WorldWideScience

Sample records for californium 254

  1. Californium-252

    International Nuclear Information System (INIS)

    1975-01-01

    This meeting constituted the third phase of a project initiated by the Dosimetry Section of the IAEA in 1973. The first step, early in 1973, consisted of the development of a programme for the loan of Cf-252 sources to the Member States in support of education, training and some limited research. To date, 14 institutions in 13 Member States have participated in this loan programme. In August last year, the Agency published an instructional syllabus and laboratory manual authored by Professors Eric J. Hall and Harald H. Rossi of Columbia University (Californium-252 in Teaching and Research, Technical Reports Series No. 159). The appearance of this publication, including guidance on the design and construction of a storage and use facility, was the second phase of this programme aimed at providing some support to potential users in the fields of radiation biology and dosimetry. The objective of the programme's third phase - the convening of an Educational Seminar - was to provide a forum to bring together participants in the Agency's loan programme and experts in various scientific fields. Specifically, the Seminar consisted of a series of expert presentations in spectrometry, activation and prompt gamma analyses, on-stream analysis, dosimetry, health physics, radiology and radiotherapy. (author)

  2. Magnetism in californium

    International Nuclear Information System (INIS)

    Moore, J.R.

    1988-03-01

    A SQUID-based magnetic susceptometer has been constructed for studying small radioactive samples at temperatures below 350 K and in magnetic fields up to 50 kilogauss. The device has been used to study californium (element 98) in a number of solid-state forms: the dhcp metal, several oxides (Cf 2 O 3 in both the bcc and monoclinic structures, Cf 7 O 12 , CfO 2 and BaCfO 3 ), several monopnictides (CfN, CfAs and CfSb) and the trichloride (in both the hexagonal and orthorhombic structures). All of these materials were studied in polycrystalline form, and hexagonal CfCl 3 was studied in single-crystal form as well. The susceptometer has the sensitivity to measure samples containing less than 10 micrograms of californium. The magnetic susceptibilities of all of the californium materials at temperatures above about 100 K are described well by the Curie-Weiss relationship. This behavior is consistent with the assumption that the magnetic 5f electrons are localized and that the paramagnetic behavior can be interpreted in terms of the properties of the free ion. The measured values of the effective paramagnetic moment, μ/sub eff/, for all the californium materials that were studied are reasonably consistent with theoretical values based on intermediate coupling models. All of the californium materials showed some indications of cooperative magnetic effects. The dhcp metal was observed to order ferromagnetically at 52 K, and all of the californium compounds studied showed signs of antiferromagnetic ordering, mostly at temperatures below 25 K. 91 refs., 50 figs., 19 tabs

  3. Medical applications of californium-252

    International Nuclear Information System (INIS)

    Oliver, G.D. Jr.

    1975-01-01

    Primarily, californium-252 sources have been utilized in medicine for the treatment of neoplastic lesions. For five years, a coordinated effort between several cancer research institutions and national laboratories has developed the necessary physics, radiobiology, and engineering skills to establish an evaluation program for californium. Several more years of combined effort are required before it is known whether californium therapy is as good as or better than conventional therapy with sources like radium. Recently, development of diagnostic applications of californium in medicine has received attention. Studies comparing neutron decay activation analysis versus prompt capture gamma ray analysis are in progress. A hopeful application of prompt analysis with reasonable quantities (200 μg) of californium is the elemental analysis of bone in the human body. (U.S.)

  4. Californium loan programme

    International Nuclear Information System (INIS)

    1974-01-01

    The offer of the United States to loan Californium-252 sources to the IAEA was made by Dr. Glenn T. Seaborg, then chairman of the USAEC, in his opening statement at the 15th. General Conference of the IAEA held in Vienna in 1971. The purpose of this loan was to make neutron emitting sources available to universities in the Member States for use in educational programmes. The sources, in the form of small needles designed for medical use in radiation therapy, were judged highly suitable for didactic applications due to their small size, limited activity and well documented radiological parameters. Subsequently, in May 1973, the Director General announced the availability of the Californium sources to the Member States. To date, numerous sources have been loaned to universities in Czechoslovakia, Costa Rica, the Federal Republic of Germany, Ghana, India, Iran, Israel, Japan, South Africa, Switzerland, the United Kingdom and Uruguay; additional applications for loans are being processed. It is anticipated that the loan programme will be terminated in 1975 once all the available sources have been distributed. n order to provide guidance for the Member States on the safe exploitation of these sources, a prototype use and storage facility was designed by IAEA staff of the Dosimetry Section of the Division of Life Sciences, and constructed at the IAEA laboratory in Seibersdorf, Austria. Figures 2-5 illustrate some of the details of this container, which is being given to the Ghana Nuclear Centre in support of a training programme for students at the university in Accra. Further advice to users of these sources will be provided by the publication of an instructional syllabus, a laboratory manual for experiments and the safety precautions inherent in the proper handling of neutron emitting radionuclides, authored by Professors Erich J. Hall and Harald H. Rossi of Columbia University. The syllabus and manual will be published as part of the IAEA Technical Series in September

  5. Californium source transfer

    International Nuclear Information System (INIS)

    Wallace, C.R.

    1995-01-01

    In early 1995, the receipt of four sealed californium-252 sources from Oak Ridge National Lab was successfully accomplished by a team comprised of Radiological Engineering, Radiological Operations and Health Physics Instrumentation personnel. A procedure was developed and walked-down by the participants during a Dry Run Evolution. Several special tools were developed during the pre-planning phases of the project which reduced individual and job dose to minimal levels. These included a mobile lifting device for attachment of a transfer ball valve assembly to the undercarriage of the Cannonball Carrier, a transfer tube elbow to ensure proper angle of the source transfer tube, and several tools used during emergency response for remote retrieval and handling of an unshielded source. Lessons were learned in the areas of contamination control, emergency preparedness, and benefits of thorough pre-planning, effectiveness of locally creating and designing special tools to reduce worker dose, and methods of successfully accomplishing source receipt evolutions during extreme or inclement weather

  6. Californium-252 progress, report No. 7, April 1971

    Energy Technology Data Exchange (ETDEWEB)

    1971-12-31

    This report contains discusses of the following topics on Californium-252: First sales of californium-252; encapsulation services discussed; three new participants in market evaluation program; summer training programs to use californium; Californium-252 shipping casks available; Californium-252 questions and answers, radiotherapy; neutron radiography; natural resources exploration; nuclear safeguards; process control; dosimetry; neutron radiography; neutron shielding; and nuclear safeguards.

  7. Uranium standards for Californium Shuffler

    International Nuclear Information System (INIS)

    Gibbs, A.; Boynton, S.P.

    1978-10-01

    The Laboratories Department analyzed pieces of a U-Al log which were to be canned and used as a set of standards for the nondestructive Californium Shuffler instrument. Evaluation of this instrument is part of an on-going Safeguards Program and is a joint project between LASL and SRP. A U-Al casting of a nominal 30% to 70% composition was made with enriched uranium (56 wt % 235 U). The log was 6 in. in diameter and approximately 2 ft long. A 1/4-in. slice was made before and after each 1-in. slice taken for use as a standard. The 1-in. slices were scanned nondestructively by collimated gamma pulse height analysis. The 1/4-in. slices were divided into quadrants and one quadrant for each slice was destructively analyzed. Results from these tests showed an approximate 1.5% relative variation in uranium concentration from the high to the low point. Successive pieces showed less than 1% relative difference. The 1-in. pieces have been canned and shipped to LASL for testing and will be returned with the Californium Shuffler. The remaining 1/4-in. slices have been sent to NBL and LASL for destructive analysis

  8. Radiography using californium-252 neutron sources

    International Nuclear Information System (INIS)

    Ray, J.W.

    1975-01-01

    The current status in the technology of neutron radiography using californium-252 neutron sources is summarized. Major emphasis is on thermal neutron radiography since it has the widest potential applicability at the present time. Attention is given to four major factors which affect the quality and useability of thermal neutron radiography: source neutron thermalization, neutron beam extraction geometry, neutron collimator dimensions, and neutron imaging methods. Each of these factors has a major effect on the quality of the radiographs which are obtained from a californium source neutron radiography system and the exposure times required to obtain the radiographs; radiograph quality and exposure time in turn affect the practicality of neutron radiography for specific nondestructive inspection applications. A brief discussion of fast neutron radiography using californium-252 neutron sources is also included. (U.S.)

  9. Californium-252 radiotherapy sources for interstitial afterloading

    International Nuclear Information System (INIS)

    Permar, P.H.; Walker, V.W.

    1976-01-01

    Californium-252 neutron sources for interstitial afterloading were developed to investigate the value of this radionuclide in cancer therapy. Californium-252 seed assemblies contain essentially point sources of 252 Cf permanently sealed on 1-cm centers within a flexible plastic tube. The seed assemblies are fabricated with remotely operated, specially designed machines. The fabrication process involves the production of a Pt-10 percent Ir-clad wire with a 252 Cf 2 O 3 -Pd cermet core. The wire is swaged and drawn to size, cut to length, and welded in a Pt-10 percent Ir capsule 0.8 mm in diameter and 6 mm long. Each seed capsule contains approximately 0.5 microgram of 252 Cf. Because the effective half-life of 252 Cf is 2.6 years, the seed assemblies are not disposable and must be reused until their activities have decreased to unsuitable levels. The flexible plastic components must therefore have sufficient resistance to radiation damage to survive the neutron-plus-gamma radiation from 252 Cf. On the basis of accelerated irradiation tests with a large 252 Cf source, a recently developed fluoropolymer, ''Tefzel'' (trademark of E. I. du Pont de Nemours and Company) has adequate radiation resistance for this application. Californium-252 seed assembly systems are loaned by the United States Energy Research and Development Administration for clinical investigations under a protocol of the Radiation Therapy Oncology Group, U.S. National Cancer Institute

  10. Historical review of californium-252 discovery and development

    International Nuclear Information System (INIS)

    Stoddard, D.H.

    1985-01-01

    This paper discusses the discovery and history of californium 252. This isotope may be synthesized by irradiating plutonium 239, plutonium 242, americium 243, or curium 244 with neutrons in a nuclear reactor. Various experiments and inventions involving 252 Cf conducted at the Savannah River Plant are discussed. The evolution of radiotherapy using californium 252 is reviewed

  11. Californium-252: a remarkable versatile radioisotope

    International Nuclear Information System (INIS)

    Osborne-Lee, I.W.; Alexander, C.W.

    1995-01-01

    A product of the nuclear age, Californium-252 ( 252 Cf) has found many applications in medicine, scientific research, industry, and nuclear science education. Californium-252 is unique as a neutron source in that it provides a highly concentrated flux and extremely reliable neutron spectrum from a very small assembly. During the past 40 years, 252 Cf has been applied with great success to cancer therapy, neutron radiography of objects ranging from flowers to entire aircraft, startup sources for nuclear reactors, fission activation for quality analysis of all commercial nuclear fuel, and many other beneficial uses, some of which are now ready for further growth. Californium-252 is produced in the High Flux Isotope Reactor (HFIR) and processed in the Radiochemical Engineering Development Center (REDC), both of which are located at the Oak Ridge National Laboratory (ORNL) in Oak Ridge, Tennessee. The REDC/HFIR facility is virtually the sole supplier of 252 Cf in the western world and is the major supplier worldwide. Extensive exploitation of this product was made possible through the 252 Cf Market Evaluation Program, sponsored by the United States Department of Energy (DOE) [then the Atomic Energy Commission (AEC) and later the Energy Research and Development Administration (ERDA)]. This program included training series, demonstration centers, seminars, and a liberal loan policy for fabricated sources. The Market Evaluation Program was instituted, in part, to determine if large-quantity production capability was required at the Savannah River Laboratory (SRL). Because of the nature of the product and the means by which it is produced, 252 Cf can be produced only in government-owned facilities. It is evident at this time that the Oak Ridge research facility can meet present and projected near-term requirements. The production, shipment, and sales history of 252 Cf from ORNL is summarized herein

  12. Californium-252: a remarkable versatile radioisotope

    Energy Technology Data Exchange (ETDEWEB)

    Osborne-Lee, I.W.; Alexander, C.W.

    1995-10-10

    A product of the nuclear age, Californium-252 ({sup 252}Cf) has found many applications in medicine, scientific research, industry, and nuclear science education. Californium-252 is unique as a neutron source in that it provides a highly concentrated flux and extremely reliable neutron spectrum from a very small assembly. During the past 40 years, {sup 252}Cf has been applied with great success to cancer therapy, neutron radiography of objects ranging from flowers to entire aircraft, startup sources for nuclear reactors, fission activation for quality analysis of all commercial nuclear fuel, and many other beneficial uses, some of which are now ready for further growth. Californium-252 is produced in the High Flux Isotope Reactor (HFIR) and processed in the Radiochemical Engineering Development Center (REDC), both of which are located at the Oak Ridge National Laboratory (ORNL) in Oak Ridge, Tennessee. The REDC/HFIR facility is virtually the sole supplier of {sup 252}Cf in the western world and is the major supplier worldwide. Extensive exploitation of this product was made possible through the {sup 252}Cf Market Evaluation Program, sponsored by the United States Department of Energy (DOE) [then the Atomic Energy Commission (AEC) and later the Energy Research and Development Administration (ERDA)]. This program included training series, demonstration centers, seminars, and a liberal loan policy for fabricated sources. The Market Evaluation Program was instituted, in part, to determine if large-quantity production capability was required at the Savannah River Laboratory (SRL). Because of the nature of the product and the means by which it is produced, {sup 252}Cf can be produced only in government-owned facilities. It is evident at this time that the Oak Ridge research facility can meet present and projected near-term requirements. The production, shipment, and sales history of {sup 252}Cf from ORNL is summarized herein.

  13. Californium-252 sales and loans at Oak Ridge National Laboratory

    International Nuclear Information System (INIS)

    King, L.J.

    1987-01-01

    The production and distribution in the United States of 252 Cf has recently been consolidated at the Oak Ridge National Laboratory (ORNL). The 252 Cf Industrial Sales/Loan Program and the 252 Cf University Load Program, which were formerly located at the Savannah River Plant (SRP), have been combined with the californium production and distribution activities of the Transuranium Element Production Program at ORNL. Californium-252 is sold to commercial users in the form of bulk californium oxide, palladium-californium alloy pellets, or alloy wires. Neutron source capsules, which are fabricated for loans to DOE or other US government agencies, are still available in all forms previously available. The consolidation of all 252 Cf distribution activities at the production site is expected to result in better service to users. In particular, customers for neutrons sources will be ale to select from a wider range of neutron source forms, including custom designs, through a single contact point

  14. Calibration of a Modified Californium Shuffler

    International Nuclear Information System (INIS)

    Sadowski, E.T.; Armstrong, F.; Oldham, R.; Ceo, R.; Williams, N.

    1995-01-01

    A californium shuffler originally designed to assay hollow cylindrical pieces of UA1 has been modified to assay solid cylinders. Calibration standards were characterized via chemical analysis of the molten UA1 taken during casting of the standards. The melt samples yielded much more reliable characterization data than drill samples taken from standards after the standards had solidified. By normalizing one well-characterized calibration curve to several standards at different enrichments, a relatively small number of standards was required to develop an enrichment-dependent calibration. The precision of this shuffler is 0.65%, and the typical random and systematic uncertainties are 0.53% and 0.73%, respectively, for a six minute assay of an ingot containing approximately 700 grams of 235 U. This paper will discuss (1) the discrepancies encountered when UA1 standards were characterized via melt samples versus drill samples, (2) a calibration methodology employing a small number of standards, and (3) a comparison of results from a previously unused shuffler with an existing shuffler. A small number of UA1 standards have been characterized using samples from the homogeneous molten state and have yielded enrichment-dependent and enrichment-independent calibration curves on two different shufflers

  15. Californium production at the transuranium processing plant

    International Nuclear Information System (INIS)

    King, L.J.

    1976-01-01

    The Transuranium Processing Plant (TRU) at ORNL, which is the production, storage, and distribution center for the ERDA heavy element research program, is described. About 0.5 percent of 252 Cf is currently being produced. TRU is a hot-cell, chemical processing facility of advanced design. New concepts have been incorporated into the facility for absolute containment, remote operation, remote equipment installation, and remote maintenance. The facilities include a battery of nine heavily shielded process cells served by master-slave manipulators and eight laboratories, four on each of two floors. Processing includes chemical dissolution of the targets followed by a series of solvent extraction, ion exchange, and precipitation steps to separate and purify the transuranium elements. The transcurium elements Bk, Cf, Es, and Fm are distributed to users. Remote techniques are used to fabricate the Am and Cm into target rods for reirradiation in the HFIR. Californium-252 that is in excess of the needs of the heavy element research program and the Cf sales program is stored at TRU and processed repeatedly to recover the daughter product 248 Cm, which is a highly desirable research material

  16. Fabrication of californium-252 sources in the United Kingdom

    International Nuclear Information System (INIS)

    Ainsworth, A.; Brady, M.W.; Thornett, W.H.

    1975-01-01

    The advent of californium-252 in weighable quantities and at a reasonable price has caused some rethinking among neutron source suppliers. To explore this market the Radiochemical Center Ltd. has purchased 2 mg of californium-252, and subdivided this into a wide range of sources. To take advantage of its high specific neutron emission, a small double welded stainless steel capsule 7.8mm diameter x 10mm high was chosen for stock sources and this entailed the use of a microdispensing technique which had to be specially developed. The apparatus and procedure for subdividing milligram amounts of californium-252 are described. Some details of our experience in processing these one milligram shipments are given. 100 sources with activities from 200 microgram to 0.01 microgram have been produced. Losses have been small. Measurement of neutron spectra gamma spectra and dose rates from encapsulated sources has confirmed published data. Though it is early days, little industrial interest in californium-252 sources has been detected, most of the sources have so far been required for research into activation analysis and two examples of this are given. (U.S.)

  17. Californium Multiplier. Part I. Design for neutron radiography

    International Nuclear Information System (INIS)

    Crosbie, K.L.; Preskitt, C.A.; John, J.; Hastings, J.D.

    1982-01-01

    The Californium Multiplier (CFX) is a subcritical assembly of enriched uranium surrounding a californium-252 neutron source. The function of the CFX is to multiply the neutrons emitted by the source to a number sufficient for neutron radiography. The CFX is designed to provide a collimated beam of thermal neutrons from which the gamma radiation is filtered, and the scattered neutrons are reduced to make it suitable for high resolution radiography. The entire system has inherent safety features, which provide for system and personnel safety, and it operates at moderate cost. In Part I, the CFX and the theory of its operation are described in detail. Part II covers the performance of the Mound Facility CFX

  18. Production, Distribution, and Applications of Californium-252 Neutron Sources

    International Nuclear Information System (INIS)

    Balo, P.A.; Knauer, J.B.; Martin, R.C.

    1999-01-01

    The radioisotope 252 Cf is routinely encapsulated into compact, portable, intense neutron sources with a 2.6-year half-life. A source the size of a person's little finger can emit up to 10 11 neutrons/s. Californium-252 is used commercially as a reliable, cost-effective neutron source for prompt gamma neutron activation analysis (PGNAA) of coal, cement, and minerals, as well as for detection and identification of explosives, laud mines, and unexploded military ordnance. Other uses are neutron radiography, nuclear waste assays, reactor start-up sources, calibration standards, and cancer therapy. The inherent safety of source encapsulations is demonstrated by 30 years of experience and by U.S. Bureau of Mines tests of source survivability during explosions. The production and distribution center for the U. S Department of Energy (DOE) Californium Program is the Radiochemical Engineering Development Center (REDC) at Oak Ridge National Laboratory (ORNL). DOE sells 252 Cf to commercial reencapsulators domestically and internationally. Sealed 252 Cf sources are also available for loan to agencies and subcontractors of the U.S. government and to universities for educational, research, and medical applications. The REDC has established the Californium User Facility (CUF) for Neutron Science to make its large inventory of 252 Cf sources available to researchers for irradiations inside uncontaminated hot cells. Experiments at the CUF include a land mine detection system, neutron damage testing of solid-state detectors, irradiation of human cancer cells for boron neutron capture therapy experiments, and irradiation of rice to induce genetic mutations

  19. Prompt neutron spectrum of the spontaneous fission of californium-252

    International Nuclear Information System (INIS)

    Zamyatnin, Yu.S.; Kroshkin, N.I.; Korostylev, V.A.; Nefedov, V.N.; Ryazanov, D.K.; Starostov, B.I.; Semenov, A.F.

    1976-01-01

    The californium-252 spontaneous fission neutron spectrum was measured in the energy range of 0.01 to 10 MeV by the time-of-flight technique using various neutron detectors. The measurements of 252 Cf neutron spectrum at energies of 0.01 to 5 MeV were performed as a function of fission fragment kinetic energy. The mean neutron spectrum energy in the range of 0.7 to 10 MeV was found from the results of measurements. The irregularity in the 252 Cf neutron spectrum in the neutron energy range of less than 0.7 MeV compared to theoretical values is discussed. The mechanism of 252 Cf neutron emission is also discussed on the basis of neutron yield angle measurements. 12 references

  20. A californium-252 source for radiobiological studies at Hiroshima University

    International Nuclear Information System (INIS)

    Kato, Kazuo; Takeoka, Seiji; Kuroda, Tokue; Tsujimura, Tomotaka; Kawami, Masaharu; Hoshi, Masaharu; Sawada, Shozo

    1987-01-01

    A 1.93 Ci (3.6 mg) californium-252 source was installed in the radiation facility of the Research Institute for Nuclear Medicine and Biology, Hiroshima University. This source produces fission neutrons (8.7 x 10 9 n/s at the time of its installation), which are similar to neutron spectrum of the atomic bombs. It is useful for studying biological effects of fission neutrons and neutron dosimetry. An apparatus was dosigned to accomodate this source and to apply it to such studies. It has resulted in profitable fission neutron exposures, while suppressing scattered neutrons and secondary gamma rays. This apparatus incorporates many safety systems, including one which interlocks with all of doors and an elevator serving the exposure room, so as to prevent accidents involving users. (author)

  1. Application of californium-252 neutron sources for analytical chemistry

    International Nuclear Information System (INIS)

    Ishii, Daido

    1976-01-01

    The researches made for the application of Cf-252 neutron sources to analytical chemistry during the period from 1970 to 1974 including partly 1975 are reviewed. The first part is the introduction to the above. The second part deals with general review of symposia, publications and the like. Attention is directed to ERDA publishing the periodical ''Californium-252 Progress'' and to a study group of Cf-252 utilization held by Japanese Radioisotope Association in 1974. The third part deals with its application for radio activation analysis. The automated absolute activation analysis (AAAA) of Savannha River is briefly explained. The joint experiment of Savannha River operation office with New Brunswick laboratory is mentioned. Cf-252 radiation source was used for the non-destructive analysis of elements in river water. East neutrons of Cf-252 were used for the quantitative analysis of lead in paints. Many applications for industrial control processes have been reported. Attention is drawn to the application of Cf-252 neutron sources for the field search of neutral resources. For example, a logging sonde for searching uranium resources was developed. the fourth part deals with the application of the analysis with gamma ray by capturing neutrons. For example, a bore hole sonde and the process control analysis of sulfur in fuel utilized capture gamma ray. The prompt gamma ray by capturing neutrons may be used for the nondestructive analysis of enrivonment. (Iwakiri, K.)

  2. Teratogenic effect of Californium-252 irradiation in rats

    International Nuclear Information System (INIS)

    Satow, Yukio; Lee, Juing-Yi; Hori, Hiroshi; Okuda, Hiroe; Tsuchimoto, Shigeo; Sawada, Shozo; Yokoro, Kenjiro

    1989-01-01

    The teratogenicity of Californium-252 (Cf-252) irradiation which generates approximately 70% 2.3 MeV fast neutron and 30% gamma rays was evaluated. A single whole body exposure of Cf-252 at various doses was given to pregnant rats on day 8 or 9 of pregnancy, followed by microscopic autopsy of the fetuses at the terminal stage of pregnancy to search for external and internal malformations. For comparison, pregnant rats were irradiated with various doses of Cobalt-60 (Co-60) standard gamma rays at the same dose rate (1 rad/min.). The doses were 20-120 rad of Cf-252 and 80-220 rad of Co-60. Using frequency of radiation induced malformations observed on day 8 of pregnancy as an index, relative biological effectiveness (RBE) of 2.3-2.7 was obtained from the straight line obtained by modifying by the least squares method the frequency curves of malformed fetuses in total implants and in surviving fetuses. The types of malformations induced by Cf-252 and Co-60 irradiation were alike. Using fetal LD 50 as an index, 2.4 was obtained as RBE when irradiated on day 8 of pregnancy and 3.1 as that when irradiated on day 9. The results showed that Cf-252 had stronger a teratogenic effect than Co-60 gamma rays. (author)

  3. Experimental studies on californium bioavailability to marine benthic invertebrates

    International Nuclear Information System (INIS)

    Fowler, S.W.; Carvalho, F.P.; Aston, S.R.

    1986-01-01

    252 Cf is readily taken up by benthic invertebrates from sea water, reaching whole-body concentration factors of 763 in the polychaete Hermione hystrix, 220 in the shrimp Lysmata seticaudata, 665 in the crab Pilumnus hirtellus and 78 in the bivalve mollusc Venerupis decussata after 3 weeks exposure. Surface sorption plays a predominant role in the uptake process. Depuration in clean sea water was a relatively slow process. The shrimp Lysmata eliminated 252 Cf very rapidly due to moulting. Absorption coefficients for ingested 252 Cf were high, approx. 23% in crabs and approx. 97% in brittlestars. The absorbed fraction was excreted twice as fast from crabs as brittlestars. Exposure of organisms to labelled sediment resulted in low transfer factors that were species dependent. There is some evidence to suggest that uptake from sediments is primarily due to 252 Cf transfer from the pore water. Comparison of these results with published experimental data on other transuranic nuclides in the same or similar species suggests that californium bioavailability is roughly equivalent to that of plutonium and americium. (author)

  4. Biomedical neutron research at the Californium User Facility for Neutron Science

    International Nuclear Information System (INIS)

    Martin, R.C.; Byrne, T.E.; Miller, L.F.

    1998-01-01

    The Californium User Facility for Neutron Science has been established at Oak Ridge National Laboratory (ORNL). The Californium User Facility (CUF) is a part of the larger Californium Facility, which fabricates and stores compact 252 Cf neutron sources for worldwide distribution. The CUF can provide a cost-effective option for research with 252 Cf sources. Three projects at the CUF that demonstrate the versatility of 252 Cf for biological and biomedical neutron-based research are described: future establishment of a 252 Cf-based neutron activation analysis system, ongoing work to produce miniature high-intensity, remotely afterloaded 252 Cf sources for tumor therapy, and a recent experiment that irradiated living human lung cancer cells impregnated with experimental boron compounds to test their effectiveness for boron neutron capture therapy. (author)

  5. Proposed Californium-252 User Facility for Neutron Science at Oak Ridge National Laboratory

    International Nuclear Information System (INIS)

    Martin, R.C.; Laxson, R.R.; Knauer, J.B.

    1996-01-01

    The Radiochemical Engineering Development Center (REDC) at ORNL has petitioned to establish a Californium-252 User Facility for Neutron Science for academic, industrial, and governmental researchers. The REDC Californium Facility (CF) stores the national inventory of sealed 252 Cf neutron source for university and research loans. Within the CF, the 252 Cf storage pool and two uncontaminated hot cells currently in service for the Californium Program will form the physical basis for the User Facility. Relevant applications include dosimetry and experiments for neutron tumor therapy; fast and thermal neutron activation analysis of materials; experimental configurations for prompt gamma neutron activation analysis; neutron shielding and material damage studies; and hardness testing of radiation detectors, cameras, and electronics. A formal User Facility simplifies working arrangements and agreements between US DOE facilities, academia, and commercial interests

  6. Biomedical neutron research at the Californium User Facility for neutron science

    International Nuclear Information System (INIS)

    Martin, R.C.; Byrne, T.E.; Miller, L.F.

    1997-01-01

    The Californium User Facility for Neutron Science has been established at Oak Ridge National Laboratory (ORNL). The Californium User Facility (CUF) is a part of the larger Californium Facility, which fabricates and stores compact 252 Cf neutron sources for worldwide distribution. The CUF can provide a cost-effective option for research with 252 Cf sources. Three projects at the CUF that demonstrate the versatility of 252 Cf for biological and biomedical neutron-based research are described: future establishment of a 252 Cf-based neutron activation analysis system, ongoing work to produce miniature high-intensity, remotely afterloaded 252 Cf sources for tumor therapy, and a recent experiment that irradiated living human lung cancer cells impregnated with experimental boron compounds to test their effectiveness for boron neutron capture therapy

  7. 27 CFR 44.254 - Shipping containers.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 2 2010-04-01 2010-04-01 false Shipping containers. 44.254 Section 44.254 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU... Requirements § 44.254 Shipping containers. Each shipping case, crate, or other container, in which cigars are...

  8. 7 CFR 254.1 - General purpose.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false General purpose. 254.1 Section 254.1 Agriculture... GENERAL REGULATIONS AND POLICIES-FOOD DISTRIBUTION ADMINISTRATION OF THE FOOD DISTRIBUTION PROGRAM FOR INDIAN HOUSEHOLDS IN OKLAHOMA § 254.1 General purpose. This part sets the requirement under which...

  9. 20 CFR 632.254 - Program startup.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Program startup. 632.254 Section 632.254 Employees' Benefits EMPLOYMENT AND TRAINING ADMINISTRATION, DEPARTMENT OF LABOR INDIAN AND NATIVE AMERICAN EMPLOYMENT AND TRAINING PROGRAMS Summer Youth Employment and Training Programs § 632.254 Program startup...

  10. X-ray-diffraction study of californium metal to 16 GPa

    International Nuclear Information System (INIS)

    Peterson, J.R.; Benedict, U.; Dufour, C.; Birkel, I.; Haire, R.G.

    1983-01-01

    The first series of measurements to determine the structural behavior of californium (Cf) metal under pressure has been carried out. The initial dhcp structure transformed sluggishly with increasing pressure to a fcc structure. A bulk modulus of 50(5) GPa was derived for dhcp Cf metal from the relative volume (V/V 0 ) data to 10 GPa

  11. Study of the shielding for spontaneous fission sources of Californium-252

    International Nuclear Information System (INIS)

    Davila R, I.

    1991-06-01

    A shielding study is made to attenuate, until maximum permissible levels, the neutrons radiation and photons emitted by spontaneous fission coming from a source of Californium-252. The compound package by a database (Library DLC-23) and the ANISNW code is used, in it version for personal computer. (Author)

  12. Assessment of the neutron component in a neutron-gamma field of a californium-252 source

    International Nuclear Information System (INIS)

    Tetteh, G.K.

    1978-12-01

    Experiments have been performed to determine the percentages of the different components in the radiation field of californium-252 which has now some clinical applications. Using Rossi Chambers in conjunction with absorption investigations involving lead and aluminium thimbles, it is observed that the dose rates due to the different components are: neutrons 54%; gammas 30%; betas 16%

  13. 36 CFR 254.6 - Segregative effect.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Segregative effect. 254.6... ADJUSTMENTS Land Exchanges § 254.6 Segregative effect. (a) If a proposal is made to exchange Federal lands... segregative effect terminates as follows: (1) Automatically, upon issuance of a patent or other document of...

  14. 36 CFR 254.10 - Bargaining; arbitration.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Bargaining; arbitration. 254.10 Section 254.10 Parks, Forests, and Public Property FOREST SERVICE, DEPARTMENT OF AGRICULTURE... determine values. Bargaining or any other process must be based on an objective analysis of the valuation in...

  15. 7 CFR 254.2 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Definitions. 254.2 Section 254.2 Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE... (25 CFR part 81 et. seq.). (b) FNS service area means the areas over which FNS has approved the food...

  16. Local Structure in Americium and Californium Hexa-cyanoferrates - Comparison with Their Lanthanide Analogues

    International Nuclear Information System (INIS)

    Dupouy, G.; Bonhoure, I.; Dumas, Th.; Moisy, Ph.; Petit, S.; Den Auwer, Ch.; Conradson, St.D.; Hennig, Ch.; Scheinost, A.C.; Le Naour, C.; Simoni, E.

    2011-01-01

    Metal hexa-cyanoferrates are well known molecular solids for a large variety of cations, although very little has been described for actinide adducts. Two new members of actinide(III) hexa-cyanoferrates were synthesized with the cations americium and californium. They were structurally characterized by infrared and X-ray absorption spectroscopy. Combined EXAFS data at the iron K edge and actinide L 3 edge provide evidence for a three-dimensional model for these two new compounds. Structural data in terms of bond lengths were compared to those reported for the parent lanthanide(III) compounds, neodymium and gadolinium hexa-cyanoferrates, respectively: the americium compound with (KNd(III)Fe(II)-Fe-III(CN) 6 .4H 2 O and the californium compound with (KGd(III)Fe(II)(CN) . 3.5H 2 O and (KGd(III)Fe(II)(CN) 6 .3H 2 O. This comparison between actinide and lanthanide homologues has been carried out on the basis of ionic radii considerations. The americium and neodymium environments appear to be very similar and are arranged in a tri-capped trigonal prism polyhedron of coordination number 9 (CN: 9), in which the americium atom is bonded to six nitrogen atoms and to three water molecules. For the californium adduct, a similar comparison and bond length and angle values derived from EXAFS studies suggest that the californium cation sits in a bi-capped trigonal prism (CN: 8) as in (KGd(III)Fe(II)(CN) 6 . 3H 2 O. This arrangement differs from that in the structure of (KGd(III)Fe(II)(CN) 6 .3.5H 2 O, in which the gadolinium atom is surrounded by 9 atoms. This is one of the rare pieces of information revealed by EXAFS spectroscopy for americium and californium in comparison to lanthanide atoms in molecular solid compounds. A discussion on the decrease in bond length and coordination number from americium to californium is also provided, on the basis of crystallographic results reported in the literature for actinide(III) and lanthanide(III) hydrate series. (authors)

  17. Atlantic Richfield Hanford Company californium multiplier/delayed neutron counter safety analysis

    International Nuclear Information System (INIS)

    Zimmer, W.H.

    1976-08-01

    The Californium Multiplier (CFX) is a subcritical assembly of uranium surrounding 252 Cf spontaneously fissioning neutron sources; its function is to multiply the neutron flux to a level useful for activation analysis. This document summarizes the safety analysis aspects of the CFX, DNC, pneumatic transfer system, and instrumentation and to detail all the aspects of the total facility as a starting point for the ARHCO Safety Analysis Review. Recognized hazards and steps already taken to neutralize them are itemized

  18. Instrumental neutron activation determination of gold in mineral raw materials using a californium neutron source

    International Nuclear Information System (INIS)

    Shilo, N.A.; Ippolitov, E.G.; Ivanenko, V.V.; Kustov, B.N.; Zheleznov, V.V.; Aristov, G.N.; Kovalenko, V.V.; Kondrat'ev, N.B.

    1983-01-01

    A facility using a californium neutron source and a method for the neutron activation analysis of gold were developed. The sensitivity of the determination is 0.1 g/t. The causes of random and systematic errors have been studied. It is concluded that in prospection and evaluation of gold ore deposists, the traditional test tube analysis for gold may be replaced with the developed method. (author)

  19. Safety Analysis Report for Packaging (SARP) of the Oak Ridge National Laboratory TRU Californium Shipping Container

    International Nuclear Information System (INIS)

    Box, W.D.; Shappert, L.B.; Seagren, R.D.; Klima, B.B.; Jurgensen, M.C.; Hammond, C.R.; Watson, C.D.

    1980-01-01

    An analytical evaluation of the Oak Ridge National Laboratory TRU Californium Shipping Container was made in order to demonstrate its compliance with the regulations governing off-site shipment of packages that contain radioactive material. The evaluation encompassed five primary categories: structural integrity, thermal resistance, radiation shielding, nuclear criticality safety, and quality assurance. The results of this evaluation demonstrate that the container complies with the applicable regulations

  20. Spectroscopic and redox properties of curium and californium ions in concentrated aqueous carbonate-bicarbonate media

    International Nuclear Information System (INIS)

    Hobart, D.E.; Varlashkin, P.G.; Samhoun, K.; Haire, R.G.; Peterson, J.R.

    1983-01-01

    Multimilligram quantities of trivalent curium-248 and californium-249 were investigated by absorption spectroscopy, cyclic voltammetry, and bulk solution electrolysis in concentrated aqueous carbonate-bicarbonate solution. Actinide concentrations between 10 -4 and 10 -2 M were studied in 2 M sodium carbonate and 5.5 M potassium carbonate solutions at pH values from 8 to 14. The solution absorption spectra of Cm(III) and Cf(III) in carbonate media are presented for the first time and compared to literature spectra of these species in noncomplexing aqueous solution. It was anticipated that carbonate complexation of the actinide ions could provide a sufficient negative shift in the formal potentials of the M(IV)/M(III) couples of Cm and Cf to permit the generation and stabilization of their tetravalent states in aqueous carbonate-bicarbonate medium. No conclusive evidence was found in the present work to indicate the existence of any higher oxidation states of curium or californium in carbonate solution. Some possible reasons for our inability to generate and detect oxidized species of curium and californium in this medium are discussed

  1. 48 CFR 53.303-DD-254 - Department of Defense DD Form 254, Contract Security Classification Specification.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Department of Defense DD Form 254, Contract Security Classification Specification. 53.303-DD-254 Section 53.303-DD-254 Federal... Illustrations of Forms 53.303-DD-254 Department of Defense DD Form 254, Contract Security Classification...

  2. Convenient method of simultaneously analyzing aluminum and magnesium in pharmaceutical dosage forms using californium-252 thermal neutron activation

    International Nuclear Information System (INIS)

    Landolt, R.R.; Hem, S.L.

    1983-01-01

    A commercial antacid suspension containing aluminum hydroxide and magnesium hydroxide products was used as a model sample to study the use of a californium-252 thermal neutron activation as a method for quantifying aluminum content as well as for the simultaneous assay of aluminum and magnesium. A 3.5-micrograms californium-252 source was used for the activation, and the induced aluminum-28 and magnesium-27 activity was simultaneously measured by sodium iodide crystal gamma-ray spectrometry using dual single-channel analyzers and scalers. The antacid suspension was contained in a chamber designed with the unique capability of serving as the container for counting the induced radioactivity in addition to being the irradiation chamber itself. This pilot study demonstrated that use of more intense californium-252 sources, which are commonly available, would provide a method that is competitive with the ethylenediaminetetraacetic acid titration method in precision and in other aspects as well

  3. Measurement of californium-252 gamma photons depth dose distribution in tissue equivalent material. Vol. 4

    Energy Technology Data Exchange (ETDEWEB)

    Fadel, M A; El-Fiki, M A; Eissa, H M; Abdel-Hafez, A; Naguib, S H [National Institute of Standards, Cairo (Egypt)

    1996-03-01

    Phantom of tissue equivalent material with and without bone was used measuring depth dose distribution of gamma-rays from californium-252 source. The source was positioned at center of perspex walled phantom. Depth dose measurements were recorded for X, Y and Z planes at different distances from source. TLD 700 was used for measuring the dose distribution. Results indicate that implantation of bone in tissue equivalent medium cause changes in the gamma depth dose distribution which varies according to variation in bone geometry. 9 figs.

  4. Measurements of integral cross sections in the californium-252 fission neutron spectrum

    International Nuclear Information System (INIS)

    Alberts, W.G.; Guenther, E.; Matzke, M.; Rassl, G.

    1977-01-01

    In a low-scattering arrangement cross sections averaged over the californium-252 spontaneous fission neutron spectrum were measured. The reactions 27 Al(n,α) 46 Ti, 47 Ti, 48 Ti(n,p), 54 Fe, 56 Fe(n,p), 58 Ni(n,p), 64 Zn(n,p), 115 In(n,n') were studied in order to obtain a consistent set of threshold detectors used in fast neutron flux density measurements. Overall uncertainties between 2 and 2.5% could be achieved; corrections due to neutron scattering in source and samples are discussed

  5. Neutron emission in fission of highly excited californium nuclei (E*=76 MeV)

    International Nuclear Information System (INIS)

    Blinov, M.V.; Bordyug, V.M.; Kozulin, Eh.M.; Mozhaev, A.N.; Levitovich, M.; Muzychka, Yu.A.; Penionzhkevich, Yu.Eh.; Pustyl'nik, B.I.

    1990-01-01

    The differential cross sections for neutron production in the fission of highly excited californium nuclei formed in the 238 U+ 12 C (105 MeV) reaction have been measured. From the analysis of the experimental data is follows that the number of pre-fission neutrons substantially exceeds the value obtained in the framework of the standard statistical model. The saddle-to-scission time of the excited nucleus is estimated on the basis of the neutron multiplicity. The dependences of the neutron number and neutron average energies upon the fragment mass are determined

  6. Neutron emission in fission of highly excited californium nuclei (E* = 76 MeV)

    International Nuclear Information System (INIS)

    Blinov, M.V.; Bordyug, V.M.; Kozulin, E.M.; Levitovich, M.; Mozhaev, A.N.; Muzychka, Yu.A.; Penionzhkevich, Yu.E.; Pustyl'nik, B.I.

    1990-01-01

    Differential cross sections for neutron production have been measured in fission of excited californium nuclei produced in the reaction 238 U + 12 C (105 MeV). It follows from analysis of the experimental results that the number of neutrons emitted before fission considerably exceeds the number obtained in the framework of the standard statistical model. On the basis of the multiplicity of neutrons they authors have estimated the time of fission of the excited nucleus. The dependence of the number of neutrons and their average energies on the mass of the fragments is determined

  7. Californium oxygen system for 1.50 < O/Cf < 1.72

    International Nuclear Information System (INIS)

    Turcotte, R.P.; Haire, R.G.

    1975-01-01

    The californium-oxygen system was studied as a function of temperature, oxygen pressure, and stoichiometry by manometric and x-ray diffraction methods. The results establish rhombohedral Cf 7 O 12 as the stable compound obtained by heating Cf 2 O 3 in air. The isobaric oxidation-reduction cycles Cf 2 O 3 → Cf 7 O 12 → Cf 2 O 3 , observed in constant rate of heating (cooling) experiments, occur with large hysteresis. A close parallel to other fluorite related lanthanide and actinide oxide systems is established. (auth)

  8. Possible stabilization of the tetravalent oxidation state of berkelium and californium in acetonitrile with triphenylarsine oxide

    International Nuclear Information System (INIS)

    Payne, G.F.; Peterson, J.R.

    1987-01-01

    It appears that we may have prepared Bk(IV) nitrate.nTPAs0 and Bk(IV) perchlorate.nTPAs0 complexes which formed the corresponding Cf(IV) complexes through the beta decay of Bk-249. Definitive proof should come from similar experiments with quantities of Bk-249 large enough to allow spectrophotometric detection of the characteristic f→f transitions in these berkelium and californium species. It is clear, however, that TPAs0 and acetonitrile can play a pivotal role in the stabilization of lanact(IV) species

  9. Dicty_cDB: VHK254 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHK254 (Link to dictyBase) - - - Contig-U16260-1 VHK254P (Link to Original site) VHK2...54F 616 VHK254Z 744 VHK254P 1340 - - Show VHK254 Library VH (Link to library) Clone ID VHK2...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHK2-C/VHK254Q.Seq.d/ Representative seq. ID VHK2...54P (Link to Original site) Representative DNA sequence >VHK254 (VHK254Q) /CSM/VH/VHK2-C/VHK2...BJ446805 ) Dictyostelium discoideum cDNA clone:ddv63k21, 3' ... 1455 0.0 1 ( BJ446732 ) Dictyostelium discoi

  10. 36 CFR 254.15 - Title standards.

    Science.gov (United States)

    2010-07-01

    ...) Conveyances of lands from the United States are made by patent, quitclaim deed, or deed and without express or implied warranties, except as to hazardous substances pursuant to § 254.3 of this subpart. (c) Title... of the existing use(s) authorized under the terms of the grant, permit, easement, or lease. The non...

  11. 50 CFR 216.254 - Mitigation.

    Science.gov (United States)

    2010-10-01

    ..., DEPARTMENT OF COMMERCE MARINE MAMMALS REGULATIONS GOVERNING THE TAKING AND IMPORTING OF MARINE MAMMALS Taking Marine Mammals Incidental to Conducting Precision Strike Weapon Missions in the Gulf of Mexico § 216.254... greatest extent practicable, adverse impacts on marine mammal species and stocks and their habitats. When...

  12. Comparison of the Savannah River Site billet active well coincidence counter and two Californium Shufflers

    International Nuclear Information System (INIS)

    Sadowski, E.T.; Griffin, J.C.; Rinard, P.M.

