens, E. F. C.; de Vries, H.; Steglich, C. E. G.

    2013-01-01

    The present study examined whether parenting and parental smoking can prevent children from selecting smoking friends during adolescence. 254 Adolescents of one Belgian secondary school participated. Self-administered questionnaires were distributed among 2nd-4th graders (mean ages = 14.2-16.2 years) during spring 2006. Follow-up was conducted 12…

  4. 78 FR 68987 - Guides for Private Vocational and Distance Education Schools

    Science.gov (United States)

    2013-11-18

    ... CFR Part 254 Guides for Private Vocational and Distance Education Schools AGENCY: Federal Trade... ``Commission'') has completed its regulatory review of the Guides for Private Vocational and Distance Education... on August 14, 1972 (37 FR 9665 (May 16, 1972)). The Commission amended the Guides effective October...

  5. Prostor města a jeho fázový růst v českých zemích od konce 19. století

    Czech Academy of Sciences Publication Activity Database

    Semotanová, Eva

    2010-01-01

    Roč. 36, č. 2 (2010), s. 225-254. ISSN 0323-0988 R&D Projects: GA ČR GA404/09/0897 Institutional research plan: CEZ:AV0Z80150510 Keywords : Urbanization * Towns * Landscape Subject RIV: AB - History

  6. Dědicové dakšinského impéria: Kákatíjové z Varangalu

    Czech Academy of Sciences Publication Activity Database

    Filipský, Jan

    Praha : Nakladatelství Lidové noviny, 2003, s. 254-261 ISBN 80-7106-493-9. - (Dějiny států.) Institutional research plan: CEZ:AV0Z9021901 Keywords : eastern Deccan * medieval period * the Kakatiya dynasty Subject RIV: AB - History

  7. Indický středověk před vpádem islámu: Dakšin

    Czech Academy of Sciences Publication Activity Database

    Strnad, Jaroslav

    1.doplněné. Praha : Lidové noviny, 2008, s. 239-254 ISBN 978-80-7106-493-0. - (Dějiny států) Institutional research plan: CEZ:AV0Z90210515 Keywords : India * pre-islamic * Deccan Subject RIV: AB - History

  8. Dědicové dakšinského impéria: Kákatíjové z Varangalu

    Czech Academy of Sciences Publication Activity Database

    Filipský, Jan

    1.doplněné. Praha : Lidové noviny, 2008, s. 254-261 ISBN 978-80-7106-493-0. - (Dějiny států) Institutional research plan: CEZ:AV0Z90210515 Keywords : South India * history * medieval period Subject RIV: AB - History

  9. Quaternary benzo[c]phenanthridine alkaloids biological activities.Intracellular targets of their action and application in human and veterinary medicine

    Czech Academy of Sciences Publication Activity Database

    Šimánek, V.; Vespalec, Radim; Šedo, A.; Ulrichová, J.; Vičar, J.

    Dordrecht : Kluwer Academic Publishers, 2003 - (Schneider, M.), s. 245-254 ISBN 1-4020-1769-3 R&D Projects: GA ČR GA203/02/0023 Institutional research plan: CEZ:AV0Z4031919 Keywords : benzo[c]phenanthridine alkaloids * sanguinarine * chelerythrine Subject RIV: CE - Biochemistry

  10. 24 CFR 570.506 - Records to be maintained.

    Science.gov (United States)

    2010-04-01

    ... gender of single heads of households) displaced as a result of CDBG funded activities, together with the... HOME program income targeting requirements at 24 CFR 92.252 or 92.254. (5) For each activity determined... skills or education; (2) A listing by job title of the permanent jobs to be created indicating which...