    1991-01-01

    A Scrap Californium Shuffler at the Savannah River Site (SRS) was calibrated to assay the U-Al cores of billets (an intermediate step in the SRS reactor fuel fabrication cycle.) The precision of the Scrap Shuffler over several years has been approximately 0.50%. A typical total uncertainty for the assay of a core on the Scrap Shuffler is approximately 0.33% for a twelve minute assay. The precision over several months and a typical total uncertainty for the Billet Active Well (neutron) Coincidence Counter (BAWCC) are approximately 1.0% and 1.9%, respectively, for a fifteen minute assay. A new Billet Californium Shuffler specifically designed for assaying SRS billets has yielded precision (over one month) and total uncertainty results of 0.40% and 0.69%, respectively, for an eight minute assay. The introduction of a measurement point into the fuel fabrication cycle to replace estimates based upon material weight will greatly enhance material and process control in the Reactor Materials area of SRS. The use of all three instruments provides a comparison of the relative merits of Active Well (neutron) Coincidence Counters (AWCCs) and shufflers for assay of homogeneous and geometrically simple material containing 235 U. The measurement precisions, systematic and random uncertainties, as well as the procurement and operation of each instrument will be compared. 3 refs., 5 figs., 1 tab

  13. 7 CFR 254.4 - Application by an ITO.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Application by an ITO. 254.4 Section 254.4 Agriculture... INDIAN HOUSEHOLDS IN OKLAHOMA § 254.4 Application by an ITO. (a) Application to FNS Regional Office. An ITO which desires to participate in the Food Distribution Program shall file an application with the...

  14. 7 CFR 254.3 - Administration by an ITO.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Administration by an ITO. 254.3 Section 254.3... FOR INDIAN HOUSEHOLDS IN OKLAHOMA § 254.3 Administration by an ITO. (a) Applicability of part 253. All... any claim and to settle and adjust any claim against an ITO. (d) ITO administration. The ITO, acting...

  15. 36 CFR 254.42 - Valuation of tracts.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Valuation of tracts. 254.42 Section 254.42 Parks, Forests, and Public Property FOREST SERVICE, DEPARTMENT OF AGRICULTURE LANDOWNERSHIP ADJUSTMENTS Conveyance of Small Tracts § 254.42 Valuation of tracts. (a) Approximately equal value shall be...

  16. 36 CFR 254.4 - Agreement to initiate an exchange.

    Science.gov (United States)

    2010-07-01

    ... exchange. 254.4 Section 254.4 Parks, Forests, and Public Property FOREST SERVICE, DEPARTMENT OF AGRICULTURE LANDOWNERSHIP ADJUSTMENTS Land Exchanges § 254.4 Agreement to initiate an exchange. (a) Exchanges may be proposed by the Forest Service or by any person, State, or local government. Initial exchange proposals...

  17. 4 CFR 25.4 - Preservation of property.

    Science.gov (United States)

    2010-01-01

    ... 4 Accounts 1 2010-01-01 2010-01-01 false Preservation of property. 25.4 Section 25.4 Accounts GOVERNMENT ACCOUNTABILITY OFFICE GENERAL PROCEDURES CONDUCT IN THE GOVERNMENT ACCOUNTABILITY OFFICE BUILDING AND ON ITS GROUNDS § 25.4 Preservation of property. The improper disposal of rubbish in the GAO...

  18. 36 CFR 254.11 - Exchanges at approximately equal value.

    Science.gov (United States)

    2010-07-01

    ... equal value. 254.11 Section 254.11 Parks, Forests, and Public Property FOREST SERVICE, DEPARTMENT OF AGRICULTURE LANDOWNERSHIP ADJUSTMENTS Land Exchanges § 254.11 Exchanges at approximately equal value. (a) The authorized officer may exchange lands which are of approximately equal value upon a determination that: (1...

  19. 29 CFR 1910.254 - Arc welding and cutting.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 5 2010-07-01 2010-07-01 false Arc welding and cutting. 1910.254 Section 1910.254 Labor... OCCUPATIONAL SAFETY AND HEALTH STANDARDS Welding, Cutting and Brazing § 1910.254 Arc welding and cutting. (a... following limits shall not be exceeded: (i) Alternating-current machines (A) Manual arc welding and cutting...

  20. Spectral investigation of neutron radiation in three-sectional concrete labyrinth from a californium-252 source

    International Nuclear Information System (INIS)

    Belogorlov, E.A.; Britvich, G.I.; Getmanov, V.B.

    1985-01-01

    Construction of labyrinths in points of communication output from the storage-ring under construction is accompanied by numerous difficulties due to a considerable number of gas and cryogenic pipelines, which require large cross sections at the minimal length of the pipelines proper for their location. It results in unfavourable for radiation attenuation ratios between cross section and length of the labyrinth separate sections. Neutron spectra in a model concrete labyrinth, at the entrance to which a neutron source with fission spectrum (californium-252) and the same source in a polyethylene moderator are located, are measured. On the basis of the spectra obtained the formation of fluence and equivalent dose along the labyrinth geometric axis is analyzed. Conditions permitting actually to reduce radiation dose in the labyrinth (dead end provision, the use of cover materials, construction of diaphragms and shielding plates) are simulated

  1. Transport calculations of. gamma. -ray flux density and dose rate about implantable californium-252 sources

    Energy Technology Data Exchange (ETDEWEB)

    Shapiro, A; Lin, B I [Cincinnati Univ., Ohio (USA). Dept. of Chemical and Nuclear Engineering; Windham, J P; Kereiakes, J G

    1976-07-01

    ..gamma.. flux density and dose rate distributions have been calculated about implantable californium-252 sources for an infinite tissue medium. Point source flux densities as a function of energy and position were obtained from a discrete-ordinates calculation, and the flux densities were multiplied by their corresponding kerma factors and added to obtain point source dose rates. The point dose rates were integrated over the line source to obtain line dose rates. Container attenuation was accounted for by evaluating the point dose rate as a function of platinum thickness. Both primary and secondary flux densities and dose rates are presented. The agreement with an independent Monte Carlo calculation was excellent. The data presented should be useful for the design of new source configurations.

  2. Uretritis masculina Estudio prospectivo de 254 casos

    Directory of Open Access Journals (Sweden)

    Federico Diaz G.

    1983-06-01

    Full Text Available La uretritis no gonocócica (UNG fue la forma predominante (78,0% en una serie de 254 hombres con síndrome de uretritis, estudiados prospectivamente en 1982. La Trichomonas vaginalis estuvo presente en el 4.0% de los casos de UNG. Con base en la comparación entre los pacientes de uretritis gonocócica (UG y los de UNO, puede proponerse un perfil de los segundo que oriente al médico en su sospecha diagnóstica: mayor probabilidad de no hallar secreción uretral o de que Ésta sea escasa y de las modalidades acuosa, mucoide o mixta; también mayor probabilidad de un período de incubación por encima de 9 días y de una evolución superior a un mes. A pesar de tales indicios hay mucha superposición clínica entre las dos formas de uretritis por lo que sigue siendo valedera la recomendación de recurrir al Gram como procedimiento confiable y económico para establecer el diagnóstico diferencial. Se llama la atención hacia la necesidad de disponer de datos sobre uretritis en otros grupos socioeconómicos y de investigar aspectos como la frecuencia en nuestro medio del síndrome de uretritis postgonocócica (U PG.

  3. Fast and efficient charge breeding of the Californium rare isotope breeder upgrade electron beam ion source

    International Nuclear Information System (INIS)

    Ostroumov, P. N.; Barcikowski, A.; Dickerson, C. A.; Perry, A.; Sharamentov, S. I.; Vondrasek, R. C.; Zinkann, G. P.; Pikin, A. I.

    2015-01-01

    The Electron Beam Ion Source (EBIS), developed to breed Californium Rare Isotope Breeder Upgrade (CARIBU) radioactive beams at Argonne Tandem Linac Accelerator System (ATLAS), is being tested off-line. A unique property of the EBIS is a combination of short breeding times, high repetition rates, and a large acceptance. Overall, we have implemented many innovative features during the design and construction of the CARIBU EBIS as compared to the existing EBIS breeders. The off-line charge breeding tests are being performed using a surface ionization source that produces singly charged cesium ions. The main goal of the off-line commissioning is to demonstrate stable operation of the EBIS at a 10 Hz repetition rate and a breeding efficiency into single charge state higher than 15%. These goals have been successfully achieved and exceeded. We have measured (20% ± 0.7%) breeding efficiency into the single charge state of 28+ cesium ions with the breeding time of 28 ms. In general, the current CARIBU EBIS operational parameters can provide charge breeding of any ions in the full mass range of periodic table with high efficiency, short breeding times, and sufficiently low charge-to-mass ratio, 1/6.3 for the heaviest masses, for further acceleration in ATLAS. In this paper, we discuss the parameters of the EBIS and the charge breeding results in a pulsed injection mode with repetition rates up to 10 Hz

  4. Manganese determination om minerals by activation analysis, using the californium-252 as a neutron source

    International Nuclear Information System (INIS)

    Cardoso, Antonio

    1976-01-01

    Neutron Activation Analysis, using a Californium-252 neutron source, has been applied for the determination of manganese in ores such as pyrolusite, rodonite (manganese silicate)' and blending used in dry-batteries The favorable nuclear properties of manganese, such as high thermal neutron cross-section for the reaction 55 Mn (n.gamma) 56 Mn, high concentration of manganese in the matrix and short half - life of 56 Mn, are an ideal combination for non-destructive analysis of manganese in ores. Samples and standards of manganese dioxide were irradiated for about 20 minutes, followed by a 4 to 15 minutes decay and counted in a single channel pulse-height discrimination using a NaI(Tl) scintillation detector. Counting time was equal to 10 minutes. The interference of nuclear reactions 56 Fe(n,p) 56 Mn and 59 Co (n, α) 56 were studied, as well as problems in connection with neutron shadowing during irradiation, gamma-rays attenuation during counting and influence of granulometry of samples. One sample,was also analysed by wet-chemical method (sodium bismuthate) in order to compare results. As a whole, i t was shown that the analytical method of neutron activation for manganese in ores and blending, is a method simple, rapid and with good precision and accuracy. (author)

  5. Long-term effects of an intracavitary treatment with californium-252 on normal tissue

    International Nuclear Information System (INIS)

    Sullivan, M.F.; Beamer, J.L.; Mahony, T.D.; Cross, F.T.; Lund, J.E.; Endres, G.W.R.

    1976-01-01

    About one hundred fifty swine were exposed to either radium-226 or californium-252 sources in the uterine cervix to determine an RBE for both acute and long-term effects. That value for early changes in the tissues at risk in the treatment of cervical cancer was between 6.2 and 6.8. The incidence of complications increased with time after exposure, especially among animals treated with 252 Cf. Analysis of rectal injury showed that ulceration occurred frequently within a year postexposure at doses between 1600 and 2400 rad calculated at 2 cm lateral to the source midline. Fat necrosis and smooth muscle atrophy, resulting in a local rectal stricture, were delayed changes observed in some animals. The lower ureter was the site for a greater frequency of complications than the GI tract. Ureteral stricture often occurred at doses of 1200 rad from 252 Cf and 7000 rad from 226 Ra. Observation of delayed effects in the uterine-cervix in animals held up to 4 years postexposure indicate that the RBE for 252 Cf may be increased to a value as high as 18, while repair may have even decreased it to about 5.6 in the rectum. Fifty swine are still being observed for long-term effects after doses above 800 rad from 252 Cf and 5000 rad from 226 Ra

  6. Neutron activation analysis at the Californium User Facility for Neutron Science

    International Nuclear Information System (INIS)

    Martin, R.C.; Smith, E.H.; Glasgow, D.C.; Jerde, E.A.; Marsh, D.L.; Zhao, L.

    1997-12-01

    The Californium User Facility (CUF) for Neutron Science has been established to provide 252 Cf-based neutron irradiation services and research capabilities including neutron activation analysis (NAA). A major advantage of the CUF is its accessibility and controlled experimental conditions compared with those of a reactor environment The CUF maintains the world's largest inventory of compact 252 Cf neutron sources. Neutron source intensities of ≤ 10 11 neutrons/s are available for irradiations within a contamination-free hot cell, capable of providing thermal and fast neutron fluxes exceeding 10 8 cm -2 s -1 at the sample. Total flux of ≥10 9 cm -2 s -1 is feasible for large-volume irradiation rabbits within the 252 Cf storage pool. Neutron and gamma transport calculations have been performed using the Monte Carlo transport code MCNP to estimate irradiation fluxes available for sample activation within the hot cell and storage pool and to design and optimize a prompt gamma NAA (PGNAA) configuration for large sample volumes. Confirmatory NAA irradiations have been performed within the pool. Gamma spectroscopy capabilities including PGNAA are being established within the CUF for sample analysis

  7. 30 CFR 254.41 - Training your response personnel.

    Science.gov (United States)

    2010-07-01

    ... procedures; (3) Oil-spill trajectory analysis and predicting spill movement; and (4) Any other... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Training your response personnel. 254.41 Section 254.41 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR OFFSHORE OIL...

  8. 36 CFR 254.34 - Mineral survey fractions.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Mineral survey fractions. 254... LANDOWNERSHIP ADJUSTMENTS Conveyance of Small Tracts § 254.34 Mineral survey fractions. (a) Mineral survey fractions subject to conveyance under this subpart are limited to those tracts which: (1) Cannot be...

  9. 40 CFR 52.254 - Organic solvent usage.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 3 2010-07-01 2010-07-01 false Organic solvent usage. 52.254 Section...) APPROVAL AND PROMULGATION OF IMPLEMENTATION PLANS California § 52.254 Organic solvent usage. (a) This... (d) of this section and the architectural coatings and solvent disposal emission limitations...

  10. Feasibility and market potential of protein determination of wheat using californium-252

    International Nuclear Information System (INIS)

    Roberts, T.C. Jr.; Eckhoff, N.D.; Clack, R.W.; Roberts, T.C. Sr.

    1976-01-01

    To evaluate the feasibility of protein determination by capture gamma-ray analysis using californium-252 neutrons, an in-situ protein analysis system for use by grain handlers has been examined. Three 227 kilogram (approximately) lots of wheat were used to determine the amount of nitrogen present. Protein analyses by the Kjeldahl method were obtained from samples taken before and after the capture gamma-ray analyses. The 5.267-MeV gamma-ray was selected for use in this study as a compromise between efficiency and interference from other elements. The associated counting equipment was a multichannel analyzer with pulse shaping electronic and analysis computing equipment. A linear regression program was used to compare the regions of interest to the Kjeldahl protein averages. The counts composing each peak were summed and normalized using the total count of the hydrogen peak. The normalized nitrogen percentages indicate a significant correlation between the spectral regions and the Kjeldahl analyses. To a first approximation, the value of wheat is the wheat protein. At the present time, protein testing of wheat is destructive, cumbersome, and time-consuming as compared to the potential for capture gamma-ray analysis testing. Assuming that such a protein analysis unit can analyze 42 tonne of wheat per hour, over 120 units would be needed to monitor one-half the U.S. annual wheat production. A 0.5% improvement in processor realizations and grain throughput value of $167.00 per tonne will result in a projected savings of $150,000 per year per unit

  11. Neutron reflector design with Californium 252 neutron for Boron neutron chapter therapy facility using MCNP5 simulation method

    International Nuclear Information System (INIS)

    Muhammad Fakhrurreza; Kusminanto; Y Sardjono

    2014-01-01

    In this research has made a reflector design to provide beams of Neutron for BNCT with Californium-252 radioactive source. This collimator is useful to obtain optimum epithermal neutron flux with the smallest impurity radiation (thermal neutron, fast neutron, and gamma). The design process is done using Monte Carlo N-Particle simulation version 5 (MCNP5) code to calculate the neutron flux tally form. The chosen reflector design is the reflectors which use material such as BeO ceramic with 13 cm thick. Moderator use sulfur material with the slope angle of the cone is 30°. From the calculation result, it is obtained that Reflector with 1 gram Californium-252 source can produce a neutron output thermal which has thermal neutron specification 2.23189 x 10 9 n/s.cm 2 , epithermal neutron 3.51548 x 10 9 n/s.cm 2 , and fast neutron 4.82241 x 10 9 n/s.cm 2 From the result, it needs additional collimator because the BNCT requirement. (author)

  12. Hypoxic versus normoxic external-beam irradiation of cervical carcinoma combined with californium-252 neutron brachytherapy. Comparative treatment results of a 5-year randomized study

    Czech Academy of Sciences Publication Activity Database

    Tačev, T.; Vacek, Antonín; Ptáčková, B.; Strnad, V.

    2005-01-01

    Roč. 181, č. 5 (2005), s. 273-284 ISSN 0179-7158 Institutional research plan: CEZ:AV0Z50040507 Keywords : cervical carcinoma * hypoxyradiotherapy * californium-252 Subject RIV: BO - Biophysics Impact factor: 3.490, year: 2005

  13. Study of the shielding for spontaneous fission sources of Californium-252; Estudio de blindaje para fuentes de fision espontanea de Californio-252

    Energy Technology Data Exchange (ETDEWEB)

    Davila R, I

    1991-06-15

    A shielding study is made to attenuate, until maximum permissible levels, the neutrons radiation and photons emitted by spontaneous fission coming from a source of Californium-252. The compound package by a database (Library DLC-23) and the ANISNW code is used, in it version for personal computer. (Author)

  14. Structure and formation mechanism of the transfermium isotope 254No

    International Nuclear Information System (INIS)

    Reiter, P.

    1998-01-01

    The ground-state band of the Z=102 isotope 254 No has been identified up to spin 14, indicating that the nucleus is deformed. The deduced quadruple deformation, β = 0.27, is in agreement with theoretical predictions. These observations confirm that the shell-correction energy responsible for the stability of transfermium nuclei is partly derived from deformation. The survival of 254 No up to spin 14 means that its fission barrier persists at least up to that spin

  15. Simulation and design of an electron beam ion source charge breeder for the californium rare isotope breeder upgrade

    Directory of Open Access Journals (Sweden)

    Clayton Dickerson

    2013-02-01

    Full Text Available An electron beam ion source (EBIS will be constructed and used to charge breed ions from the californium rare isotope breeder upgrade (CARIBU for postacceleration into the Argonne tandem linear accelerator system (ATLAS. Simulations of the EBIS charge breeder performance and the related ion transport systems are reported. Propagation of the electron beam through the EBIS was verified, and the anticipated incident power density within the electron collector was identified. The full normalized acceptance of the charge breeder with a 2 A electron beam, 0.024π  mm mrad for nominal operating parameters, was determined by simulating ion injection into the EBIS. The optics of the ion transport lines were carefully optimized to achieve well-matched ion injection, to minimize emittance growth of the injected and extracted ion beams, and to enable adequate testing of the charge bred ions prior to installation in ATLAS.

  16. Neutron activation analysis of the calcium content in vivo, using a 50μg source of californium 252

    International Nuclear Information System (INIS)

    Guey, A.; Zech, P.Y.; Meary, M.F.; Leitienne, P.

    1975-01-01

    Owing to the recent commercialisation of californium 252 it is now possible to obtain neutron fluxes strong enough for precise activation of the calcium content of biological targets. After the preliminary measurements necessary to establish the most suitable conditions for irradiating 3 to 5cm thick targets, two parallel sets of experiments were developed. In the first the medium-term total calcium variation was studied in 20 rats, 16 suffering from chronic kidney deficiency. In the second the precision expected as a function of the calcium content of the irradiated target was examined, using 3 sets of tissue equivalent standards of calcium contents 5, 20 and 50g respectively. The first results obtained on calcium 49 in vivo show that a calcium content variation can be followed with a sensitivity threshold below that obtained by conventional methods [fr

  17. Extraction of Trivalent Actinides and Lanthanides from Californium Campaign Rework Solution Using TODGA-based Solvent Extraction System

    Energy Technology Data Exchange (ETDEWEB)

    Benker, Dennis [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Delmau, Laetitia Helene [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Dryman, Joshua Cory [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States)

    2017-07-01

    This report presents the studies carried out to demonstrate the possibility of quantitatively extracting trivalent actinides and lanthanides from highly acidic solutions using a neutral ligand-based solvent extraction system. These studies stemmed from the perceived advantage of such systems over cationexchange- based solvent extraction systems that require an extensive feed adjustment to make a low-acid feed. The targeted feed solutions are highly acidic aqueous phases obtained after the dissolution of curium targets during a californium (Cf) campaign. Results obtained with actual Cf campaign solutions, but highly diluted to be manageable in a glove box, are presented, followed by results of tests run in the hot cells with Cf campaign rework solutions. It was demonstrated that a solvent extraction system based on the tetraoctyl diglycolamide molecule is capable of quantitatively extracting trivalent actinides from highly acidic solutions. This system was validated using actual feeds from a Cf campaign.

  18. Susceptibility to Stress Corrosion Cracking of 254SMO SS

    Directory of Open Access Journals (Sweden)

    De Micheli Lorenzo

    2002-01-01

    Full Text Available The susceptibility to stress corrosion cracking (SCC of solubilized and sensitized 254SMO SS was studied in sodium chloride, and sodium fluoride solutions at 80 °C and sulfuric acid solutions in presence of sodium chloride at 25 °C. The influence of salt concentration, pH values and the addition of thiosulfate was examined. The susceptibility to SCC was evaluated by Slow Strain Rate Tests (SSRT, at 1.5 x 10-6 s-1 strain rate. The behavior of 254SMO was compared to those of AISI 316L SS and Hastelloy C276. 254SMO showed an excellent resistance to SCC in all conditions, except in the more acidic solutions (pH <= 1 where, in the sensitized conditions, intergranular stress corrosion cracking occurred.

  19. Californium-252 Brachytherapy Combined With External-Beam Radiotherapy for Cervical Cancer: Long-Term Treatment Results

    International Nuclear Information System (INIS)

    Lei Xin; Qian Chengyuan; Qing Yi; Zhao Kewei; Yang Zhengzhou; Dai Nan; Zhong Zhaoyang; Tang Cheng; Li Zheng; Gu Xianqing; Zhou Qian; Feng Yan; Xiong Yanli; Shan Jinlu; Wang Dong

    2011-01-01

    Purpose: To observe, by retrospective analysis, the curative effects and complications due to californium-252 ( 252 Cf) neutron intracavitary brachytherapy (ICBT) combined with external-beam radiotherapy (EBRT) in the treatment of cervical cancer. Methods and Materials: From February 1999 to December 2007, 696 patients with cervical cancer (Stages IB to IIIB) were treated with 252 Cf-ICBT in combination of EBRT. Of all, 31 patients were at Stage IB, 104 at IIA, 363 at IIB, 64 at IIIA, and 134 at IIIB. Californium-252 ICBT was delivered at 7–12 Gy per insertion per week, with a total dose of 29–45 Gy to reference point A in three to five insertions. The whole pelvic cavity was treated with 8-MV X-ray external irradiation at 2 Gy per fraction, four times per week. After 16–38 Gy of external irradiation, the center of the whole pelvic field was blocked with a 4-cm-wide lead shield, with a total external irradiation dose of 44–56 Gy. The total treatment course was 5 to 6 weeks. Results: Overall survival rate at 3 and 5 years for all patients was 76.0% and 64.9%, respectively. Disease-free 3- and 5-year survival rates of patients were 71.2% and 58.4%, respectively. Late complications included vaginal contracture and adhesion, radiation proctitis, radiation cystitis, and inflammatory bowel, which accounted for 5.8%, 7.1%, 6.2%, and 4.9%, respectively. Univariate analysis results showed significant correlation of stage, age, histopathologic grade, and lymph node status with overall survival. Cox multiple regression analysis showed that the independent variables were stage, histopathologic grade, tumor size, and lymphatic metastasis in all patients. Conclusion: Results of this series suggest that the combined use of 252 Cf-ICBT with EBRT is an effective method for treatment of cervical cancer.

  20. Beyond Californium-A Neutron Generator Alternative for Dosimetry and Instrument Calibration in the U.S.

    Science.gov (United States)

    Piper, Roman K; Mozhayev, Andrey V; Murphy, Mark K; Thompson, Alan K

    2017-09-01

    Evaluations of neutron survey instruments, area monitors, and personal dosimeters rely on reference neutron radiations, which have evolved from the heavy reliance on (α,n) sources to a shared reliance on (α,n) and the spontaneous fission neutrons of californium-252 (Cf). Capable of producing high dose equivalent rates from an almost point source geometry, the characteristics of Cf are generally more favorable when compared to the use of (α,n) and (γ,n) sources or reactor-produced reference neutron radiations. Californium-252 is typically used in two standardized configurations: unmoderated, to yield a fission energy spectrum; or with the capsule placed within a heavy-water moderating sphere to produce a softened spectrum that is generally considered more appropriate for evaluating devices used in nuclear power plant work environments. The U.S. Department of Energy Cf Loan/Lease Program, a longtime origin of affordable Cf sources for research, testing and calibration, was terminated in 2009. Since then, high-activity sources have become increasingly cost-prohibitive for laboratories that formerly benefited from that program. Neutron generators, based on the D-T and D-D fusion reactions, have become economically competitive with Cf and are recognized internationally as important calibration and test standards. Researchers from the National Institute of Standards and Technology and the Pacific Northwest National Laboratory are jointly considering the practicality and technical challenges of implementing neutron generators as calibration standards in the U.S. This article reviews the characteristics of isotope-based neutron sources, possible isotope alternatives to Cf, and the rationale behind the increasing favor of electronically generated neutron options. The evaluation of a D-T system at PNNL has revealed characteristics that must be considered in adapting generators to the task of calibration and testing where accurate determination of a dosimetric quantity is

  1. High transfer cross sections from reactions with 254Es

    International Nuclear Information System (INIS)

    Schaedel, M.; Bruechle, W.; Bruegger, M.; Gaeggeler, H.; Moody, J.; Schardt, D.; Suemmerer, K.; Hulet, E.K.; Dougan, A.D.; Dougan, R.J.; Landrum, J.H.; Lougheed, R.W.; Wild, J.F.; O'Kelly, G.D.

    1985-08-01

    We report radiochemically determined cross sections for the heaviest known actinides produced in transfer reactions of 101 MeV 16 O, 98 MeV 18 O and 127 MeV 22 Ne with 254 Es as a target. A comparison with data for similar transfers from 248 Cm targets is made. Transfer cross sections are extrapolated for the production of unknown, neutron-rich isotopes of elements 101 through 105, and the unique potential of 254 Es as a target to make these exotic nuclei accessible is demonstrated. (orig.)

  2. 36 CFR 254.33 - Road rights-of-way.

    Science.gov (United States)

    2010-07-01

    ... parcels subject to conveyance under this subpart are limited to those which are substantially surrounded by lands not owned by the United States. (b) Forest Service officials shall consider public road... Section 254.33 Parks, Forests, and Public Property FOREST SERVICE, DEPARTMENT OF AGRICULTURE LANDOWNERSHIP...

  3. 40 CFR 264.254 - Monitoring and inspection.

    Science.gov (United States)

    2010-07-01

    ... Waste Piles § 264.254 Monitoring and inspection. (a) During construction or installation, liners (except in the case of existing portions of piles exempt from § 264.251(a)) and cover systems (e.g... increase in the permeability of the liner or cover. (b) While a waste pile is in operation, it must be...

  4. 36 CFR 254.12 - Value equalization; cash equalization waiver.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Value equalization; cash... AGRICULTURE LANDOWNERSHIP ADJUSTMENTS Land Exchanges § 254.12 Value equalization; cash equalization waiver. (a..., either with or without adjustments of relative values as compensation for various costs, the parties to...

  5. 24 CFR 221.254 - Mortgage insurance premiums.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Mortgage insurance premiums. 221... Cost Homes § 221.254 Mortgage insurance premiums. (a) All of the provisions of §§ 203.260 through 203.295 of this chapter relating to mortgage insurance premiums shall apply to mortgages insured under...

  6. Use of californium-252 neutron irradiator for in-vivo analysis of the bone calcium content of the hand

    International Nuclear Information System (INIS)

    Guey, A.; Leitienne, P.; Zech, P.Y.; Traeger, J.; Doyen, J.B.; Breton, J.P.

    1979-01-01

    With californium-252 it is easy to obtain a high neutron flux of the order of 10 9 n/s. The mean energy of this radiation, which is close on 2 MeV, activates calcium very well. The authors describe a storage and irradiator unit with a 100 μg californium source, with which it will henceforth be possible to develop this technique of measuring the calcium of the hand in a hospital. The test programme has three distinct phases: (1) irradiation of the biological target for 10 min; (2) after a transfer period of 30 s, detection of the radiation emitted by the 49 Ca for 600 s; (3) processing of the numerical data received, which are transmitted on line to a T 1600 calculator. The weight is found by comparing the activity induced in the unknown calcium mass with that induced in a phantom chosen as the activity standard. The reproducibility of the method is of the order of 3% (5% at the worst). The gross standardized result is edited automatically. For physical and clinical reasons, the hand is chosen as the reference part of the body in 70 control subjects. The local irradiation dose is less than 2 rem. The bone calcium content is 14.3+-1.9 g in men and 10.1+-1.3 g in women. In clinical application of the technique it is necessary to differentiate between the normal calcium content and the calcium content found with a pathological state. This makes it necessary to express the measurement in the form of a volume mass (rho). The volume of the hand skeleton (V in cm 3 ) is calculated from the corresponding bone surface (S in cm 2 ) measured by planimetry with the relationship V=8.925 exp 0.0205.S, found after studying 80 hand skeletons. In our control subjects the calcium bone volume mass was 0.288 g/cm 3 in men and 0.282 g/cm 3 in women. There is a very significant difference (p<0.001) in a population of 88 subjects with chronic renal insufficiencies at the terminal stage: rho=0.233 in men and 0.235 in women

  7. In-beam spectroscopy of 253,254No

    International Nuclear Information System (INIS)

    Herzberg, R.D.; Amzal, N.; Bastin, J.E.; Brew, P.M.T.; Butler, P.A.; Chewter, A.J.C.; Hammond, N.J.; Humphreys, R.D.; Jones, G.D.; Becker, F.; Hauschild, K.; Houry, M.; Huerstel, A.; Cocks, J.F.C.; Dorvaux, O.; Greenlees, P.T.; Eskola, K.; Gerl, J.; Hessberger, F.; Helariutta, K.; Jones, P.M.; Julin, R.; Juutinen, S.; Kankaanpaeae, H.; Kettunen, H.; Khoo, T.L.; Korten, W.; Kuusiniemi, P.; Le Coz, Y.; Leino, M.; Leppaenen, C.J.; Lister, A.P.; Lucas, R.; Muikku, M.; Nieminen, P.; Page, R.D.; Page, T.; Rahkila, P.; Reiter, P.; Schlegel, Ch.; Scholey, C.; Sletten, G.; Stezowski, O.; Theisen, Ch.; Trzaska, W.H.; Uusitalo, J.; Wollersheim, H.J.

    2002-01-01

    In-beam conversion electron spectroscopy experiments have been performed on the transfermium nuclei 253, 254 No using the conversion electron spectrometer SACRED in nearly collinear geometry in conjunction with the gas-filled separator RITU at the University of Jyvaeskylae. The experimental setup is discussed and the spectra are compared to Monte Carlo simulations. The implications for the ground-state configuration of 253 No are discussed. (orig.)

  8. Long-term effects of an intracavitary treatment with californium-252 on normal tissue. [Swine, /sup 226/Ra

    Energy Technology Data Exchange (ETDEWEB)

    Sullivan, M.F.; Beamer, J.L.; Mahony, T.D.; Cross, F.T.; Lund, J.E.; Endres, G.W.R.

    1976-01-01

    About one hundred fifty swine were exposed to either radium-226 or californium-252 sources in the uterine cervix to determine an RBE for both acute and long-term effects. That value for early changes in the tissues at risk in the treatment of cervical cancer was between 6.2 and 6.8. The incidence of complications increased with time after exposure, especially among animals treated with /sup 252/Cf. Analysis of rectal injury showed that ulceration occurred frequently within a year postexposure at doses between 1600 and 2400 rad calculated at 2 cm lateral to the source midline. Fat necrosis and smooth muscle atrophy, resulting in a local rectal stricture, were delayed changes observed in some animals. The lower ureter was the site for a greater frequency of complications than the GI tract. Ureteral stricture often occurred at doses of 1200 rad from /sup 252/Cf and 7000 rad from /sup 226/Ra. Observation of delayed effects in the uterine-cervix in animals held up to 4 years postexposure indicate that the RBE for /sup 252/Cf may be increased to a value as high as 18, while repair may have even decreased it to about 5.6 in the rectum. Fifty swine are still being observed for long-term effects after doses above 800 rad from /sup 252/Cf and 5000 rad from /sup 226/Ra.

  9. Neutron flux characterization of californium-252 Neutron Research Facility at the University of Texas - Pan American by nuclear analytical technique

    Science.gov (United States)

    Wahid, Kareem; Sanchez, Patrick; Hannan, Mohammad

    2014-03-01

    In the field of nuclear science, neutron flux is an intrinsic property of nuclear reaction facilities that is the basis for experimental irradiation calculations and analysis. In the Rio Grande Valley (Texas), the UTPA Neutron Research Facility (NRF) is currently the only neutron facility available for experimental research purposes. The facility is comprised of a 20-microgram californium-252 neutron source surrounded by a shielding cascade containing different irradiation cavities. Thermal and fast neutron flux values for the UTPA NRF have yet to be fully investigated and may be of particular interest to biomedical studies in low neutron dose applications. Though a variety of techniques exist for the characterization of neutron flux, neutron activation analysis (NAA) of metal and nonmetal foils is a commonly utilized experimental method because of its detection sensitivity and availability. The aim of our current investigation is to employ foil activation in the determination of neutron flux values for the UTPA NSRF for further research purposes. Neutron spectrum unfolding of the acquired experimental data via specialized software and subsequent comparison for consistency with computational models lends confidence to the results.

  10. 17 CFR 230.254 - Solicitation of interest document for use prior to an offering statement.

    Science.gov (United States)

    2010-04-01

    ... subject to the antifraud provisions of the federal securities laws. No solicitation or acceptance of money... document for use prior to an offering statement. 230.254 Section 230.254 Commodity and Securities Exchanges...-Conditional Small Issues Exemption § 230.254 Solicitation of interest document for use prior to an offering...

  11. 47 CFR 1.254 - Nature of the hearing; burden of proof.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 1 2010-10-01 2010-10-01 false Nature of the hearing; burden of proof. 1.254 Section 1.254 Telecommunication FEDERAL COMMUNICATIONS COMMISSION GENERAL PRACTICE AND PROCEDURE Hearing Proceedings Hearing and Intermediate Decision § 1.254 Nature of the hearing; burden of proof. Any hearing upon...

  12. 3C 254: the alignment effect and unification schemes

    Science.gov (United States)

    Bremer, M. N.

    1997-01-01

    3C 254 is a radio-loud quasar at z=0.734. Optical line and continuum emission from the underlying galaxy is clearly extended and aligned with the radio axis; the object shows the so-called `alignment effect' which is often seen in powerful radio galaxies. This is the clearest case yet of the continuum alignment effect in a radio-loud quasar. The object is one of the most lobe-dominated 3C quasars; the significance of the aligned emission in this source is discussed in terms of orientation-based unification schemes for radio-loud quasars and radio galaxies. 3C 254 is a very asymmetric radio source and it is shown that the radio structure on the side with the shortest nucleus-hotspot distance is interacting with the emission-line gas surrounding the quasar. It is also shown that the quasar is surrounded by an overdensity of faint objects, consistent with a cluster or group of galaxies around the object.

  13. Human Factors evaluation of LCS 254 and 255

    International Nuclear Information System (INIS)

    Goffe, L.; Held, J.E.

    1993-01-01

    This report includes the results of the Human Factors evaluation of the local control stations (LCS) 254 and 255 performed by Savannah River Technology Center (SRTC) Human Factors. Recommendations are included in order that the panel designs will be upgraded to comply with human engineering design guidelines. Figures 1 and 2 are included as examples of recommended changes. Also, consideration was given to including the proposed engineering changes which are currently on-going for LCS 255. Appendix A identifies the human engineering requirements from NUREG-0700 which were used in the evaluation process, and the areas of the design which do not comply with the guidelines. Those areas of the panel design which fail to comply with the human engineering guidelines are label location, label content, location aids, panel layout, and control display integration. Each of these design deficiencies and proposed corrections are described in this report

  14. Photooxidation of polystyrene: irradiation at 254 and 365 nm

    International Nuclear Information System (INIS)

    Otocka, E.P.; Curran, S.; Porter, R.S.

    1983-01-01

    Studies have been made of the near surface photooxidation of atactic polystyrene films prepared in the absence of air. The samples were photooxidized on exposure to air at two frequencies, 254 and 365 nm, using a calibrated mercury irradiation source with filters. Most studies were made at 40 0 C and as a function of irradiation time with the reactions characterized by changes in molecular weight and composition. The former was evaluated by gel permeation chromatography and the latter by transmission Fourier transform infrared ir spectroscopy and by multiple-internal-reflectance ir spectra using different angles and different crystals to evaluate compositions as a function of film depth. Species identified in photooxidation include the generation of hydroperoxides and the appearance of carbonyl bands with the latter identified by the spectral shift associated with the exposure of the photooxidized polystyrene surface to ammonia. These results suggest that principal products of near-surface oxidation of polystyrene are carboxylic acids. 6 figures, 1 table

  15. Ab initio full-potential study of mechanical properties and magnetic phase stability of californium monopnictides (CfN and CfP)

    Energy Technology Data Exchange (ETDEWEB)

    Amari, S., E-mail: siham_amari@yahoo.fr [Faculté des Sciences de la Nature et de la Vie, Université Hassiba Benbouali, Chlef, 02000 (Algeria); Bouhafs, B. [Laboratoire de Modélisation et Simulation en Sciences des Matériaux, Université Djillali Liabès de Sidi Bel-Abbés, Sidi Bel-Abbés, 22000 (Algeria)

    2016-09-15

    Based on the first-principles methods, the structural, elastic, electronic, properties and magnetic ordering of californium monopnictides CfX (X = P) have been studied using the full-potential augmented plane wave plus local orbitals (FP-L/APW + lo) method within the framework of density functional theory (DFT). The electronic exchange correlation energy is described by generalized gradient approximation GGA and GGA+U (U is the Hubbard correction). The GGA+U method is applied to the rare-earth 5f states. We have calculated the lattice parameters, bulk modulii and the first pressure derivatives of the bulk modulii. The elastic properties of the studied compounds are only investigated in the most stable calculated phase. In order to gain further information, we have calculated Young’s modulus, shear modulus, anisotropy factor and Kleinman parameter by the aid of the calculated elastic constants. The results mainly show that californium monopnictides CfX (X = P) have an antiferromagnetic spin ordering. Density of states (DOS) and charge densities for both compounds are also computed in the NaCl (B1) structure.

  16. Use of polyethylene pellets in the design and construction of a storage safe, a transport vessel and a portable shield for californium-252

    International Nuclear Information System (INIS)

    Sharma, S.

    1986-01-01

    A storage and shielding facility for 300 μg of Californium-252 sources was designed and constructed. Though the safe was in a permanent location, the fact that it consisted of a lead bucket surrounded by polyethylene pellets made it simple, movable and inexpensive. If need be, more quantities of Cf-252 could be added without altering the basic design and sacrificing the radiation protection guidelines. The measured radiation levels from 300 μg of stored Cf-252 in and around the storage vault were lower than the expected dose rates by a factor of 5. The measured radiation levels around the occupied environs of the facility were below the maximum permissible yearly dose of 500mrem for non-occupational workers. A transport vessel was designed and constructed to carry up to 50 μg of Californium-252 sources. It consisted of a standard 55 gallon steel drum on casters containing cylindrical lead shield surrounded by polyethylene pellets. The measured maximum surface dose rates on the drum and at one meter away were within the radiation protection guidelines and were less than the expected dose rates. A portable shield was designed and constructed to protect the body in afterloading operations and handling of the sources. It consisted of polyethylene pellets in an aluminum box and an attached 10 cm thick plexiglass eye shield. The simple design, with the ease of using polyethylene pellets can be extended to construct bedside shields

  17. 75 FR 6319 - Proposed Amendment of Low Altitude Area Navigation Route T-254; Houston, TX

    Science.gov (United States)

    2010-02-09

    ... Amendment of Low Altitude Area Navigation Route T-254; Houston, TX AGENCY: Federal Aviation Administration... altitude Area Navigation (RNAV) route T-254 in the Houston, TX, terminal area by eliminating the segment... safety and the efficient use of the navigable airspace in the Houston, TX, terminal area. DATES: Comments...

  18. 75 FR 18047 - Amendment of Low Altitude Area Navigation Route T-254; Houston, TX

    Science.gov (United States)

    2010-04-09

    ...-254; Houston, TX AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Final rule. SUMMARY: This action amends low altitude Area Navigation (RNAV) route T-254 in the Houston, TX, terminal area by... Houston, TX, terminal area. DATES: Effective Dates: 0901 UTC, June 3, 2010. The Director of the Federal...

  19. 37 CFR 2.54 - Requirements for drawings submitted on paper.

    Science.gov (United States)

    2010-07-01

    ... submitted on paper. 2.54 Section 2.54 Patents, Trademarks, and Copyrights UNITED STATES PATENT AND TRADEMARK... drawings submitted on paper. The drawing must meet the requirements of § 2.52. In addition, in a paper submission, the drawing should: (a) Be on non-shiny white paper that is separate from the application; (b) Be...

  20. 48 CFR 53.204-1 - Safeguarding classified information within industry (DD Form 254, DD Form 441).

    Science.gov (United States)

    2010-10-01

    ... information within industry (DD Form 254, DD Form 441). 53.204-1 Section 53.204-1 Federal Acquisition....204-1 Safeguarding classified information within industry (DD Form 254, DD Form 441). The following... specified in subpart 4.4 and the clause at 52.204-2: (a) DD Form 254 (Department of Defense (DOD)), Contract...

  1. 37 CFR 254.2 - Definition of coin-operated phonorecord player.

    Science.gov (United States)

    2010-07-01

    ...-OPERATED PHONORECORD PLAYERS § 254.2 Definition of coin-operated phonorecord player. As used in this part..., currency, tokens, or other monetary units or their equivalent; (b) Is located in an establishment making no...

  2. Structure and formation mechanism of the transfermium isotope {sup 254}No.

    Energy Technology Data Exchange (ETDEWEB)

    Reiter, P.

    1998-12-17

    The ground-state band of the Z=102 isotope {sup 254}No has been identified up to spin 14, indicating that the nucleus is deformed. The deduced quadruple deformation, {beta} = 0.27, is in agreement with theoretical predictions. These observations confirm that the shell-correction energy responsible for the stability of transfermium nuclei is partly derived from deformation. The survival of {sup 254}No up to spin 14 means that its fission barrier persists at least up to that spin.

  3. cdc-25.4, a Caenorhabditis elegans Ortholog of cdc25, Is Required for Male Mating Behavior

    Directory of Open Access Journals (Sweden)

    Sangmi Oh

    2016-12-01

    Full Text Available Cell division cycle 25 (cdc25 is an evolutionarily conserved phosphatase that promotes cell cycle progression. Among the four cdc25 orthologs in Caenorhabditis elegans, we found that cdc-25.4 mutant males failed to produce outcrossed progeny. This was not caused by defects in sperm development, but by defects in male mating behavior. The cdc-25.4 mutant males showed various defects during male mating, including contact response, backing, turning, and vulva location. Aberrant turning behavior was the most prominent defect in the cdc-25.4 mutant males. We also found that cdc-25.4 is expressed in many neuronal cells throughout development. The turning defect in cdc-25.4 mutant males was recovered by cdc-25.4 transgenic expression in neuronal cells, suggesting that cdc-25.4 functions in neurons for male mating. However, the neuronal morphology of cdc-25.4 mutant males appeared to be normal, as examined with several neuronal markers. Also, RNAi depletion of wee-1.3, a C. elegans ortholog of Wee1/Myt1 kinase, failed to suppress the mating defects of cdc-25.4 mutant males. These findings suggest that, for successful male mating, cdc-25.4 does not target cell cycles that are required for neuronal differentiation and development. Rather, cdc-25.4 likely regulates noncanonical substrates in neuronal cells.

  4. Oxidation-reduction properties of americium, curium, berkelium, californium, einsteinium and fermium, and thermodynamic consequences for the 5f series

    International Nuclear Information System (INIS)

    Samhoun, K.

    1976-01-01

    The amalgamation of 5f elements from Am to Fm has been studied by using 241 Am, 244 Cm, 249 Bk, 249 Cf, 252 Cf, 253 Es, 254 Es, 252 Fm and 255 Fm with two electrochemical methods, radiocoulometry and radiopolarography, perfectly adapted to investigate extremely diluted solutions when the concentration of electroactive species is as low as 10 -16 M. The theory of radiocoulometry has been developed in the general cases of reversible and irreversible electrode process. It has been used to interpret the experimental data on the kinetic curves of amalgamation, and to estimate the standard rate constant of the electrode process in complexing medium (citric). On the other hand the radiopolarographic method has been applied to study the mechanism of reduction at the dropping mercury electrode of cations M 3+ in aqueous medium to the metal M with formation of amalgam. The results are exploited into two directions: 1- Acquisition of some data concerning the oxidation-reduction properties of elements from Am to Fm. Therefore the standard electrode E 0 [M(III-0)] potentials for Bk, Cf and Es, and the standard electrode E 0 [M(II-0)] potential for Fm are estimated and the relative stability of each oxidation state (from II to VII) of 5f elements is discussed; 2- Acquisition of unknown thermodynamic data on transcalifornium elements. Correlations between 4f and 5f elements are precised and some divergences appear for the second half of 4f and 5f series (i.e. for 65 [fr

  5. Ground-State Band and Deformation of the Z = 102 Isotope N 254

    International Nuclear Information System (INIS)

    Reiter, P.; Khoo, T.L.; Lister, C.J.; Seweryniak, D.; Ahmad, I.; Alcorta, M.; Carpenter, M.P.; Cizewski, J.A.; Davids, C.N.; Gervais, G.; Greene, J.P.; Henning, W.F.; Janssens, R.V.; Lauritsen, T.; Siem, S.; Sonzogni, A.A.; Sullivan, D.; Uusitalo, J.; Wiedenhoever, I.; Amzal, N.; Butler, P.A.; Chewter, A.J.; Greenlees, P.T.; Herzberg, R.; Jones, G.D.; Cizewski, J.A.; Ding, K.Y.; Fotiades, N.; Fox, J.D.; Korten, W.; Leino, M.; Vetter, K.; Siem, S.

    1999-01-01

    The ground-state band of the Z=102 isotope 254 No has been identified up to spin 14, indicating that the nucleus is deformed. The deduced quadrupole deformation, β=0.27 , is in agreement with theoretical predictions. These observations confirm that the shell-correction energy responsible for the stability of transfermium nuclei is partly derived from deformation. The survival of 254 No up to spin 14 means that its fission barrier persists at least up to that spin. copyright 1999 The American Physical Society

  6. Optical and near-infrared study of the AM Herculis-type binary CW 1103 + 254

    Energy Technology Data Exchange (ETDEWEB)

    Bailey, J [Anglo-Australian Observatory, Epping (Australia); Watts, D J [Tasmania Univ., Sandy Bay (Australia). Dept. of Physics; Sherrington, M R [Leicester Univ. (UK). Dept. of Astronomy

    1985-07-15

    The AM Herculis-type binary CW 1103+254 has been observed using optical and near-infrared photometry and polarimetry, and optical spectroscopy and spectropolarimetry. It is found that from such a set of observations it is relatively easy to distinguish all the main components of the system.

  7. 6 CFR 25.4 - Designation of qualified anti-terrorism technologies.

    Science.gov (United States)

    2010-01-01

    ... 6 Domestic Security 1 2010-01-01 2010-01-01 false Designation of qualified anti-terrorism... REGULATIONS TO SUPPORT ANTI-TERRORISM BY FOSTERING EFFECTIVE TECHNOLOGIES § 25.4 Designation of qualified anti-terrorism technologies. (a) General. The Under Secretary may Designate as a Qualified Anti-Terrorism...

  8. Enhanced escape rate for Hg 254 nm resonance radiation in fluorescent lamps

    International Nuclear Information System (INIS)

    Lawler, James E; Raizen, Mark G

    2013-01-01

    The potential of the low-cost MAGIS isotopic separation method to improve fluorescent lamp efficacy is explored using resonance radiation transport simulations. New Hg isotopic mixes are discovered that yield escape rates for 254 nm Hg I resonance radiation equal to 117% to 122% of the rate for a natural isotopic mix under the same lamp conditions. (paper)

  9. Californium interrogation prompt neutron (CIPN) instrument for non-destructive assay of spent nuclear fuel—Design concept and experimental demonstration

    Energy Technology Data Exchange (ETDEWEB)

    Henzlova, D., E-mail: henzlova@lanl.gov [Los Alamos National Laboratory, Los Alamos, NM 87545 (United States); Menlove, H.O.; Rael, C.D.; Trellue, H.R.; Tobin, S.J. [Los Alamos National Laboratory, Los Alamos, NM 87545 (United States); Park, Se-Hwan; Oh, Jong-Myeong; Lee, Seung-Kyu; Ahn, Seong-Kyu; Kwon, In-Chan; Kim, Ho-Dong [Korea Atomic Energy Research Institute, Daejeong (Korea, Republic of)

    2016-01-11

    This paper presents results of the first experimental demonstration of the Californium Interrogation Prompt Neutron (CIPN) instrument developed within a multi-year effort launched by the Next Generation Safeguards Initiative Spent Fuel Project of the United States Department of Energy. The goals of this project focused on developing viable non-destructive assay techniques with capabilities to improve an independent verification of spent fuel assembly characteristics. For this purpose, the CIPN instrument combines active and passive neutron interrogation, along with passive gamma-ray measurements, to provide three independent observables. This paper describes the initial feasibility demonstration of the CIPN instrument, which involved measurements of four pressurized-water-reactor spent fuel assemblies with different levels of burnup and two initial enrichments. The measurements were performed at the Post-Irradiation Examination Facility at the Korea Atomic Energy Institute in the Republic of Korea. The key aim of the demonstration was to evaluate CIPN instrument performance under realistic deployment conditions, with the focus on a detailed assessment of systematic uncertainties that are best evaluated experimentally. The measurements revealed good positioning reproducibility, as well as a high degree of insensitivity of the CIPN instrument's response to irregularities in a radial burnup profile. Systematic uncertainty of individual CIPN instrument signals due to assembly rotation was found to be <4.5%, even for assemblies with fairly extreme gradients in the radial burnup profile. These features suggest that the CIPN instrument is capable of providing a good representation of assembly average characteristics, independent of assembly orientation in the instrument.

  10. Californium interrogation prompt neutron (CIPN) instrument for non-destructive assay of spent nuclear fuel—Design concept and experimental demonstration

    International Nuclear Information System (INIS)

    Henzlova, D.; Menlove, H.O.; Rael, C.D.; Trellue, H.R.; Tobin, S.J.; Park, Se-Hwan; Oh, Jong-Myeong; Lee, Seung-Kyu; Ahn, Seong-Kyu; Kwon, In-Chan; Kim, Ho-Dong

    2016-01-01

    This paper presents results of the first experimental demonstration of the Californium Interrogation Prompt Neutron (CIPN) instrument developed within a multi-year effort launched by the Next Generation Safeguards Initiative Spent Fuel Project of the United States Department of Energy. The goals of this project focused on developing viable non-destructive assay techniques with capabilities to improve an independent verification of spent fuel assembly characteristics. For this purpose, the CIPN instrument combines active and passive neutron interrogation, along with passive gamma-ray measurements, to provide three independent observables. This paper describes the initial feasibility demonstration of the CIPN instrument, which involved measurements of four pressurized-water-reactor spent fuel assemblies with different levels of burnup and two initial enrichments. The measurements were performed at the Post-Irradiation Examination Facility at the Korea Atomic Energy Institute in the Republic of Korea. The key aim of the demonstration was to evaluate CIPN instrument performance under realistic deployment conditions, with the focus on a detailed assessment of systematic uncertainties that are best evaluated experimentally. The measurements revealed good positioning reproducibility, as well as a high degree of insensitivity of the CIPN instrument's response to irregularities in a radial burnup profile. Systematic uncertainty of individual CIPN instrument signals due to assembly rotation was found to be <4.5%, even for assemblies with fairly extreme gradients in the radial burnup profile. These features suggest that the CIPN instrument is capable of providing a good representation of assembly average characteristics, independent of assembly orientation in the instrument.

  11. Coulomb dissociation of {sup 8}B at 254 A MeV

    Energy Technology Data Exchange (ETDEWEB)

    Suemmerer, K; Boue, F; Baumann, T; Geissel, H; Hellstroem, M; Koczon, P; Schwab, E; Schwab, W; Senger, P; Surowiecz, A [Gesellschaft fuer Schwerionenforschung (GSI), Darmstadt (Germany); Iwasa, N; Ozawa, A [Gesellschaft fuer Schwerionenforschung (GSI), Darmstadt (Germany); [RIKEN Institute of Physical and Chemical Research, Saitama (Japan); Surowka, G [Gesellschaft fuer Schwerionenforschung (GSI), Darmstadt (Germany); [Jagiellonian Univ., Krakow (Poland). Inst. of Physics; Blank, B; Czajkowski, S; Marchand, C; Pravikoff, M S [Centre d` Etudes Nucleaires de Bordeaux-Gradignan, 33 (France); Foerster, A; Lauer, F; Oeschler, H; Speer, J; Sturm, C; Uhlig, F; Wagner, A [Technische Univ. Darmstadt (Germany); Gai, M [Connecticut Univ., Storrs, CT (United States). Dept. of Physics; Grosse, E [Inst. fuer Kern- und Hadronenphysik, Forschungszentrum Rossendorf, Dresden (Germany); Kohlmeyer, B [Philipps Univ., Marburg (Germany). Fachbereich Physik; Kulessa, R; Walus, W [Jagiellonian Univ., Krakow (Poland). Inst. of Physics; Motobayashi, T [Rikkyo Univ., Tokyo (Japan). Dept. of Physics; Teranishi, T [RIKEN Institute of Physical and Chemical Research, Saitama (Japan)

    1998-06-01

    As an alternative method for determining the astrophysical S-factor for the {sup 7}Be(p,{gamma}){sup 8}B reaction we have measured the Coulomb dissociation of {sup 8}B at 254 A MeV. From our preliminary results, we obtain good agreement with both the accepted direct-reaction measurements and the low-energy Coulomb dissociation study of Iwasa et al. performed at about 50 A MeV. (orig.)

  12. Ferric ion mediated photochemical decomposition of perfluorooctanoic acid (PFOA) by 254 nm UV light

    International Nuclear Information System (INIS)

    Wang Yuan; Zhang Pengyi; Pan Gang; Chen Hao

    2008-01-01

    The great enhancement of ferric ion on the photochemical decomposition of environmentally persistent perfluorooctanoic acid (PFOA) under 254 nm UV light was reported. In the presence of 10 μM ferric ion, 47.3% of initial PFOA (48 μM) was decomposed and the defluorination ratio reached 15.4% within 4 h reaction time. While the degradation and defluorination ratio greatly increased to 80.2% and 47.8%, respectively, when ferric ion concentration increased to 80 μM, and the corresponding half-life was shortened to 103 min. Though the decomposition rate was significantly lowered under nitrogen atmosphere, PFOA was efficiently decomposed too. Other metal ions like Cu 2+ and Zn 2+ also slightly improved the photochemical decomposition of PFOA under irradiation of 254 nm UV light. Besides fluoride ion, other intermediates during PFOA decomposition including formic acid and five shorter-chain perfluorinated carboxylic acids (PFCAs) with C7, C6, C5, C4 and C3, respectively, were identified and quantified by IC or LC/MS. The mixture of PFOA and ferric ion had strong absorption around 280 nm. It is proposed that PFOA coordinates with ferric ion to form a complex, and its excitation by 254 nm UV light leads to the decomposition of PFOA in a stepwise way

  13. Comparative functional analysis of two fibroblast growth factor receptor 1 (FGFR1) mutations affecting the same residue (R254W and R254Q) in isolated hypogonadotropic hypogonadism (IHH).

    Science.gov (United States)

    Koika, Vasiliki; Varnavas, Petros; Valavani, Helen; Sidis, Yisrael; Plummer, Lacey; Dwyer, Andrew; Quinton, Richard; Kanaka-Gantenbein, Christine; Pitteloud, Nelly; Sertedaki, Amalia; Dacou-Voutetakis, Catherine; Georgopoulos, Neoklis A

    2013-03-01

    FGFR1 mutations have been identified in both Kallmann syndrome and normosmic HH (nIHH). To date, few mutations in the FGFR1 gene have been structurally or functionally characterized in vitro to identify molecular mechanisms that contribute to the disease pathogenesis. We attempted to define the in vitro functionality of two FGFR1 mutants (R254W and R254Q), resulting from two different amino acid substitutions of the same residue, and to correlate the in vitro findings to the patient phenotypes. Two unrelated GnRH deficient probands were found to harbor mutations in FGFR1 (R254W and R254Q). Mutant signaling activity and expression levels were evaluated in vitro and compared to a wild type (WT) receptor. Signaling activity was determined by a FGF2/FGFR1 dependent transcription reporter assay. Receptor total expression levels were assessed by Western blot and cell surface expression was measured by a radiolabeled antibody binding assay. The R254W maximal receptor signaling capacity was reduced by 45% (p<0.01) while R254Q activity was not different from WT. However, both mutants displayed diminished total protein expression levels (40 and 30% reduction relative to WT, respectively), while protein maturation was unaffected. Accordingly, cell surface expression levels of the mutant receptors were also significantly reduced (35% p<0.01 and 15% p<0.05, respectively). The p.R254W and p.R254Q are both loss-of-function mutations as demonstrated by their reduced overall and cell surface expression levels suggesting a deleterious effect on receptor folding and stability. It appears that a tryptophan substitution at R254 is more disruptive to receptor structure than the more conserved glutamine substitution. No clear correlation between the severity of in vitro loss-of-function and phenotypic presentation could be assigned. Copyright © 2012 Elsevier B.V. All rights reserved.

  14. Understanding the different rotational behaviors of $^{252}$No and $^{254}$No in terms of high-order deformation

    CERN Document Server

    Liu, H L; Walker, P M

    2012-01-01

    Total Routhian surface calculations have been performed to investigate rapidly rotating transfermium nuclei, the heaviest nuclei accessible by detailed spectroscopy experiments. The observed fast alignment in $^{252}$No and slow alignment in $^{254}$No are well reproduced by the calculations incorporating high-order deformations. The different rotational behaviors of $^{252}$No and $^{254}$No can be understood for the first time in terms of $\\beta_6$ deformation that decreases the energies of the $\

  15. Coulomb dissociation of 8B at 254 MeV/u

    International Nuclear Information System (INIS)

    Surowka, G.; Iwasa, N.; Boue, F.

    1999-01-01

    As an alternative method to determine the cross section of 7 Be (p, γ) 8 B, the Coulomb dissociation reaction 8 B → 7 Be + p at E inc = 254 MeV/u was measured. Our preliminary results show the dominant role of the dipole excitation in the Coulomb break-up process. The extracted astrophysical S 17 factor is consistent with the lower-value results both of the direct-capture studies, and the RIKEN Coulomb-dissociation experiment at ∼ 50 MeV/u. (author)

  16. Crítica textual y estilo: nota a Farsalia I 254

    Directory of Open Access Journals (Sweden)

    Antonio Holgado Redondo

    1981-12-01

    Full Text Available Almost every Lucan's manuscript has in Pharsalia I 254 the variant furentem (only one gives ruentem, but almost every one of the editors prefers ruentem. The acceptance of ruentem is due to the nearby presence of a furentum and a furoris. Here we maintain furentem as the right reading, on grounds of Lucan's familiar stylistic procedure of repetition of the key terms of a passage. The poetic value of this repetition is endorsed in modern times by R. Jakobson and S. R. Levin.

  17. The O-GlcNAc Transferase Intellectual Disability Mutation L254F Distorts the TPR Helix.

    Science.gov (United States)

    Gundogdu, Mehmet; Llabrés, Salomé; Gorelik, Andrii; Ferenbach, Andrew T; Zachariae, Ulrich; van Aalten, Daan M F

    2018-05-17

    O-linked β-N-acetyl- D -glucosamine (O-GlcNAc) transferase (OGT) regulates protein O-GlcNAcylation, an essential post-translational modification that is abundant in the brain. Recently, OGT mutations have been associated with intellectual disability, although it is not understood how they affect OGT structure and function. Using a multi-disciplinary approach we show that the L254F OGT mutation leads to conformational changes of the tetratricopeptide repeats and reduced activity, revealing the molecular mechanisms contributing to pathogenesis. Copyright © 2018 The Authors. Published by Elsevier Ltd.. All rights reserved.

  18. Decay and Fission Hindrance of Two- and Four-Quasiparticle K Isomers in ^{254}Rf.

    Science.gov (United States)

    David, H M; Chen, J; Seweryniak, D; Kondev, F G; Gates, J M; Gregorich, K E; Ahmad, I; Albers, M; Alcorta, M; Back, B B; Baartman, B; Bertone, P F; Bernstein, L A; Campbell, C M; Carpenter, M P; Chiara, C J; Clark, R M; Cromaz, M; Doherty, D T; Dracoulis, G D; Esker, N E; Fallon, P; Gothe, O R; Greene, J P; Greenlees, P T; Hartley, D J; Hauschild, K; Hoffman, C R; Hota, S S; Janssens, R V F; Khoo, T L; Konki, J; Kwarsick, J T; Lauritsen, T; Macchiavelli, A O; Mudder, P R; Nair, C; Qiu, Y; Rissanen, J; Rogers, A M; Ruotsalainen, P; Savard, G; Stolze, S; Wiens, A; Zhu, S

    2015-09-25

    Two isomers decaying by electromagnetic transitions with half-lives of 4.7(1.1) and 247(73) μs have been discovered in the heavy ^{254}Rf nucleus. The observation of the shorter-lived isomer was made possible by a novel application of a digital data acquisition system. The isomers were interpreted as the K^{π}=8^{-}, ν^{2}(7/2^{+}[624],9/2^{-}[734]) two-quasineutron and the K^{π}=16^{+}, 8^{-}ν^{2}(7/2^{+}[624],9/2^{-}[734])⊗8^{-}π^{2}(7/2^{-}[514],9/2^{+}[624]) four-quasiparticle configurations, respectively. Surprisingly, the lifetime of the two-quasiparticle isomer is more than 4 orders of magnitude shorter than what has been observed for analogous isomers in the lighter N=150 isotones. The four-quasiparticle isomer is longer lived than the ^{254}Rf ground state that decays exclusively by spontaneous fission with a half-life of 23.2(1.1) μs. The absence of sizable fission branches from either of the isomers implies unprecedented fission hindrance relative to the ground state.

  19. Kinetics and mechanism investigation on the destruction of oxytetracycline by UV-254nm activation of persulfate.

    Science.gov (United States)

    Liu, Yiqing; He, Xuexiang; Fu, Yongsheng; Dionysiou, Dionysios D

    2016-03-15

    Oxytetracycline (OTC), an important broad-spectrum antibiotic, has been detected extensively in various environmental systems, which may have a detrimental impact on ecosystem and human health through the development of drug resistant bacteria and pathogens. In this study, the degradation of OTC was evaluated by UV-254nm activated persulfate (PS). The observed UV fluence based pseudo first-order rate constant (kobs) was found to be the highest at near neutral pH conditions (pH 5.5-8.5). Presence of various natural water constituents had different effects on OTC degradation, with a significant enhancement in the presence of bicarbonate or Cu(2+). Limited elimination of total organic carbon (TOC) and PS was observed during the mineralization of OTC. Transformation byproducts in the presence and absence of hydroxyl radical scavenging agent tert-butanol (t-BuOH) were identified using ultra-high definition accurate-mass quadrupole time-of-flight liquid chromatography/mass spectrometer (LC-QTOF/MS). Potential OTC degradation mechanism was subsequently proposed revealing four different reaction pathways by SO4(-) reaction including hydroxylation (+16Da), demethylation (-14Da), decarbonylation (-28Da) and dehydration (-18Da). This study suggests that UV-254nm/PS is a promising treatment technology for the control of water pollution caused by emerging contaminants such as OTC. Copyright © 2015 Elsevier B.V. All rights reserved.

  20. Californium-252 Program Equipment Evaluation

    Energy Technology Data Exchange (ETDEWEB)

    Chattin, Fred Rhea [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Wilson, Kenton [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Ezold, Julie G. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States)

    2017-12-01

    To successfully continue the 252Cf production and meet the needs of the customers, a comprehensive evaluation of the Building 7920 processing equipment was requested to identify equipment critical to the operational continuity of the program.

  1. Californium Recovery from Palladium Wire

    Energy Technology Data Exchange (ETDEWEB)

    Burns, Jon D. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States)

    2014-08-01

    The recovery of 252Cf from palladium-252Cf cermet wires was investigated to determine the feasibility of implementing it into the cermet wire production operation at Oak Ridge National Laboratory’s Radiochemical Engineering Development Center. The dissolution of Pd wire in 8 M HNO3 and trace amounts of HCl was studied at both ambient and elevated temperatures. These studies showed that it took days to dissolve the wire at ambient temperature and only 2 hours at 60°C. Adjusting the ratio of the volume of solvent to the mass of the wire segment showed little change in the kinetics of dissolution, which ranged from 0.176 mL/mg down to 0.019 mL/mg. A successful chromatographic separation of 153Gd, a surrogate for 252Cf, from Pd was demonstrated using AG 50x8 cation exchange resin with a bed volume of 0.5 mL and an internal diameter of 0.8 cm.

  2. Substitution of Tyr254 with Phe at the active site of flavocytochrome b2: consequences on catalysis of lactate dehydrogenation

    International Nuclear Information System (INIS)

    Dubois, J.; Chapman, S.K.; Mathews, F.S.; Reid, G.A.; Lederer, F.

    1990-01-01

    A role for Tyr254 in L-lactate dehydrogenation catalyzed by flavocytochrome b2 has recently been proposed on the basis of the known active-site structure and of studies that had suggested a mechanism involving the initial formation of a lactate carbanion. This role is now examined after replacement of Tyr254 with phenylalanine. The kcat is decreased about 40-fold, Km for lactate appears unchanged, and the mainly rate-limiting step is still alpha-hydrogen abstraction, as judged from the steady-state deuterium isotope effect. Modeling studies with lactate introduced into the active site indicate two possible substrate conformations with different hydrogen-bonding partners for the substrate hydroxyl. If the hydrogen bond is formed with Tyr254, as was initially postulated, the mechanism must involve removal by His373 of the C2 hydrogen, with carbanion formation. If, in the absence of the Tyr254 phenol group, the hydrogen bond is formed with His373 N3, the substrate is positioned in such a way that the reaction must proceed by hydride transfer. Therefore the mechanism of the Y254F enzyme was investigated so as to distinguish between the two mechanistic possibilities. 2-Hydroxy-3-butynoate behaves with the mutant as a suicide reagent, as with the wild-type enzyme. Similarly, the mutant protein also catalyzes the reduction and the dehydrohalogenation of bromopyruvate under transhydrogenation conditions

  3. Alimentation impact of treatments of 254 oropharyngeal cancers (1998-2003).

    Science.gov (United States)

    Buiret, Guillaume; Daveau, Clémentine; Landry, Guillaume; Colin, Carole; Pignat, Jean-Christian; Poupart, Marc

    2011-01-01

    Objective. To analyze the functional impact of the various possible treatments of oropharyngeal squamous cell carcinomas to find the main prognostic factors of dysphagia induced by these treatments. Patients. Clinical data from 254 patients treated for squamous cell carcinoma of the oropharynx between 1998 and 2003 were retrospectively analyzed. A multivariate model enabled us to evaluate the role of each potentially harmful factor on swallowing. Main Outcome Measures. The significant factors influencing the consumption of liquid, pasty, and normal food were the same: the initial T stage and the type of treatment. Conclusion. Whatever the possible and selected treatment was, the impact on the functional capacities, and thus, the quality of life of the patients was considerable. Even though we could not significantly demonstrate exclusive radiotherapy caused more long-term undesirable effects than surgery followed by radiotherapy, our daily practice has shown that we should favour the latter.

  4. Stability of trans-fermium elements at high spin: Measuring the fission barrier of 254No

    International Nuclear Information System (INIS)

    Henning, Greg

    2012-01-01

    Super heavy nuclei provide opportunities to study nuclear structure near three simultaneous limits: in charge Z, spin I and excitation energy E*. These nuclei exist only because of a fission barrier, created by shell effects. It is therefore important to determine the fission barrier and its spin dependence B f (I), which gives information on the shell energy E(shell)(I). Theoretical calculations predict different fission barrier heights from B f (I = 0) = 6.8 MeV for a macro-microscopic model to 8.7 MeV for Density Functional Theory calculations using the Gogny or Skyrme interactions. Hence, a measurement of B f provides a test for theories.To investigate the fission barrier, an established method is to measure the rise of fission with excitation energy, characterized by the ratio of decay widths Γ(fission)/Γ(total), using transfer reactions. However, for heavy elements such as 254 No, there is no suitable target for a transfer reaction. We therefore rely on the complementary decay widths ratio Γ γ /Γ(fission) and its spin dependence, deduced from the entry distribution (I, E*).Measurements of the gamma-ray multiplicity and total energy for 254 No have been performed with beam energies of 219 and 223 MeV in the reaction 208 Pb( 48 Ca,2n) at ATLAS (Argonne Tandem Linac Accelerator System). The 254 No gamma rays were detected using the Gammasphere array as a calorimeter - as well as the usual high resolution γ-ray detector. Coincidences with evaporation residues at the Fragment Mass Analyzer focal plane separated 254 No gamma rays from those from fission fragments, which are ≥ 10 6 more intense. From this measurement, the entry distribution - i.e. the initial distribution of I and E* - is constructed. Each point (I,E*) of the entry distribution is a point where gamma decay wins over fission and, therefore, gives information on the fission barrier. The measured entry distributions show an increase in the maximum spin and excitation energy from 219 to 223 Me

  5. Printed wax masks for 254 nm deep-UV pattering of PMMA-based microfluidics

    KAUST Repository

    Fan, Yiqiang

    2012-01-13

    This paper reports a new technique for masking deep-UV exposure of poly(methyl methacrylate) (PMMA) using a printed wax mask. This technique provides an inexpensive and bulk fabrication method for PMMA structures. The technique involves the direct printing of the mask onto a polymer sheet using a commercial wax printer. The wax layer was then transferred to a PMMA substrate using a thermal laminator, exposed using deep-UV (with a wavelength of 254 nm), developed in an IPA:water solution, and completed by bonding on a PMMA cap layer. A sample microfluidic device fabricated with this method is also presented, with the microchannel as narrow as 50 μm. The whole process is easy to perform without the requirement for any microfabrication facilities. © 2012 IOP Publishing Ltd.

  6. Radiochemical search for neutron-rich isotopes of nielsbohrium in the (16)O + (254)Es reaction

    International Nuclear Information System (INIS)

    Schaedel, M.; Jaeger, E.; Bruechle, W.; Suemmerer, K.; Hulet, E.K.; Wild, J.F.; Lougheed, R.W.; Dougan, R.J.; Moody, K.J.

    1994-09-01

    We have used on-line gas chromatography to search for new isotopes of element 107 near the deformed sub-shell at N = 162 and Z = 108. Enhanced nuclear stability is predicted for this region. 254g Es was irradiated with 16 O at barrier energies to minimize the fusion hindrance in the entrance channel and to reduce the excitation energy of the compound nucleus to a minimum value. For half-lives between roughly two seconds and two minutes no signal for a positive identification of a new isotope of element 107 was detected. Consequently, only an upper cross-section limit of a few nanobarns was obtained. While this cross-section limit was too high to probe the influence of the predicted enhanced nuclear ground-state stability on the survival probability in the fission/evaporation competition, a very large cross-section enhancement would have been detectable. (orig.)

  7. Printed wax masks for 254 nm deep-UV pattering of PMMA-based microfluidics

    International Nuclear Information System (INIS)

    Fan, Yiqiang; Liu, Yang; Li, Huawei; Foulds, Ian G

    2012-01-01

    This paper reports a new technique for masking deep-UV exposure of poly(methyl methacrylate) (PMMA) using a printed wax mask. This technique provides an inexpensive and bulk fabrication method for PMMA structures. The technique involves the direct printing of the mask onto a polymer sheet using a commercial wax printer. The wax layer was then transferred to a PMMA substrate using a thermal laminator, exposed using deep-UV (with a wavelength of 254 nm), developed in an IPA:water solution, and completed by bonding on a PMMA cap layer. A sample microfluidic device fabricated with this method is also presented, with the microchannel as narrow as 50 µm. The whole process is easy to perform without the requirement for any microfabrication facilities. (technical note)

  8. Identification of intermediates, acute toxicity removal, and kinetics investigation to the Ametryn treatment by direct photolysis (UV254), UV254/H2O2, Fenton, and photo-Fenton processes.

    Science.gov (United States)

    de Oliveira, Dirce Martins; Cavalcante, Rodrigo Pereira; da Silva, Lucas de Melo; Sans, Carme; Esplugas, Santiago; de Oliveira, Silvio Cesar; Junior, Amilcar Machulek

    2018-02-09

    This paper reports the degradation of 10 mg L -1 Ametryn solution with different advanced oxidation processes and by ultraviolet (UV 254 ) irradiation alone with the main objective of reducing acute toxicity and increase biodegradability. The investigated factors included Fe 2+ and H 2 O 2 concentrations. The effectiveness of the UV 254 and UV 254 /H 2 O 2 processes were investigated using a low-pressure mercury UV lamp (254 nm). Photo-Fenton process was explored using a blacklight blue lamp (BLB, λ = 365 nm). The UV 254 irradiation process achieved complete degradation of Ametryn solution after 60 min. The degradation time of Ametryn was greatly improved by the addition of H 2 O 2 . It is worth pointing out that a high rate of Ametryn removal was attained even at low concentrations of H 2 O 2 . The kinetic constant of the reaction between Ametryn and HO ● for UV 254 /H 2 O 2 was 3.53 × 10 8  L mol -1  s -1 . The complete Ametryn degradation by the Fenton and photo-Fenton processes was observed following 10 min of reaction for various combinations of Fe 2+ and H 2 O 2 under investigation. Working with the highest concentration (150 mg L -1 H 2 O 2 and 10 mg L -1 Fe 2+ ), around 30 and 70% of TOC removal were reached within 120 min of treatment by Fenton and photo-Fenton processes, respectively. Although it did not obtain complete mineralization, the intermediates formed in the degradation processes were hydroxylated and did not promote acute toxicity of Vibrio fischeri. Furthermore, a substantial improvement of biodegradability was obtained for all studied processes.

  9. Kinetics and mechanism investigation on the destruction of oxytetracycline by UV-254 nm activation of persulfate

    Energy Technology Data Exchange (ETDEWEB)

    Liu, Yiqing [Faculty of Geosciences and Environmental Engineering, Southwest Jiaotong University, Chengdu 611756 (China); Environmental Engineering and Science Program, University of Cincinnati, Cincinnati, OH 45221-0012 (United States); He, Xuexiang [Environmental Engineering and Science Program, University of Cincinnati, Cincinnati, OH 45221-0012 (United States); Fu, Yongsheng [Faculty of Geosciences and Environmental Engineering, Southwest Jiaotong University, Chengdu 611756 (China); Dionysiou, Dionysios D., E-mail: dionysios.d.dionysiou@uc.edu [Environmental Engineering and Science Program, University of Cincinnati, Cincinnati, OH 45221-0012 (United States)

    2016-03-15

    Highlights: • The most effective destruction of OTC by UV/PS was achieved at near neutral pH. • Deprotonated HOTC{sup −} had the highest second-order rate constant with SO{sub 4}·{sup −}. • Presence of HCO{sub 3}{sup −} or Cu{sup 2+} enhanced the removal of OTC in UV/PS system. • Total organic carbon was degraded slowly during the mineralization of OTC. • Studies on the degradation mechanism revealed four different reaction pathways. - Abstract: Oxytetracycline (OTC), an important broad-spectrum antibiotic, has been detected extensively in various environmental systems, which may have a detrimental impact on ecosystem and human health through the development of drug resistant bacteria and pathogens. In this study, the degradation of OTC was evaluated by UV-254 nm activated persulfate (PS). The observed UV fluence based pseudo first-order rate constant (k{sub obs}) was found to be the highest at near neutral pH conditions (pH 5.5–8.5). Presence of various natural water constituents had different effects on OTC degradation, with a significant enhancement in the presence of bicarbonate or Cu{sup 2+}. Limited elimination of total organic carbon (TOC) and PS was observed during the mineralization of OTC. Transformation byproducts in the presence and absence of hydroxyl radical scavenging agent tert-butanol (t-BuOH) were identified using ultra-high definition accurate-mass quadrupole time-of-flight liquid chromatography/mass spectrometer (LC-QTOF/MS). Potential OTC degradation mechanism was subsequently proposed revealing four different reaction pathways by SO{sub 4}·{sup −} reaction including hydroxylation (+16 Da), demethylation (−14 Da), decarbonylation (−28 Da) and dehydration (−18 Da). This study suggests that UV-254 nm/PS is a promising treatment technology for the control of water pollution caused by emerging contaminants such as OTC.

  10. Kinetics and mechanism investigation on the destruction of oxytetracycline by UV-254 nm activation of persulfate

    International Nuclear Information System (INIS)

    Liu, Yiqing; He, Xuexiang; Fu, Yongsheng; Dionysiou, Dionysios D.

    2016-01-01

    Highlights: • The most effective destruction of OTC by UV/PS was achieved at near neutral pH. • Deprotonated HOTC"− had the highest second-order rate constant with SO_4·"−. • Presence of HCO_3"− or Cu"2"+ enhanced the removal of OTC in UV/PS system. • Total organic carbon was degraded slowly during the mineralization of OTC. • Studies on the degradation mechanism revealed four different reaction pathways. - Abstract: Oxytetracycline (OTC), an important broad-spectrum antibiotic, has been detected extensively in various environmental systems, which may have a detrimental impact on ecosystem and human health through the development of drug resistant bacteria and pathogens. In this study, the degradation of OTC was evaluated by UV-254 nm activated persulfate (PS). The observed UV fluence based pseudo first-order rate constant (k_o_b_s) was found to be the highest at near neutral pH conditions (pH 5.5–8.5). Presence of various natural water constituents had different effects on OTC degradation, with a significant enhancement in the presence of bicarbonate or Cu"2"+. Limited elimination of total organic carbon (TOC) and PS was observed during the mineralization of OTC. Transformation byproducts in the presence and absence of hydroxyl radical scavenging agent tert-butanol (t-BuOH) were identified using ultra-high definition accurate-mass quadrupole time-of-flight liquid chromatography/mass spectrometer (LC-QTOF/MS). Potential OTC degradation mechanism was subsequently proposed revealing four different reaction pathways by SO_4·"− reaction including hydroxylation (+16 Da), demethylation (−14 Da), decarbonylation (−28 Da) and dehydration (−18 Da). This study suggests that UV-254 nm/PS is a promising treatment technology for the control of water pollution caused by emerging contaminants such as OTC.

  11. Estimation of organic carbon deposition into forest ecosystems by determination of the spectral absorption of rainwater in range of ultraviolet radiation (SAC254)

    International Nuclear Information System (INIS)

    Bartels, U.

    1988-01-01

    Organic compounds are mostly neglected within deposition measurement programs because their determination is expensive and complicated. A very simple and rapid estimation of total organic carbon (TOC) is possible by determination of the spectral absorption coefficient in the range of ultraviolet radiation at 254 nm wave-length (SAC 254 ): TOC (mg/1) = 0,5 SAC 254 (m −1 ) - 0,15 (author) [de

  12. Clofibric acid degradation in UV254/H2O2 process: effect of temperature.

    Science.gov (United States)

    Li, Wenzhen; Lu, Shuguang; Qiu, Zhaofu; Lin, Kuangfei

    2010-04-15

    The degradation of clofibric acid (CA) in UV(254)/H(2)O(2) process under three temperature ranges, i.e. T1 (9.0-11.5 degrees C), T2 (19.0-21.0 degrees C) and T3 (29.0-30.0 degrees C) was investigated. The effects of solution constituents including NO(3)(-) and HCO(3)(-) anions, and humic acid (HA) on CA degradation were evaluated in Milli-Q waters. CA degradation behaviors were simulated with the pseudo-first-order kinetic model and the apparent rate constant (k(ap)) and half-life time (t(1/2)) were calculated. The results showed that higher temperature would favor CA degradation, and CA degradation was taken place mostly by indirect oxidation through the formation of OH radicals in UV(254)/H(2)O(2) process. In addition, the effects of both NO(3)(-) and HCO(3)(-) anions at two selected concentrations (1.0x10(-3) and 0.1 mol L(-1)) and HA (20 mg L(-1)) on CA degradation were investigated. The results showed that HA had negative effect on CA degradation, and this effect was much more apparent under low temperature condition. On the other hand, the inhibitive effect on CA degradation at both lower and higher concentrations of bicarbonate was observed, and this inhibitive effect was much more apparent at higher bicarbonate concentration and lower temperature condition. While, at higher nitrate concentration the inhibitive effect on CA degradation under three temperature ranges was observed, and with the temperature increase this negative effect was apparently weakened. However, at lower nitrate concentration a slightly positive effect on CA degradation was found under T2 and T3 conditions. Moreover, when using a real wastewater treatment plant (WWTP) effluent spiked with CA over 99% of CA removal could be achieved under 30 degrees C within only 15 min compared with 40 and 80 min under 20 and 10 degrees C respectively, suggesting a significant promotion in CA degradation under higher temperature condition. Therefore, it can be concluded that temperature plays an

  13. 30 CFR 254.26 - What information must I include in the “Worst case discharge scenario” appendix?

    Science.gov (United States)

    2010-07-01

    ... and environmental importance, if any, specified in the appropriate Area Contingency Plan(s). (d) A... COAST LINE Oil-Spill Response Plans for Outer Continental Shelf Facilities § 254.26 What information... Control Systems for Use on Water, and ASTM F818-93, Standard Definitions Relating to Spill Response...

  14. Complete Genome Sequence of Streptomyces albus SM254, a Potent Antagonist of Bat White-Nose Syndrome Pathogen Pseudogymnoascus destructans.

    Science.gov (United States)

    Badalamenti, Jonathan P; Erickson, Joshua D; Salomon, Christine E

    2016-04-14

    We sequenced and annotated the complete 7,170,504-bp genome of a novel secondary metabolite-producingStreptomycesstrain,Streptomyces albusSM254, isolated from copper-rich subsurface fluids at ~220-m depth within the Soudan Iron Mine (Soudan, MN, USA). Copyright © 2016 Badalamenti et al.

  15. Corrective Action Plan for Corrective Action Unit 254: Area 25 R-MAD Decontamination Facility Nevada Test Site, Nevada

    International Nuclear Information System (INIS)

    Obi, C.M.

    2000-01-01

    The Area 25 Reactor Maintenance, Assembly, and Disassembly Decontamination Facility is identified in the Federal Facility Agreement and Consent Order (FFACO) as Corrective Action Unit (CAU) 254. CAU 254 is located in Area 25 of the Nevada Test Site and consists of a single Corrective Action Site CAS 25-23-06. CAU 254 will be closed, in accordance with the FFACO of 1996. CAU 254 was used primarily to perform radiological decontamination and consists of Building 3126, two outdoor decontamination pads, and surrounding soil within an existing perimeter fence. The site was used to decontaminate nuclear rocket test-car hardware and tooling from the early 1960s through the early 1970s, and to decontaminate a military tank in the early 1980s. The site characterization results indicate that, in places, the surficial soil and building materials exceed clean-up criteria for organic compounds, metals, and radionuclides. Closure activities are expected to generate waste streams consisting of nonhazardous construction waste. petroleum hydrocarbon waste, hazardous waste, low-level radioactive waste, and mixed waste. Some of the wastes exceed land disposal restriction limits and will require off-site treatment before disposal. The recommended corrective action was revised to Alternative 3- ''Unrestricted Release Decontamination, Verification Survey, and Dismantle Building 3126,'' in an addendum to the Correction Action Decision Document

  16. 40 CFR 60.254 - Standards for coal processing and conveying equipment, coal storage systems, transfer and loading...

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 6 2010-07-01 2010-07-01 false Standards for coal processing and conveying equipment, coal storage systems, transfer and loading systems, and open storage piles. 60.254... (CONTINUED) STANDARDS OF PERFORMANCE FOR NEW STATIONARY SOURCES Standards of Performance for Coal Preparation...

  17. Nuclear structure data from in beam and decay studies around 254No

    International Nuclear Information System (INIS)

    Jones, P.

    2005-01-01

    The study of trans-fermium nuclei, the heaviest nuclei for which in-beam spectroscopy studies are possible has provided over recent years a rich tapestry of data. These have enhanced the mean field theories important for the prediction of nuclear properties at the limits of the nuclear chart. Developments in spectrometer and data-acquisition techniques at the Department of Physics, University of Jyvaskyla have further enhanced the studies. Utilising the RITU gas-filled spectrometer, the GREAT focal plane spectrometer, the identification recoils and their subsequent decay modes (alpha-, fission-, and gamma-ray decay) have been studied. The JUROGAM gamma-ray array of 43 Compton-suppressed HPGe detectors has been employed in the in-beam spectroscopy of the trans-fermium region. In-beam gamma-ray spectroscopy studies of trans-fermium nuclei 253 No, 254 No, 250 Fm, 251 Md, 253 No and 255 Lr have been performed, as well as detailed focal plane spectroscopy. Selected highlights of the work will be presented

  18. Cold valleys in the radioactive decay of 248-254Cf isotopes

    International Nuclear Information System (INIS)

    Biju, R.K.; Sahadevan, Sabina; Santhosh, K.P.; Joseph, Antony

    2008-01-01

    Based on the concept of cold valley in cold fission and fusion, we have investigated the cluster decay process in 248-254 Cf isotopes. In addition to alpha particle minima, other deep minima occur for S, Ar and Ca clusters. It is found that inclusion of proximity potential does not change the position of minima but minima become deeper. Taking Coulomb and proximity potential as interacting barrier for post-scission region, we computed half-lives and other characteristics for various clusters from these parents. Our study reveals that these parents are stable against light clusters and unstable against heavy clusters. Computed half-lives for alpha decay agree with experimental values within two orders of magnitude. The most probable clusters from these parents are predicted to be 46 Ar, 48,50 Ca which indicate the role of doubly or near doubly magic clusters in cluster radioactivity. Odd A clusters are found to be favorable for emission from odd A parents. Cluster decay model is extended to symmetric region and it is found that symmetric fission is also probable which stresses the role of doubly or near doubly magic 132 Sn nuclei. Geiger-Nuttal plots were studied for various clusters and are found to be linear with varying slopes and intercepts. (author)

  19. A prospective study on time to recovery in 254 injured novice runners.

    Directory of Open Access Journals (Sweden)

    Rasmus Oestergaard Nielsen

    Full Text Available Describe the diagnoses and the time to recovery of running-related injuries in novice runners.Prospective cohort study on injured runners.This paper is a secondary data analysis of a 933-person cohort study (DANO-RUN aimed at characterizing risk factors for injury in novice runners. Among those sustaining running-related injuries, the types of injuries and time to recovery is described in the present paper. All injured runners were diagnosed after a thorough clinical examination and then followed prospectively during their recovery. If they recovered completely from injury, time to recovery of each injury was registered.A total of 254 runners were injured. The proportion of runners diagnosed with medial tibial stress syndrome was 15%, 10% for patellofemoral pain, 9% for medial meniscal injury, 7% for Achilles tendinopathy and 5% for plantar fasciitis. Among the 220 runners (87% recovering from their injury, the median time to recovery was 71 days (minimum  = 9 days, maximum  = 617 days.Medial tibial stress syndrome was the most common injury followed by patellofemoral pain, medial meniscal injury and Achilles tendinopathy. Half of the injured runners were unable to run 2×500 meters without pain after 10 weeks. Almost 5% of the injured runners received surgical treatment.

  20. Critical pitting temperature for Type 254 SMO stainless steel in chloride solutions

    International Nuclear Information System (INIS)

    Abd El Meguid, E.A.; Abd El Latif, A.A.