  11. An investigation into reservoir NOM reduction by UV photolysis and advanced oxidation processes.

    Science.gov (United States)

    Goslan, Emma H; Gurses, Filiz; Banks, Jenny; Parsons, Simon A

    2006-11-01

    A comparison of four treatment technologies for reduction of natural organic matter (NOM) in a reservoir water was made. The work presented here is a laboratory based evaluation of NOM treatment by UV-C photolysis, UV/H(2)O(2), Fenton's reagent (FR) and photo-Fenton's reagent (PFR). The work investigated ways of reducing the organic load on water treatment works (WTWs) with a view to treating 'in-reservoir' or 'in-pipe' before the water reaches the WTW. The efficiency of each process in terms of NOM removal was determined by measuring UV absorbance at 254 nm (UV(254)) and dissolved organic carbon (DOC). In terms of DOC reduction PFR was the most effective (88% removal after 1 min) however there were interferences when measuring UV(254) which was reduced to a lesser extent (31% after 1 min). In the literature, pH 3 is reported to be the optimal pH for oxidation with FR but here the reduction of UV(254) and DOC was found to be insensitive to pH in the range 3-7. The treatment that was identified as the most effective in terms of NOM reduction and cost effectiveness was PFR. PMID:16765416

  12. AcEST: DK953339 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST39A01NGRL0017_I05 559 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0017_I05. 5' end seq ... |Q6DW15_9CARY Tonoplast intrinsic protein gamma OS=Salicornia ... herbacea PE=2 SV=2 Length = 254 Score = 180 bits ( ...

  13. AcEST: DK963449 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST39A01NGRL0016_J03 544 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0016_J03. 5' end seq ... |Q6DW15_9CARY Tonoplast intrinsic protein gamma OS=Salicornia ... herbacea PE=2 SV=2 Length = 254 Score = 134 bits ( ...

  14. AcEST: DK963176 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST39A01NGRL0015_N07 592 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0015_N07. 5' end seq ... |Q6DW15_9CARY Tonoplast intrinsic protein gamma OS=Salicornia ... herbacea PE=2 SV=2 Length = 254 Score = 198 bits ( ...

  15. AcEST: DK953319 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST39A01NGRL0017_H09 560 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0017_H09. 5' end seq ... |Q6DW15_9CARY Tonoplast intrinsic protein gamma OS=Salicornia ... herbacea PE=2 SV=2 Length = 254 Score = 187 bits ( ...

  16. AcEST: DK959990 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST39A01NGRL0006_C24 656 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0006_C24. 5' end seq ... |Q6DW15_9CARY Tonoplast intrinsic protein gamma OS=Salicornia ... herbacea PE=2 SV=2 Length = 254 Score = 239 bits ( ...

  17. Domain Modeling: NP_066574.2 [SAHG[Archive

    Lifescience Database Archive (English)

    Full Text Available NP_066574.2 chr2 CRYSTAL STRUCTURE OF A DESIGNED ZINC FINGER PROTEIN BOUND TO DNA c1meyf_ chr2/NP_066574.2.../NP_066574.2_holo_254-335.pdb blast 255K,259C,261E,262C,263G,264K,265A,266F,267F,268D

  18. Czech-Iranian research in salt karst (SE Iran, Zagros Mts.): Project NAMAK in the period 2005-2008

    Czech Academy of Sciences Publication Activity Database

    Filippi, Michal; Bruthans, J.

    Prague : Czech Speleological Society, 2009, s. 39-43. ISBN 978-80-254-4928-8 R&D Projects: GA AV ČR(CZ) KJB301110501 Institutional research plan: CEZ:AV0Z30130516 Keywords : salt karst * karst research * karst * Iran Subject RIV: DB - Geology ; Mineralogy

  19. Microvessel density and endothelial cell proliferation levels in colorectal liver metastases from patients given neo-adjuvant cytotoxic chemotherapy and bevacizumab

    DEFF Research Database (Denmark)

    Eefsen, Rikke Løvendahl; Engelholm, Lars Henning; Willemoe, Gro L.;

    2016-01-01

    differences in angiogenesis. To identify possible response markers, histological markers of angiogenesis were assessed. Patients who underwent resection of colorectal liver metastasis at Rigshospitalet, Copenhagen, Denmark from 2007 to 2011 were included (n = 254) including untreated and patients treated with...

  20. 29 CFR 780.145 - The relationship is determined by consideration of all relevant factors.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 3 2010-07-01 2010-07-01 false The relationship is determined by consideration of all... Incident to Or in Conjunction Withâ the Farming Operations § 780.145 The relationship is determined by... will control (Maneja v. Waialua, 349 U.S. 254; Mitchell v. Budd, 350 U.S. 473). Due weight should...