    2007-01-01

    The variation with time of the open circuit potential of high molybdenum containing stainless steel (Type 254 SMO) was measured in 4% sodium chloride solution in the temperatures range 30-100 deg. C. The plot of steady state potentials as function of temperature showed an inflection at 50 deg. C, attributed to the decrease of oxygen solubility in test solution above 50 deg. C. Potentiodynamic cycling anodic polarization technique was used to determine the critical pitting potential (E pit ) and the critical protection potential (E prot ) of the steel in 4-30% NaCl solutions at temperatures between 30 and 100 deg. C. By plotting the two values versus solution temperature, the corresponding critical pitting (CPT) and the critical protection (CPrT) temperatures were determined. Both parameters decreased with increasing chloride content. Above the CPT, E pit and E prot decreased linearly with log[Cl - ]. The addition of bromide ions to the solution shifted both E pit and E prot towards positive values. In 4% NaCl, E pit increased linearly with pH in the range 1-10. The combined effect of chloride ion concentration and pH on the morphology of the pits was examined by scanning electron microscopy (SEM) following potentiodynamic cycling anodic polarization

  1. Manganese determination om minerals by activation analysis, using the californium-252 as a neutron source; Determinacao de manganes em minerios, por analise por ativacao, usando californio-252 como fonte de neutrons

    Energy Technology Data Exchange (ETDEWEB)

    Cardoso, Antonio

    1976-07-01

    Neutron Activation Analysis, using a Californium-252 neutron source, has been applied for the determination of manganese in ores such as pyrolusite, rodonite (manganese silicate)' and blending used in dry-batteries The favorable nuclear properties of manganese, such as high thermal neutron cross-section for the reaction {sup 55}Mn (n.gamma){sup 56} Mn, high concentration of manganese in the matrix and short half - life of {sup 56}Mn, are an ideal combination for non-destructive analysis of manganese in ores. Samples and standards of manganese dioxide were irradiated for about 20 minutes, followed by a 4 to 15 minutes decay and counted in a single channel pulse-height discrimination using a NaI(Tl) scintillation detector. Counting time was equal to 10 minutes. The interference of nuclear reactions {sup 56}Fe(n,p){sup 56}Mn and {sup 59} Co (n, {alpha}){sup 56} were studied, as well as problems in connection with neutron shadowing during irradiation, gamma-rays attenuation during counting and influence of granulometry of samples. One sample,was also analysed by wet-chemical method (sodium bismuthate) in order to compare results. As a whole, i t was shown that the analytical method of neutron activation for manganese in ores and blending, is a method simple, rapid and with good precision and accuracy. (author)

  2. Design of a homogeneous subcritical nuclear reactor based on thorium with a source of californium 252; Diseno de un reactor nuclear subcritico homogeneo a base de Torio con una fuente de Californio 252

    Energy Technology Data Exchange (ETDEWEB)

    Delgado H, C. E.; Vega C, H. R. [Universidad Autonoma de Zacatecas, Unidad Academica de Estudios Nucleares, Cipres No. 10, Fracc. La Penuela, 98068 Zacatecas, Zac. (Mexico); Sajo B, L., E-mail: ce_delgado89@hotmail.com [Universidad Simon Bolivar, Laboratorio de Fisica Nuclear, Apdo. 89000, 1080A Caracas (Venezuela, Bolivarian Republic of)

    2015-10-15

    Full text: One of the energy alternatives to fossil fuels which do not produce greenhouse gases is the nuclear energy. One of the drawbacks of this alternative is the generation of radioactive wastes of long half-life and its relation to the generation of nuclear materials to produce weapons of mass destruction. An option to these drawbacks of nuclear energy is to use Thorium as part of the nuclear fuel which it becomes in U{sup 233} when capturing neutrons, that is a fissile material. In this paper Monte Carlo methods were used to design a homogeneous subcritical reactor based on thorium. As neutron reflector graphite was used. The reactor core is homogeneous and is formed of 70% light water as moderator, 12% of enriched uranium UO{sub 2}(NO{sub 3}){sub 4} and 18% of thorium Th(NO{sub 3}){sub 4} as fuel. To start the nuclear fission chain reaction an isotopic source of californium 252 was used with an intensity of 4.6 x 10{sup 7} s{sup -1}. In the design the value of the effective multiplication factor, whose value turned out k{sub eff} <1 was calculated. Also, the neutron spectra at different distances from the source and the total fluence were calculated, as well as the values of the ambient dose equivalent in the periphery of the reactor. (Author)

  3. Manganese determination om minerals by activation analysis, using the californium-252 as a neutron source; Determinacao de manganes em minerios, por analise por ativacao, usando californio-252 como fonte de neutrons

    Energy Technology Data Exchange (ETDEWEB)

    Cardoso, Antonio

    1976-07-01

    Neutron Activation Analysis, using a Californium-252 neutron source, has been applied for the determination of manganese in ores such as pyrolusite, rodonite (manganese silicate)' and blending used in dry-batteries The favorable nuclear properties of manganese, such as high thermal neutron cross-section for the reaction {sup 55}Mn (n.gamma){sup 56} Mn, high concentration of manganese in the matrix and short half - life of {sup 56}Mn, are an ideal combination for non-destructive analysis of manganese in ores. Samples and standards of manganese dioxide were irradiated for about 20 minutes, followed by a 4 to 15 minutes decay and counted in a single channel pulse-height discrimination using a NaI(Tl) scintillation detector. Counting time was equal to 10 minutes. The interference of nuclear reactions {sup 56}Fe(n,p){sup 56}Mn and {sup 59} Co (n, {alpha}){sup 56} were studied, as well as problems in connection with neutron shadowing during irradiation, gamma-rays attenuation during counting and influence of granulometry of samples. One sample,was also analysed by wet-chemical method (sodium bismuthate) in order to compare results. As a whole, i t was shown that the analytical method of neutron activation for manganese in ores and blending, is a method simple, rapid and with good precision and accuracy. (author)

  4. 25 CFR 900.254 - May the contractor be reimbursed for actual and reasonable “wind up costs” incurred after the...

    Science.gov (United States)

    2010-04-01

    ... up costs” incurred after the effective date of rescission? Yes. ... 25 Indians 2 2010-04-01 2010-04-01 false May the contractor be reimbursed for actual and reasonable âwind up costsâ incurred after the effective date of rescission? 900.254 Section 900.254 Indians...

  5. 47 CFR 25.254 - Special requirements for ancillary terrestrial components operating in the 1610-1626.5 MHz/2483.5...

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 2 2010-10-01 2010-10-01 false Special requirements for ancillary terrestrial components operating in the 1610-1626.5 MHz/2483.5-2500 MHz bands. 25.254 Section 25.254 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) COMMON CARRIER SERVICES SATELLITE COMMUNICATIONS Technical...

  6. Comparative mutagenesis and interaction between near-ultraviolet (313- to 405-nm) and far-ultraviolet (254-nm) radiation in Escherichia coli strains with differing repair capabilities

    International Nuclear Information System (INIS)

    Turner, M.A.; Webb, R.B.

    1981-01-01

    Comparative mutagenesis and possible synergistic interaction between broad-spectrum (313- to 405-nm) near-ultraviolet (black light bulb [BLB]) radiation and 254-nm radiation were studied in Escherichia coli strains WP2 (wild type), WP2s (uvrA), WP10 (recA), WP6 (polA), WP6s (polA uvrA), WP100 (uvrA recA), and WP5 (lexA). With BLB radiation, strains WP2s and WP6s demonstrated a high level of mutagenesis, whereas strains WP2, WP5, WP6, WP10, and WP100 did not demonstrate significant mutagenesis. In contrast, 254-nm radiation was mutagenic in strains WP2, WP2s, WP6, and WP6s, but strains WP5, WP10, and WP100 were not significantly mutated. The absence of mutagenesis by BLB radiation in lexA and recA strains WP10, WP5, and WP100 suggests that lex + rec + repair may play a major role in mutagenesis by both BLB and 254-nm radiation. The hypothesis that BLB radiation selectively inhibits rec + lex + repair was tested by sequential BLB-254 nm radiation. With strain WP2, a fluence of 30 J/m 2 at 254 nm induced trp + revertants at a frequency of 15 x 10 -6 . However, when 10 5 J/m 2 or more BLB radiation preceded the 254-nm exposure, no trp + revertants could be detected. A similar inhibition of 254-nm mutagenesis was observed with strain WP6 (polA). However, strains WP2s (uvrA) and WP6s (polA uvrA) showed enhanced 254-nm mutagenesis when a prior exposure to BLB radiation was given

  7. c-Abl phosphorylation of Yin Yang 1's conserved tyrosine 254 in the spacer region modulates its transcriptional activity.

    Science.gov (United States)

    Daraiseh, Susan I; Kassardjian, Ari; Alexander, Karen E; Rizkallah, Raed; Hurt, Myra M

    2018-05-25

    Yin Yang 1 (YY1) is a multifunctional transcription factor that can activate or repress transcription depending on the promotor and/or the co-factors recruited. YY1 is phosphorylated in various signaling pathways and is critical for different biological functions including embryogenesis, apoptosis, proliferation, cell-cycle regulation and tumorigenesis. Here we report that YY1 is a substrate for c-Abl kinase phosphorylation at conserved residue Y254 in the spacer region. Pharmacological inhibition of c-Abl kinase by imatinib, nilotinib and GZD824, knock-down of c-Abl using siRNA, and the use of c-Abl kinase-dead drastically reduces tyrosine phosphorylation of YY1. Both radioactive and non-radioactive in vitro kinase assays, as well as co-immunoprecipitation in different cell lines, show that the target of c-Abl phosphorylation is tyrosine residue 254. c-Abl phosphorylation has little effect on YY1 DNA binding ability or cellular localization in asynchronous cells. However, functional studies reveal that c-Abl mediated phosphorylation of YY1 regulates YY1's transcriptional ability in vivo. In conclusion, we demonstrate the novel role of c-Abl kinase in regulation of YY1's transcriptional activity, linking YY1 regulation with c-Abl tyrosine kinase signaling pathways. Copyright © 2018. Published by Elsevier B.V.

  8. Induction of micronuclei by 2-hydroxypyridine in water and elimination of solution genotoxicity by UVC (254 nm) photolysis

    International Nuclear Information System (INIS)

    Skoutelis, Charalambos G.; Vlastos, Dimitris; Kortsinidou, Marianna C.; Theodoridis, Ioannis T.; Papadaki, Maria I.

    2011-01-01

    Highlights: ► 2-Hydroxypyridine (2-HPY) is the major metabolite of 2-halogenated pyridines photolysis. ► We examine the genotoxicity of 2-HPY in cultured human lymphocytes applying the micronucleus assay. ► 2-HPY was found to be genotoxic. ► Aqueous solutions of 2-HPY were irradiated by UV at 254 nm. ► Solution genotoxicity can be completely removed after prolonged phototreatment. - Abstract: 2-Hydroxypyridine (2-HPY) is a major first-stage product formed upon the photolytic destruction of 2-halogenated pyridines. Genotoxicity of 2-HPY in water was studied as a function of concentration. Aqueous solutions of 2-HPY were irradiated by ultraviolet (UV) at 254 nm. 2-HPY concentration, solution total organic carbon (TOC) concentration and solution genotoxicity were measured as a function of treatment time and their profile as a function of time is presented in this work. 2-HPY was found to be genotoxic at all concentrations in the range of 5–400 μg ml −1 . 2-HPY mineralises completely upon prolonged UV irradiation. All untreated and irradiated solution samples, taken at different photo-treatment times, were tested in cultured human lymphocytes applying the cytokinesis block micronucleus (CBMN) assay. The genotoxicity of the solution was reduced near to the control level after prolonged UV irradiation.

  9. Comparative ultraviolet action spectra (254-320 nm) of five wild-type eukaryotic microorganisms and Escherichia coli

    International Nuclear Information System (INIS)

    Calkins, J.; Wheeler, J.S.; Keller, C.I.; Colley, E.; Hazle, J.D.

    1988-01-01

    The action spectra of five eukaryotic organisms and the prokaryote, Escherichia coli, were examined over the wavelength range, 254-320 nm. Both the repair competent and three repair defective strains (E. coli, Caenorhabditis elegans, Saccharomyces) were examined. Tetrahymena pyriformis action spectra were performed with and without the excision repair inhibitor caffeine present. Others have observed that lethality, mutation, and the production of pyrimidine dimers show much the same wavelength dependence as DNA absorption. The results presented here demonstrate several action spectra which deviate from the DNA absorption spectra. Ultraviolet sensitization ratios (repair competent/repair defective) were also examined and were shown to change over the wavelength range. These findings suggest that DNA may not be the only important chromophore leading to cell death in the uv wavelength range studied. Since uv-B is of major importance in solar uv damage, these findings may also yield important implications for solar uv studies

  10. Closure Report for Corrective Action Unit 254: Area 25, R-MAD Decontamination Facility, Nevada Test Site, Nevada

    Energy Technology Data Exchange (ETDEWEB)

    G. N. Doyle

    2002-02-01

    Corrective Action Unit (CAU) 254 is located in Area 25 of the Nevada Test Site (NTS), approximately 100 kilometers (km) (62 miles) northwest of Las Vegas, Nevada. The site is located within the Reactor Maintenance, Assembly and Disassembly (R-MAD) compound and consists of Building 3126, two outdoor decontamination pads, and surrounding areas within an existing fenced area measuring approximately 50 x 37 meters (160 x 120 feet). The site was used from the early 1960s to the early 1970s as part of the Nuclear Rocket Development Station program to decontaminate test-car hardware and tooling. The site was reactivated in the early 1980s to decontaminate a radiologically contaminated military tank. This Closure Report (CR) describes the closure activities performed to allow un-restricted release of the R-MAD Decontamination Facility.

  11. A clinico-radiological study on 254 cases of pontine high signals on magnetic resonance imaging in relation to brain stem semiology

    Energy Technology Data Exchange (ETDEWEB)

    Watanabe, Masaki; Takahashi, Akira (Nagoya Univ. (Japan). Faculty of Medicine); Arahata, Yutaka; Motegi, Yoshimasa; Furuse, Masahiro

    1993-11-01

    A total of 254 patients who were proved to have pontine high intensity areas on T[sub 2]-weighted magnetic resonance imaging (MRI) were analyzed in relation to brain stem semiology. A comparative study on MRI and MR angiography was made between 254 patients with pontine high signals and 276 control cases showing no abnormality either on T[sub 1] or T[sub 2]-weighted images. Of the 254 patients, 62 had transient subjective complaints such as vertigo-dizziness. Supratentorial high signals, basilar artery tortuousness and vertebral artery asymmetry on MR angiography were seen more frequently in patients with pontine high signals than in the controls. In conclusion, pontine high signals may result from diffuse arteriosclerosis and MR angiography is considered to be a useful screening method. (author).

  12. Corrective Action Decision Document for Corrective Action Unit 254: Area 25 R-MAD Decontamination Facility, Nevada Test Site, Nevada

    International Nuclear Information System (INIS)

    2000-01-01

    This Corrective Action Decision Document identifies and rationalizes the US Department of Energy, Nevada Operations Office's selection of a recommended corrective action alternative (CAA) appropriate to facilitate the closure of Corrective Action Unit (CAU) 254, R-MAD Decontamination Facility, under the Federal Facility Agreement and Consent Order. Located in Area 25 at the Nevada Test Site in Nevada, CAU 254 is comprised of Corrective Action Site (CAS) 25-23-06, Decontamination Facility. A corrective action investigation for this CAS as conducted in January 2000 as set forth in the related Corrective Action Investigation Plan. Samples were collected from various media throughout the CAS and sent to an off-site laboratory for analysis. The laboratory results indicated the following: radiation dose rates inside the Decontamination Facility, Building 3126, and in the storage yard exceeded the average general dose rate; scanning and static total surface contamination surveys indicated that portions of the locker and shower room floor, decontamination bay floor, loft floor, east and west decon pads, north and south decontamination bay interior walls, exterior west and south walls, and loft walls were above preliminary action levels (PALs). The investigation-derived contaminants of concern (COCs) included: polychlorinated biphenyls, radionuclides (strontium-90, niobium-94, cesium-137, uranium-234 and -235), total volatile and semivolatile organic compounds, total petroleum hydrocarbons, and total Resource Conservation and Recovery Act (Metals). During the investigation, two corrective action objectives (CAOs) were identified to prevent or mitigate human exposure to COCs. Based on these CAOs, a review of existing data, future use, and current operations at the Nevada Test Site, three CAAs were developed for consideration: Alternative 1 - No Further Action; Alternative 2 - Unrestricted Release Decontamination and Verification Survey; and Alternative 3 - Unrestricted

  13. Preparation and study of elemental californium-249

    International Nuclear Information System (INIS)

    Noe, M.; Peterson, J.R.

    1975-01-01

    Bulk samples of 249 Cf metal were prepared on the 10 μg scale via the Li metal vapor reduction of 249 CfF 3 . Above about 725 0 C elemental Cf exhibits a face-centered cubic (fcc) structure with an average, room-temperature lattice parameter of 5.75(1)A. Between about 600 0 C and 725 0 C, the stable form of Cf metal is another fcc structure with an average, room-temperature lattice parameter of 4.94(1)A. Below 600 0 C metallic Cf exhibits a double hexagonal closest packed (dhcp) structure with average, room temperature lattice parameters of a 0 = 3.39(1)A and c 0 = 11.01(5)A. By comparison of the metallic radii calculated for these three forms with those of the receding transuranium elements, it is suggested that the two, lower temperature modifications represent Cf with a metallic valence of three, while the highest temperature form represents a metallic valence of two. Although the data reported here are from the most complete study to date of elemental Cf, the limitations accompanying such microscale research are duly noted. (U.S.)

  14. Californium Cf-252 for pelvic radiotherapy

    Energy Technology Data Exchange (ETDEWEB)

    Maruyama, Y; Feola, J M; Tai, D; Wilson, L C; Van Nagell, J R; Yoneda, J

    1978-01-01

    Clinical data about therapy concerning tumors of the female gynecological cancers of the cervix, vagina and uterus are reviewed. Dosimetric, laboratory and radiobiological research data form the basis for an approach to such tumors using Cf-252 as a form of boost brachytherapy. Extreme personnel hazards are a real and important consideration and indicate that maximal containment and isolation procedures should be exercised in its use.

  15. International travel in the immunocompromised patient: a cross-sectional survey of travel advice in 254 consecutive patients.

    Science.gov (United States)

    Bialy, C; Horne, K; Dendle, C; Kanellis, J; Littlejohn, G; Ratnam, I; Woolley, I

    2015-06-01

    Our primary aim was to determine the rate of overseas travel in immunocompromised individuals attending appropriate clinics at an Australian tertiary care hospital. We also aimed to characterise health-seeking behaviour prior to travel and investigated sources of pre-travel advice, compared travel patterns and activities between three specific immunosuppressed groups, and examined pre-immunosuppression patient serology. We implemented a cross-sectional survey of patients between February and August 2012. This survey was implemented among three outpatient populations at Monash Medical Centre, an Australian tertiary care hospital. We recruited 254 immunosuppressed adults from three patient populations: human immunodeficiency virus-positive individuals, renal transplant patients and rheumatology patients requiring immunosuppressive therapy. No clinical intervention was performed. In the 10 years preceding the survey, 153 (60.2%) participants reported international travel. Of these, 105 (68.6%) were immunosuppressed at the time of travel. These patients were 47.6% male and 60% Australian born. Forty per cent were visiting friends and relatives as part of their travel. Fifty-four per cent of those immunocompromised at the time of travel were going to high-risk destinations. Pathology files indicated that serological screening was frequently not performed prior to immunosuppression in the renal transplant and rheumatology groups. Immunocompromised patients often travel to high-risk destinations with limited or inadequate pre-travel preparations. Doctors caring for the immunocompromised should be aware of travel risks, suitable vaccination protocols and when to refer to specialist travel clinics. © 2015 Royal Australasian College of Physicians.

  16. Determination of the total mercury in contaminated soils by direct solid sampling atomic absorption spectrometry using an AMA-254 device and radiochemical neutron activation analysis

    Czech Academy of Sciences Publication Activity Database

    Sysalová, J.; Kučera, Jan; Fikrle, Marek; Drtinová, B.

    2013-01-01

    Roč. 110, SEP (2013), s. 691-694 ISSN 0026-265X R&D Projects: GA ČR GAP503/12/0682; GA ČR(CZ) GBP108/12/G108 Institutional support: RVO:61389005 Keywords : Mercury * contaminated soils * AMA-254 * RNAA Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 3.583, year: 2013

  17. 48 CFR 15.403-4 - Requiring certified cost or pricing data (10 U.S.C. 2306a and 41 U.S.C. 254b).

    Science.gov (United States)

    2010-10-01

    ... or pricing data (10 U.S.C. 2306a and 41 U.S.C. 254b). 15.403-4 Section 15.403-4 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION CONTRACTING METHODS AND CONTRACT TYPES CONTRACTING BY NEGOTIATION Contract Pricing 15.403-4 Requiring certified cost or pricing data (10 U.S.C. 2306a and 41 U.S.C...

  18. Study of the average charge states of 188Pb and 252,254No ions at the gas-filled separator TASCA

    International Nuclear Information System (INIS)

    Khuyagbaatar, J.; Ackermann, D.; Andersson, L.-L.; Ballof, J.; Brüchle, W.; Düllmann, Ch.E.; Dvorak, J.; Eberhardt, K.; Even, J.; Gorshkov, A.; Graeger, R.; Heßberger, F.-P.; Hild, D.; Hoischen, R.; Jäger, E.; Kindler, B.

    2012-01-01

    The average charge states of 188 Pb and 252,254 No ions in dilute helium gas were measured at the gas-filled recoil separator TASCA. Hydrogen gas was also used as a filling gas for measurements of the average charge state of 254 No. Helium and hydrogen gases at pressures from 0.2 mbar to 2.0 mbar were used. A strong dependence of the average charge state on the pressure of the filling gases was observed for both, helium and hydrogen. The influence of this dependence, classically attributed to the so-called “density effect”, on the performance of TASCA was investigated. The average charge states of 254 No ions were also measured in mixtures of helium and hydrogen gases at low gas pressures around 1.0 mbar. From the experimental results simple expressions for the prediction of average charge states of heavy ions moving in rarefied helium gas, hydrogen gas, and in their mixture were derived.

  19. Photochemical Degradation of the Anticancer Drug Bortezomib by V-UV/UV (185/254 nm) Investigated by (1)H NMR Fingerprinting: A Way to Follow Aromaticity Evolution.

    Science.gov (United States)

    Martignac, Marion; Balayssac, Stéphane; Gilard, Véronique; Benoit-Marquié, Florence

    2015-06-18

    We have investigated the removal of bortezomib, an anticancer drug prescribed in multiple myeloma, using the photochemical advanced oxidation process of V-UV/UV (185/254 nm). We used two complementary analytical techniques to follow the removal rate of bortezomib. Nuclear magnetic resonance (NMR) is a nonselective method requiring no prior knowledge of the structures of the byproducts and permits us to provide a spectral signature (fingerprinting approach). This untargeted method provides clues to the molecular structure changes and information on the degradation of the parent drug during the irradiation process. This holistic NMR approach could provide information for monitoring aromaticity evolution. We use liquid chromatography, coupled with high-resolution mass spectrometry (LC-MS), to correlate results obtained by (1)H NMR and for accurate identification of the byproducts, in order to understand the mechanistic degradation pathways of bortezomib. The results show that primary byproducts come from photoassisted deboronation of bortezomib at 254 nm. A secondary byproduct of pyrazinecarboxamide was also identified. We obtained a reliable correlation between these two analytical techniques.

  20. Atomic gas temperature in a nonequilibrium high-intensity discharge lamp determined from the red wing of the resonance mercury line 254 nm

    International Nuclear Information System (INIS)

    Drakakis, E.; Karabourniotis, D.

    2012-01-01

    For developing low-wattage high intensity discharge (HID) lamps, a better understanding of the relatively unexplored nonequilibrium phenomena is essential. This needs interpretation of diagnostic results by methods free from equilibrium assumptions. In this paper, the atomic temperature is determined from the simulation of a quasistatic broadened resonance line by distinguishing between atomic temperature and excitation temperature in the equation of radiative transfer. The proposed method is applied to the red wing of the resonance mercury line 254 nm emitted from a HID lamp working on ac. The experimental results show severe deviation from local thermodynamic equilibrium. More than one thousand degrees difference was obtained between atomic and electron temperatures at the maximum current phase.

  1. Atomic gas temperature in a nonequilibrium high-intensity discharge lamp determined from the red wing of the resonance mercury line 254 nm

    Energy Technology Data Exchange (ETDEWEB)

    Drakakis, E. [Technological Educational Institute, Department of Electrical Engineering, 71004 Heraklion (Greece); Karabourniotis, D. [Institute of Plasma Physics, Department of Physics, University of Crete, 71003 Heraklion (Greece)

    2012-09-01

    For developing low-wattage high intensity discharge (HID) lamps, a better understanding of the relatively unexplored nonequilibrium phenomena is essential. This needs interpretation of diagnostic results by methods free from equilibrium assumptions. In this paper, the atomic temperature is determined from the simulation of a quasistatic broadened resonance line by distinguishing between atomic temperature and excitation temperature in the equation of radiative transfer. The proposed method is applied to the red wing of the resonance mercury line 254 nm emitted from a HID lamp working on ac. The experimental results show severe deviation from local thermodynamic equilibrium. More than one thousand degrees difference was obtained between atomic and electron temperatures at the maximum current phase.

  2. ONKALO pose experiment. Geophysical logging and imaging of drillholes ONK-PP223, ONK-PP226, ONK-PP254 and ONK-PP259...261

    International Nuclear Information System (INIS)

    Tarvainen, A.-M.

    2011-08-01

    Suomen Malmi Oy conducted geophysical drillhole logging as well as optical and acoustic imaging of shallow drillholes ONK-PP223, ONK-PP226, ONK-PP254, ONKPP259, ONK-PP260 and ONK-PP261 at ONKALO in the investigation niche ONKTKU- 3 (POSE) between December 2009 and June 2010. The survey is a part of Posiva Oy's detailed investigation program for the final disposal of spent nuclear fuel. The assignment included the field work and data processing. The report describes field operation, equipment as well as processing procedures and shows the obtained results and an analysis of their quality in the appendices. The raw and processed data are delivered digitally in WellCAD, PDF and Excel format. (orig.)

  3. The Effects of Short Wave UV Irradiation (254-366nm on Color Values of Recycled and Bleached ONP/OMP Pulps

    Directory of Open Access Journals (Sweden)

    Emrah Peşman

    2011-04-01

    Full Text Available ABSTRACT As it is known, mechanical pulp papers include significant amount of lignin and carbohydrates as well as cellulose. Thus, when these lignin reach papers irradiated with short wave UV light they could not protect their color. In this study, bleaching of ONP/OMG recycled pulps with hydrogen peroxide, sodium percarbonate, sodium dithyonite, sodium borohydride and formamidin sulfunic acid were performed. Then the test papers of these pulps were irradiated with 254-366nm UV light and changes in the ISO Brightness, CIE L*a*b*, yellowness (YI and whiteness (WI values were observed. At the result of study, all bleaching agents were determined as insufficient in the respect of color stability. But if they compared with each other, the two stages sodium percarbonate-sodium borohydride bleaching sequence was gave the best results against to color reversion. Keywords: Old news/old magazine papers (ONP/OMG, Bleaching, Color Stability, UV Irradiation

  4. Lethal effect of short-wave (254 nm) UV-radiation on cells of Chlamidomonas reinhardii strains with different carotenoid content

    International Nuclear Information System (INIS)

    Kamchatova, I.E.; Chunaev, A.S.; Bronnikov, V.A.

    1987-01-01

    In experiments on related Chlamidomonas reinhardii strains of similar mating type a study was made of sensitivity of cells with different carotenoid content to UV-radiation of 254 nm. Mutants having a lower, as opposed to the wild type strain, content of carotenoids exhibited an increased radiosensitivity. A carotenoid-free mutant was found to possess a higher sensitivity to UV-radiation which was typical of the strain with the impaired excision repair system. The studied subclone of the UV-radiosensitive strain CC-888 was unable to photoreactivate the UV-induced damages which was typical of the wild-type strain. The content of carotenoids in cells of this subnuclone exceeded that in cells of mutants with the reduced pigmentation

  5. Projecto 254 - Produção de suínos ao ar livre : unidade de demonstração Programa AGRO

    OpenAIRE

    Marinho, M.C.; Dias, S.F.; Rodrigues, J.P.V.

    2006-01-01

    A produção de suínos ao ar livre pode contribuir para a preservação e valorização das raças autóctones e dos produtos delas derivados, evitando assim a sua extinção. O projecto, Produção de suínos ao ar livre – Unidade de demonstração, cujo período de execução vai de setembro de 2004 a dezembro de 2006, tem como principal objectivo demonstrar a tecnologia de produção de leitões ao ar livre. Programa AGRO - Projecto 254, Medida 8.1.

  6. Degradation and mineralization of organic UV absorber compound 2-phenylbenzimidazole-5-sulfonic acid (PBSA) using UV-254 nm/H{sub 2}O{sub 2}

    Energy Technology Data Exchange (ETDEWEB)

    Abdelraheem, Wael H.M. [Chemistry Department, Faculty of Science, Sohag University, Sohag 82524 (Egypt); Environmental Engineering and Science Program, University of Cincinnati, Cincinnati, OH 45221-0012 (United States); He, Xuexiang; Duan, Xiaodi [Environmental Engineering and Science Program, University of Cincinnati, Cincinnati, OH 45221-0012 (United States); NIREAS-International Water Research Center, University of Cyprus, Nicosia 1678 (Cyprus); Dionysiou, Dionysios D., E-mail: dionysios.d.dionysiou@uc.edu [Environmental Engineering and Science Program, University of Cincinnati, Cincinnati, OH 45221-0012 (United States); NIREAS-International Water Research Center, University of Cyprus, Nicosia 1678 (Cyprus)

    2015-01-23

    Graphical abstract: - Highlights: • UV-254 nm/H{sub 2}O{sub 2} AOP was utilized for the degradation and mineralization of PBSA and BSA. • Promotion of k{sub obs} with [H{sub 2}O{sub 2}]{sub 0} ≤ 4 mM and inhibition at higher [H{sub 2}O{sub 2}]{sub 0} were observed. • The S and N were released and monitored as SO{sub 4}{sup 2−} and NH{sub 4}{sup +}, respectively. • Br{sup −} inhibited both the degradation and mineralization much more significantly than Cl{sup −}. • There was an increase in [NH{sub 4}{sup +}] at higher [H{sub 2}O{sub 2}]{sub 0} and its further destruction at higher UV fluence. - Abstract: Various studies have revealed the non-biodegradable and endocrine disrupting properties of sulfonated organic UV absorbers, directing people's attention toward their risks on ecological and human health and hence their removal from water. In this study, UV-254 nm/H{sub 2}O{sub 2} advanced oxidation process (AOP) was investigated for degrading a model UV absorber compound 2-phenylbenzimidazole-5-sulfonic acid (PBSA) and a structurally similar compound 1H-benzimidazole-2-sulfonic acid (BSA), with a specific focus on their mineralization. At 4.0 mM [H{sub 2}O{sub 2}]{sub 0}, a complete removal of 40.0 μM parent PBSA and 25% decrease in TOC were achieved with 190 min of UV irradiation; SO{sub 4}{sup 2−} was formed and reached its maximum level while the release of nitrogen as NH{sub 4}{sup +} was much lower (around 50%) at 190 min. Sulfate removal was strongly enhanced by increasing [H{sub 2}O{sub 2}]{sub 0} in the range of 0–4.0 mM, with slight inhibition in 4.0–12.0 mM. Faster and earlier ammonia formation was observed at higher [H{sub 2}O{sub 2}]{sub 0}. The presence of Br{sup −} slowed down the degradation and mineralization of both compounds while a negligible effect on the degradation was observed in the presence of Cl{sup −}. Our study provides important technical and fundamental results on the HO{sup ·} based degradation and

  7. Removal of sulfamethoxazole, ibuprofen and nitrobenzene by UV and UV/chlorine processes: A comparative evaluation of 275 nm LED-UV and 254 nm LP-UV.

    Science.gov (United States)

    Kwon, Minhwan; Yoon, Yeojoon; Kim, Seonbaek; Jung, Youmi; Hwang, Tae-Mun; Kang, Joon-Wun

    2018-05-15

    The aim of this study is to evaluate the micropollutant removal capacity of a 275 nm light-emitting diode (LED)-UV/chlorine system. The sulfamethoxazole, ibuprofen, and nitrobenzene removal efficiencies of this system were compared with those of a conventional 254 nm low-pressure (LP)-UV system as a function of the UV dose. In a direct photolysis system, the photon reactivity of sulfamethoxazole is higher than that of nitrobenzene and ibuprofen at both wavelengths. The molar absorption coefficients and quantum yields of each micropollutant were as follows: sulfamethoxazole (ε SMX, 275 nm protonated  = 17,527 M -1  cm -1 , Φ SMX, 275 nm protonated  = 0.239, ε SMX, 275 nm deprotonated  = 8430 M -1  cm -1 , and Φ SMX, 275 nm deprotonated  = 0.026), nitrobenzene (ε NB, 275 nm  = 7176 M -1  cm -1 and Φ NB, 275 nm  = 0.057), and ibuprofen (ε NB, 275 nm  = 200 M -1  cm -1 and Φ IBF, 275 nm  = 0.067). The photon reactivity of chlorine species, i.e., HOCl and OCl-, were determined at 275 nm (ε HOCl, 275 nm  = 28 M -1  cm -1 , Φ HOCl, 275 nm  = 1.97, ε OCl-, 275 nm  = 245 M -1  cm -1 , and Φ OCl-, 275 nm  = 0.8), which indicate that the decomposition rate of OCl - is higher and that of HOCl is lower by 275 nm photolysis than that by 254 nm photolysis (ε HOCl, 254 nm  = 60 M -1  cm -1 , Φ HOCl, 254 nm  = 1.46, ε OCl-, 254 nm  = 58 M -1  cm -1 , and Φ OCl-, 254 nm  = 1.11). In the UV/chlorine system, the removal rates of ibuprofen and nitrobenzene were increased by the formation of OH and reactive chlorine species. The 275-nm LED-UV/chlorine system has higher radical yields at pH 7 and 8 than the 254 nm LP-UV/chlorine system. Copyright © 2018 Elsevier B.V. All rights reserved.

  8. Damage to uracil- and adenine-containing bases, nucleosides, nucleotides and polynucleotides: quantum yields on irradiation at 193 and 254 nm

    International Nuclear Information System (INIS)

    Gurzadyan, G.G.; Goerner, H.

    1994-01-01

    Photoreactions, such as base release and decomposition of the base moeity, induced by either 20 ns laser pulses at 193 nm or continuous 254 nm irradiation, were studied for a series of uracil and adenine derivatives in neutral aqueous solution. The quantum yield of chromophore loss (Φ cl ) depends significantly on the nature of the nucleic acid constituent and the saturating gas (Ar, N 2 O or O 2 ). In the case of polynucleotides the destruction of nucleotides was measured by high-performance liquid chromatography after hydrolysis; the quantum yields (Φ dn ) are comparable to those of chromophore loss or larger. The Φ cl and Φ dn of 0.04-0.1 for poly(U) and poly(dU), obtained for both wavelengths of irradiation, are due to processes originating from the lowest excited singlet state, i.e. formation of photohydrates and photodimers, and a second part from photoionization using λ irr = 193 nm. Irradiation at 193 nm effectively splits pyrimidine dimers and thus reverts them into monomers. (author)

  9. Photo-removal of sulfamethoxazole (SMX) by photolytic and photocatalytic processes in a batch reactor under UV-C radiation ({lambda}{sub max} = 254 nm)

    Energy Technology Data Exchange (ETDEWEB)

    Nasuhoglu, Deniz; Yargeau, Viviane [Department of Chemical Engineering, McGill University, 3610 University Street, Montreal, Quebec, H3A 2B2 (Canada); Berk, Dimitrios, E-mail: dimitrios.berk@mcgill.ca [Department of Chemical Engineering, McGill University, 3610 University Street, Montreal, Quebec, H3A 2B2 (Canada)

    2011-02-15

    In this study, photolytic and photocatalytic removal of the antibiotic sulfamethoxazole (SMX) under UVC radiation ({lambda} = 254 nm) was investigated. The light intensity distribution inside the batch photoreactor was characterized by azoxybenzene actinometry. The intensity of incident radiation was found to be a strong function of position inside the reactor. 12 mg L{sup -1} of SMX was completely removed within 10 min of irradiation under UVC photolysis, compared to 30 min under TiO{sub 2} photocatalysis. COD measurement was used as an indication of the mineralization efficiency of both processes and higher COD removal with photocatalysis was shown. After 6 h of reaction with photolysis and photocatalysis, 24% and 87% removal of COD was observed, respectively. Two of the intermediate photo-products were identified as sulfanilic acid and 3-amino-5-methylisoxazole by direct comparison of the HPLC chromatograms of standards to those of treated solutions. Ecotoxicity of treated and untreated solutions of SMX towards Daphnia magna was also investigated. It was found that a 3:1 ratio of sample to standard freshwater and a high initial concentration of 60 mg L{sup -1} of SMX were used to obtain reliable and reproducible results. The photo-products formed during photocatalytic and photolytic processes were shown to be generally more toxic than the parent compound.

  10. Low-energy fission systematics of the fermium isotopes: the transition from mass asymmetry at fermium-254 to symmetry at fermium-259

    International Nuclear Information System (INIS)

    Hoffman, D.C.

    1976-01-01

    Recent measurements have shown that 259 Fm gives the highest total kinetic energy release and the most symmetric mass division so far observed for spontaneous fission. These results continue the trends observed previously in the fermium isotopes toward higher total kinetic energies and more symmetric mass division with increasing mass of the fermium isotopes. The transition from asymmetric mass division ( 254 Fm) to highly favored symmetric mass division ( 259 Fm) now appears to have been completed. These features are consistent with the simple postulate that the more neutron-rich fermium isotopes show an increase in the yield of symmetric fragments and in the total kinetic energy because symmetric mass division of fermium (Z = 100) nuclei results in two fragments which have the magic proton number of 50 and are close to the magic neutron number of 82. The proximity of the fragments to the doubly magic configuration seems to have a profound effect on the mass division and total kinetic energy release in fission

  11. Photo-removal of sulfamethoxazole (SMX) by photolytic and photocatalytic processes in a batch reactor under UV-C radiation (λmax = 254 nm)

    International Nuclear Information System (INIS)

    Nasuhoglu, Deniz; Yargeau, Viviane; Berk, Dimitrios

    2011-01-01

    In this study, photolytic and photocatalytic removal of the antibiotic sulfamethoxazole (SMX) under UVC radiation (λ = 254 nm) was investigated. The light intensity distribution inside the batch photoreactor was characterized by azoxybenzene actinometry. The intensity of incident radiation was found to be a strong function of position inside the reactor. 12 mg L -1 of SMX was completely removed within 10 min of irradiation under UVC photolysis, compared to 30 min under TiO 2 photocatalysis. COD measurement was used as an indication of the mineralization efficiency of both processes and higher COD removal with photocatalysis was shown. After 6 h of reaction with photolysis and photocatalysis, 24% and 87% removal of COD was observed, respectively. Two of the intermediate photo-products were identified as sulfanilic acid and 3-amino-5-methylisoxazole by direct comparison of the HPLC chromatograms of standards to those of treated solutions. Ecotoxicity of treated and untreated solutions of SMX towards Daphnia magna was also investigated. It was found that a 3:1 ratio of sample to standard freshwater and a high initial concentration of 60 mg L -1 of SMX were used to obtain reliable and reproducible results. The photo-products formed during photocatalytic and photolytic processes were shown to be generally more toxic than the parent compound.

  12. Effect of Key Parameters on the Photocatalytic Oxidation of Toluene at Low Concentrations in Air under 254 + 185 nm UV Irradiation

    Energy Technology Data Exchange (ETDEWEB)

    Quici, Natalia; Vera, Maria L.; Choi, Hyeok; Puma, Gianluca Li; Dionysiou, Dionysios D.; Litter, Marta I.; Destaillats, Hugo

    2009-07-01

    The effect of key experimental parameters on the removal of toluene under 254 + 185 nm irradiation was investigated using a benchtop photocatalytic flow reactor. Toluenewas introduced at low concentrations between 10 and 500 ppbv, typical of indoorenvironments, and reacted on TiO2-coated Raschig rings. Two different TiO2-coated rings were prepared: in one case, by dip-coating using a P25 aqueous suspension and, on the other, using an organic/inorganic sol-gel method that produced thin films of mesoporous anatase. Flow rates in the photoreactor varied between 4 L min-1 and 125 mL min-1, leading to residence times in the range 100 ms< tau< 2 s. For these conditions, toluene removal efficiencies were between 30 and 90percent, indicating that the system did not achieve total conversion in any case. For each air flow rate, the conversion oftoluene was significantly higher when the reactor length was 10 cm, as compared with 5 cm; however, only marginal increases in conversions were achieved in the two reactor lengths at equal residence time and different concentration of toluene, suggesting that that the reactor is effectively behaving as an ideal reactor and that the reaction is first-order in the concentration of toluene. Experiments were carried out between 0 and 66percent relative humidity (RH), the fastest reaction rate being observed at moderately low humidity conditions (10percent RH), with respect to both dry air and higher humidity levels. Formaldehyde was formed as a partial oxidation byproduct at low and at high residence times (240 and 960 ms), although higher formaldehyde molar yields (up to 20percent) were observed at low tau (240 ms) and moderate humidity conditions (10 and 33percent), suggesting that both tau and RH can be optimized toreduce the formation of harmful intermediates. Toluene removal efficiency increased with the TiO2 thickness (i.e., mass) until a maximum value of 500 nm, beyond which the removal efficiency decreased. This should be

  13. Savannah River Plant californium-252 Shuffler electronics manual

    International Nuclear Information System (INIS)

    Bourret, S.C.; Crane, T.W.; Eccleston, G.W.; Gallegos, E.A.; Garcia, D.L.

    1980-03-01

    Detailed information is presented in this report, an electronics manual for the Savannah River Plant Shuffler, about the electronics associated with the various control and data acquisition functions of the Shuffler subsystems. Circuit diagrams, interconnection information, and details about computer control and programming are included

  14. Survey of potential markets for devices using Californium-252

    International Nuclear Information System (INIS)

    Permar, P.H.

    1975-01-01

    Potential applications for devices or systems containing 252 Cf in the years from 1975 to 1980 are estimated. The estimated number of devices and associated business value were derived from a survey of 46 industrial, educational and governmental organizations conducted from Jan. to May, 1975. Applications for devices and systems based on 252 Cf are expected to increase by a factor of 7 in the 6-y period from 1975 to 1980. The annual business value of 252 Cf devices should increase from 1.5 million dollars in 1975 to 10.8 million dollars in 1980. The potential European market should be several times as large as the US market, based on actual sales of 252 Cf, which have been two to four times greater in Europe than in the US

  15. The protective cell petrus for the production of californium 252

    International Nuclear Information System (INIS)

    Sontag, R.; Berger, R.

    1967-01-01

    The alpha, beta, gamma, neutron cell which is described in the present paper is devoted to the transplutonium element production and study. It is located at the CEN in Fontenay-aux-Roses (France). The 4 feet ordinary concrete shielding made of stacked blocs allows the manipulation of radioactive sources as high as 1000 curies of 1 MeV gamma rays and with a fast neutrons flux of 10 9 n.cm -2 .s -1 . The airtight alpha containment box is equipped with two transfer systems, one consists of a parallelepiped shaped airtight box located in a turntable, the other uses standard cylindrical containers made of polyethylene. The general equipment and the main setting up are also described. (authors) [fr

  16. Automated absolute activation analysis with californium-252 sources

    International Nuclear Information System (INIS)

    MacMurdo, K.W.; Bowman, W.W.

    1978-09-01

    A 100-mg 252 Cf neutron activation analysis facility is used routinely at the Savannah River Laboratory for multielement analysis of many solid and liquid samples. An absolute analysis technique converts counting data directly to elemental concentration without the use of classical comparative standards and flux monitors. With the totally automated pneumatic sample transfer system, cyclic irradiation-decay-count regimes can be pre-selected for up to 40 samples, and samples can be analyzed with the facility unattended. An automatic data control system starts and stops a high-resolution gamma-ray spectrometer and/or a delayed-neutron detector; the system also stores data and controls output modes. Gamma ray data are reduced by three main programs in the IBM 360/195 computer: the 4096-channel spectrum and pertinent experimental timing, counting, and sample data are stored on magnetic tape; the spectrum is then reduced to a list of significant photopeak energies, integrated areas, and their associated statistical errors; and the third program assigns gamma ray photopeaks to the appropriate neutron activation product(s) by comparing photopeak energies to tabulated gamma ray energies. Photopeak areas are then converted to elemental concentration by using experimental timing and sample data, calculated elemental neutron capture rates, absolute detector efficiencies, and absolute spectroscopic decay data. Calculational procedures have been developed so that fissile material can be analyzed by cyclic neutron activation and delayed-neutron counting procedures. These calculations are based on a 6 half-life group model of delayed neutron emission; calculations include corrections for delayed neutron interference from 17 O. Detection sensitivities of 239 Pu were demonstrated with 15-g samples at a throughput of up to 140 per day. Over 40 elements can be detected at the sub-ppM level

  17. Savannah River Plant Californium-252 Shuffler software manual

    International Nuclear Information System (INIS)

    Johnson, S.S.; Crane, T.W.; Eccleston, G.W.

    1979-03-01

    A software manual for operating the Savannah River Plant Shuffler nondestructive assay instrument is presented. The procedures for starting up the instrument, making assays, calibrating, and checking the performance of the hardware units are described. A list of the error messages with an explanation of the circumstances prompting the message and possible corrective measures is given. A summary of the software package is included showing the names and contents of the files and subroutines. The procedure for modifying the software package is outlined

  18. Californium-252 interstitial implants in carcinoma of the tongue

    International Nuclear Information System (INIS)

    Vtyurin, B.M.; Ivanov, V.N.; Medvedev, V.S.; Galantseva, G.F.; Abdulkadyrov, S.A.; Ivanova, L.F.; Petrovskaya, G.A.; Plichko, V.I.

    1985-01-01

    A clinical study using 252 Cf sources in brachytherapy of tumors began in the Research Institute of Medical Radiology of the Academy of Medical Sciences of the USSR in 1973. 252 Cf afterloading cells were utilized by the method of simple afterloading. Dosimetry and radiation protection of medical personnel were developed. To substantiate optimal therapeutic doses of 252 Cf neutrons, a correlation of dose, time, and treatment volume factors with clinical results of 252 Cf interstitial implants in carcinoma of the tongue for 47 patients with a minimum follow-up period of 1 year was studied. Forty-nine interstitial implants have been performed. Seventeen patients received 252 Cf implants alone (Group I), 17 other patients received 252 Cf implants in combination with external radiation (Group II), and 15 patients were treated with interstitial implants for recurrent or residual tumors (Groups III). Complete regression of carcinoma of the tongue was obtained in 48 patients (98%). Thirteen patients (27%) developed radiation necrosis. The therapeutic dose of neutron radiation from 252 Cf sources in interstitial radiotherapy of primary tongue carcinomas (Group I) was found to be 7 to 9 Gy. Optimal therapeutic neutron dose in combined interstitial and external radiotherapy of primary tumors (Group II) was 5 to 6 Gy with an external radiation dose of 40 Gy. For recurrent and residual tumors (Group III), favorable results were obtained with tumor doses of 6.5 to 7 Gy

  19. Undergraduate experiments using the neutron radiation from californium-252

    International Nuclear Information System (INIS)

    Rossel, J.; Golecki, I.

    1976-01-01

    Three experiments designed to demonstrate and measure several properties of the neutron radiation emitted by a 3μg 252 Cf source are described. The experiments constitute a special project carried out by a third-year undergraduate student at the Institute of Physics of the University of Neuchatel. The 252 Cf source is enclosed in a shield which allows a pencil of fast neutrons to pass through a central tube, while reducing the ambient radiation below the tolerance level. The shield consists of layers of borated paraffin wax, iron and cadmium. The first experiment uses an air-alcohol diffusion cloud chamber for the demonstration of tracks of recoil protons produced by the neutrons. Semi-quantitative measurements of track lengths give the correct order of magnitude of the proton energies. In the second experiment a liquid scintillator detector is used to scan the beam profile across the radiation shield enclosing the source. A pulse-shape-discrimination system discriminates between neutrons and gamma photons. The third experiment makes use of the nuclear emulsion technique to study the neutron energy distribution of 252 Cf. Preliminary results are compared with published values. (author)

  20. Synthesis and antimicrobial screening of novel 2-(5-(4-(allyloxy-3-methoxyphenyl-1H-pyrazol-3-ylphenols analogues of 2-(4-(allyloxy-3-methoxyphenyl-4H-chromen-4-ones

    Directory of Open Access Journals (Sweden)

    Asha V. Chate

    2012-01-01

    Full Text Available A series of novel 2-(5-(4-(allyloxy-3-methoxyphenyl-1H-pyrazol-3-ylphenols derivatives have been synthesized via the ring opening of 2-(4-(allyloxy-3-methoxyphenyl-4H-chromen-4-ones in ethanol and hydrazine hydrate under reflux condition. The synthesized compounds were screened for antibacterial and antifungal activity against bacteria Staphylococcus aureus (MRSA E710 and Escherichia coli (ATCC 25922 and fungi Candida albicans and Aspergillus fumigates respectively. Some of the tested compounds showed significant antimicrobial activity. 1H NMR, IR, Mass spectral data and elemental analysis elucidated the structures of the all newly synthesized compounds.

  1. Quantum mechanical and spectroscopic (FT-IR, 13C, 1H NMR and UV) investigations of 2-(5-(4-Chlorophenyl)-3-(pyridin-2-yl)-4,5-dihydropyrazol-1-yl)benzo[d]thiazole by DFT method

    Science.gov (United States)

    Diwaker

    2014-07-01

    The electronic, NMR, vibrational, structural properties of a new pyrazoline derivative: 2-(5-(4-Chlorophenyl)-3-(pyridine-2-yl)-4,5-dihydropyrazol-1-yl)benzo[d]thiazole has been studied using Gaussian 09 software package. Using VEDA 4 program we have reported the PED potential energy distribution of normal mode of vibrations of the title compound. We have also reported the 1H and 13C NMR chemical shifts of the title compound using B3LYP level of theory with 6-311++G(2d,2p) basis set. Using time dependent (TD-DFT) approach electronic properties such as HOMO and LUMO energies, electronic spectrum of the title compound has been studied and reported. NBO analysis and MEP surface mapping has also been calculated and reported using ab initio methods.

  2. Frequency of Tabagism and N34S and P55S Mutations of Serine Peptidase Inhibitor, Kazal Type 1 (SPINK1) and R254W Mutation of Chymotrypsin C (CTRC) in Patients With Chronic Pancreatitis and Controls.

    Science.gov (United States)

    da Costa, Marianges Zadrozny Gouvêa; Pires, Júlia Glória Lucatelli; Nasser, Paulo Dominguez; Ferreira, Camila da Silva; Teixeira, Ana Cristina de Sá; Paranaguá-Vezozzo, Denise Cerqueira; Guarita, Dulce Reis; Carrilho, Flair José; Ono, Suzane Kioko

    2016-10-01

    This study aimed to investigate the association between chronic pancreatitis and smoking or genetic mutations. The study sample comprised 148 patients with chronic pancreatitis, 110 chronic alcoholic subjects without pancreatic disease, and 297 volunteer blood donors. Of the patients with chronic pancreatitis, 74% had alcoholic etiology and 26% had idiopathic pancreatitis. The frequency of smoking was 91.4% in patients with alcoholic pancreatitis, higher than 73.3% in alcoholic subjects without pancreatitis (P pancreatitis and blood donors. The N34S mutation of serine peptidase inhibitor, Kazal type 1 (SPINK1) was found in 2.7% of patients with chronic alcoholic pancreatitis, in 5.3% of patients with idiopathic pancreatitis, and in 0.4% of blood donors (P = 0.02). The P55S mutation of SPINK1 was found in 2.7% of patients with alcoholic pancreatitis and in 0.7% of blood donors (P = 0.12). The R254W mutation of chymotrypsin C was found in 0.9% of patients with alcoholic pancreatitis, in 0.9% of chronic alcoholic subjects without pancreatitis, and in 0.4% of blood donors (P = 0.75). In all cases, the mutations were heterozygous. Smoking and the N34S mutation of SPINK1 were positively correlated with chronic pancreatitis.

  3. 16 CFR 254.1 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... corporate charter to operate or license to do business as a school and should not be used unless the represented “approval” has been affirmatively required or authorized by State or Federal law. (c) Industry...

  4. 30 CFR 254.6 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... dangerous or impossible to respond to a spill. Area Contingency Plan means an Area Contingency Plan prepared... Contingency Plan means the National Oil and Hazardous Substances Pollution Contingency Plan prepared and... Comprehensive Environmental Response Compensation and Liability Act (42 U.S.C. 9605). National Contingency Plan...

  5. Publications | Page 254 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Madagascar, the world's fourth largest island, is home to an astonishing range of life forms found nowhere else on the planet. Much of this biodiversity is highly vulnerable to climate change. So too are ... Blood on the Stone Ian Smillie in his own words. Below, Ian Smillie traces his involvement in the struggle to halt conflict ...

  6. Reference: 254 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available plant cell growth and identify a plant S-acyl transferase, an essential research tool if we are to unders...tand how this important, reversible lipid modification operates in plant cells. The

  7. 36 CFR 254.3 - Requirements.

    Science.gov (United States)

    2010-07-01

    ... of fish and wildlife habitats, cultural resources, watersheds, and wilderness and aesthetic values... use of the conveyed Federal land will not substantially conflict with established management... human health and the environment with respect to any such substances remaining on the property has been...

  8. 36 CFR 254.2 - Definitions.

    Science.gov (United States)

    2010-07-01

    ..., use, physical characteristics, and other amenities. Arbitration is a process to resolve a disagreement... public domain for national forest purposes and the Geothermal Steam Act of 1970 (30 U.S.C. 1001 et seq.... Resource values means any of the various commodity values or non-commodity values, such as wildlife habitat...

  9. 36 CFR 254.9 - Appraisals.

    Science.gov (United States)

    2010-07-01

    ....9 Parks, Forests, and Public Property FOREST SERVICE, DEPARTMENT OF AGRICULTURE LANDOWNERSHIP... contributory value of any interest in land such as water rights, minerals, or timber, to the extent they are... the physical characteristics of the land being appraised; a statement of all encumbrances; title...

  10. Publications | Page 254 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    restricted access). India''s trade policy has seen a marked shift towards regional trade agreements (RTAs). However, results of this survey show that a Generalized Scheme of Preferences (GSP) is a better preference-giving scheme than all of India''s ...

  11. 7 CFR 1944.254 - Program costs.

    Science.gov (United States)

    2010-01-01

    ... Regulations of the Department of Agriculture (Continued) RURAL HOUSING SERVICE, RURAL BUSINESS-COOPERATIVE... supplies (including food) necessary to provide services; (iv) Operational costs of a transportation service... development of the application and plan of operations before the effective date of CHSP grant award; (vi...

  12. Destruction of microcystins (cyanotoxins) by UV-254 nm-based direct photolysis and advanced oxidation processes (AOPs): influence of variable amino acids on the degradation kinetics and reaction mechanisms.

    Science.gov (United States)

    He, Xuexiang; de la Cruz, Armah A; Hiskia, Anastasia; Kaloudis, Triantafyllos; O'Shea, Kevin; Dionysiou, Dionysios D

    2015-05-01

    Hepatotoxic microcystins (MCs) are the most frequently detected group of cyanobacterial toxins. This study investigated the degradation of common MC variants in water, MC-LR, MC-RR, MC-YR and MC-LA, by UV-254 nm-based processes, UV only, UV/H2O2, UV/S2O8(2-) and UV/HSO5(-). Limited direct photolysis of MCs was observed, while the addition of an oxidant significantly improved the degradation efficiency with an order of UV/S2O8(2-) > UV/HSO5(-) > UV/H2O2 at the same initial molar concentration of the oxidant. The removal of MC-LR by UV/H2O2 appeared to be faster than another cyanotoxin, cylindrospermopsin, at either the same initial molar concentration or the same initial organic carbon concentration of the toxin. It suggested a faster reaction of MC-LR with hydroxyl radical, which was further supported by the determined second-order rate constant of MCs with hydroxyl radical. Both isomerization and photohydration byproducts were observed in UV only process for all four MCs; while in UV/H2O2, hydroxylation and diene-Adda double bond cleavage byproducts were detected. The presence of a tyrosine in the structure of MC-YR significantly promoted the formation of monohydroxylation byproduct m/z 1061; while the presence of a second arginine in MC-RR led to the elimination of a guanidine group and the absence of double bond cleavage byproducts. It was therefore demonstrated in this study that the variable amino acids in the structure of MCs influenced not only the degradation kinetics but also the preferable reaction mechanisms. Copyright © 2015 Elsevier Ltd. All rights reserved.

  13. Daniel Gallego Hernández (Ed.). Enfoques actuales en traducción económica e institucional. Actas del Congreso Internacional de Traducción Económica, Comercial, Financiera e Institucional. Suiça: Editorial Peter Lang, 2015. 254 p.

    OpenAIRE

    Miguel Tolosa Igualada

    2016-01-01

    Daniel Gallego-Hernández (ed.). Current Approaches to Business and Institutional Translation. Proceedings of the International Conference on Economic, Business, Financial and Institutional Translation / Enfoques actuales en traducción económica e institucional. Actas del Congreso Internacional de Traducción Económica, Comercial, Financiera e Institucional. Suíça: Peter Lang, 2015, 254 páginas. ISBN 978-3-0343-1656-9.

  14. Daniel Gallego Hernández (Ed.. Enfoques actuales en traducción económica e institucional. Actas del Congreso Internacional de Traducción Económica, Comercial, Financiera e Institucional. Suiça: Editorial Peter Lang, 2015. 254 p.

    Directory of Open Access Journals (Sweden)

    Miguel Tolosa Igualada

    2016-05-01

    Full Text Available http://dx.doi.org/10.5007/2175-7968.2016v36n2p291 Daniel Gallego Hernández (Ed.. Enfoques actuales en traducción económica e institucional. Actas del Congreso Internacional de Traducción Económica, Comercial, Financiera e Institucional. Suiça: Editorial Peter Lang, 2015. 254 p.

  15. Degradation kinetics and mechanism of β-lactam antibiotics by the activation of H{sub 2}O{sub 2} and Na{sub 2}S{sub 2}O{sub 8} under UV-254 nm irradiation

    Energy Technology Data Exchange (ETDEWEB)

    He, Xuexiang [Environmental Engineering and Science Program, University of Cincinnati, Cincinnati, OH 45221-0012 (United States); Department of Civil and Environmental Engineering and Nireas-International Water Research Centre, School of Engineering, University of Cyprus, PO Box 20537, 1678 Nicosia (Cyprus); Mezyk, Stephen P. [Department of Chemistry and Biochemistry, California State University Long Beach, 1250 Bellflower Blvd., Long Beach, CA 90840 (United States); Michael, Irene; Fatta-Kassinos, Despo [Department of Civil and Environmental Engineering and Nireas-International Water Research Centre, School of Engineering, University of Cyprus, PO Box 20537, 1678 Nicosia (Cyprus); Dionysiou, Dionysios D., E-mail: dionysios.d.dionysiou@uc.edu [Environmental Engineering and Science Program, University of Cincinnati, Cincinnati, OH 45221-0012 (United States); Department of Civil and Environmental Engineering and Nireas-International Water Research Centre, School of Engineering, University of Cyprus, PO Box 20537, 1678 Nicosia (Cyprus)

    2014-08-30

    Graphical abstract: - Highlights: • Removal efficiency was comparable at different UV fluence rates but same fluence. • Reducing pH to 3 or 2 did not inhibit the removal of nitrobenzene by UV/S{sub 2}O{sub 8}{sup 2−}. • 1.84 × 10{sup −14} M [HO{sup •} ]{sub ss} and 3.10 × 10{sup −13} M [SO{sub 4}{sup •} {sup −}]{sub ss} in UV/S{sub 2}O{sub 8}{sup 2−} were estimated. • HO{sup •} reacted faster with the β-lactams than SO{sub 4}{sup •} {sup −} but sharing similar byproducts. • Transformation pathways included hydroxylation, hydrolysis and decarboxylation. - Abstract: The extensive production and usage of antibiotics have led to an increasing occurrence of antibiotic residuals in various aquatic compartments, presenting a significant threat to both ecosystem and human health. This study investigated the degradation of selected β-lactam antibiotics (penicillins: ampicillin, penicillin V, and piperacillin; cephalosporin: cephalothin) by UV-254 nm activated H{sub 2}O{sub 2} and S{sub 2}O{sub 8}{sup 2−} photochemical processes. The UV irradiation alone resulted in various degrees of direct photolysis of the antibiotics; while the addition of the oxidants improved significantly the removal efficiency. The steady-state radical concentrations were estimated, revealing a non-negligible contribution of hydroxyl radicals in the UV/S{sub 2}O{sub 8}{sup 2−} system. Mineralization of the β-lactams could be achieved at high UV fluence, with a slow formation of SO{sub 4}{sup 2−} and a much lower elimination of total organic carbon (TOC). The transformation mechanisms were also investigated showing the main reaction pathways of hydroxylation (+16 Da) at the aromatic ring and/or the sulfur atom, hydrolysis (+18 Da) at the β-lactam ring and decarboxylation (–44 Da) for the three penicillins. Oxidation of amine group was also observed for ampicillin. This study suggests that UV/H{sub 2}O{sub 2} and UV/S{sub 2}O{sub 8}{sup 2−} advanced

  16. Degradation kinetics and mechanism of β-lactam antibiotics by the activation of H2O2 and Na2S2O8 under UV-254 nm irradiation

    International Nuclear Information System (INIS)

    He, Xuexiang; Mezyk, Stephen P.; Michael, Irene; Fatta-Kassinos, Despo; Dionysiou, Dionysios D.

    2014-01-01

    Graphical abstract: - Highlights: • Removal efficiency was comparable at different UV fluence rates but same fluence. • Reducing pH to 3 or 2 did not inhibit the removal of nitrobenzene by UV/S 2 O 8 2− . • 1.84 × 10 −14 M [HO • ] ss and 3.10 × 10 −13 M [SO 4 • − ] ss in UV/S 2 O 8 2− were estimated. • HO • reacted faster with the β-lactams than SO 4 • − but sharing similar byproducts. • Transformation pathways included hydroxylation, hydrolysis and decarboxylation. - Abstract: The extensive production and usage of antibiotics have led to an increasing occurrence of antibiotic residuals in various aquatic compartments, presenting a significant threat to both ecosystem and human health. This study investigated the degradation of selected β-lactam antibiotics (penicillins: ampicillin, penicillin V, and piperacillin; cephalosporin: cephalothin) by UV-254 nm activated H 2 O 2 and S 2 O 8 2− photochemical processes. The UV irradiation alone resulted in various degrees of direct photolysis of the antibiotics; while the addition of the oxidants improved significantly the removal efficiency. The steady-state radical concentrations were estimated, revealing a non-negligible contribution of hydroxyl radicals in the UV/S 2 O 8 2− system. Mineralization of the β-lactams could be achieved at high UV fluence, with a slow formation of SO 4 2− and a much lower elimination of total organic carbon (TOC). The transformation mechanisms were also investigated showing the main reaction pathways of hydroxylation (+16 Da) at the aromatic ring and/or the sulfur atom, hydrolysis (+18 Da) at the β-lactam ring and decarboxylation (–44 Da) for the three penicillins. Oxidation of amine group was also observed for ampicillin. This study suggests that UV/H 2 O 2 and UV/S 2 O 8 2− advanced oxidation processes (AOPs) are capable of degrading β-lactam antibiotics decreasing consequently the antibiotic activity of treated waters

  17. The protective cell petrus for the production of californium 252; Cellule blindee petrus pour la production et l'etude du californium 252

    Energy Technology Data Exchange (ETDEWEB)

    Sontag, R; Berger, R [Commissariat a l' Energie Atomique, Fontenay-aux-Roses (France). Centre d' Etudes Nucleaires

    1967-07-01

    The alpha, beta, gamma, neutron cell which is described in the present paper is devoted to the transplutonium element production and study. It is located at the CEN in Fontenay-aux-Roses (France). The 4 feet ordinary concrete shielding made of stacked blocs allows the manipulation of radioactive sources as high as 1000 curies of 1 MeV gamma rays and with a fast neutrons flux of 10{sup 9} n.cm{sup -2}.s{sup -1}. The airtight alpha containment box is equipped with two transfer systems, one consists of a parallelepiped shaped airtight box located in a turntable, the other uses standard cylindrical containers made of polyethylene. The general equipment and the main setting up are also described. (authors) [French] La cellule alpha, beta, gamma, neutron, qui fait l'objet du present article, est destinee a la production et a l'etude des elements transplutoniens. Elle est construite au C.E.N. de Fontenay-aux-Roses (France). La protection biologique, calculee pour une activite de 1000 curies de rayonnement gamma d'energie 1 MeV accompagnee d'un flux de neutrons rapides de 10{sup 9}/cm{sup 2}s, est constituee par des parois en beton de 1,20 m d'epaisseur. L'enceinte alpha est une boite etanche qui comporte devx systemes de transferts: l'un consiste en une boite parallelepipedique etanche logee dans un barillet, l'autre fait appel a des recipients cylindriques standard en polyethylene. L'equipement general et les installations les plus importantes sont ensuite decrits. (auteurs)

  18. Application of fission track detectors to californium-252 neutron dosimetry in tissue near the radiation source

    International Nuclear Information System (INIS)

    Oswald, R.A.; Lanzl, L.H.; Rozenfeld, M.

    1981-01-01

    Fission track detectors were applied to a unique problem in neutron dosimetry. Measurements of neutron doses were required at locations within a tumor of 1 cm diameter implanted on the back of a mouse and surrounded by a square array of four 252 Cf medical sources. Measurements made in a tissue-equivalent mouse phantom showed that the neutron dose rate to the center of the tumor was 2.18 rads mg -1 h -1 +- 8.4%. The spatial variation of neutron dose to the tumor ranged from 1.88 to 2.55 rads mg -1 h -1 . These measurements agree with calculated values of neutron dose to those locations in the phantom. Fission track detectors have been found to be a reliable tool for neutron dosimetry for geometries in which one wishes to know neutron dose values which may vary considerably over distances of 1 cm or less

  19. Application of fission track detectors to californium-252 neutron dosimetry in tissue near the radiation source

    International Nuclear Information System (INIS)

    Oswald, R.A.; Lanzl, L.H.; Rozenfeld, M.

    1981-01-01

    Fission track detectors were applied to a unique problem in neutron dosimetry. Measurements of neutron doses were required at locations within a tumor of 1 cm diameter implanted on the back of a mouse and surrounded by a square array of four 252 Cf medical sources. Measurements made in a tissue-equivalent mouse phantom showed that the neutron dose rate to the center of the tumor was 2.18 rads micrograms-1 h-1 +/- 8.4%. The spatial variation of neutron dose to the tumor ranged from 1.88 to 2.55 rads micrograms-1 h-1. These measurements agree with calculated values of neutron dose to those locations in the phantom. Fission track detectors have been found to be a reliable tool for neutron dosimetry for geometries in which one wishes to know neutron dose values which may vary considerably over distances of 1 cm or less

  20. Neutron Protection Factor Determination and Validation for a Vehicle Surrogate Using a Californium Fission Source

    Science.gov (United States)

    2017-06-01

    study the laws governing shock wave propagation, and evaluate the suitability of military operations after being subjected to their use. During...14]. MCNP6.1 then outputs a dose spectrum, instead of the standard fluence spectrum created from the “ f4 ” tally [14]. In order to produce the dose...manually, an unmodified fluence tally ( f4 ) was exported externally to a spreadsheet. The energy bins were summed and grouped to mimic the energy bin

  1. Californium-252 neutron activation analysis of high-level processed nuclear tank waste

    International Nuclear Information System (INIS)

    Troyer, G.L.; Purcell, M.A.

    2000-01-01

    The basis for production assessment of the vitrification of Hanford nuclear fuel reprocessing wastes will be high-precision measurements of the elemental sodium content. However, the chemical analysis of both radioactive and nonradioactive components in nuclear waste can be challenged by high radiation dose rates. The dose rates compromise many analytical techniques as well as pose personnel dosimetry risks. In many cases, reduction of dose rates through dilution compromises the precision and sensitivity for certain key components. The use of neutron activation analysis (NAA) provides a method of analysis that avoids the need for dilutions or extensive sample preparation. These waste materials also contain trace quantities of fissionable isotopes, which, through neutron activation, can be estimated by delayed neutron counting of fissioned fragments

  2. Multiplicity and correlated energy of gamma rays emitted in the spontaneous fission of Californium-252

    International Nuclear Information System (INIS)

    Brunson, G.S. Jr.

    1982-06-01

    An array of eight high-speed plastic scintillation detectors has been used to infer a mathematical model for the emission multipliciy of prompt gammas in the spontaneous fission of 252 Cf. Exceptional time resolution and coincidence capability permitted the separation of gammas from fast neutrons over a flight path of approximately 10 cm. About 20 different distribution models were tested. The average energy of the prompt gammas is inversely related to the number emitted; however, this inverse relationship is not strong and the total gamma energy does increase with increasing gamma number. An extension of the experiment incorporated a lithium-drifted germanium gamma spectrometer that resolved nearly 100 discrete gammas associated with fission. Of these gammas, some were preferentially associated with fission in which few gammas were emitted. Certain others were more frequent when many gammas were emitted. Results are presented

  3. Use of californium-252 sources in Hungary for teaching and research

    International Nuclear Information System (INIS)

    Csikai, J.

    1976-01-01

    An activation facility was designed to accommodate up to 50 mg of 252 Cf; it contains at present a 500 μg source. The absolute values of thermal, epithermal and fast neutron fluxes were determined by the foil activation method using In, Dy, Au, Al and Fe detectors. Cross-sections averaged for unmoderated 252 Cf neutrons were determined for 22 different reactions for elements with atomic weights lying between A=27 and 204. The sensitivity for determination of Al, Ti, Cu, As, Sr, Mo, In, Cd, Ba, Au, Hg and Pb was calculated for NaI(Tl) and Ge(Li) detectors. Average (n,2n) cross-sections for 252 Cf spectrum were calculated for 49 nuclei lying between A=14 and 204. Angular distributions and cross-sections for the fragments from 252 Cf neutron-induced fission of 232 Th and 238 U were measured. Titanium in bauxite and manganese in aluminium alloys were determined with a 252 Cf source. The applicability of solid-state track detectors for neutron dosimetry, radiography and for the determination of fuel burn-up were investigated using 252 Cf neutron and fragment sources. Characteristics of a jumping spark counter for counting fission fragments were studied with 252 Cf sources. (author)

  4. Chromatographic cation exchange separation of decigram quantities of californium and other transplutonium elements

    Energy Technology Data Exchange (ETDEWEB)

    Benker, D.E.; Chattin, F.R.; Collins, E.D.; Knauer, J.B.; Orr, P.B.; Ross, R.G.; Wiggins, J.T.

    1980-01-01

    Decigram quantities of highly radioactive transplutonium elements are routinely partitioned at TRU by chromatographic elution from cation resin using AHIB eluent. By using two high-pressure ion exchange columns, a small one for the initial loading of the feed and a large one for the elution, batch runs containing up to 200 mg of /sup 252/Cf can be made in about 5 hours (2 hours to load the feed and 3 hours for the elution). The number of effluent product fractions and the amount of actinides that must be collected in intermediate fractions are minimized by monitoring response from a flow-through alpha-detector. This process has been reliable and relatively easy to operate, and will continue to be used for partitioning transplutonium elements at TRU.

  5. Determination of the average number of neutrons per fission event for californium-252

    International Nuclear Information System (INIS)

    Aleksandrov, B.M.; Belov, L.M.; Drapchinskij, L.V.

    1982-01-01

    By means of a separate determination of neutron yields and fission event rates, the value of #betta#-bar( 252 Cf) has been measured for a series of new high-purity sources. The improved quality of the source active layers has reduced the error in determining the fission rate to 0.35%. The value obtained for #betta#-bar( 252 Cf) is 3.747+-0.036. A description is given of the design and the parameters of a spherical manganese bath in which the work on refining the value of #betta#-bar( 252 Cf) will be continued. (author)

  6. Remarkably High Stability of Late Actinide Dioxide Cations: Extending Chemistry to Pentavalent Berkelium and Californium.

    Science.gov (United States)

    Dau, Phuong D; Vasiliu, Monica; Peterson, Kirk A; Dixon, David A; Gibson, John K

    2017-12-06

    Actinyl chemistry is extended beyond Cm to BkO 2 + and CfO 2 + through transfer of an O atom from NO 2 to BkO + or CfO + , establishing a surprisingly high lower limit of 73 kcal mol -1 for the dissociation energies, D[O-(BkO + )] and D[O-(CfO + )]. CCSD(T) computations are in accord with the observed reactions, and characterize the newly observed dioxide ions as linear pentavalent actinyls; these being the first Bk and Cf species with oxidation states above IV. Computations of actinide dioxide cations AnO 2 + for An=Pa to Lr reveal an unexpected minimum for D[O-(CmO + )]. For CmO 2 + , and AnO 2 + beyond EsO 2 + , the most stable structure has side-on bonded η 2 -(O 2 ), as An III peroxides for An=Cm and Lr, and as An II superoxides for An=Fm, Md, and No. It is predicted that the most stable structure of EsO 2 + is linear [O=Es V =O] + , einsteinyl, and that FmO 2 + and MdO 2 + , like CmO 2 + , also have actinyl(V) structures as local energy minima. The results expand actinide oxidation state chemistry, the realm of the distinctive actinyl moiety, and the non-periodic character towards the end of the periodic table. © 2017 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.

  7. Californium-252: isotope for modern radiotherapy of cervix, uterine and vaginal carcinomas

    International Nuclear Information System (INIS)

    Maruyama, J.; Beach, J.L.; Nagell, J.R. van

    1984-01-01

    Cf-252 is an isotope that can easily be afterloaded into available gynecological applicators and used for bulky cervix, uterus or vaginal cancer therapy. It is economical, time and cost effective in use, and can be applied to the therapy of many patients throughout the world. It is more effective for neutron therapy than machine fast neutron therapy and is the only form of neutron therapy producing consistent complication-free 5-year cure of advanced cancers currently available. Cf-252 is an isotope for modern gynecological tumor therapy for the future. Isodose curves for Cf-252 implants revealed dose distributions conforming well to tumor. (orig.) [de

  8. Testing of ENDF/B cross section data in the Californium-252 neutron benchmark field

    International Nuclear Information System (INIS)

    Mannhart, W.

    1979-01-01

    The fission neutron field of 252 Cf presently represents one of the most well-known neutron benchmark fields. For 13 neutron reactions which are of importance in reactor metrology, measurements of spectrum-averaged cross sections, [sigma], performed in this neutron field were compared with calculated average cross sections. This comparison allows one to draw conclusions as to the quality of different sigma(E) data taken from ENDF/B-IV, from ENDF/B-V, and from recent experiments and used in the calculation of average cross sections. The comparison includes an uncertainty analysis regarding the different uncertainty contributions of [sigma], of sigma(E), and of the spectral distribution of 252 Cf fission neutrons. Additionally, in a few examples, sensitivity studies were carried out. The sensitivity of the spectrum-averaged cross sections to individual characteristics of the sigma(E) data, such as normalization factors or shifts in the energy scale, was investigated. Similarly, the sensitivity of [sigma] to the spectral distribution of 252 Cf was determined. 4 figures, 2 tables

  9. Total neutron cross sections of berkelium-249 and californium-249 below 100 eV

    International Nuclear Information System (INIS)

    Benjamin, R.W.; Harvey, J.A.; Hill, N.W.; Pandey, M.S.; Carlton, R.F.

    1979-01-01

    The neutron total cross sections of 249 Bk and 249 Cf have been measured from 0.03 to 100 eV using the Oak Ridge Electron Linear Accelerator (ORELA) as a source of pulsed neutrons. The 1.6 mm dia. cylindrical transmission samples contained initially up to 5.3 mg of 98% 249 Bk and 2% 249 Cf: 4.5 years later, when the final measurements were made, the composition of the samples had become 2.5% 249 Bk, 96.9% 249 Cf, and 0.6% 245 Cm. Samples were cooled with liquid nitrogen to reduce Doppler broadening. Thirty-nine resonances were identified in 249 Bk and analyzed using a single-level Breit-Wigner formalism. Fifty-five resonances were identified in 249 Cf and analyzed using an R-matrix multilevel formalism. Fifty-five resonances were identified in 249 Cf and analyzed using an R-matrix multilevel formalism. The resonance parameters obtained have been used to determine the average level spacings and the s-wave neutron and fission strength functions. Where possible, bound-level parameters were derived to fit the thermal neutron total cross section data

  10. Tritium labelling of two highly selective agonists for CCK-B receptors : [[sup 3]H]propionyl-Tyr(SO[sub 3]Na)-gNle-mGly-Trp-(N-Me)Nle-Asp-Phe-NHsub (2) ([[sup 3]H]pBC 264) [[sup 3]H]propionyl-[gamma]D. Glu-Tyr(SO[sub 3]H)-Nle-D. Lys-Trp-Nle-Asp-Phe-NH[sub 2] ([[sup 3]H]pBC 254). [Cholecystokini-B receptors

    Energy Technology Data Exchange (ETDEWEB)

    Corringer, P J; Durieux, C; Ruiz-Gayo, M; Roques, B P [UA498 CNRS, U266 INSERM, UFR des Sciences Pharmaceutiques et Biologiques, 75 - Paris (France)

    1992-06-01

    Among the CCK-B receptor agonists reported to date, the two modified peptides BC 264 and BC 254 display a high affinity and selectivity for this binding site and are highly protected from enzymatic degradation. Recently, we reported the biological properties of a tritiated analog of this agonist, [[sup 3]H]pBC 264, which fullfils all the criteria required for in vitro as well as in vivo studies of the CCK-B receptor. On the other hand, BC 254 displays a high affinity for the CCK-B binding sites in the guinea-pig (K[sub i] = 0.56 nM) while its affinity in the rat is more than 60-fold lower, a difference which could be due to the occurrence of CCK-B receptor subtypes. In the present paper, we report the synthesis of [[sup 3]H]pBC 264 and of the new tritiated ligand [[sup 3]H]pBC 254 using [[sup 3]H] NPS (N-succinimidyl[2,3-[sup 3]H]propionate) as labelling agent. These two probes have high specific activity (70-100 Ci/mmol) and will enable extensive studies of the CCK-B receptors to be carried out. (author).

  11. Polarimetry of ST LMi (CW1103+254)

    Energy Technology Data Exchange (ETDEWEB)

    Cropper, M

    1986-10-15

    White-light simultaneous photometry and linear and circular polarimetry is presented for the AM Her type variable ST LMi. Linear polarization evident throughout the faint phase is tentatively attributed to electron scattering from gas in the accretion column at heights greater than 5 Rsub(wd) above the surface. The values of inclination and magnetic dipole offset are revised to take into account the height and extent of the cyclotron emission regions which are also determined. A model of two closely connected emitting regions is proposed to account for the asymmetries observed in the light curve and polarization data for this and other AM Her systems. The size of the soft X-ray pole cap is calculated. Various parameters such as masses, accretion rates and luminosities are calculated for the system.

  12. Dicty_cDB: SHL254 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available IXIXIIX*xfyxilk*lviivshs lxpyisxxckgyd*ixxklfitrfmmvvxvhgqinhchlvvrasqvwwcfxsclqcxxcs gkecxiqrllvvfvkrygflkx...iihn**lllh*hnnkliq*lyhh *enqmllkhgwkl*ecv--- ---XLXPVQVXEPNFQMXXFHFXLXLETXFXXDFRRIXIXIIX*xfyxilk*lviivshs lxpyisxxc

  13. 36 CFR 254.20 - Purpose and scope.

    Science.gov (United States)

    2010-07-01

    ..., needed by a community, may be sold under the Townsite Act, for fair market value if those lands would serve indigenous community objectives that outweigh the public objectives and values of retaining the... projects that would change the character of the local community. ...

  14. 16 CFR 254.0 - Scope and application.

    Science.gov (United States)

    2010-01-01

    ..., business, or clerical skills, or that is for the purpose of enabling a person to improve his appearance..., marketing, and sale of courses or programs of instruction offered by private vocational or distance...

  15. All projects related to | Page 254 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    2012-02-10

    related Violence in Mexico. Project. Violent conflict related to drug trafficking in Mexico has had a profound impact on the quality of life and health of affected communities. Start Date: February 10, 2012. End Date: May 10, 2014. Topic: NARCOTICS ...

  16. 7 CFR 1710.254 - Alternative sources of power.

    Science.gov (United States)

    2010-01-01

    ... proposals on an economic, present-value basis, giving consideration to cost-effectiveness, reliability of... reliability problems. (Approved by the Office of Management and Budget under control number 0572-0032) [57 FR...

  17. Dicty_cDB: VFM254 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available (All Frames) Frame A: ---xxxxxxxxxxxxxxxxvxxxxxxxrxxxxxxxxxxxxxxxkvxxxxxkxxfxxvxnx xmvvlxxittfkrnplsi*ssd*ev...vckflskpslvrllhxklkvlitlrmlkpksktkk vfhqinnvsfspvnnwrmvvlslittfkrnplsi*fsd*evvckfl*klslvkplhsklk vvttlrm*kqkfktkkvshq Frame B: ---xxx...xxxxxxxxxxxxwxxxxxxsxgxxxxxxcxxxxxxxxryxxxxxxxxfxw*xix x

  18. 7 CFR 1220.254 - Patents, copyrights, inventions, and publications.

    Science.gov (United States)

    2010-01-01

    ...) AGRICULTURAL MARKETING SERVICE (MARKETING AGREEMENTS AND ORDERS; MISCELLANEOUS COMMODITIES), DEPARTMENT OF..., franchising, or other uses of such patents, copyrights, inventions, or publications, inure to the benefit of...

  19. 40 CFR 180.254 - Carbofuran; tolerances for residues.

    Science.gov (United States)

    2010-07-01

    ...) PESTICIDE PROGRAMS TOLERANCES AND EXEMPTIONS FOR PESTICIDE CHEMICAL RESIDUES IN FOOD Specific Tolerances... than 1 ppm is carbamates) 2 12/31/09 Pumpkin (of which not more than 0.6 ppm is carbamates) 0.8 12/31...

  20. 24 CFR 92.254 - Qualification as affordable housing: Homeownership.

    Science.gov (United States)

    2010-04-01

    ... residents, percentage of owner-occupants) in relation to housing and incomes in the housing market area. An... public facilities and services. If a participating jurisdiction in preparing a neighborhood revitalization strategy under § 91.215(e)(2) of its consolidated plan or Empowerment Zone or Enterprise Community...

  1. 42 CFR 403.254 - Calculation of premiums.

    Science.gov (United States)

    2010-10-01

    ... rate credits. (4) Unearned premium reserve means the portion of gross premiums due that provide for...) Written premiums for the period; plus— (ii) The total premium reserve at the beginning of the period; less— (iii) The total premium reserve at the end of the period. (2) Written premiums in a period means— (i...

  2. 40 CFR 25.4 - Information, notification, and consultation responsibilities.

    Science.gov (United States)

    2010-07-01

    ... participation in all significant decisions covered by § 25.2(a), particularly where alternative courses of... shall highlight significant issues that will be the subject of decision-making. Whenever possible... distribution of information and must occur sufficiently in advance of decision-making to allow the agency to...

  3. 18 CFR 367.2540 - Account 254, Other regulatory liabilities.

    Science.gov (United States)

    2010-04-01

    ... accounts, imposed on the service company by the ratemaking actions of regulatory agencies. (See Definitions § 367.1(a)(38).) (b) The amounts included in this account are to be established by those credits which... authorized to charge for its services; or refunds to customers, not provided for in other accounts, will be...

  4. 42 CFR 422.254 - Submission of bids.

    Science.gov (United States)

    2010-10-01

    ... principles. (i) A qualified actuary must certify the plan's actuarial valuation (which may be prepared by others under his or her direction or review). (ii) To be deemed a qualified actuary, the actuary must be a member of the American Academy of Actuaries. (iii) Applicants may use qualified outside actuaries...

  5. Inverse gamma ray dose rate effect in californium-252 RBE experiment with human T-1 cells irradiated in vitro

    International Nuclear Information System (INIS)

    Todd, P.; Feola, J.M.

    1986-01-01

    Metabolically deoxygenated suspensions of human T-1 cells were used to determine the RBE in hypoxia of low dose rate (LDR) Cf-252 radiation compared to LDR gamma radiation. Based upon the initial portion of the survival curves the RBE was 5.0 ± 1.0 for all components of the Cf-252 radiation and 7.1 ± 1.7 for the neutrons alone. An inverse dose rate effect was observed for LDR gamma radiation in which greater cell sensitivity was observed at lower dose rates and longer irradiation periods. It was demonstrated that there was little or no sublethal damage repair or cell progression during LDR at 21 deg C, and the observed decrease in cell survival probability with increasing irradiation time at a given dose was attributable to reoxygenation of the cell suspensions during the course of LDR exposures. (Auth.)

  6. In situ x-ray fluorescence and californium-252 neutron activation analysis for marine and terrestrial mineral exploration

    International Nuclear Information System (INIS)

    Wogman, N.A.

    1976-12-01

    Instrumentation has been designed for in situ analysis of marine and terrestrial minerals using the techniques of x-ray fluorescence and neutron activation analysis. The energy-dispersive x-ray fluorescence analyzer allows more than 20 elements to be quantitatively measured at the 10 ppM level in water depths to 300 m. The analyzer consists of a solid cryogen-cooled Si(Li) detector, a 50 mCi 109 Cd or 57 Co excitation source, and an analyzer-computer system for data storage and manipulation. The neutron activation analysis, which is designed to measure up to 30 elements at parts per hundred to ppM levels, utilizes the man-made element 252 Cf as its neutron activation source. The resulting radioelements which emit characteristic gamma radiation are then analyzed in situ during 2- to 200-s counting intervals with Ge(Li) or NaI(T1) detector systems. An extension of this latter technique, which uses a 252 Cf- 235 U fueled subcritical multiplier, is also being studied. The subcritical facility allows the neutrons from the 252 Cf source to be multiplied, thus providing greater neutron flux. Details of these in situ analysis systems, actual in situ spectra, and recorded data are discussed with respect to the detection of minerals at their varying concentration levels. The system response of each illustrates its usefulness for various rapid environmental mineral exploration studies. These techniques can be utilized on terrestrial surfaces and marine or fresh water sediments. 5 figures, 2 tables

  7. Csapody, Tamás. 2014. Bortól Szombathelyig - Tanulmányok a bori munkaszolgálatról és a bori munkaszolgálatosok részleges névlistája ('From Bor to Szombathely- Studies on the Forced Labor Service at Bor Camp and the Partial List of the Forced Laborers in Bor'. Budapest: Zrinyi Kadó. 254 pp. ; Csapody, Tamás. 2015. A Cservenkai tömeggyilkosság ('The Mass Murder at Cservenka'. Budapest: Zsidó Tudományok Szabadegyeteme Alapítvány. 150 pp.

    Directory of Open Access Journals (Sweden)

    Julia Bock

    2016-10-01

    Full Text Available Csapody, Tamás. 2014. Bortól Szombathelyig - Tanulmányok a bori munkaszolgálatról és a bori munkaszolgálatosok részleges névlistája ('From Bor to Szombathely- Studies on the Forced Labor Service at Bor Camp and the Partial List of the Forced Laborers in Bor'. Budapest: Zrinyi Kadó. 254 pp. ; Csapody, Tamás. 2015. A Cservenkai tömeggyilkosság ('The Mass Murder at Cservenka'. Budapest: Zsidó Tudományok Szabadegyeteme Alapítvány. 150 pp. (e-book; a shorter version is accessible at: http://zsido.com/konyvek/a-cservenkai-tomeggyilkossag/.

  8. Reactor production of 252Cf and transcurium isotopes

    International Nuclear Information System (INIS)

    Alexander, C.W.; Halperin, J.; Walker, R.L.; Bigelow, J.E.

    1990-01-01

    Berkelium, californium, einsteinium, and fermium are currently produced in the High Flux Isotope Reactor (HFIR) and recovered in the Radiochemical Engineering Development Center (REDC) at the Oak Ridge National Laboratory (ORNL). All the isotopes are used for research. In addition, 252 Cf, 253 Es, and 255 Fm have been considered or are used for industrial or medical applications. ORNL is the sole producer of these transcurium isotopes in the western world. A wide range of actinide samples were irradiated in special test assemblies at the Fast Flux Test Facility (FFTF) at Hanford, Washington. The purpose of the experiments was to evaluate the usefulness of the two-group flux model for transmutations in the special assemblies with an eventual goal of determining the feasibility of producing macro amounts of transcurium isotopes in the FFTF. Preliminary results from the production of 254g Es from 252 Cf will be discussed. 14 refs., 5 tabs

  9. [An improved method of preparing protein and peptide probes in mass spectrometry with ionization of division fragments by californium-252 (TOF-PDMS)].

    Science.gov (United States)

    Chivanov, V D; Zubarev, R A; Aksenov, S A; Bordunova, O G; Eremenko, V I; Kabanets, V M; Tatarinova, V I; Mishnev, A K; Kuraev, V V; Knysh, A N; Eremenko, I A

    1996-08-01

    The addition of organic acids (picric, oxalic, citric, or tartaric) to peptide and protein samples was found to significantly increase the yield of their quasi-molecular ions (QMI) in time-of-flight 252Cf plasma desorption mass spectrometry. The yield of the ions depended on the pKa of the acid added.

  10. The development and medical applications of a simple facility for partial body in vivo neutron activation analysis using californium-252 sources

    International Nuclear Information System (INIS)

    Boddy, K.

    1978-11-01

    A simple and cheap facility for partial body neutron activation analysis has been designed, based on the use of two 100 μg 252 Cf neutron sources. The results reported show that calcium can be measured in parts of the body such as the tibia with a precision as good as +- 1.6 % for a radiation dose of 2 rem. The uniformity of the thermal neutron flux density is better than +- 3 % over 10 cm. Some applications of this irradiation facility for studies of trace elements, in particular cadmium in liver and aluminium in liver or brain, have also been explored. However, the sensitivity attainable is not yet sufficient for the study of normal levels, but could be of interest in toxicological investigations

  11. Radiological Characterization Technical Report on Californium-252 Sealed Source Transuranic Debris Waste for the Off-Site Source Recovery Project at Los Alamos National Laboratory

    Energy Technology Data Exchange (ETDEWEB)

    Feldman, Alexander [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2014-04-24

    This document describes the development and approach for the radiological characterization of Cf-252 sealed sources for shipment to the Waste Isolation Pilot Plant. The report combines information on the nuclear material content of each individual source (mass or activity and date of manufacture) with information and data on the radionuclide distributions within the originating nuclear material. This approach allows for complete and accurate characterization of the waste container without the need to take additional measurements. The radionuclide uncertainties, developed from acceptable knowledge (AK) information regarding the source material, are applied to the summed activities in the drum. The AK information used in the characterization of Cf-252 sealed sources has been qualified by the peer review process, which has been reviewed and accepted by the Environmental Protection Agency.

  12. Calculation of neutron and gamma-ray energy spectra in liquid air and liquid nitrogen due to 14-MeV neutron and californium-252 sources

    International Nuclear Information System (INIS)

    Straker, E.A.; Gritzner, M.L.; Harris, L. Jr.

    1978-01-01

    Calculations of neutron and gamma-ray fluences from 14-MeV neutron and 252 Cf sources in liquid air and liquid nitrogen have been performed. These calculations were made specifically for comparison with experimental data measured at Stohl, Federal Republic of Germany. The discrete-ordinates method was utilized with neutron and gamma-ray cross sections from ENDF/B-IV. One-dimensional calculational models were developed for the sources and tank. Limited comparisons are made with experimental data

  13. Measurement and model description of differential neutron spectra of the californium 252 spontaneous fission depending on THETA, Msub(T), Esub(kin sum)

    International Nuclear Information System (INIS)

    Vasil'ev, Yu.A.; Sidorov, L.V.; Vasil'eva, N.K.; Barashkov, Yu.A.; Golovanov, O.A.; Kopalkin, N.V.; Nemudrov, N.I.; Surin, V.M.; Khachaturov, Yu.F.

    1984-01-01

    The results of the 4π-spectrometer mesurement of the neutron spectra in the 26-154 deg angle range for seven groups of fragments with different masses and total kinetic energies are given. Experimental spectra have been analyzed for consistency with the evaporation model of neutrons from moving fragments. The results of an analysis of differential neutron spectra shows that the main reason of the ''yearly'' neutron emission is a neutron evaporation from fragments with large excitation energy and from fragments with neutron number N>82 during the time as compared with the time of fragment acceleration

  14. Efficacy of brachytherapy with californium-252 neutrons versus cesium-137 photons for eradication of bulky localized cervical cancer: single-institution study

    International Nuclear Information System (INIS)

    Maruyama, Y.; van Nagell, J.R.; Yoneda, J.; Donaldson, E.; Gallion, H.; Higgins, R.; Powell, D.; Turner, C.; Kryscio, R.

    1988-01-01

    A fast-neutron-emitting radioisotope, 252 Cf, is being tested in clinical trials of neutron brachytherapy for cervical cancer. The efficacy for histological eradication of bulky stage IB cervical tumors (mean diameter, approximately 6 cm) using combined radiation and surgery was studied in 65 patients treated with 137 Cs or 252 Cf before surgery during 1983-1986. Forty-four patients were treated with 137 Cs and 21 were treated with 252 Cf at equivalent doses of radiation. Fifteen of the 44 specimens (34%) were positive after 137Cs therapy. Only one of the 21 specimens was positive after 252 Cf therapy (P = .025), and that patient was treated in a delayed schedule 21 days after the start of external-beam irradiation rather than early in the course. 252 Cf therapy required a much lower radiation dose and shorter treatment time. The study compared tumor destruction of an identically staged human cervical tumor in situ by direct histological means, using 252 Cf neutron therapy or conventional photon therapy at an identical and equivalent dose adjusted by a relative biological effectiveness of 6.0 for 252 Cf

  15. Accurate determination of Curium and Californium isotopic ratios by inductively coupled plasma quadrupole mass spectrometry (ICP-QMS) in 248Cm samples for transmutation studies

    Energy Technology Data Exchange (ETDEWEB)

    Gourgiotis, A.; Isnard, H.; Aubert, M.; Dupont, E.; AlMahamid, I.; Cassette, P.; Panebianco, S.; Letourneau, A.; Chartier, F.; Tian, G.; Rao, L.; Lukens, W.

    2011-02-01

    The French Atomic Energy Commission has carried out several experiments including the mini-INCA (INcineration of Actinides) project for the study of minor-actinide transmutation processes in high intensity thermal neutron fluxes, in view of proposing solutions to reduce the radiotoxicity of long-lived nuclear wastes. In this context, a Cm sample enriched in {sup 248}Cm ({approx}97 %) was irradiated in thermal neutron flux at the High Flux Reactor (HFR) of the Laue-Langevin Institute (ILL). This work describes a quadrupole ICP-MS (ICP-QMS) analytical procedure for precise and accurate isotopic composition determination of Cm before sample irradiation and of Cm and Cf after sample irradiation. The factors that affect the accuracy and reproducibility of isotopic ratio measurements by ICP-QMS, such as peak centre correction, detector dead time, mass bias, abundance sensitivity and hydrides formation, instrumental background, and memory blank were carefully evaluated and corrected. Uncertainties of the isotopic ratios, taking into account internal precision of isotope ratio measurements, peak tailing, and hydrides formations ranged from 0.3% to 1.3%. This uncertainties range is quite acceptable for the nuclear data to be used in transmutation studies.

  16. People and things. CERN Courier, May 1985, v. 25(4)

    Energy Technology Data Exchange (ETDEWEB)

    Anon.

    1985-05-15

    The article reports on achievements of various people, staff changes and position opportunities within the CERN organization and contains news updates on upcoming or past events. A workshop is being arranged to discuss the potential of the CERN SPS proton-antiproton Collider for the early 90s in view of the then simultaneous operation of the Tevatron at Fermilab, LEP at CERN and HERA at DESY, and to evaluate the need for a new Collider detector.

  17. Spectroscopy of odd-proton nuclei in the region of 254No

    International Nuclear Information System (INIS)

    Ketelhut, S.; Greenlees, P. T.; Eeckhaudt, S.; Jones, P.; Julin, R.; Juutinen, S.; Kettunen, H.; Leino, M.; Leppaenen, A.-P.; Nieminen, P.; Nyman, M.; Perkowski, J.; Rahkila, P.; Saren, J.; Scholey, C.; Uusitalo, J.; Chatillon, A.; Bouchez, E.; Clement, E.; Goergen, A.

    2008-01-01

    Two rotational bands have been found in the transfermium nuclei 251 Md and 255 Lr, the latter being the heaviest nucleus so far studied in-beam. Both are assigned to a [521]1/2 - Nilsson state by comparison to theory. The experiments have been carried out in the Accelerator Laboratory of the University of Jyvaeskylae (JYFL), where the array of germanium detectors JUROGAM was used in conjunction with the recoil-seperator RITU and the focal-plane setup GREAT for gamma-spectroscopic studies

  18. Feasibility and desirability of employing the thorium fuel cycle for power generation - 254

    International Nuclear Information System (INIS)

    Sehgal, B.R.

    2010-01-01

    Thorium fuel cycle for nuclear power generation has been considered since the very start of the nuclear power era. In spite of a very large amount of research, experimentation, pilot scale and prototypic scale installations, the thorium fuel was not adopted for large scale power generation [1,2]. This paper reviews the developments over the years on the front and the back-end of the thorium fuel cycle and describes the pros and cons of employing the thorium fuel cycle for large generation of nuclear power. It examines the feasibility and desirability of employing the thorium fuel cycle in concert with the uranium fuel cycle for power generation. (authors)

  19. Printed wax masks for 254 nm deep-UV pattering of PMMA-based microfluidics

    KAUST Repository

    Fan, Yiqiang; Liu, Yang; Li, Huawei; Foulds, Ian G.

    2012-01-01

    This paper reports a new technique for masking deep-UV exposure of poly(methyl methacrylate) (PMMA) using a printed wax mask. This technique provides an inexpensive and bulk fabrication method for PMMA structures. The technique involves the direct

  20. S. Afr. J. Anim. Sci. I I , 247- 254 ( I 981 ) PRACTICAL ...

    African Journals Online (AJOL)

    In the case of sheep the treatment of OF-collected samples (total extrusa vs. solid frac- tion) had a significant ... of laboratory drying equipment, is discussed. Oesophageally ..... Chemistry of browning reactions in model system. J. Agric. Food ...

  1. SSC 254 Screen-Based Word Processors: Production Tests. The Lanier Word Processor.

    Science.gov (United States)

    Moyer, Ruth A.

    Designed for use in Trident Technical College's Secretarial Lab, this series of 12 production tests focuses on the use of the Lanier Word Processor for a variety of tasks. In tests 1 and 2, students are required to type and print out letters. Tests 3 through 8 require students to reformat a text; make corrections on a letter; divide and combine…

  2. 16 CFR 254.3 - Misrepresentation of extent or nature of accreditation or approval.

    Science.gov (United States)

    2010-01-01

    ...) Misrepresent that students successfully completing a course or program of instruction can transfer the credit... subject of unsolicited testimonials or endorsements from former students. It is deceptive for an industry member to use testimonials or endorsements that do not accurately reflect current practices of the school...

  3. 40 CFR 421.254 - Standards of performance for new sources.

    Science.gov (United States)

    2010-07-01

    ... property Maximum for any 1 day Maximum for monthly average mg/troy ounce of gold and silver smelted Lead 0... Pollutant or pollutant property Maximum for any 1 day Maximum for monthly average mg/troy ounce of silver... average mg/troy ounce of gold refined electrolytically Lead 5.544 2.574 Mercury 2.970 1.188 Silver 5.742 2...

  4. 30 CFR 254.7 - How do I submit my response plan to the MMS?

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false How do I submit my response plan to the MMS... do I submit my response plan to the MMS? You must submit the number of copies of your response plan that the appropriate MMS regional office requires. If you prefer to use improved information technology...

  5. 30 CFR 254.47 - Determining the volume of oil of your worst case discharge scenario.

    Science.gov (United States)

    2010-07-01

    ... break. You must calculate this volume as follows: (1) Add the pipeline system leak detection time to the... the total volume of oil that would leak from the pipeline after it is shut in. Calculate this volume... lines on the facility. Flow line volume may be estimated; and (2) The volume of oil calculated to leak...

  6. Textural parameters distribution in sediments surface of the Uruguay river background between km 221 and 254

    International Nuclear Information System (INIS)

    Capeluto, W.; Campos, T. de los

    2010-01-01

    The aim of this paper is to analyze the distribution of textural statistical parameters and spatial variation in the morphology of the sediment areas. The geology of the area comprises alluvial and alluvial deposits of variable thicknesses overlying deposits of Fray Bent os, Salto and Guichon formations that occasionally emerge in the river bed

  7. 40 CFR 98.254 - Monitoring and QA/QC requirements.

    Science.gov (United States)

    2010-07-01

    ...) Standard Test Method for Heat of Combustion of Liquid Hydrocarbon Fuels by Bomb Calorimeter (incorporated... methods. (1) ASTM D4809-06 Standard Test Method for Heat of Combustion of Liquid Hydrocarbon Fuels by Bomb...) Method 18 at 40 CFR part 60, appendix A-6. (2) ASTM D1945-03 Standard Test Method for Analysis of Natural...

  8. 30 CFR 254.42 - Exercises for your response personnel and equipment.

    Science.gov (United States)

    2010-07-01

    ..., communication, and decisionmaking in managing a response. You must not reveal the spill scenario to team members... the complete 3-year exercise cycle. Records should be maintained at the facility or at a corporate...

  9. TASK 2.5.4 DEVELOPMENT OF AN ENERGY SAVINGS CALCULATOR

    Energy Technology Data Exchange (ETDEWEB)

    Miller, William A [ORNL; New, Joshua Ryan [ORNL; Desjarlais, Andre Omer [ORNL; Huang, Joe [Lawrence Berkeley National Laboratory (LBNL); Erdem, Ender [Lawrence Berkeley National Laboratory (LBNL); Ronnen, Levinson [Lawrence Berkeley National Laboratory (LBNL)

    2010-03-01

    California s major energy utilities and the California Energy Commission (CEC) are seeking to allocate capital that yields the greatest return on investment for energy infrastructure that meets any part of the need for reliable supplies of energy. The utilities are keenly interested in knowing the amount of electrical energy savings that would occur if cool roof color materials are adopted in the building market. To meet this need the Oak Ridge National Laboratory and the Lawrence Berkeley National Laboratory (LBNL) have been collaborating on a Public Interest Energy Research (PIER) project to develop an industry-consensus energy-savings calculator. The task was coordinated with an ongoing effort supported by the DOE to develop one calculator to achieve both the DOE and the EPA objectives for deployment of cool roof products. Recent emphasis on domestic building energy use has made the work a top priority by the Department of Energy s (DOE) Building Technologies Program. The Roof Savings Calculator (RSC) tool is designed to help building owners, manufacturers, distributors, contractors and practitioners easily run complex simulations. The latest web technologies and usability design were employed to provide an easy input interface to an annual simulation of hour-by-hour, whole-building performance using the world-class simulation tools DOE-2.1E and AtticSim. Building defaults were assigned based on the best available statistical evidence and can provide energy and cost savings after the user selects nothing more than the building location. A key goal for the tool is to promote the energy benefits of cool color tile, metal and asphalt shingle roof products and other energy saving systems. The RSC tool focuses on applications for the roof and attic; however, the code conducts a whole building simulation that puts the energy and heat flows of the roof and attic into the perspective of the whole house. An annual simulation runs in about 30 sec. In addition to cool reflective roofs, the RSC tool will simulate high- medium- and low-slope roofs, and has a custom selection for the user whose house has a unique inclination. There is an option for above sheathing ventilation, which is prevalent in tile and stone-coated metal roof assemblies. The tool also accommodates the effects of radiant barriers and low-emittance surfaces in the inclined air space above the sheathing. The practitioner can select to have air-conditioning ducts either in the conditioned space or in the attic. If in the attic, the user can select one of three air leakage options. Option 1 is an inspected duct having 4% leakage and code level of duct insulation; option 2 is a poorly insulated duct having 14% air leakage; and option 3 is a custom leakage rate specified by the user. The practitioner can setup multiple layers of ceiling insulation. AtticSim is benchmarked against the field data acquired for Ft. Irwin located near Barstow, CA, first as a standalone simulation program and then again integrated within the DOE-2.1E program. The standalone benchmark was very useful to determining how well AtticSim replicates the building physics of an attic. The coupled benchmark was useful to verify that the DOE-2.1E/AtticSim code is modeling correctly the dynamic relationship between the attic and the occupied space below, as well as the interactions between the attic and the HVAC system, in particular when the ducts are located in the attic.

  10. 50 CFR 14.254 - What are the requirements contained in these regulations?

    Science.gov (United States)

    2010-10-01

    ... IMPORTATION OF WILDLIFE AND PLANTS IMPORTATION, EXPORTATION, AND TRANSPORTATION OF WILDLIFE Captive Wildlife... exemption in § 14.255, an accredited wildlife sanctuary must maintain complete and accurate records of any..., sold, or otherwise transferred; and the dates of these transactions. The accredited wildlife sanctuary...

  11. : tous les projets | Page 254 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    La production de petits mils, en dépit des vertus nutritionnelles de cette céréale, de sa capacité de croître dans des conditions difficiles et de sa facilité de stockage, a toujours été négligée par les politiques agricoles déployées en Asie du Sud. Ces dernières, en effet, ont privilégié les cultures de rente et les céréales comme ...

  12. SU-E-J-254: Utility of Pinnacle Dynamic Planning Module Utilizing Deformable Image Registration in Adaptive Radiotherapy

    International Nuclear Information System (INIS)

    Jani, S

    2014-01-01

    Purpose For certain highly conformal treatment techniques, changes in patient anatomy due to weight loss and/or tumor shrinkage can result in significant changes in dose distribution. Recently, the Pinnacle treatment planning system added a Dynamic Planning module utilizing Deformable Image Registration (DIR). The objective of this study was to evaluate the effectiveness of this software in adapting to altered anatomy and adjusting treatment plans to account for it. Methods We simulated significant tumor response by changing patient thickness and altered chin positions using a commercially-available head and neck (H and N) phantom. In addition, we studied 23 CT image sets of fifteen (15) patients with H and N tumors and eight (8) patients with prostate cancer. In each case, we applied deformable image registration through Dynamic Planning module of our Pinnacle Treatment Planning System. The dose distribution of the original CT image set was compared to the newly computed dose without altering any treatment parameter. Result was a dose if we did not adjust the plan to reflect anatomical changes. Results For the H and N phantom, a tumor response of up to 3.5 cm was correctly deformed by the Pinnacle Dynamic module. Recomputed isodose contours on new anatomies were within 1 mm of the expected distribution. The Pinnacle system configuration allowed dose computations resulting from original plans on new anatomies without leaving the planning system. Original and new doses were available side-by-side with both CT image sets. Based on DIR, about 75% of H and N patients (11/15) required a re-plan using new anatomy. Among prostate patients, the DIR predicted near-correct bladder volume in 62% of the patients (5/8). Conclusions The Dynamic Planning module of the Pinnacle system proved to be an accurate and useful tool in our ability to adapt to changes in patient anatomy during a course of radiotherapy

  13. 30 CFR 254.23 - What information must I include in the “Emergency response action plan” section?

    Science.gov (United States)

    2010-07-01

    ... response operations on your behalf. You must describe the team's organizational structure as well as the... include the number and types of personnel available from each identified labor source. (d) A planned... primary and secondary radio frequencies that will be used. (e) A listing of the types and characteristics...

  14. Final Environmental Assessment for the Closure of the Garland ANG Station 254th Combat Communications Group Garland, Texas

    Science.gov (United States)

    2009-07-01

    Rec~ td <if J)ecision (ROD) Final step:in the EIS process. It iS a concise_ public doctunent that sets fNth the.decisioll, identifies the...associated with a site to cnsme Lh<lt 1 111 111 I ui p11i li!l\\’.111 d u lliJ ’·’·’IJI d.u llJ lll iutlut.lL iLtluu li ll ~~.•udu lLJ u JJJLLJ JuguJ i11 u

  15. No 2965, No 254. Report on new energy technologies and carbon dioxide sequestration: scientifical and technical aspects

    International Nuclear Information System (INIS)

    Bataille, Ch.; Birraux, C.

    2006-03-01

    The abatement of CO 2 emissions is a huge technical and economical challenge. Fossil fuels, which represent 88% of the world primary energy consumption, are the main source of the 25 billions of CO 2 released each year in the atmosphere. The mastery of CO 2 emissions cannot come from a single technology but must result from the simultaneous implementation of several means, like the development of carbon-free energies and the mastery of fossil fuel emissions. The opportunities of progress are numerous and compatible with the economic development. This document presents, first, the different greenhouse gases, the CO 2 emissions per country and the main sources of CO 2 emissions (power and heat generation, transports). Then it presents different ways of abatement of CO 2 emissions: clean coal technologies, gas combined cycles, CO 2 sequestration, reduction of fuel consumption in transports, development of carbon-free energies: wind power, solar photovoltaic for decentralized power generation, nuclear energy for a competitive power generation and for CO 2 abatement, biofuels of 2. generation and fuel cells. The conclusion stresses on the investments needed for the renewal and increase of energy capacities, and on the necessary visibility and moderation of emission abatement mechanisms (carbon trading and CO 2 prices). (J.S.)

  16. 75 FR 21299 - Determination of Regulatory Review Period for Purposes of Patent Extension; VIMPAT-NDA 22-254

    Science.gov (United States)

    2010-04-23

    ... additive, or color additive) was subject to regulatory review by FDA before the item was marketed. Under...). VIMPAT injection is indicated as adjunctive therapy in the treatment of partial-onset seizures in...

  17. SU-F-T-254: Dose Volume Histogram (DVH) Analysis of Breath Hold Vs Free Breathing Techniques for Esophageal Tumors

    Energy Technology Data Exchange (ETDEWEB)

    Badkul, R; Doke, K; Pokhrel, D; Aguilera, N; Lominska, C [University of Kansas Medical Center, Kansas City, KS (United States)

    2016-06-15

    Purpose: Lung and heart doses and associated toxicity are of concern in radiotherapy for esophageal cancer. This study evaluates the dosimetry of deep-inspiration-breath-hold (DIBH) technique as compared to freebreathing( FB) using 3D-conformal treatment(3D-CRT) of esophageal cancer. Methods: Eight patients were planned with FB and DIBH CT scans. DIBH scans were acquired using Varian RPM system. FB and DIBH CTs were contoured per RTOG-1010 to create the planning target volume(PTV) as well as organs at risk volumes(OAR). Two sets of gross target volumes(GTV) with 5cm length were contoured for each patient: proximal at the level of the carina and distal at the level of gastroesophageal junction and were enlarged with appropriate margin to generate Clinical Target Volume and PTV. 3D-CRT plans were created on Eclipse planning system for 45Gy to cover 95% of PTV in 25 fractions for both proximal and distal tumors on FB and DIBH scans. For distal tumors celiac nodes were covered electively. DVH parameters for lung and heart OARs were generated and analyzed. Results: All DIBH DVH parameters were normalized to FB plan values. Average of heart-mean and heart-V40 was 0.70 and 0.66 for proximal lesions. For distal lesions ratios were 1.21 and 2.22 respectively. For DIBH total lung volume increased by 2.43 times versus FB scan. Average of lung-mean, V30, V20, V10, V5 are 0.82, 0.92, 0.76, 0.77 and 0.79 for proximal lesions and 1.17,0.66,0.87,0.93 and 1.03 for distal lesions. Heart doses were lower for breath-hold proximal lesions but higher for distal lesions as compared to free-breathing plans. Lung doses were lower for both proximal and distal breath-hold lesions except mean lung dose and V5 for distal lesions. Conclusion: This study showed improvement of OAR doses for esophageal lesions at mid-thoracic level utilizing DIBH vs FB technique but did not show consistent OAR sparing with DIBH for distal lesions.

  18. SU-F-T-254: Dose Volume Histogram (DVH) Analysis of Breath Hold Vs Free Breathing Techniques for Esophageal Tumors

    International Nuclear Information System (INIS)

    Badkul, R; Doke, K; Pokhrel, D; Aguilera, N; Lominska, C

    2016-01-01

    Purpose: Lung and heart doses and associated toxicity are of concern in radiotherapy for esophageal cancer. This study evaluates the dosimetry of deep-inspiration-breath-hold (DIBH) technique as compared to freebreathing( FB) using 3D-conformal treatment(3D-CRT) of esophageal cancer. Methods: Eight patients were planned with FB and DIBH CT scans. DIBH scans were acquired using Varian RPM system. FB and DIBH CTs were contoured per RTOG-1010 to create the planning target volume(PTV) as well as organs at risk volumes(OAR). Two sets of gross target volumes(GTV) with 5cm length were contoured for each patient: proximal at the level of the carina and distal at the level of gastroesophageal junction and were enlarged with appropriate margin to generate Clinical Target Volume and PTV. 3D-CRT plans were created on Eclipse planning system for 45Gy to cover 95% of PTV in 25 fractions for both proximal and distal tumors on FB and DIBH scans. For distal tumors celiac nodes were covered electively. DVH parameters for lung and heart OARs were generated and analyzed. Results: All DIBH DVH parameters were normalized to FB plan values. Average of heart-mean and heart-V40 was 0.70 and 0.66 for proximal lesions. For distal lesions ratios were 1.21 and 2.22 respectively. For DIBH total lung volume increased by 2.43 times versus FB scan. Average of lung-mean, V30, V20, V10, V5 are 0.82, 0.92, 0.76, 0.77 and 0.79 for proximal lesions and 1.17,0.66,0.87,0.93 and 1.03 for distal lesions. Heart doses were lower for breath-hold proximal lesions but higher for distal lesions as compared to free-breathing plans. Lung doses were lower for both proximal and distal breath-hold lesions except mean lung dose and V5 for distal lesions. Conclusion: This study showed improvement of OAR doses for esophageal lesions at mid-thoracic level utilizing DIBH vs FB technique but did not show consistent OAR sparing with DIBH for distal lesions.

  19. Branching ratios of α-decay to ground and excited states of Fm, Cf, Cm and Pu

    Science.gov (United States)

    Hassanabadi, H.; Hosseini, S. S.

    2018-06-01

    We use the well-known Wentzel-Kramers-Brillouin (WKB) barrier penetration probability to calculate α-decay branching ratios for ground and excited states of heavy even-even nuclei of Fermium (248-254Fm), Californium (244-252Cf), Curium (238-248Cm) and Plutonium (234-244Pu) with 94 ≤Zp ≤100. We obtained the branching ratios for the excited states of daughter nucleus by the α-decay energy (Qα), the angular momentum of α-particle (ℓα), and the excitation probability of the daughter nucleus with the excitation energy of state ℓ in the daughter nucleus (i.e. Eℓ*). α-Decay half-lives have been evaluated by using the proximity potential model for the heavy even-even nuclei. We have reported the half-lives and compared the results with the experimental data. The theoretical branching ratios of α-transitions in our calculation are found to agree with the available experimental data well for 0+→ 0+, 0+→ 2+, 0+→ 4+, 0+→ 6+ and 0+ → 8+α-transitions.

  20. Freeze drying method for preparing radiation source material

    International Nuclear Information System (INIS)

    Mosley, W.C.; Smith, P.K.

    1976-01-01

    Fabrication of a neutron source is specifically claimed. A palladium/californium solution is freeze dried to form a powder which, through conventional powder metallurgy, is shaped into a source containing the californium evenly distributed through a palladium metal matrix. (E.C.B.)

  1. Comments to " Retrieval of source parameters of an event of the 2000 West Bohemia earthquake swarm assuming an anisotropic crust", Stud. geophys. geod., 51, 231-254

    Czech Academy of Sciences Publication Activity Database

    Rössler, D.; Krüger, F.; Pšenčík, Ivan; Rümpker, G.

    2008-01-01

    Roč. 52, č. 2 (2008), s. 285-286 ISSN 0039-3169 Institutional research plan: CEZ:AV0Z30120515 Keywords : West Bohemia * tensile faulting * seismic anisotropy * seismic source Subject RIV: DC - Siesmology, Volcanology, Earth Structure Impact factor: 0.770, year: 2008

  2. Comparison of Recanalization and In-Stent Stenosis Between the Low-Profile Visualized Intraluminal Support Stent and Enterprise Stent-Assisted Coiling for 254 Intracranial Aneurysms.

    Science.gov (United States)

    Feng, Xin; Qian, Zenghui; Liu, Peng; Zhang, Baorui; Wang, Luyao; Guo, Erkang; Wen, Xiaolong; Xu, Wenjuan; Jiang, Chuhan; Wu, Zhongxue; Li, Youxiang; Liu, Aihua

    2018-01-01

    To compare the rates of recanalization and in-stent stenosis between the Enterprise (EP) and low-profile visualized intraluminal support (LVIS) stent deployments for intracranial aneurysms (IAs), and the factors associated therein. Between June 2014 and July 2016, 142 patients with a total of 161 IAs were treated by LVIS stent-assisted coiling and 111 patients with a total of 142 IAs were treated by EP stent-assisted coiling at our institution. Procedure-related complications, angiographic follow-up results, and clinical outcomes were analyzed statistically. The rates of initially complete and near-complete IA occlusion immediately after the procedure were similar in the LVIS and EP groups (94.3% vs. 89.9%; P = 0.275). On follow-up, complete and near-complete occlusion rates and recanalization rates were also similar in the 2 groups (96.6% vs. 92.1%; P =0.330 and 8.0% vs. 13.5%; P = 0.245, respectively). On logistic regression analysis, a higher size ratio (SR) was significantly associated with the recanalization of aneurysms in the EP group, but not in the LVIS group. The rate of moderate to severe in-stent stenosis was lower in the LVIS group (10.2%) than in the EP group (16.8%), but the difference was not statistically significant (P = 0.198). Our data show acceptable rates of complete and near-complete occlusion with both the LVIS and EP stents. LVIS stents were associated with lower rates of recanalization and in-stent stenosis, but the difference was not significant. Higher SR (≥2) was a significant predictor of recanalization in IAs treated with EP stents, but not in those treated with LVIS stents. Copyright © 2017. Published by Elsevier Inc.

  3. Effects of pH and H2O2 on ammonia, nitrite, and nitrate transformations during UV254nm irradiation: Implications to nitrogen removal and analysis.

    Science.gov (United States)

    Wang, Junli; Song, Mingrui; Chen, Baiyang; Wang, Lei; Zhu, Rongshu

    2017-10-01

    In order to achieve better removal and analyses of three dissolved inorganic nitrogen (DIN) species via ultraviolet-activated hydrogen peroxide (UV/H 2 O 2 ) process, this study systematically investigated the rates of photo-oxidations of ammonia/ammonium (NH 3 /NH 4 + ) and nitrite (NO 2 - ) as well as the photo-reduction of nitrate (NO 3 - ) at varying pH and H 2 O 2 conditions. The results showed that the mass balances of nitrogen were maintained along irradiation despite of interconversions of DIN species, suggesting that no nitrogen gas (N 2 ) or other nitrogen-containing compound was formed. NH 3 was more reactive than NH 4 + with hydroxyl radical (OH), and by a stepwise H 2 O 2 addition method NH 3 /NH 4 + can be completely converted to NO x - ; NO 2 - underwent rapid oxidation to form NO 3 - when H 2 O 2 was present, suggesting that it is an intermediate compound linking NH 3 /NH 4 + and NO 3 - ; but once H 2 O 2 was depleted, NO 3 - can be gradually photo-reduced back to NO 2 - at high pH conditions. Other than H 2 O 2 , the transformation kinetics of DINs were all dependent on pH, but to varying aspects and extents: the NH 3 photo-oxidation favored a pH of 10.3, which fell within the pK a values of NH 4 + (9.24) and H 2 O 2 (11.6); the NO 3 - photo-reduction increased with increasing pH provided that it exceeds the pK a of peroxynitrous acid (6.8); while the NO 2 - photo-oxidation remained stable unless the pH neared the pK a of H 2 O 2 (11.6). The study thereby demonstrates a picture of the evolutions of DIN species together during UV/H 2 O 2 irradiation process, and for the first time presents a method to achieve complete conversion of NH 4 + to NO 3 - with UV/H 2 O 2 process. Copyright © 2017 Elsevier Ltd. All rights reserved.

  4. N′-Benzylidene-2-({5-[(4-chlorophenoxymethyl]-4-phenyl-4H-1,2,4-triazol-3-yl}sulfanylacetohydrazide hemihydrate

    Directory of Open Access Journals (Sweden)

    Joel T. Mague

    2016-04-01

    Full Text Available The title compound, C24H20ClN5O2S·0.5H2O, has three independent molecules in the asymmetric unit and two water molecules of crystallization, one of which is equally disordered over two sites. The three unique organic molecules differ in the conformations of the substituents on the pyrazole ring. In the crystal, extensive O—H...O, O—H...N, N—H...O and C—H...O hydrogen bonding generates a three-dimensional network and C—H...π interactions are also observed.

  5. Lack of arginine vasopressin-induced phosphorylation of aquaporin-2 mutant AQP2-R254L explains dominant nephrogenic diabetes insipidus.

    NARCIS (Netherlands)

    Mattia, F.P. de; Savelkoul, P.J.M.; Kamsteeg, E.J.; Konings, I.B.M.; Sluijs, P. van der; Mallmann, R.; Oksche, A.; Deen, P.M.T.

    2005-01-01

    Water homeostasis in humans is regulated by vasopressin, which induces the translocation of homotetrameric aquaporin-2 (AQP2) water channels from intracellular vesicles to the apical membrane of renal principal cells. For this process, phosphorylation of AQP2 at S256 by cAMP-dependent protein kinase

  6. N-(2-Chlorophenyl-2-({5-[4-(methylsulfanylbenzyl]-4-phenyl-4H-1,2,4-triazol-3-yl}sulfanylacetamide

    Directory of Open Access Journals (Sweden)

    Hoong-Kun Fun

    2011-08-01

    Full Text Available In the title molecule, C24H21ClN4OS2, the central 1,2,4-triazole ring forms dihedral angles of 89.05 (9, 86.66 (9 and 82.70 (10° with the chloro-substituted benzene ring, the methylsulfanyl-substituted benzene ring and the phenyl ring, respectively. In the crystal, molecules are linked into sheets parallel to (100 by intermolecular N—H...N and weak C—H...O hydrogen bonds.

  7. 5-Bromo-2-[5-(4-nitrophenyl-3-phenyl-4,5-dihydro-1H-pyrazol-1-yl]pyrimidine

    Directory of Open Access Journals (Sweden)

    B. Kalluraya

    2009-12-01

    Full Text Available In the title pyrazoline compound, C19H14BrN5O2, the essentially planar pyrazoline and pyrimidine rings [maximum deviations = 0.013 (1 and 0.009 (1 Å, respectively] are inclined slightly to one another, making a dihedral angle of 10.81 (10°. The nitrobenzene unit is almost perpendicular to the attached pyrazoline ring, as indicated by the dihedral angle of 84.61 (8°. In the crystal structure, intermolecular C—H...N contacts link the molecules into dimers in an antiparallel manner. These dimers are further linked into one-dimensional chains along the b axis via C—H...O contacts. The crystal structure is consolidated by three different intermolecular π–π interactions [range of centroid–centroid distances = 3.5160 (11–3.6912 (11 Å].

  8. N,N-Diethyl-2-[5-(4-methoxybenzylidene-2,4-dioxo-1,3-thiazolidin-3-yl]acetamide

    Directory of Open Access Journals (Sweden)

    Vijayan Viswanathan

    2017-05-01

    Full Text Available In the title compound, C17H20N2O4S, the thiazolidine (r.m.s. deviation = 0.022 Å and phenyl rings (major and minor occupancies are inclined to one another by 6.3 (3 and 10.5 (3°, respectively. The molecular conformation is stabilized by an intramolecular C—H...S interaction. In the crystal, molecules are linked by C—H...O hydrogen bonds, which generate R22(18, R22(24 and R21(7 ring motifs. Aromatic π–π stacking interactions are also observed.

  9. Stablité des Eléments Trans-ferminums à Haut Spin : Mesure de la barrière de fission de 254No

    OpenAIRE

    Henning , Gregoire

    2012-01-01

    Super heavy nuclei provide opportunities to study nuclear structure near three simultaneous limits: in charge Z, spin I and excitation energy E∗. These nuclei exist only because of a fission barrier, created by shell effects. It is therefore important to determine the fission barrier and its spin dependence Bf(I), which gives information on the shell energy Eshell(I). Theoretical calculations predict different fission barrier heights from Bf(I = 0) = 6.8 MeV for a macro-microscopic model to 8...

  10. Errata Sheet for Closure Report for Corrective Action Unit 254: Area 25 R-MAD Decontamination Facility, Nevada Test Site, Nevada

    International Nuclear Information System (INIS)

    NSTec Environmental Restoration

    2007-01-01

    Errata Sheet--The survey map referenced on Page F-10 is a draft. This errata sheet replaces the map with a final version. All recipients of this errata sheet shall replace Page F-10 with the attached map

  11. Nr 254 - Opinion on the behalf of the Commission of foreign affairs in the finance bill project for 2013 (nr 235), Volume 5 - ecology, sustainable development and planning

    International Nuclear Information System (INIS)

    Le Guen, Jean-Marie

    2012-01-01

    After an introduction evoking the different parts of the finance bill project, its main programs and endowments, this report sets the associated national strategy within the context of the European and world agenda with respect to the protection of the environment, to climate change, and to international negotiations (Rio protocol, Durban conference, biodiversity). It outlines three main challenges: the international conference on climate of 2015 France has proposed to organize, the creation of European community on energy, and solving the current difficulties of the carbon trading scheme

  12. SU-E-T-254: Optimization of GATE and PHITS Monte Carlo Code Parameters for Uniform Scanning Proton Beam Based On Simulation with FLUKA General-Purpose Code

    Energy Technology Data Exchange (ETDEWEB)

    Kurosu, K [Department of Radiation Oncology, Osaka University Graduate School of Medicine, Osaka (Japan); Department of Medical Physics ' Engineering, Osaka University Graduate School of Medicine, Osaka (Japan); Takashina, M; Koizumi, M [Department of Medical Physics ' Engineering, Osaka University Graduate School of Medicine, Osaka (Japan); Das, I; Moskvin, V [Department of Radiation Oncology, Indiana University School of Medicine, Indianapolis, IN (United States)

    2014-06-01

    Purpose: Monte Carlo codes are becoming important tools for proton beam dosimetry. However, the relationships between the customizing parameters and percentage depth dose (PDD) of GATE and PHITS codes have not been reported which are studied for PDD and proton range compared to the FLUKA code and the experimental data. Methods: The beam delivery system of the Indiana University Health Proton Therapy Center was modeled for the uniform scanning beam in FLUKA and transferred identically into GATE and PHITS. This computational model was built from the blue print and validated with the commissioning data. Three parameters evaluated are the maximum step size, cut off energy and physical and transport model. The dependence of the PDDs on the customizing parameters was compared with the published results of previous studies. Results: The optimal parameters for the simulation of the whole beam delivery system were defined by referring to the calculation results obtained with each parameter. Although the PDDs from FLUKA and the experimental data show a good agreement, those of GATE and PHITS obtained with our optimal parameters show a minor discrepancy. The measured proton range R90 was 269.37 mm, compared to the calculated range of 269.63 mm, 268.96 mm, and 270.85 mm with FLUKA, GATE and PHITS, respectively. Conclusion: We evaluated the dependence of the results for PDDs obtained with GATE and PHITS Monte Carlo generalpurpose codes on the customizing parameters by using the whole computational model of the treatment nozzle. The optimal parameters for the simulation were then defined by referring to the calculation results. The physical model, particle transport mechanics and the different geometrybased descriptions need accurate customization in three simulation codes to agree with experimental data for artifact-free Monte Carlo simulation. This study was supported by Grants-in Aid for Cancer Research (H22-3rd Term Cancer Control-General-043) from the Ministry of Health, Labor and Welfare of Japan, Grants-in-Aid for Scientific Research (No. 23791419), and JSPS Core-to-Core program (No. 23003). The authors have no conflict of interest.

  13. No 2965, No 254. Report on new energy technologies and carbon dioxide sequestration: scientifical and technical aspects; N. 2965, N. 254. Rapport sur les nouvelles technologies de l'energie et la sequestration du dioxyde de carbone: aspects scientifiques et techniques

    Energy Technology Data Exchange (ETDEWEB)

    Bataille, Ch; Birraux, C

    2006-03-15

    The abatement of CO{sub 2} emissions is a huge technical and economical challenge. Fossil fuels, which represent 88% of the world primary energy consumption, are the main source of the 25 billions of CO{sub 2} released each year in the atmosphere. The mastery of CO{sub 2} emissions cannot come from a single technology but must result from the simultaneous implementation of several means, like the development of carbon-free energies and the mastery of fossil fuel emissions. The opportunities of progress are numerous and compatible with the economic development. This document presents, first, the different greenhouse gases, the CO{sub 2} emissions per country and the main sources of CO{sub 2} emissions (power and heat generation, transports). Then it presents different ways of abatement of CO{sub 2} emissions: clean coal technologies, gas combined cycles, CO{sub 2} sequestration, reduction of fuel consumption in transports, development of carbon-free energies: wind power, solar photovoltaic for decentralized power generation, nuclear energy for a competitive power generation and for CO{sub 2} abatement, biofuels of 2. generation and fuel cells. The conclusion stresses on the investments needed for the renewal and increase of energy capacities, and on the necessary visibility and moderation of emission abatement mechanisms (carbon trading and CO{sub 2} prices). (J.S.)

  14. No 2965, No 254. Report on new energy technologies and carbon dioxide sequestration: scientifical and technical aspects; N. 2965, N. 254. Rapport sur les nouvelles technologies de l'energie et la sequestration du dioxyde de carbone: aspects scientifiques et techniques

    Energy Technology Data Exchange (ETDEWEB)

    Bataille, Ch.; Birraux, C

    2006-03-15

    The abatement of CO{sub 2} emissions is a huge technical and economical challenge. Fossil fuels, which represent 88% of the world primary energy consumption, are the main source of the 25 billions of CO{sub 2} released each year in the atmosphere. The mastery of CO{sub 2} emissions cannot come from a single technology but must result from the simultaneous implementation of several means, like the development of carbon-free energies and the mastery of fossil fuel emissions. The opportunities of progress are numerous and compatible with the economic development. This document presents, first, the different greenhouse gases, the CO{sub 2} emissions per country and the main sources of CO{sub 2} emissions (power and heat generation, transports). Then it presents different ways of abatement of CO{sub 2} emissions: clean coal technologies, gas combined cycles, CO{sub 2} sequestration, reduction of fuel consumption in transports, development of carbon-free energies: wind power, solar photovoltaic for decentralized power generation, nuclear energy for a competitive power generation and for CO{sub 2} abatement, biofuels of 2. generation and fuel cells. The conclusion stresses on the investments needed for the renewal and increase of energy capacities, and on the necessary visibility and moderation of emission abatement mechanisms (carbon trading and CO{sub 2} prices). (J.S.)

  15. Radionuclides in rodents

    International Nuclear Information System (INIS)

    Taylor, G.N.

    1985-01-01

    Studies are being conducted in mice comparing the toxicity of radium-226, plutonium-239, americium-241, californium-249 and californium-252 in C57B1/Do (albino) mice and the toxicity of americium-241, plutonium-239 and radium-226 in deer mice (Peromyscus maniculatus) and grasshopper mice (Onychomys leucogaster). These experiments will ultimately enable comparison of the toxicity of the above actinide toxicity in man to be made using radium toxicity as the baseline

  16. Trends in radioisotope development and utilization in the United States

    Energy Technology Data Exchange (ETDEWEB)

    Mott, W E [Energy Research and Development Administration, Washington, D.C. (USA)

    1976-06-01

    The current trends in radioisotope and radiation technology in the United States are overviewed with emphasis on the developments since the 1973 Conference. The comments focus primarily on the research and development activities receiving the most attention today from the various agencies of the Government. Among the many available radionuclides, technetium-99m has played the single most important role for making possible the developments in the field of nuclear medicine. Many other short lived medium-lived nuclides are applied in the fields of nuclear medicine, cardiac pacemaker, artificial heart, and blood irradiator. Radiation processing is now firmly established in the United States. The trends in sewage treatment, polymer-impregnated materials, bioengineering, and food irradiation are reviewed. The programs for californium-252, strontium-90, cesium-137, plutonium-238, and krypton-85 are also reviewed. The author concludes this paper with the acknowledgement that Japanese researchers have contributed to and have been closely involved in many of the programs discussed. Of particular note is the participation in the clinical phase of the californium-252 radiotherapy program. Several Japanese hospitals have been cooperating with the United States since the very beginning of the californium-252 program in determining the value of the californium-252 neutron therapy. The research being performed is unique, and will contribute greatly to the decisions on the ultimate future of californium-252 for therapeutic purposes.

  17. A complexa convivência humana e os processos educativos libertadores (The human coexistence and the process of the liberating education - DOI: 10.5752/P.2175-5841.2013v11n29p254

    Directory of Open Access Journals (Sweden)

    Sergio Rogerio Junqueira

    2013-03-01

    Full Text Available Este artigo objetiva traçar o itinerário da educação libertadora na realidade social brasileira e refletir sobre a necessidade de se repensar a ação dessa modalidade de educação nos dias atuais. Ao se articular a realidade da época do surgimento da educação libertadora, que pretendia  responder aos apelos de libertação dos povos Latino-Americanos, com a realidade dos tempos atuais e suas implicações, este artigo busca respostas às questões postas por essa educação libertadora na atualidade. Para abordar as funções do processo educativo dentro do contexto de uma sociedade, é preciso situar as abordagens em sua realidade, contemporizando e adequando as suas ações. Essa temática representa um grande desafio, pois a concepção libertadora de educação extrapola os ambientes acadêmicos, visando sobretudo o bem comum do ser humano e o seu pleno desenvolvimento. Para a realização deste trabalho foram realizadas pesquisas bibliográficas e estudo da realidade desta época informatizada em que estamos inseridos, assim como suas consequências. Palavras-chave: Conscientização. Emancipação. Informatização. Educação Libertadora. Abstract This article aims to trace the route of liberating education in Brazilian social reality and reflect on the need to rethink the action of this type of education these days. In order to articulate the onset of liberating education that intended to respond to calls for liberation of Latin American peoples with the reality of the present time and its implications, this article seeks to answer to the questions posed by this liberating education today. To address the functions of the educational process within the context of a society, one must situate the approaches in their reality, compromising and adapting their actions. This theme represents a great challenge because the conception of such liberating education goes beyond the academic environments, seeking above all, the common good of the human being and its full development. The methodology used in this paper consisted of bibliographical research and a study of the reality of this computerized era in which we operate. Keywords: Awareness Empowerment. Information Technology. Liberating Education. 

  18. Compilation and testing of tools and methods for sustainable coastal management at local and regional scales : Deliverable D2.5.4, Thresholds project, 6th framework programme, EU, 108 p.

    OpenAIRE

    Håkanson, Lars

    2008-01-01

    This work describes how general methods and models for sustainable coastal ecosystem management at local to regional scales may be used to address key questions in coastal management and threshold science. The general, process-based mass-balance model (CoastMab) for substances transported to, within and from for coastal areas may be used as a tool to: 1. Combat eutrophication, 2. Rank nutrient fluxes, 3. Estimate the system response related to nutrient reductions and 4. Estimate realistic val...

  19. SU-E-J-254: Evaluating the Role of Mid-Treatment and Post-Treatment FDG-PET/CT in Predicting Progression-Free Survival and Distant Metastasis of Anal Cancer Patients Treated with Chemoradiotherapy

    International Nuclear Information System (INIS)

    Zhang, H; Wang, J; Chuong, M; D’Souza, W; Choi, W; Lu, W; Latifi, K; Hoffe, S; Moros, E; Saeed, Nadia; Tan, S; Shridhar, R

    2015-01-01

    Purpose: To evaluate the role of mid-treatment and post-treatment FDG-PET/CT in predicting progression-free survival (PFS) and distant metastasis (DM) of anal cancer patients treated with chemoradiotherapy (CRT). Methods: 17 anal cancer patients treated with CRT were retrospectively studied. The median prescription dose was 56 Gy (range, 50–62.5 Gy). All patients underwent FDG-PET/CT scans before and after CRT. 16 of the 17 patients had an additional FDG-PET/CT image at 3–5 weeks into the treatment (denoted as mid-treatment FDG-PET/CT). 750 features were extracted from these three sets of scans, which included both traditional PET/CT measures (SUVmax, SUVpeak, tumor diameters, etc.) and spatialtemporal PET/CT features (comprehensively quantify a tumor’s FDG uptake intensity and distribution, spatial variation (texture), geometric property and their temporal changes relative to baseline). 26 clinical parameters (age, gender, TNM stage, histology, GTV dose, etc.) were also analyzed. Advanced analytics including methods to select an optimal set of predictors and a model selection engine, which identifies the most accurate machine learning algorithm for predictive analysis was developed. Results: Comparing baseline + mid-treatment PET/CT set to baseline + posttreatment PET/CT set, 14 predictors were selected from each feature group. Same three clinical parameters (tumor size, T stage and whether 5-FU was held during any cycle of chemotherapy) and two traditional measures (pre- CRT SUVmin and SUVmedian) were selected by both predictor groups. Different mix of spatial-temporal PET/CT features was selected. Using the 14 predictors and Naive Bayes, mid-treatment PET/CT set achieved 87.5% accuracy (2 PFS patients misclassified, all local recurrence and DM patients correctly classified). Post-treatment PET/CT set achieved 94.0% accuracy (all PFS and DM patients correctly predicted, 1 local recurrence patient misclassified) with logistic regression, neural network or support vector machine model. Conclusion: Applying radiomics approach to either midtreatment or post-treatment PET/CT could achieve high accuracy in predicting anal cancer treatment outcomes. This work was supported in part by the National Cancer Institute Grant R01CA172638

  20. Geological and petrophysical characterization of the Ferron Sandstone for 3-D simulation of a fluvial-deltaic reservoir. Deliverable 2.5.4, Ferron Sandstone lithologic strip logs, Emergy & Sevier Counties, Utah: Volume I

    Energy Technology Data Exchange (ETDEWEB)

    Allison, M.L.

    1995-12-08

    Strip logs for 491 wells were produced from a digital subsurface database of lithologic descriptions of the Ferron Sandstone Member of the Mancos Shale. This subsurface database covers wells from the parts of Emery and Sevier Counties in central Utah that occur between Ferron Creek on the north and Last Chance Creek on the south. The lithologic descriptions were imported into a logging software application designed for the display of stratigraphic data. Strip logs were produced at a scale of one inch equals 20 feet. The strip logs were created as part of a study by the Utah Geological Survey to develop a comprehensive, interdisciplinary, and qualitative characterization of a fluvial-deltaic reservoir using the Ferron Sandstone as a surface analogue. The study was funded by the U.S. Department of Energy (DOE) under the Geoscience/Engineering Reservoir Characterization Program.

  1. SU-E-J-254: Evaluating the Role of Mid-Treatment and Post-Treatment FDG-PET/CT in Predicting Progression-Free Survival and Distant Metastasis of Anal Cancer Patients Treated with Chemoradiotherapy

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, H; Wang, J; Chuong, M; D’Souza, W; Choi, W; Lu, W [University of Maryland School of Medicine, Baltimore, MD (United States); Latifi, K; Hoffe, S; Moros, E [Moffitt Cancer Center, Tampa, FL (United States); Saeed, Nadia [Brwon University, Providence, RI (United States); Tan, S [Huazhong University of Science & Technology, Wuhan (China); Shridhar, R [Florida Hospital, Orlando, FL (United States)

    2015-06-15

    Purpose: To evaluate the role of mid-treatment and post-treatment FDG-PET/CT in predicting progression-free survival (PFS) and distant metastasis (DM) of anal cancer patients treated with chemoradiotherapy (CRT). Methods: 17 anal cancer patients treated with CRT were retrospectively studied. The median prescription dose was 56 Gy (range, 50–62.5 Gy). All patients underwent FDG-PET/CT scans before and after CRT. 16 of the 17 patients had an additional FDG-PET/CT image at 3–5 weeks into the treatment (denoted as mid-treatment FDG-PET/CT). 750 features were extracted from these three sets of scans, which included both traditional PET/CT measures (SUVmax, SUVpeak, tumor diameters, etc.) and spatialtemporal PET/CT features (comprehensively quantify a tumor’s FDG uptake intensity and distribution, spatial variation (texture), geometric property and their temporal changes relative to baseline). 26 clinical parameters (age, gender, TNM stage, histology, GTV dose, etc.) were also analyzed. Advanced analytics including methods to select an optimal set of predictors and a model selection engine, which identifies the most accurate machine learning algorithm for predictive analysis was developed. Results: Comparing baseline + mid-treatment PET/CT set to baseline + posttreatment PET/CT set, 14 predictors were selected from each feature group. Same three clinical parameters (tumor size, T stage and whether 5-FU was held during any cycle of chemotherapy) and two traditional measures (pre- CRT SUVmin and SUVmedian) were selected by both predictor groups. Different mix of spatial-temporal PET/CT features was selected. Using the 14 predictors and Naive Bayes, mid-treatment PET/CT set achieved 87.5% accuracy (2 PFS patients misclassified, all local recurrence and DM patients correctly classified). Post-treatment PET/CT set achieved 94.0% accuracy (all PFS and DM patients correctly predicted, 1 local recurrence patient misclassified) with logistic regression, neural network or support vector machine model. Conclusion: Applying radiomics approach to either midtreatment or post-treatment PET/CT could achieve high accuracy in predicting anal cancer treatment outcomes. This work was supported in part by the National Cancer Institute Grant R01CA172638.

  2. Can neuromuscular fatigue threshold bedetermined by short and non-exhaustive bouts?. DOI: http://dx.doi.org/10.5007/1980-0037.2012v14n3p254

    Directory of Open Access Journals (Sweden)

    Alexandre Hideki Okano

    2012-05-01

    Full Text Available The present study determined the neuromuscular fatigue threshold (NFT using four different time-periods of analysis of the electromyographic signal and compared these estimations with critical power (CP. Fifteen healthy young men (73.6 ± 5.1 kg, 177.8 ± 7.0 cm, 23.4 ± 5.2 years performed 3-4 different severe constant workload trials until exhaustion on a cycle ergometer with simultaneous SEMG signals acquisition. The obtained data permitted NFT estimation with four different periods of analysis as follows: initial 30s (T30, 1min (T1, 2min (T2 and total time (TT, as well as CP. T30 and T1 were significantly higher than TT and CP and, T2 and TT did not differ between each other, and both were significantly higher than CP. In addition, TT was significantly correlated to CP (0.72; P < 0.05 and to T2 (0.58; P < 0.05. We conclude that NFT overestimates CP, independent of the time-period analysis used for its determination.

  3. Quantum-chemical consideration of extermal valent forms of actinides

    International Nuclear Information System (INIS)

    Ionova, G.V.; Pershina, V.G.; Spitsyn, V.I.

    1982-01-01

    Stability of valent forms of actinides that has not yet studied experimentally, is considered within the framework of quantum-chemical considerations. Oxidizing potentials E 0 for actinide elements are determined theoretically. A dependence of the definite valent state stability on relativistic effect is shown. A conclusion is made that oxidizing potential E 0 (4-5) for americium should be higher than E 0 (4-5) for plutonium. A relatively small oxidizing potential E 0 (4-5) for curium speaks about principle possibility of production of five-valent curium in solution, though it is less stable than the six-valent one. Oxidizing potential corresponding to transition of three-valent californium into the four-valent state should be less than the value adopted in literature. A relatively small oxidizing potential of californium E 0 (4-5) speaks about possible existence of five-valent californium in solution

  4. Source storage and transfer cask: Users Guide

    International Nuclear Information System (INIS)

    Eccleston, G.W.; Speir, L.G.; Garcia, D.C.

    1985-04-01

    The storage and shield cask for the dual californium source is designed to shield and transport up to 3.7 mg (2 Ci) of 252 Cf. the cask meets Department of Transportation (DOT) license requirements for Type A materials (DOT-7A). The cask is designed to transfer sources to and from the Flourinel and Fuel Storage (FAST) facility delayed-neutron interrogator. Californium sources placed in the cask must be encapsulated in the SR-CF-100 package and attached to Teleflex cables. The cask contains two source locations. Each location contains a gear box that allows a Teleflex cable to be remotely moved by a hand crank into and out of the cask. This transfer procedure permits sources to be easily removed and inserted into the delayed-neutron interrogator and reduces personnel radiation exposure during transfer. The radiation dose rate with the maximum allowable quantity of californium (3.7 mg) in the cask is 30 mR/h at the surface and less than 2 mR/h 1 m from the cask surface. This manual contains information about the cask, californium sources, describes the method to ship the cask, and how to insert and remove sources from the cask. 28 figs

  5. Neutron spectra from radionuclide sources for cardiac pacemakers

    International Nuclear Information System (INIS)

    Kluge, H.

    1975-01-01

    Neutron spectra from Plutonium 238 radioisotope batteries powering cardiac pacemakers are measured in the energy range above 0.7 MeV. The results are used to calculate radiation doses within a cylindrical phantom. There are only minor differences between the different types of plutonium 238-batteries and californium 252-batteries

  6. Validation of the MCNP-DSP Monte Carlo code for calculating source-driven noise parameters of subcritical systems

    International Nuclear Information System (INIS)

    Valentine, T.E.; Mihalczo, J.T.

    1995-01-01

    This paper describes calculations performed to validate the modified version of the MCNP code, the MCNP-DSP, used for: the neutron and photon spectra of the spontaneous fission of californium 252; the representation of the detection processes for scattering detectors; the timing of the detection process; and the calculation of the frequency analysis parameters for the MCNP-DSP code

  7. Magnetic measurements of the transuranium elements. Progress report, January 1, 1984-December 31, 1984

    International Nuclear Information System (INIS)

    Huray, P.G.; Nave, S.E.

    1984-01-01

    Measurements of the magnetic properties of dhcp californium-249 metal indicated the presence of three regions of differing magnetic character. Additional measurements are also reported. Magnetic moments and valence states of terbium in TbF 3 , BaTbO 3 , and TbO 1 8 are discussed. Progress on high-field operation of the micro-magnetic susceptometer is reported

  8. Single-event burnout of power MOSFET devices for satellite application

    International Nuclear Information System (INIS)

    Xue Yuxiong; Tian Kai; Cao Zhou; Yang Shiyu; Liu Gang; Cai Xiaowu; Lu Jiang

    2008-01-01

    Single-event burnout (SEB) sensitivity was tested for power MOSFET devices, JTMCS081 and JTMCS062, which were made in Institute of Microelectronics, Chinese Academy of Sciences, using californium-252 simulation source. SEB voltage threshold was found for devices under test (DUT). It is helpful for engineers to choose devices used in satellites. (authors)

  9. ORF Alignment: NC_005090 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available YYWRICASKGVKILLLGEYVLNLFFKEIENLPSNMVAEQSE 60 ... Query: 121 FANSLPKSPKNPPVFEIDGIKIAPLFGYEAHFDEFWLKFKRLDVDLALIPSAS...TFDSLNR 180 ... FANSLPKSPKNPPVFEIDGIKIAPLFGYEAHFDEFWLKFKRLDVDLALIPSASTFD...SLNR Sbjct: 121 FANSLPKSPKNPPVFEIDGIKIAPLFGYEAHFDEFWLKFKRLDVDLALIPSASTFDSLNR 180 ... Query: 241 XXXXXXXXXIRRSW 254 ... IRRSW Sbjct: 241 ELDQGYLEEIRRSW 254

  10. ORF Alignment: NC_003888 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ... Length = 309 ... Query: 254 LRPGEQVQIDTTRLDIMAILEDGSLGRPELTIAVDVATRSILAAVLRPYSTKAVDAALLL 313 ... LRPGEQVQIDTTRLDIMAIL...EDGSLGRPELTIAVDVATRSILAAVLRPYSTKAVDAALLL Sbjct: 1 ... LRPGEQVQIDTTRLDIMAILEDGSLGRPELTIAVDVA

  11. ORF Alignment: NC_004461 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available AIVKGYFADQLQQYFLSHGVSSAIIDLGGNVLTIGRQPETLE 180 ... Query: 254 ASVTIISDHGIDGEVWSTICSFGQSQKNIELLNLIDGIEGIIVTRDGSV...LMTSKMQKY 311 ... ASVTIISDHGIDGEVWSTICSFGQSQKNIELLNLIDGIEGIIVTRDGSVLMTSKMQKY Sbjct: 241 ASVTIISDHGIDGEVWSTICSFGQSQKNIELLNLIDGIEGIIVTRDGSVLMTSKMQKY 298

  12. ORF Alignment: NC_006350 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available 98 ... Query: 254 IVAAARDYVLAHRSRPVGVPELCEQLHVSRRTLQYCFQDVLGMAPATYLRALRLNGVRRD 313 ... IVAAARDYVLAHRSRP...VGVPELCEQLHVSRRTLQYCFQDVLGMAPATYLRALRLNGVRRD Sbjct: 1 ... IVAAARDYVLAHRSRPVGVPELCEQLHVSRRTLQYCFQDVLGMAPATYLRALRLNGVRRD 60 ...

  13. Transport behaviour of the lanthanide 152Eu(III), 153Gd(III) and 170Tm(III) and transplutonium element 254Es(III), 244Cm(III), 241Am(III), 249Cf(III) and 249Bk(III) ions in aqueous solutions at 298 K

    International Nuclear Information System (INIS)

    Ouerfelli, N.

    2014-01-01

    Ionic self-diffusion coefficients (D) for trivalent radiotracers, lanthanide and actinide ions have been determined in concentrated aqueous solutions of supporting electrolytes of Gd(NO 3 ) 3 -HNO 3 or Nd(ClO 3 ) 4 -HClO 4 up to 1.5 mol L -1 at 298.15 K and pH 2.50 by the open-end capillary method. The data obtained in large range of concentrations, allow to derive the limiting value D deg, the validity of the Onsager limiting law and a more extended law. This study contributes to demonstrate similarities in transport and structure properties between 4f and 5f trivalent ions explained by a similar electronic configuration, ionic radius and hydration number. An empirical equation is suggested for predicting ionic hydration number with a good precision. (author)

  14. Hydration of the lanthanide ions 152Eu(III), 153Gd(III) and 170Tm(III) in aqueous solutions at 298 K and similarity with the transplutonium element ions 254Es(III), 244Cm(III), 241Am(III), 249Cf(III) and 249Bk(III)

    International Nuclear Information System (INIS)

    Ouerfelli, N.; Latrous, H.; Ammar, M.; Das, D.; Oliver, J.

    2013-01-01

    The open-end capillary method is used for the determination of ionic self-diffusion coefficients (D) for trivalent radiotracer, lanthanide and actinide ions are reported in concentrated aqueous solutions of supporting electrolytes of Gd(NO 3 ) 3 -HNO 3 or Nd(ClO 3 ) 4 -HClO 4 up to 1.5 mol.L -1 at 298.15 K and pH 2.50. The data obtained in large range of concentrations, allow deriving the limiting value D°, the validity of the Onsager limiting law and a more extended law. This study contributes to demonstrate similarities in transport and structure properties between 4f and 5f trivalent ions explained by a similar electronic configuration, ionic radius and hydration number. (author)

  15. Isotopic and chemical composition (δ13C, Δ14C, δ15N, C:N, SUVA254nm, % HPOA) of aquatic carbon and field conditions (water temperature, pH, discharge) in the Upper Mississippi River Basin, October 2014 – February 2016

    Data.gov (United States)

    Department of the Interior — This dataset contains stable isotope (δ13C) and radioisotope (Δ14C) compositions of dissolved inorganic carbon, dissolved organic carbon, particulate organic carbon,...

  16. Retraction Notice to ;Fabrication, electromagnetic characteristics of microwave absorbers containing Li0.35Zn0.3Fe2.35O4 micro-belts, nickel-coated carbon fibers; [J. Magn. Magn. Mater. 345 (2013) 249-254

    Science.gov (United States)

    Zhao, Bin; Wang, Qilei; Zhang, Cunrui

    2017-08-01

    This article has been retracted: please see Elsevier Policy on Article Withdrawal (http://www.elsevier.com/locate/withdrawalpolicy) This article has been retracted at the request of the Editor-in-Chief. The authors have plagiarized part of a paper that had already appeared in Ceram. Int., 39 (2013) 2317-2322, http://dx.doi.org/10.1016/j.ceramint.2012.08.079.

  17. Comment on "Nanosecond laser textured superhydrophobic metallic surfaces and their chemical sensing applications" by Duong V. Ta, Andrew Dunn, Thomas J. Wasley, Robert W. Kay, Jonathan Stringer, Patrick J. Smith, Colm Connaughton, Jonathan D. Shephard (Appl. Surf. Sci. 357 (2015) 248-254)

    Science.gov (United States)

    Boinovich, L. B.; Emelyanenko, A. M.; Emelyanenko, K. A.; Domantovsky, A. G.; Shiryaev, A. A.

    2016-08-01

    Nowadays the problem of design of durable ecologically friendly superhydrophobic surfaces is of great importance for science and technology. A recent paper in Applied Surface Science reports the method of fabricating the superhydrophobic metallic surfaces by infrared nanosecond laser surface texturing without using hydrophobic agents. Since this method of surface texturing can be considered as one of the most suitable for various industrial applications, the nature of superhydrophobic state of surfaces produced by laser texturing in the abovementioned paper deserves to be analyzed in detail. Authors of the commented paper attributed the change in wettability to the partial deoxidation of CuO into Cu2O on the surface during storage in atmosphere. However, such interpretation of the results contradicts to the basic notions in the theory of wetting and to more accurate and detailed data. In our Comment we discuss these contradictions point by point.

  18. Computer-assisted nuclear fuel manufacture

    International Nuclear Information System (INIS)

    Maloney, J.P.; Schaumann, S.M.; Stone, E.

    1976-01-01

    At the ERDA Savannah River Plant, a process monitor, which incorporates an online digital computer, assists in manufacturing fuel elements used to produce nuclides such as plutonium, tritium, and californium in the plant's nuclear reactors. Also, inventory functions assist in safeguarding fissile material and protecting against accidental nuclear criticality. Terminals at strategic locations throughout the process area enable production operators to send and receive instructions and information on each manufacturing step

  19. Computer-assisted nuclear fuel manufacture

    International Nuclear Information System (INIS)

    Maloney, J.P.; Schaumann, C.M.; Stone, E.

    1976-06-01

    At the ERDA Savannah River Plant, a process monitor, which incorporates an online digital computer, assists in manufacturing fuel elements used to produce nuclides such as plutonium, tritium, and californium in the plant's nuclear reactors. Also, inventory functions assist in safeguarding fissile material and protecting against accidental nuclear criticality. Terminals at strategic locations throughout the process area enable production operators to send and receive instructions and information on each manufacturing step. 11 fig

  20. Heavy ion tests on programmable VLSI

    International Nuclear Information System (INIS)

    Provost-Grellier, A.

    1989-11-01

    The radiation from space environment induces operation damages in onboard computers systems. The definition of a strategy, for the Very Large Scale Integrated Circuitry (VLSI) qualification and choice, is needed. The 'upset' phenomena is known to be the most critical integrated circuit radiation effect. The strategies for testing integrated circuits are reviewed. A method and a test device were developed and applied to space applications candidate circuits. Cyclotron, synchrotron and Californium source experiments were carried out [fr

  1. Charge breeding of radioactive isotopes at the CARIBU facility with an electron beam ion source

    Science.gov (United States)

    Vondrasek, R. C.; Dickerson, C. A.; Hendricks, M.; Ostroumov, P.; Pardo, R.; Savard, G.; Scott, R.; Zinkann, G.

    2018-05-01

    An Electron Beam Ion Source Charge Breeder (EBIS-CB) has been developed at Argonne National Laboratory as part of the californium rare ion breeder upgrade. For the past year, the EBIS-CB has been undergoing commissioning as part of the ATLAS accelerator complex. It has delivered both stable and radioactive beams with A/Q 18% into a single charge state. The operation of this device, challenges during the commissioning phase, and future improvements will be discussed.

  2. Solid-State Neutron Multiplicity Counting System Using Commercial Off-the-Shelf Semiconductor Detectors

    Energy Technology Data Exchange (ETDEWEB)

    Rozhdestvenskyy, S. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

    2017-08-09

    This work iterates on the first demonstration of a solid-state neutron multiplicity counting system developed at Lawrence Livermore National Laboratory by using commercial off-the-shelf detectors. The system was demonstrated to determine the mass of a californium-252 neutron source within 20% error requiring only one-hour measurement time with 20 cm2 of active detector area.

  3. Safety analysis report for packaging: neutron shipping cask, model 0.5T

    International Nuclear Information System (INIS)

    Peterson, R.T.

    1976-01-01

    The Safety Analysis Report for Packaging demonstrates that the neutron shipping cask can safely transport, in solid or powder form, all isotopes of uranium, plutonium, americium, curium, berkelium, californium, einsteinium, and fermium. The shipping cask and its contents are described. It also evaluates transport conditions, structural parameters (e.g., load resistance, pressure and impact effects, lifting and tiedown devices), and shielding. Finally, it discusses compliance with Chapter 0529 of the Energy Research and Development Administration Manual

  4. Directed evolution of the periodic table: probing the electronic structure of late actinides.

    Science.gov (United States)

    Marsh, M L; Albrecht-Schmitt, T E

    2017-07-25

    Recent investigations of the coordination chemistry and physical properties of berkelium (Z = 97) and californium (Z = 98) have revealed fundamental differences between post-curium elements and lighter members of the actinide series. This review highlights these developments and chronicles key findings and concepts from the last half-century that have helped usher in a new understanding of the evolution of electronic structure in the periodic table.

  5. NWIS casting measurements taken during demonstrations to Russian visitors

    International Nuclear Information System (INIS)

    Mullens, J.A.; Valentine, T.E.; Mihalczo, J.T.

    1998-01-01

    This report describes a set of NWIS measurements made during demonstrations to Russian visitors on August 28, 1997. These measurements will be given to the Russian visitors from Arzamus-16 as part of their NWIS training (part of a DOE laboratory-to-laboratory exchange program). These measurements are made on standard highly enriched Uranium annular castings (as used for storage). Associated NWIS calibration runs were made in air (no casting, just the NWIS Californium source and detectors)

  6. Properties of neutron sources

    International Nuclear Information System (INIS)

    1987-03-01

    The Conference presentations were divided into sessions devoted to the following topics: white neutron sources, primarily pulsed (6 papers); fast neutron fields (5 papers); Californium-252 prompt fission neutron spectra (14 papers); monoenergetic sources and filtered beams (11 papers); 14 MeV neutron sources (10 papers); selected special application (one paper); and a general interest session (4 papers). Individual abstracts were prepared separately for the papers

  7. Health physics aspects of 252Cf

    International Nuclear Information System (INIS)

    Bhagwat, A.M.

    1974-01-01

    After briefly describing the methods of production, radioactive, chemical and biological properties of californium-252, its health physics aspects are reviewed in detail. Its external and internal radiation hazards can be minimised through control of radiation and contamination and proper shield design. Use of various shielding materials is evaluated. The following aspects are also discussed : (1) radiation detectors for neutrons and gamma radiation (2) personnel monitoring techniques (3) bioassay and (4) storage and transportation. (M.G.B.)

  8. Definitive Brachytherapy for Kaposi's Sarcoma

    International Nuclear Information System (INIS)

    Williams, A.; Ezzell, G.; Zalupski, M.; Fontanesi, J.

    1996-01-01

    Purpose: To assess the efficacy and possible complications in patients diagnosed with Kaposi's sarcoma and treated with definitive brachytherapy. Methods and Materials: Between January, 1995 and December, 1995, four patients with Kaposi's sarcoma (KS) were treated with brachytherapy. Three patients, all with positive HIV status were treated using Iridium 192 (Ir-192) sources via a high-dose rate remote afterloader. One patient with endemic KS was treated using the application of catheters loaded with Californium 252. Eight sites were treated and included scalp, feet, nose, penis, hand, neck, and back. Dose rate for Ir-192 was 330cGy/fx to a total dose of 990cGy. The Californium was delivered as 100nGy/b.i.d. to a total dose of 900nGy. Follow-up as ranged from 2-6 months. Results: All four patients remain alive. Seven of eight sites have had complete clinical response and each patient has reported durable pain relief that has not subsided through last follow-up of 1/96. Two of eight sites, both treated with surface mold technique with Californium 252 developed moist desquamation. The remaining six sites did not demonstrate significant toxicity. Conclusion: Brachytherapy can offer Kaposi's sarcoma patients results that are equivalent to external beam radiation therapy, with minimal complications, a shorter treatment time and potential cost effectiveness

  9. ORF Alignment: NC_000921 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NLVVLQELNPYSYFCQSENPKFFDLGEYFEEDKAFFS 60 ... Query: 134 DLGFEPIATSVGKLGLMVCWDQWYPEAARIMALKGAEILIYPSAIGFLEEDSNEE...KKRQQ 193 ... DLGFEPIATSVGKLGLMVCWDQWYPEAARIMALKGAEILIYPSAIGFLEEDSNEEKKRQQ... Sbjct: 121 DLGFEPIATSVGKLGLMVCWDQWYPEAARIMALKGAEILIYPSAIGFLEEDSNEEKKRQQ 180 ... Query: 254 EEILYAEIELERTEEVRRM

  10. ORF Alignment: NT_033777 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available Query: 134 SDCHELDEGVRVDGVYRFLVPERNEVQRDLYERYCAFATDGPAWTVIQSRGGSFDPHENF 193 ... SDCHELDEGVRVDGVYRFLVP...ERNEVQRDLYERYCAFATDGPAWTVIQSRGGSFDPHENF Sbjct: 1 ... SDCHELDEGVRVDGVYRFLVPERNEVQRDL...YERYCAFATDGPAWTVIQSRGGSFDPHENF 60 ... Query: 254 SYNYQLSVAGEFRGSLPDALEQHNRMDFSTYDRRRNHAKSADSTCGEDYGGGWWFDRCTQ 3

  11. Grover, Dr Arun Kumar

    Indian Academy of Sciences (India)

    Specialization: Magnetism & Superconductivity, Vortex State Studies in Superconductors, Strongly Correlated Systems Address: Vice Chancellor, Panjab University, Chandigarh 160 014, U.T.. Contact: Office: (0172) 254 1945. Residence: (0172) 254 1428. Fax: (0172) 254 1022. Email: vc@pu.ac.in, arunkgrover@gmail.com.

  12. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFC254 (Link to dictyBase) - - - Contig-U15456-1 VFC254P (Link... to Original site) VFC254F 509 VFC254Z 569 VFC254P 1078 - - Show VFC254 Library VF (Link to library) Clone ID VFC254 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15456-1 Original site URL http://dict...mology vs DNA Score E Sequences producing significant alignments: (bits) Value N Y16962 |Y16962.1 Dictyostel...ium discoideum mRNA for cathepsin D. 910 0.0 3 AJ243946 |AJ243946.1 Dictyostelium

  13. Determination of the relative power density distribution in a heterogeneous reactor from the results of measurements of the reactivity effects and the neutron importance function

    International Nuclear Information System (INIS)

    Bobrov, A. A.; Glushkov, E. S.; Zimin, A. A.; Kapitonova, A. V.; Kompaniets, G. V.; Nosov, V. I.; Petrushenko, R. P.; Smirnov, O. N.

    2012-01-01

    A method for experimental determination of the relative power density distribution in a heterogeneous reactor based on measurements of fuel reactivity effects and importance of neutrons from a californium source is proposed. The method was perfected on two critical assembly configurations at the NARCISS facility of the Kurchatov Institute, which simulated a small-size heterogeneous nuclear reactor. The neutron importance measurements were performed on subcritical and critical assemblies. It is shown that, along with traditionally used activation methods, the developed method can be applied to experimental studies of special features of the power density distribution in critical assemblies and reactors.

  14. Nuclear assay of coal. Volume 1. Coal composition by prompt neutron activation analysis: basic experiments. Final report

    International Nuclear Information System (INIS)

    Reynolds, G.; Bozorganesh, H.; Elias, E.; Gozani, T.; Maung, T.; Orphan, V.

    1979-01-01

    Using californium-252 as a source of exciting neutrons, prompt gamma photons emitted by elemental nuclei in the coal have been measured using several detectors, including sodium--iodide and germanium--lithium. Several coal types, including bituminous, subbituminous lignite and anthracite were crushed to various top sizes and analyzed carefully be traditional ASTM wet chemistry techniques at two or three different laboratories. The elements (sulfur, hydrogen, carbon, aluminum, silicon, iron, calcium, sodium, nitrogen, and chlorine) were determined by prompt neutron activations and the quantities compared with those of the wet chemical analyses

  15. PROCEEDINGS OF THE SYMPOSIUM COMMEMORATING THE 25th ANNIVERSARY OF ELEMENTS 97 and 98 HELD ON JAN. 20, 1975

    Energy Technology Data Exchange (ETDEWEB)

    Seaborg, Glenn T.; Street Jr., Kenneth; Thompson, Stanley G.; Ghiorso, Albert

    1976-07-01

    This volume includes the talks given on January 20, 1975, at a symposium in Berkeley on the occasion of the celebration of the 25th anniversary of the discovery of berkelium and californium. Talks were given at this symposium by the four people involved in the discovery of these elements and by a number of people who have made significant contributions in the intervening years to the investigation of their nuclear and chemical properties. The papers are being published here, without editing, in the form in which they were submitted by the authors in the months following the anniversary symposium, and they reflect rather faithfully the remarks made on that occasion.

  16. Radiological safety considerations in the design and operation of the ORNL Transuranium Research Laboratory (TRL)

    International Nuclear Information System (INIS)

    Haynes, C.E.

    1976-01-01

    The Transuranium Research Laboratory (TRL) is the central facility at Oak Ridge National Laboratory (ORNL) for chemical and physical research involving transuranium elements. Transuranium Research Laboratory investigations are about equally divided between studies of inorganic and structural chemistry of the heavy elements and nuclear structure and properties of their isotopes. Elements studied include neptunium, plutonium, americium, curium, berkelium, californium, and einsteinium, each in microgram-to-gram quantities depending upon availability and experimental requirements. This paper describes an eight-step safety procedure followed in planning and approving individual research projects. This procedure should provide an optimum margin of safety and should permit the accomplishment of successful research

  17. Neutron crosstalk between liquid scintillators

    Energy Technology Data Exchange (ETDEWEB)

    Verbeke, J.M., E-mail: verbeke2@llnl.gov; Prasad, M.K., E-mail: prasad1@llnl.gov; Snyderman, N.J., E-mail: snyderman1@llnl.gov

    2015-09-11

    A method is proposed to quantify the fractions of neutrons scattering between liquid scintillators. Using a spontaneous fission source, this method can be utilized to quickly characterize an array of liquid scintillators in terms of crosstalk. The point model theory due to Feynman is corrected to account for these multiple scatterings. Using spectral information measured by the liquid scintillators, fractions of multiple scattering can be estimated, and mass reconstruction of fissile materials under investigation can be improved. Monte Carlo simulations of mono-energetic neutron sources were performed to estimate neutron crosstalk. A californium source in an array of liquid scintillators was modeled to illustrate the improvement of the mass reconstruction.

  18. Method for measuring multiple scattering corrections between liquid scintillators

    Energy Technology Data Exchange (ETDEWEB)

    Verbeke, J.M., E-mail: verbeke2@llnl.gov; Glenn, A.M., E-mail: glenn22@llnl.gov; Keefer, G.J., E-mail: keefer1@llnl.gov; Wurtz, R.E., E-mail: wurtz1@llnl.gov

    2016-07-21

    A time-of-flight method is proposed to experimentally quantify the fractions of neutrons scattering between scintillators. An array of scintillators is characterized in terms of crosstalk with this method by measuring a californium source, for different neutron energy thresholds. The spectral information recorded by the scintillators can be used to estimate the fractions of neutrons multiple scattering. With the help of a correction to Feynman's point model theory to account for multiple scattering, these fractions can in turn improve the mass reconstruction of fissile materials under investigation.

  19. Neutron crosstalk between liquid scintillators

    International Nuclear Information System (INIS)

    Verbeke, J.M.; Prasad, M.K.; Snyderman, N.J.

    2015-01-01

    A method is proposed to quantify the fractions of neutrons scattering between liquid scintillators. Using a spontaneous fission source, this method can be utilized to quickly characterize an array of liquid scintillators in terms of crosstalk. The point model theory due to Feynman is corrected to account for these multiple scatterings. Using spectral information measured by the liquid scintillators, fractions of multiple scattering can be estimated, and mass reconstruction of fissile materials under investigation can be improved. Monte Carlo simulations of mono-energetic neutron sources were performed to estimate neutron crosstalk. A californium source in an array of liquid scintillators was modeled to illustrate the improvement of the mass reconstruction

  20. Beam test of a grid-less multi-harmonic buncher

    International Nuclear Information System (INIS)

    Ostroumov, P.N.; Aseev, V.N.; Barcikowski, A.; Clifft, B.; Pardo, R.; Sharamentov, S.I.; Sengupta, M.

    2008-01-01

    The Argonne Tandem Linear Accelerator System (ATLAS) is the first superconducting heavy-ion linac in the world. Currently ATLAS is being upgraded with the Californium Rare Ion Breeder Upgrade (CARIBU). The latter is a funded project to expand the range of shortlived, neutron-rich rare isotope beams available for nuclear physics research at ATLAS. To avoid beam losses associated with the existing gridded multi-harmonic buncher (MHB), we have developed and built a grid-less four-harmonic buncher with fundamental frequency of 12.125 MHz. In this paper, we report the results of the MHB commissioning and ATLAS beam performance with the new buncher.

  1. Radiation protection data sheet. Radiation protection data sheets for the use of radionuclides in unsealed sources

    International Nuclear Information System (INIS)

    Anon.

    1999-01-01

    These radiation protection data sheet are devoted to responsible persons and employees of various laboratories or medical, pharmaceutical, university and industrial departments where radionuclides are handled as well as all the persons who attend to satisfy in this field. They contain the essential radiation protection data for the use of unsealed sources: physical characteristics, risk assessment, administrative procedures, recommendations, regulations and bibliography. This new series includes the following radionuclides: californium 252, curium 244, gallium 67, indium 113m, plutonium 238, plutonium 239, polonium 210, potassium 42, radium 226, thorium 232, uranium 238 and zinc 65. (O.M.)

  2. Development of a transportable neutron radiography system for non-destructive tests application

    International Nuclear Information System (INIS)

    Silva, Ademir X. da; Crispim, Verginia R.

    1999-01-01

    This paper presents a study of a transportable neutron radiography system utilizing californium-252. Studies about moderation, collimation and shielding are showed. A Monte Carlo Code, MCNP3b, has been used to obtain a maximum and more homogeneous thermal neutron flux in the collimator outlet next to the image plain, and an adequate radiation shielding to attend radiological protection rules. With the presented collimator, it was possible to obtain for the thermal neutron flux, at the collimator outlet and next to the image plain, a L/D ratio 7,5, for neutron flux up to 6 X 10 -6 cm -2 .s -1 per neutron source. (author)

  3. Composition containing transuranic elements for use in the homeopathic treatment of aids

    International Nuclear Information System (INIS)

    Lustig, D.

    1996-01-01

    A homeopathic remedy consisting of a composition containing one or more transuranic elements, particularly plutonium, for preventing and treating acquired immunodeficiency syndrome (AIDS) in humans, as well as seropositivity for human immunodeficiency virus (HIV). Said composition is characterized in that it uses any chemical or isotopic form of one or more transuranic elements (neptunium, plutonium, americium, curium, berkelium, californium or einsteinium), particularly plutonium, said form being diluted and dynamized according to conventional homeopathic methods, particularly the so-called Hahnemann and Korsakov methods, and provided preferably but not exclusively in the form of lactose and/or saccharose globules or granules impregnated with the active principle of said composition. (author)

  4. Determination of alpha activity and fissile mass content in solid waste by systems using neutron interrogation

    International Nuclear Information System (INIS)

    Romeyer Dherbey, J.; Lacruche, G.; Berne, R.; Auge, J.; Martin Deidier, L.; Butez, M.

    1990-01-01

    The Quantitative control (determination of heavy nuclides and alpha activity) of alpha radioactive wastes is necessary, particularly to determine if the waste is in accordance with the surface storage limits. In order to reduce the uncertainty on the alpha activity resulting from unknown isotopic composition, inhomogeneity of heavy nuclides in the matrix, combination of several methods is necessary. In the paper we present the Cadarache development work in the NDA of solid waste using the Californium shuffler, 14 Mev neutron generator, and also passive techniques such as neutron emission measurement and gamma spectrometry. Experimental systems combining active and passive methods are presented (COSAC, BANCO, DANAIDE, PROMETHEE)

  5. Actinides

    International Nuclear Information System (INIS)

    Martinot, L.; Fuger, J.

    1985-01-01

    The oxidation behavior of the actinides is explained on the basis of their electronic structure. The actinide elements, actinium, thorium, protactinium, uranium, neptunium, plutonium, americium, curium, berkelium, californium, einsteinium, fermium, mendelevium, nobelium, and laurencium are included. For all except the last three elements, the points of discussion are oxidation states, Gibbs energies and potentials, and potential diagram for the element in acid solution; and thermodynamic properties of these same elements are tabulated. References are cited following discussion of each element with a total of 97 references being cited. 13 tables

  6. Safety analysis report for packaging: neutron shipping cask, model 4T

    International Nuclear Information System (INIS)

    Peterson, R.T.

    1977-01-01

    This Safety Analysis Report for Packaging demonstrates that the neutron shipping cask can safely transport, in solid or powder form, all isotopes of uranium, plutonium, americium, curium, berkelium, californium, einsteinium, and fermium. The cask and its contents are described. It also evaluates transport conditions, structural parameters (e.g., load resistance, pressure and impact effects, lifting and tiedown devices), and shielding. Finally, it discusses compliance with Chapter 0529 of the Energy Research and Development Administration Manual, Safety Standards for the Packaging of Fissile and Other Radioactive Materials

  7. TOWARD AN IMPROVED UNDERSTANDING OF STRUCTURE AND MAGNETISM IN NEPTUNIUM AND PLUTONIUM PHOSPHONATES AND SULFONATES

    Energy Technology Data Exchange (ETDEWEB)

    Albrecht-Schmitt, Thomas

    2012-03-01

    This grant supported the exploratory synthesis of new actinide materials with all of the actinides from thorium to californium with the exceptions of protactinium and berkelium. We developed detailed structure-property relationships that allowed for the identification of novel materials with selective ion-exchange, selective oxidation, and long-range magnetic ordering. We found novel bonding motifs and identified periodic trends across the actinide series. We identified structural building units that would lead to desired structural features and novel topologies. We also characterized many different spectroscopic trends across the actinide series. The grant support the preparation of approximately 1200 new compounds all of which were structurally characterized.

  8. Neutron beam experiments using nuclear research reactors: honoring the retirement of professor Bernard W. Wehring -II. 5. Testing Moderating Detection Systems with 252Cf-Based Reference Neutron Fields

    International Nuclear Information System (INIS)

    Hertel, Nolan E.; Sweezy, Jeremy; Sauber, Jeremiah S.; Vaughn, David; Cook, Andrew; Tays, Jeff; Ro, Tae-Ik

    2001-01-01

    In recent years, Georgia Institute of Technology (Georgia Tech) has been involved in a number of neutron dosimetry research projects. Several reference neutron fields are now available for such projects. They are all based on the use of a 252 Cf source. The source can be used by itself to create a reference un-moderated 252 Cf neutron field, or it can be placed inside several different moderating assemblies. The spectra created by placing the source inside these assemblies and the un-moderated source are employed to investigate detector and dosimeter responses. Currently, the set of moderators available includes a 30-cm diam cadmium-covered D 2 O spherical shell, a 30-cm-thick iron spherical shell, a 30-cm-diam polyethylene spherical shell, an 18.3-cm-thick tungsten spherical shell, a 16-cm-thick lead spherical shell, and a 9-cm-thick tantalum spherical shell. In addition, the 252 Cf source can be placed inside a neutron howitzer recently constructed at Georgia Tech. The howitzer is a WEP cylinder loaded with boron that has a 10.16-cm-diam cylindrical opening. When the source is placed in the cylindrical penetration of the howitzer, a neutron field ∼30 cm in diameter is created at a distance of 50 cm from the californium source. Over the last few years, Bonner sphere spectrometers using LiI(Eu) scintillators and LiF thermoluminescence dosimeters have been calibrated using this facility at Georgia Tech. Recently, the Neely Nuclear Research Center (NNRC) acquired an LB 6411 neutron probe (product of EG and G Berthold). This probe is designed to measure ambient dose equivalent in accordance with International Commission on Radiological Protection Publication 60 recommendations. It consists of a cylindrical 3 He proportional counter surrounded by a 25-cm-diam spherical polyethylene moderator. Its neutron response is optimized for dose rate measurements of neutrons between thermal energies and 20 MeV (Ref. 5). As a test of the instrument's ability to measure ambient

  9. Citric complexes of trivalent cerium and berkelium

    International Nuclear Information System (INIS)

    Boulhassa, S.

    1977-01-01

    The extraction by thenoyltrifluoroacetone (TTA) in benzene of trivalent cerium, berkelium and californium, at the indicator scale, hydrolysis and complexation by citric acid of these cations are studied. The radionuclides used were 144 Ce, 249 Bk and 249 Cf respectively γ, β and α emitters. The solvent extraction technique of the elements by TTA in benzene from a perchloric medium at the ionic stength 0.1 was employed. The distribution coefficients D were measured by the γ, β or α radiometry. Cerium and berkelium, which have a comparable redox behavior, show in solution a relatively stable valency IV. Therefore the study by solvent extraction of their trivalent form required the standing up of complete reducing conditions of these elements and their stabilization in solution at the valency III. The thermodynamic data obtained for berkelium and californium contribute to understand the chemistry of these elements and permit to complete the third 'tetrad branch' of 5f elements from Cm 3+ to Es 3+ . This tetrad effect is a manifestation of thermodynamic consequence of the 'nephelauxetic effect'. As for Ce(III), the data confirm the pronounced acid property and may be show no neglected ligand effect for f 1 configuration [fr

  10. Radioactive materials production

    International Nuclear Information System (INIS)

    Anon.

    1985-01-01

    The Radiochemical Processing Plant (RPP) at ORNL has served as the national repository and distribution center for 233 U for > 20 years. Several hundred kilograms of uranium, containing approximately 90 to 98% 233 U, are stored there in the form of metal, oxides, and nitrate solutions. All of these uranium materials contain small, but significant, concentrations of 232 U, ranging from 2 to 225 ppm. Most of the radioactivity associated with the 233 U comes from the decay daughters of 232 U (74-year half-life). The 252 Cf Industrial Sales/Loan Program involves loans of 252 Cf neutron sources to agencies of the US Government and sales of 252 Cf as the bulk oxide and as palladium-californium alloy pellets and wires. The program has been operated since 1968 in temporary facilities at the Savannah River Laboratory (SRL). The obsolete hot-cell facilities at SRL are now being decommissioned, and the program activities are being transferred to ORNL's Californium Facility in Bldg. 7930, which is managed by the staff of the Transuranium Processing Plant

  11. An Investigation of the Performance of a Ribbon and Small Planar Magnetic Transducer, Made for Use in Air, as an Underwater Acoustic Velocity Sensor

    Science.gov (United States)

    2016-09-01

    excitation of a sensor by independently calculable means may be possible. For example, pistonphones and electrostatic actuators are common devices for...the model RE-254, shown in Figure 17, which is manufactured by Audio Components DIY in Latvia. The RE-254 employs an aluminum foil, 2.5 microns thick...Aug. 7, 2016. [8] RE-254 ribbon microphone motor for DIY mic project. (n.d.); DiY Audio Components. [Online]. Available: http

  12. ORF Alignment: NC_005296 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ... palustris CGA009] ... Length = 77 ... Query: 195 NRRKVYPESARQTRQQGTASLSFAIGASGEVISYKITRSTGSDALDRAIDS...MMKTARPPP 254 ... NRRKVYPESARQTRQQGTASLSFAIGASGEVISYKITRSTGSDALDRAIDSMMKTA...RPPP Sbjct: 1 ... NRRKVYPESARQTRQQGTASLSFAIGASGEVISYKITRSTGSDALDRAIDSMMKTARPPP 60 ...

  13. ORF Alignment: NT_037436 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ... gb|AAM10986.1| AT04143p [Drosophila melanogaster] ... Length = 254 ... Query: 12 ... STALRLLGANVEL...FGVLTRNPTYRMILDDLEQRGIDISHCTFTDASPPFSTIVQDRWTRR 71 ... STALRLLGANVELFGVLT...RNPTYRMILDDLEQRGIDISHCTFTDASPPFSTIVQDRWTRR Sbjct: 1 ... STALRLLGANVELFGVLTRNPTYRMILDDLEQRGIDISHCTFTDASPPFSTIVQ

  14. Systema Naturae. Classification of living things.

    OpenAIRE

    Alexey Shipunov

    2007-01-01

    Original classification of living organisms containing four kingdoms (Monera, Protista, Vegetabilia and Animalia), 60 phyla and 254 classes, is presented. The classification is based on latest available information.

  15. Book Review: John M. Hobson and Leonard Seabrooke (2007) (eds) Everyday Politics of the World Economy

    DEFF Research Database (Denmark)

    Strange, Michael Stewart

    2009-01-01

    Book Review: John M. Hobson and Leonard Seabrooke (2007) (eds) Everyday Politics of the World Economy (Cambridge: Cambridge University Press), 254pp. Udgivelsesdato: 2009......Book Review: John M. Hobson and Leonard Seabrooke (2007) (eds) Everyday Politics of the World Economy (Cambridge: Cambridge University Press), 254pp. Udgivelsesdato: 2009...

  16. Smart ampholytic ABC block copolypeptide

    Czech Academy of Sciences Publication Activity Database

    Schlaad, H.; Sun, J.; Černoch, Peter; Ruokolainen, J.

    2017-01-01

    Roč. 254, 20 August (2017), s. 79 ISSN 0065-7727. [ACS National Meeting & Exposition /254./. 20.08.2017-24.08.2017, Washington] Institutional support: RVO:61389013 Keywords : block copolypeptide * smart ampholytic Subject RIV: CD - Macromolecular Chemistry OBOR OECD: Polymer science

  17. Interpenetrating polymer network hydrogels based on poly(2-hydroxyethyl methacrylate): morphology effects on formation, swelling, optical, and mechanical properties

    Czech Academy of Sciences Publication Activity Database

    Dušková-Smrčková, Miroslava; Sadakbayeva, Zhansaya; Steinhart, Miloš; Šturcová, Adriana; Pfleger, Jiří; Dušek, Karel

    2017-01-01

    Roč. 254, 20 August (2017), s. 40 ISSN 0065-7727. [ACS National Meeting & Exposition /254./. 20.08.2017-24.08.2017, Washington] Institutional support: RVO:61389013 Keywords : IPN * poly(2-hydroxyethyl methacrylate) * hydrogel Subject RIV: CD - Macromolecular Chemistry OBOR OECD: Polymer science

  18. Learning Preference Models for Autonomous Mobile Robots in Complex Domains

    Science.gov (United States)

    2010-12-01

    templates,” in IEEE/RSJ International Conference on Intelligent Robots and Systems, pp. 167–172, 2009. 128, 153 [254] J. Z. Kolter , P. Abbeel, and A. Y...92] Knepper, R. A. [246] Koller, D. [234] Kolter , J. Z. [254] Konolige, K. [148] Koutsougeras, C. [32] Krotkov, E. [96, 123, 178] Kuffner, J. [252

  19. 78 FR 9056 - Agency Information Collection Activities: Proposed Collection; Comment Request

    Science.gov (United States)

    2013-02-07

    ... agent/brokers provided during training will be used to record their training history through CMS LMS... small business health options plan (SHOP) employers/employees through the Exchange. Additionally, CMS...: Private Sector: Business or other for-profits; Number of Respondents: 254,095; Total Annual Responses: 254...

  20. HPMA-based drug delivery system and its interactions of human serum albumin: SAXS, ITC, and NMR study

    Czech Academy of Sciences Publication Activity Database

    Filippov, Sergey K.; Kaberov, Leonid; Zhang, X.; Niebuur, B.-J.; Chytil, Petr; Etrych, Tomáš; Wieland, F.; Velychkivska, Nadiia; Starovoytova, Larisa; Svergun, D.; Papadakis, C.

    2017-01-01

    Roč. 254, 20 August (2017), s. 455 ISSN 0065-7727. [ACS National Meeting & Exposition /254./. 20.08.2017-24.08.2017, Washington] R&D Projects: GA ČR(CZ) GC15-10527J Institutional support: RVO:61389013 Keywords : HPMA * human serum albumin * SAXS Subject RIV: CF - Physical ; Theoretical Chemistry OBOR OECD: Physical chemistry

  1. Swelling of cross-linked polymers: interpretations and misinterpretations

    Czech Academy of Sciences Publication Activity Database

    Dušek, Karel; Dušková-Smrčková, Miroslava

    2017-01-01

    Roč. 254, 20 August (2017), s. 102 ISSN 0065-7727. [ACS National Meeting & Exposition /254./. 20.08.2017-24.08.2017, Washington] Institutional support: RVO:61389013 Keywords : swelling * cross-linked polymer Subject RIV: CD - Macromolecular Chemistry OBOR OECD: Polymer science

  2. Fiscal consequences of monetary integration within the common economic area: the case of Belarus, Kazakhstan and Russia

    Czech Academy of Sciences Publication Activity Database

    Uzagalieva, Ainura

    -, č. 254 (2005), s. 1-46 ISSN 1211-3298 Institutional research plan: CEZ:AV0Z70850503 Keywords : seigniorage * monetary integration * transition economies Subject RIV: AH - Economics http://www.cerge-ei.cz/pdf/wp/Wp254.pdf

  3. IDENTITY THEFT SERVICES: Services Offer Some Benefits but Are Limited in Preventing Fraud

    Science.gov (United States)

    2017-03-01

    17-254 Identity Theft Services standards. Those standards require that we plan and perform the audit to obtain sufficient, appropriate evidence to... audited financial statements. Page 34 GAO-17-254 Identity Theft Services Although the websites of many identity theft services ...reasonable assurance that significant decisions on the use of identity theft services are appropriately documented. We provided a draft of this

  4. ORF Alignment: NC_003305 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003305 gi|17938192 >1v7zA 16 254 17 254 3e-36 ... ref|NP_534981.1| creatinine amid...ohydrolase [Agrobacterium tumefaciens str. C58] ... gb|AAL45297.1| creatinine amidohydrolase [Agrobac... C58] pir||AC3110 ... creatinine amidohydrolase [imported] - Agrobacterium

  5. ORF Alignment: NC_003063 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003063 gi|15890482 >1v7zA 16 254 17 254 3e-36 ... ref|NP_534981.1| creatinine amid...ohydrolase [Agrobacterium tumefaciens str. C58] ... gb|AAL45297.1| creatinine amidohydrolase [Agrobac... C58] pir||AC3110 ... creatinine amidohydrolase [imported] - Agrobacterium

  6. Novel fluorinated 2-alkyl-2-oxazolines: Three-fold increasing of reactivity in polymerization reaction

    Czech Academy of Sciences Publication Activity Database

    Kaberov, Leonid; Verbraeken, B.; Riabtseva, Anna; Brus, Jiří; Štěpánek, Petr; Hoogenboom, R.; Filippov, Sergey K.

    2017-01-01

    Roč. 254, 20 August (2017), s. 304 ISSN 0065-7727. [ACS National Meeting & Exposition /254./. 20.08.2017-24.08.2017, Washington] R&D Projects: GA ČR(CZ) GC15-10527J Institutional support: RVO:61389013 Keywords : poly-2-oxazolines * triblocks * fluorinated Subject RIV: CF - Physical ; Theoretical Chemistry OBOR OECD: Physical chemistry

  7. Reliability of semiconductor and gas-filled diodes for over-voltage protection exposed to ionizing radiation

    Directory of Open Access Journals (Sweden)

    Stanković Koviljka

    2009-01-01

    Full Text Available The wide-spread use of semiconductor and gas-filled diodes for non-linear over-voltage protection results in a variety of possible working conditions. It is therefore essential to have a thorough insight into their reliability in exploitation environments which imply exposure to ionizing radiation. The aim of this paper is to investigate the influence of irradiation on over-voltage diode characteristics by exposing the diodes to californium-252 combined neutron/gamma radiation field. The irradiation of semiconductor over-voltage diodes causes severe degradation of their protection characteristics. On the other hand, gas-filled over-voltage diodes exhibit a temporal improvement of performance. The results are presented with the accompanying theoretical interpretations of the observed changes in over-voltage diode behaviour, based on the interaction of radiation with materials constituting the diodes.

  8. The CARIBU EBIS control and synchronization system

    Science.gov (United States)

    Dickerson, Clayton; Peters, Christopher

    2015-01-01

    The Californium Rare Isotope Breeder Upgrade (CARIBU) Electron Beam Ion Source (EBIS) charge breeder has been built and tested. The bases of the CARIBU EBIS electrical system are four voltage platforms on which both DC and pulsed high voltage outputs are controlled. The high voltage output pulses are created with either a combination of a function generator and a high voltage amplifier, or two high voltage DC power supplies and a high voltage solid state switch. Proper synchronization of the pulsed voltages, fundamental to optimizing the charge breeding performance, is achieved with triggering from a digital delay pulse generator. The control system is based on National Instruments realtime controllers and LabVIEW software implementing Functional Global Variables (FGV) to store and access instrument parameters. Fiber optic converters enable network communication and triggering across the platforms.

  9. Designing on-line analyzer for coal on belt conveyor using neutron activation technique

    International Nuclear Information System (INIS)

    Rony Djokorayono; Agus Cahyono

    2014-01-01

    Basic design of on-line analyzer for coal on belt conveyor using neutron activation technique has been carried out. Compared with sampling technique, this neutron activation technique has some advantages in term of analysis accuracy and time. The design activities performed include the establishment of design requirements, functional requirements, technical requirements, technical specification, detection sub-system design, data acquisition subsystem design, and operator computer console design. This program will use Nal(Tl) scintillation detector to detect gamma-rays emitted by elements in coal due to neutron activation of a neutron source, "2"5"2Cf (Californium-252). This basic design of on-line analyzer for coal on belt conveyor using neutron activation technique should be followed up with the development of detailed design, prototype construction, and field testing. (author)

  10. Nuclear assay of coal. Volume 8. Continuous nuclear assay of coal (CONAC). Final report

    International Nuclear Information System (INIS)

    Lagarias, J.; Irminger, P.; Dodson, W.

    1979-01-01

    Using californium-252 as a source of exciting neutrons, prompt gamma photons emitted by elemental nuclei in the coal have been measured using several detectors, including sodium-iodide and germanium-lithium. Several coal types, including bituminous, subbituminous lignite and anthracite were crushed to various top sizes and analyzed carefully by traditional ASTM wet chemistry techniques at two or three different laboratories. The elements (sulfur, hydrogen, carbon, aluminum, silicon, iron, calcium, sodium, nitrogen, and chlorine) were determined by prompt neutron activations and the quantities compared with those of the wet chemical analyses. Since satisfactory correlation has been obtained at bench-scale level using 100 to 200 kG samples, an apparatus has been designed to analyze a coal stream of up to 50 ton/hour, at an electric power generating station

  11. Neutron dosimetry and spectrometry with Bonner spheres. Working out a log-normal reference matrix

    International Nuclear Information System (INIS)

    Zaborowski, Henrick.

    1981-11-01

    From the experimental and theoretical studies made upon the BONNER's spheres System with a I 6 Li(Eu) crystal and with a miniaturized 3 He counter we get the normalized energy response functions R*sub(i)(E). This normalization is obtained by the mathematization of the Resolution Function R*(i,E) in the Log-Normal distribution hypothesis to mono energetic neutrons given in April 1976 to the International Symposium on Californium 252. The fit of the Log-Normal Hypothesis with the experimental and Theoretical data is very satisfactory. The parameter's tabulated values allow a precise interpolation, at all energies between 0.4 eV and 15 MeV and for all spheres diameters between 2 and 12 inches, of the discretized R*sub(ij) Reference Matrix for the applications to neutron dosimetry and spectrometry [fr

  12. Experimental survey of the potential energy surfaces associated with fission

    International Nuclear Information System (INIS)

    Britt, H.C.

    1980-01-01

    Progress in the experimental determination of the properties of the potential energy surface associated with fission is reviewed. The importance of nuclear symmetry effects on the calculation of fission widths is demonstrated. Evidence is presented for the fragmentation of the mass-asymmetric second barrier in the thorium region and the axial asymmetric first barrier in the californium region. Detailed analyses of experimental data suggest the presence of two parallel second barriers; the normal mass-asymmetric, axial-symmetric barrier and a slightly higher mass-symmetric, axial-asymmetric barrier. Experimental barrier parameters are determined systematically and compared with calculations from various theoretical models. Techniques for expanding fission probability measurements to higher energies are discussed. (author)

  13. Dynamic vortex dust structures in a nuclear-track plasma

    International Nuclear Information System (INIS)

    Rykov, V A; Khudyakov, A V; Filinov, V S; Vladimirov, V I; Deputatova, L V; Krutov, D V; Fortov, V E

    2003-01-01

    Results are presented from Monte Carlo calculations of the electric charge on dust grains in a plasma produced during the slowing down of radioactive decay products of californium nuclei in neon. The dust grain charging is explained as being due to the drift of electrons and ions in an external electric field. It is shown that the charges of the grains depend on their coordinates and strongly fluctuate with time. The time-averaged grain charges agree with the experimental data obtained on ordered liquid-like dust structures in a nuclear-track plasma. The time-averaged dust grain charges are used to carry out computer modelling of the formation of dynamic vortex structures observed in experiments. Evidence is obtained for the fact that the electrostatic forces experienced by the dust grains are potential in character. The paper is supplemented by a video clip showing the typical dynamics of the simulated vortex dust structure

  14. Operation manual for the INEL on-line mass-separator facility

    International Nuclear Information System (INIS)

    Anderl, R.A.

    1984-06-01

    This report is an operation manual for an on-line mass-separator facility which is located in Building 661 at the Test Reactor Area of the Idaho National Engineering Laboratory. The facility provides mass-separated sources of short-lived fission-product radionuclides whose decay properties can be studied using a variety of nuclear spectroscopic techniques. This facility is unique in that it utilizes the gas-jet technique to transport fission products from a 252 Cf source located in a hot cell to the ion source of the mass separator. This document includes the following: (a) a detailed description of the facility, (b) identification of equipment hazards and safety controls, (c) detailed operating procedures for startup, continuous operation and shutdown, (d) operating procedures for the californium hot cell, and (e) an operator's manual for the automated moving tape collector/data acquisition system. 7 references, 16 figures, 8 tables

  15. Separation of 248Cm (III) from 252Cf (III) and its use in time resolved fluorescence spectroscopic (TRFS) studies

    International Nuclear Information System (INIS)

    Murali, M.S.; Nair, A.G.C.; Gujar, R.B.; Jain, A.; Tomar, B.S.; Godbole, S.V.; Reddy, A.V.R.; Manchanda, V.K.

    2008-07-01

    The present report gives a description of the methodology for the separation of 248 Cm(III) from decayed 252 Cf (III) waste solution. The waste solution was first assayed for 252 Cf content by neutron counting using a neutron well coincidence counter. The sample was subjected to the chemical separation of 248 Cm (III) from 252 Cf (III) following anion and cation exchange chromatography. The alpha spectrum of the separated curium fraction showed peaks due to 246 Cm and 248 Cm while the corresponding alpha spectrum of californium fraction showed 249,250,251,252 Cf. The gamma ray abundances of 249 Cf were determined with respect to its gamma rays of 387 keV and the data agreed well with that in literature. Separated Cm(III) was further characterized by recording its time resolved fluorescence spectrum (TRFS) in aqueous medium. (author)

  16. Decay Curves and Half-Lives of Gamma-Emitting States from a Study of Prompt Fission Gamma Radiation

    Energy Technology Data Exchange (ETDEWEB)

    Albinsson, H [Chalmers Univ. of Technology, Goeteborg (SE)

    1971-04-15

    Measurements were made on the time distributions of the prompt gamma radiation emitted from fragments in the thermal-neutron induced fission of 235U. The gamma radiation emitted during different time intervals after the fission event was studied with the help of a collimator, the position of which was changed along the path of the fragments. In this way decay curves were obtained from which half-lives could be estimated. Time components with half-lives of 7.5, 18 and 60 ps were found and their relative intensities were calculated. Half-lives and associated intensities are in good agreement with earlier data from uranium and californium fission. Problems involved in this type of study are discussed. The collimator technique has proved to be effective for determination of half lives down to less than 10 ps

  17. Utilization of radiation facilities at TNRC for shielding researches and related topics

    Energy Technology Data Exchange (ETDEWEB)

    Akki, T S [Physics Department, Nuclear Physics and Radiation Shielding Division Tajura Nuclear Research Center, Tripoli (Libyan Arab Jamahiriya)

    1997-12-31

    This paper presents the running shielding research activities at Tajura Nuclear research center. The main area of researches are concentrated on the investigation of different types of concrete made from local materials such as conventional concrete, Magnetite-Limonite concrete, and heat resistant concrete. The measuring techniques used were neutron-gamma spectrometry, and activation foils. The measurements were performed using collimated beam of reactor neutrons emitted from one of the horizontal channels, as well as from californium-252 neutron source. The transmitted neutron spectra through concrete barriers of different thicknesses were measured by a scintillation spectrometer with NE-213 liquid organic scintillator. A non-destructive testing of some reactor materials were also carried out using neutron and gamma ray computerized tomography technique (CT). Some experiments were also carried out related to measurements of neutron depth dose distributions inside tissue equivalent materials. 10 figs.

  18. Physical-chemical studies of transuranium elements: Progress report for the period April 1, 1985-March 31, 1988

    International Nuclear Information System (INIS)

    Peterson, J.R.

    1987-01-01

    New knowledge is being accumulated in the role of the 5f electrons in the bonding in actinide elements and compounds, the relationships of metallic structures to metallic valence and radius, the extent and magnitude of the actinide contraction, the magnetic, thermodynamic, spectroscopic, and crystallographic properties of these materials as related to general theories, the effect of self-irradiation on chemical and physical properties, the chemical and physical consequences of radioactive decay in the bulk-phase solid state, and in general, the range of validity of the actinide hypothesis. Separate reports are given on: spectrophotometric studies of Cf(III) ions in lanthanide trihalide hosts, new ternary transplutonium chalcogenide halides, Raman spectrometric studies of lanthanide trihalides as function of T or P, and solution calorimetry of californium halides

  19. Dust grain charges in a nuclear-track plasma and the formation of dynamic vortex dust structures

    International Nuclear Information System (INIS)

    Rykov, V.A.; Khudyakov, A.V.; Filinov, V.S.; Vladimirov, V.I.; Deputatova, L.V.; Krutov, D.V.; Nefedov, A.P.; Fortov, V.E.

    2002-01-01

    Results are presented from Monte Carlo calculations of the electric charge of dust grains in a plasma produced during the slowing down of the radioactive decay products of californium nuclei in neon. The dust grain charging is explained for the first time as being due to the drift of electrons and ions in an external electric field. It is shown that the charges of the grains depend on their coordinates and strongly fluctuate with time. The time-averaged grain charges agree with the experimental data obtained on ordered liquidlike dust structures in a nuclear-track plasma. The time-averaged dust grain charges are used to carry out computer modeling of the formation of dynamic vortex structures observed in experiments. Evidence is obtained of the fact that the electrostatic forces experienced by the dust grains are potential in character

  20. Neutron radiography for nondestructive testing

    International Nuclear Information System (INIS)

    John, J.

    1979-01-01

    Neutron radiography is similar to X-ray inspection in that both depend upon use of radiation that penetrates some materials and is absorbed by others to provide a contrast image of conditions not readily available for visual inspection. X-rays are absorbed by dense materials, such as metals, whereas neutrons readily penetrate metals, but are absorbed by materials containing hydrogen. The neutron radiography has been successfully applied to a number of inspection situations. These include the inspection of explosives, advanced composites, adhesively bonded structures and a number of aircraft engine components. With the availability of Californium-252, it has become feasible to construct mobile neutron radiography systems suitable for field use. Such systems have been used for in-situ inspection of flight line aircraft, particularly to locate and measure hidden corrosion

  1. Microscopic nature of inhomogeneous line broadening: Analysis of the excitation-line-narrowing spectra of Cf4+ in CeF4

    International Nuclear Information System (INIS)

    Liu, G.K.; Huang, J.; Beitz, J.V.

    1993-01-01

    Optical transitions between 5f states of tetravalent californium ion doped (1 metal-atom %) into CeF 4 exhibit unusually large inhomogeneous broadening. The nature of the inhomogeneous broadening in this system has been studied by using fluorescence line narrowing and excitation line narrowing (ELN). It is shown that the energy distributions of different electronic states of Cf 4+ in this system are correlated. In the ELN experiments, reduced excitation linewidth was obtained when selectively monitoring fluorescence emission. A linear relation was observed between the excitation energies of crystal-field states of the 5 G 4' manifold and the fluorescence wavelength monitored across the inhomogeneous profile of a 5 G 6' -- 7 F 6' transition. Analysis of these results by means of a microscopic theory proposed by Laird and Skinner [J. Chem. Phys. 90, 3880 (1989)] has provided insights into the structural properties of this disordered system

  2. Transuranic biokinetic parameters for marine invertebrates--a review.

    Science.gov (United States)

    Ryan, T P

    2002-04-01

    A catalogue of biokinetic parameters for the transuranic elements plutonium, americium, curium, neptunium, and californium in marine invertebrates is presented. The parameters considered are: the seawater-animal concentration factor (CF); the sediment-animal concentration ratio (CR); transuranic assimilation efficiency; transuranic tissue distribution and transuranic elimination rates. With respect to the seawater-animal CF, authors differ considerably on how they define this parameter and a seven-point reporting system is suggested. Transuranic uptake from sediment by animals is characterised by low CRs. The assimilation efficiencies of transuranic elements in marine invertebrates are high compared to vertebrates and mammals in general and the distribution of transuranics within the body tissue of an animal is dependent on the uptake path. The elimination of transuranics from most species examined conformed to a standard biphasic exponential model though some examples with three elimination phases were identified.

  3. Alternative irradiation system for efficiency manganese bath determination

    Energy Technology Data Exchange (ETDEWEB)

    Passos Leite, Sandro, E-mail: sandro@ird.gov.b [Programa de Engenharia Nuclear/COPPE, Universidade Federal do Rio de Janeiro, Ilha do Fundao, Caixa Postal 68509, 21945-970, Rio de Janeiro, RJ (Brazil); Wagner Pereira, Walsan, E-mail: walsan@ird.gov.b [Instituto de Radioprotecao e Dosimetria LNMRI/IRD/CNEN, Av. Salvador Allende, s/no, Recreio dos Bandeirantes, CEP: 22780-160, Rio de Janeiro (Brazil); Xavier da Silva, Ademir, E-mail: ademir@con.ufrj.b [Programa de Engenharia Nuclear/COPPE, Universidade Federal do Rio de Janeiro, Ilha do Fundao, Caixa Postal 68509, 21945-970, Rio de Janeiro, RJ (Brazil); Simoes da Fonseca, Evaldo, E-mail: evaldo@ird.gov.b [Instituto de Radioprotecao e Dosimetria LNMRI/IRD/CNEN, Av. Salvador Allende, s/no, Recreio dos Bandeirantes, CEP: 22780-160, Rio de Janeiro (Brazil); Souza Patrao, Karla Cristina de, E-mail: karla@ird.gov.b [Instituto de Radioprotecao e Dosimetria LNMRI/IRD/CNEN, Av. Salvador Allende, s/no, Recreio dos Bandeirantes, CEP: 22780-160, Rio de Janeiro (Brazil)

    2010-12-15

    An alternative irradiation system, which works with a radionuclide neutron source and manganese sulphate solution volume have been proposed for efficiency determination of a Manganese Bath System (MBS). This irradiation system was designed by simulation with MCNP5 code, considering a californium neutron source in several manganese sulphate volumes and different neutron reflectors. Although its solution specific activity are less than those in nuclear reactors, the simulation results have showed that the irradiation system proposed takes a manganese neutron capture increase up to 200 times when it compared to manganese neutron capture from a MBS whose diameter is about 100 cm. That becomes possible to use those samples for some of the absolute specific activity measuring methods.

  4. The CARIBU EBIS control and synchronization system

    Energy Technology Data Exchange (ETDEWEB)

    Dickerson, Clayton, E-mail: cdickerson@anl.gov; Peters, Christopher, E-mail: cdickerson@anl.gov [Argonne National Laboratory, Argonne, IL 60439 (United States)

    2015-01-09

    The Californium Rare Isotope Breeder Upgrade (CARIBU) Electron Beam Ion Source (EBIS) charge breeder has been built and tested. The bases of the CARIBU EBIS electrical system are four voltage platforms on which both DC and pulsed high voltage outputs are controlled. The high voltage output pulses are created with either a combination of a function generator and a high voltage amplifier, or two high voltage DC power supplies and a high voltage solid state switch. Proper synchronization of the pulsed voltages, fundamental to optimizing the charge breeding performance, is achieved with triggering from a digital delay pulse generator. The control system is based on National Instruments realtime controllers and LabVIEW software implementing Functional Global Variables (FGV) to store and access instrument parameters. Fiber optic converters enable network communication and triggering across the platforms.

  5. Review of microscopic integral cross section data in fundamental reactor dosimetry benchmark neutron fields

    International Nuclear Information System (INIS)

    Fabry, A.; McElroy, W.N.; Kellogg, L.S.; Lippincott, E.P.; Grundl, J.A.; Gilliam, D.M.; Hansen, G.E.

    1976-01-01

    This paper is intended to review and critically discuss microscopic integral cross section measurement and calculation data for fundamental reactor dosimetry benchmark neutron fields. Specifically the review covers the following fundamental benchmarks: the spontaneous californium-252 fission neutron spectrum standard field; the thermal-neutron induced uranium-235 fission neutron spectrum standard field; the (secondary) intermediate-energy standard neutron field at the center of the Mol-ΣΣ, NISUS, and ITN-ΣΣ facilities; the reference neutron field at the center of the Coupled Fast Reactor Measurement Facility; the reference neutron field at the center of the 10% enriched uranium metal, cylindrical, fast critical; the (primary) Intermediate-Energy Standard Neutron Field

  6. Measurements of the neutron capture cross sections and incineration potentials of minor-actinides in high thermal neutron fluxes: Impact on the transmutation of nuclear wastes; Mesures des sections efficaces de capture et potentiels d'incineration des actinides mineurs dans les hauts flux de neutrons: Impact sur la transmutation des dechets

    Energy Technology Data Exchange (ETDEWEB)

    Bringer, O

    2007-10-15

    This thesis comes within the framework of minor-actinide nuclear transmutation studies. First of all, we have evaluated the impact of minor actinide nuclear data uncertainties within the cases of {sup 241}Am and {sup 237}Np incineration in three different reactor spectra: EFR (fast), GT-MHR (epithermal) and HI-HWR (thermal). The nuclear parameters which give the highest uncertainties were thus highlighted. As a result of fact, we have tried to reduce data uncertainties, in the thermal energy region, for one part of them through experimental campaigns in the moderated high intensity neutron fluxes of ILL reactor (Grenoble). These measurements were focused onto the incineration and transmutation of the americium-241, the curium-244 and the californium-249 isotopes. Finally, the values of 12 different cross sections and the {sup 241}Am isomeric branching ratio were precisely measured at thermal energy point. (author)

  7. Environmental assessment of the thermal neutron activation explosive detection system for concourse use at US airports

    Energy Technology Data Exchange (ETDEWEB)

    Jones, C.G.

    1990-08-01

    This document is an environmental assessment of a system designed to detect the presence of explosives in checked airline baggage or cargo. The system is meant to be installed at the concourse or lobby ticketing areas of US commercial airports and uses a sealed radioactive source of californium-252 to irradiate baggage items. The major impact of the use of this system arises from direct exposure of the public to scattered or leakage radiation from the source and to induced radioactivity in baggage items. Under normal operation and the most likely accident scenarios, the environmental impacts that would be created by the proposed licensing action would not be significant. 44 refs., 19 figs., 18 tabs.

  8. Radionuclide toxicity

    International Nuclear Information System (INIS)

    Galle, P.

    1982-01-01

    The aim of this symposium was to review the radionuclide toxicity problems. Five topics were discussed: (1) natural and artificial radionuclides (origin, presence or emission in the environment, human irradiation); (2) environmental behaviour of radionuclides and transfer to man; (3) metabolism and toxicity of radionuclides (radioiodine, strontium, rare gas released from nuclear power plants, ruthenium-activation metals, rare earths, tritium, carbon 14, plutonium, americium, curium and einsteinium, neptunium, californium, uranium) cancerogenous effects of radon 222 and of its danghter products; (4) comparison of the hazards of various types of energy; (5) human epidemiology of radionuclide toxicity (bone cancer induction by radium, lung cancer induction by radon daughter products, liver cancer and leukaemia following the use of Thorotrast, thyroid cancer; other site of cancer induction by radionuclides) [fr

  9. A survey of uses and users of 252Cf

    International Nuclear Information System (INIS)

    Bigelow, J.E.; Alexander, C.W.; King, L.J.; Knauer, J.B.; Notz, K.J.

    1989-01-01

    Californium-252, which is one of the transuranium-element isotopes being produced in the Radiochemical Engineering Development Center (REDC) at Oak Ridge National Laboratory (ORNL), has found many applications in service to industry and medicine. As a neutron source, 252 Cf is unique in providing a highly concentrated and extremely reliable neutron spectrum from a very small assembly. Over the past 22 years, 252 Cf has been applied with great success to cancer therapy, to neutron radiography of objects ranging from flowers to entire aircraft, to startup sources for nuclear reactors, to fission activation assay for quality control and safeguards of all commercial nuclear fuel, and to many other beneficial uses, some of which are now poised for further growth. The extensive exploitation of this highly specialized product has been made possible through 252 Sales/Loan programs sponsored by the US DOE Office of Nuclear Materials Production, initially at the Savannah River Laboratory and now at ORNL

  10. Off-line commissioning of EBIS and plans for its integration into ATLAS and CARIBU

    Energy Technology Data Exchange (ETDEWEB)

    Ostroumov, P. N., E-mail: ostroumov@anl.gov; Barcikowski, A.; Dickerson, C. A.; Mustapha, B.; Perry, A.; Sharamentov, S. I.; Vondrasek, R. C.; Zinkann, G. [Argonne National Laboratory, Argonne, Illinois 60439 (United States)

    2016-02-15

    An Electron Beam Ion Source Charge Breeder (EBIS-CB) has been developed at Argonne to breed radioactive beams from the CAlifornium Rare Isotope Breeder Upgrade (CARIBU) facility at Argonne Tandem Linac Accelerator System (ATLAS). The EBIS-CB will replace the existing ECR charge breeder to increase the intensity and significantly improve the purity of reaccelerated radioactive ion beams. The CARIBU EBIS-CB has been successfully commissioned offline with an external singly charged cesium ion source. The performance of the EBIS fully meets the specifications to breed rare isotope beams delivered from CARIBU. The EBIS is being relocated and integrated into ATLAS and CARIBU. A long electrostatic beam transport system including two 180° bends in the vertical plane has been designed. The commissioning of the EBIS and the beam transport system in their permanent location will start at the end of this year.

  11. Off-line commissioning of EBIS and plans for its integration into ATLAS and CARIBU

    Science.gov (United States)

    Ostroumov, P. N.; Barcikowski, A.; Dickerson, C. A.; Mustapha, B.; Perry, A.; Sharamentov, S. I.; Vondrasek, R. C.; Zinkann, G.

    2016-02-01

    An Electron Beam Ion Source Charge Breeder (EBIS-CB) has been developed at Argonne to breed radioactive beams from the CAlifornium Rare Isotope Breeder Upgrade (CARIBU) facility at Argonne Tandem Linac Accelerator System (ATLAS). The EBIS-CB will replace the existing ECR charge breeder to increase the intensity and significantly improve the purity of reaccelerated radioactive ion beams. The CARIBU EBIS-CB has been successfully commissioned offline with an external singly charged cesium ion source. The performance of the EBIS fully meets the specifications to breed rare isotope beams delivered from CARIBU. The EBIS is being relocated and integrated into ATLAS and CARIBU. A long electrostatic beam transport system including two 180° bends in the vertical plane has been designed. The commissioning of the EBIS and the beam transport system in their permanent location will start at the end of this year.

  12. Chemical consequences of radioactive decay. 1. Study of 249Cf ingrowth into crystalline 249BkBr3: a new crystalline phase of CfBr3

    International Nuclear Information System (INIS)

    Young, J.P.; Haire, R.G.; Peterson, J.R.; Ensor, D.D.; Fellows, R.L.

    1980-01-01

    Spectrophotometric and x-ray powder diffraction methods have been applied to a study of the ingrowth of californium-249 by β - decay of berkelium-249 in crystalline 249 BkBr 3 . It was found that the Cf daughter grows in with the same oxidation state and crystal structure as the parent. Thus, six-coordinate BkBr 3 (AlCl 3 -type monoclinic structure) generates six-coordinate CfBr 3 , and eight-coordinate BkBr 3 (PuBr 3 -type orthorhombic structure) generates eight-coordinate CfBr 3 , a previously unknown form of CfBr 3 . It was also found that the daughter Cf(III) in the BkBr 3 parent compound can be reduced to Cf(II) by treatment with H 2 , as it can in pure CfBr 3 . 5 figures

  13. Chelation and stabilization of berkelium in oxidation state +IV

    Science.gov (United States)

    Deblonde, Gauthier J.-P.; Sturzbecher-Hoehne, Manuel; Rupert, Peter B.; An, Dahlia D.; Illy, Marie-Claire; Ralston, Corie Y.; Brabec, Jiri; de Jong, Wibe A.; Strong, Roland K.; Abergel, Rebecca J.

    2017-09-01

    Berkelium (Bk) has been predicted to be the only transplutonium element able to exhibit both +III and +IV oxidation states in solution, but evidence of a stable oxidized Bk chelate has so far remained elusive. Here we describe the stabilization of the heaviest 4+ ion of the periodic table, under mild aqueous conditions, using a siderophore derivative. The resulting Bk(IV) complex exhibits luminescence via sensitization through an intramolecular antenna effect. This neutral Bk(IV) coordination compound is not sequestered by the protein siderocalin—a mammalian metal transporter—in contrast to the negatively charged species obtained with neighbouring trivalent actinides americium, curium and californium (Cf). The corresponding Cf(III)-ligand-protein ternary adduct was characterized by X-ray diffraction analysis. Combined with theoretical predictions, these data add significant insight to the field of transplutonium chemistry, and may lead to innovative Bk separation and purification processes.

  14. Robotics and remote systems applications

    International Nuclear Information System (INIS)

    Rabold, D.E.

    1996-01-01

    This article is a review of numerous remote inspection techniques in use at the Savannah River (and other) facilities. These include: (1) reactor tank inspection robot, (2) californium waste removal robot, (3) fuel rod lubrication robot, (4) cesium source manipulation robot, (5) tank 13 survey and decontamination robots, (6) hot gang valve corridor decontamination and junction box removal robots, (7) lead removal from deionizer vessels robot, (8) HB line cleanup robot, (9) remote operation of a front end loader at WIPP, (10) remote overhead video extendible robot, (11) semi-intelligent mobile observing navigator, (12) remote camera systems in the SRS canyons, (13) cameras and borescope for the DWPF, (14) Hanford waste tank camera system, (15) in-tank precipitation camera system, (16) F-area retention basin pipe crawler, (17) waste tank wall crawler and annulus camera, (18) duct inspection, and (19) deionizer resin sampling

  15. General purpose nuclear irradiation chamber

    International Nuclear Information System (INIS)

    Nurul Fadzlin Hasbullah; Nuurul Iffah Che Omar; Nahrul Khair Alang Md Rashid; Jaafar Abdullah

    2013-01-01

    Nuclear technology has found a great need for use in medicine, industry, and research. Smoke detectors in our homes, medical treatments and new varieties of plants by irradiating its seeds are just a few examples of the benefits of nuclear technology. Portable neutron source such as Californium-252, available at Industrial Technology Division (BTI/ PAT), Malaysian Nuclear Agency, has a 2.645 year half-life. However, 252 Cf is known to emit gamma radiation from the source. Thus, this chamber aims to provide a proper gamma shielding for samples to distinguish the use of mixed neutron with gamma-rays or pure neutron radiation. The chamber is compatible to be used with other portable neutron sources such as 241 Am-Be as well as the reactor TRIGA PUSPATI for higher neutron dose. This chamber was designed through a collaborative effort of Kulliyyah Engineering, IIUM with the Industrial Technology Division (BTI) team, Malaysian Nuclear Agency. (Author)

  16. Environmental assessment of the thermal neutron activation explosive detection system for concourse use at US airports

    International Nuclear Information System (INIS)

    Jones, C.G.

    1990-08-01

    This document is an environmental assessment of a system designed to detect the presence of explosives in checked airline baggage or cargo. The system is meant to be installed at the concourse or lobby ticketing areas of US commercial airports and uses a sealed radioactive source of californium-252 to irradiate baggage items. The major impact of the use of this system arises from direct exposure of the public to scattered or leakage radiation from the source and to induced radioactivity in baggage items. Under normal operation and the most likely accident scenarios, the environmental impacts that would be created by the proposed licensing action would not be significant. 44 refs., 19 figs., 18 tabs

  17. Test and evaluation results of the 252Cf shuffler at the Savannah River Plant

    International Nuclear Information System (INIS)

    Crane, T.W.

    1981-03-01

    The 252 Cf Shuffler, a nondestructive assay instrument employing californium neutron source irradiation and delayed-neutron counting, was developed for measuring 235 U content of scrap and waste items generated at the Savannah River Plant (SRP) reactor fuel fabrication facility. The scrap and waste items include high-purity uranium-aluminum alloy ingots as well as pieces of castings, saw and lathe chips from machining operations, low-purity items such as oxides of uranium or uranium intermixed with flux materials found in recovery operations, and materials not recoverable at SRP such as floor sweepings or residues from the uranium scrap recovery operation. The uranium contains about 60% 235 U with the remaining isotopes being 236 U, 238 U, and 234 U in descending order. The test and evaluation at SRP concluded that the accuracy, safety, reliability, and ease of use made the 252 Cf Shuffler a suitable instrument for routine use in an industrial, production-oriented plant

  18. Provenance and composition study on Terengganu inscribed stone using in-situ nuclear technology

    International Nuclear Information System (INIS)

    Jaafar Abdullah; Roslan Yahya; Hearie Hassan; Engku Mohd Fahmi Engku Chik; Mohamad Rabaie Shari; Airwan Affendi Mahmood; Abdul Quddoss Abu Bakar; Ainul Mardhiah Terry

    2012-01-01

    This paper focused on the analysis of trace elements and provenance study of the Inscribed Stone of Terengganu (BBPT) using Neutron-induced Prompt Gamma-Ray Techniques (NIPGAT). In this study, portable NIPGAT system was designed and developed by using volume-based measurement. It is a nondestructive testing technique for the samples. This system uses low activity of isotopic neutron radioactive source from californium-252 (Cf-252) as an irradiation source. Gamma ray spectroscopy as well as specialized computer software has been utilized to conduct the research. The study has determined that the stone was a dolerite stone based on the composition of the stone elements. Although most of the scientific data for this study have been collected, this project is still running to complete the scope of provenance study. (author)

  19. Measurements of the neutron capture cross sections and incineration potentials of minor-actinides in high thermal neutron fluxes: Impact on the transmutation of nuclear wastes

    International Nuclear Information System (INIS)

    Bringer, O.

    2007-10-01

    This thesis comes within the framework of minor-actinide nuclear transmutation studies. First of all, we have evaluated the impact of minor actinide nuclear data uncertainties within the cases of 241 Am and 237 Np incineration in three different reactor spectra: EFR (fast), GT-MHR (epithermal) and HI-HWR (thermal). The nuclear parameters which give the highest uncertainties were thus highlighted. As a result of fact, we have tried to reduce data uncertainties, in the thermal energy region, for one part of them through experimental campaigns in the moderated high intensity neutron fluxes of ILL reactor (Grenoble). These measurements were focused onto the incineration and transmutation of the americium-241, the curium-244 and the californium-249 isotopes. Finally, the values of 12 different cross sections and the 241 Am isomeric branching ratio were precisely measured at thermal energy point. (author)

  20. Nuclear fission and the transuranium elements

    International Nuclear Information System (INIS)

    Seaborg, G.T.

    1989-02-01

    Many of the transuranium elements are produced and isolated in large quantities through the use of neutrons furnished by nuclear fission reactions: plutonium (atomic number 94) in ton quantities; neptunium (93), americium (95), and curium (96) in kilogram quantities; berkelium (97) in 100 milligram quantities; californium (98) in gram quantities; and einsteinium (99) in milligram quantities. Transuranium isotopes have found many practical applications---as nuclear fuel for the large-scale generation of electricity, as compact, long-lived power sources for use in space exploration, as means for diagnosis and treatment in the medical area, and as tools in numerous industrial processes. Of particular interest is the unusual chemistry and impact of these heaviest elements on the periodic table. This account will feature these aspects. 9 refs., 5 figs

  1. Operational safety at the radiometallurgy laboratory of Fontenay-aux-Roses

    International Nuclear Information System (INIS)

    Hayet, Lucien; Petit, Pierre; Conche, Roger.

    1976-01-01

    Opened in 1967, the Radiometallurgy Laboratory is responsible for the examination of plutonium 239 based nuclear fuels of breeder reactors such as Rapsodie and Phenix. Part of the same laboratory is also responsible for the manufacture of californium 252 sources. These neutron sources can have a neutron fluency yield of 2,3 10 10 n/s/4π (i.e. 10mg of 252cf). This large laboratory includes a total area of 117m 2 of hot surfaces. It also includes 14 high activity cells with a capacity of 100000Ci at 1MeV. Located only 7km from the center of Paris, it must incorporate a special design and a particularly sure safety policy. Several statistics are given: irradiations, contaminations, incidents, quantity of fissile material, solid and liquid wastes etc... The principles of safety management are outlined and an analysis given of this basic nuclear facility [fr

  2. Review of microscopic integral cross section data in fundamental reactor dosimetry benchmark neutron fields

    International Nuclear Information System (INIS)

    Fabry, A.; McElroy, W.N.; Kellogg, L.S.; Lippincott, E.P.; Grundl, J.A.; Gilliam, D.M.; Hansen, G.E.

    1976-10-01

    The paper is intended to review and critically discuss microscopic integral cross section measurement and calculation data for fundamental reactor dosimetry benchmark neutron fields. Specifically the review covers the following fundamental benchmarks: (1) the spontaneous californium-252 fission neutron spectrum standard field; (2) the thermal-neutron induced uranium-235 fission neutron spectrum standard field; (3) the (secondary) intermediate-energy standard neutron field at the center of the Mol-ΣΣ, NISUS, and ITN--ΣΣ facilities; (4) the reference neutron field at the center of the Coupled Fast Reactor Measurement Facility (CFRMF); (5) the reference neutron field at the center of the 10 percent enriched uranium metal, cylindrical, fast critical; and (6) the (primary) Intermediate-Energy Standard Neutron Field

  3. Triton and alpha-particle contribution from LiF converter for neutron dosimeter

    CERN Document Server

    Camacho, M E; Balcazar, M

    1999-01-01

    A personnel neutron dosimeter prototype based on chemical and electrochemical etched CR-39 detector, combined with LiF converter, has been calibrated using an ICRP-like phantom, under a heavy-water moderated Californium source neutron spectra; A conversion factor of 1.052+-126 spots cm sup - sup 2 mSv sup - sup 1 was obtained. The sealing properties of the detector holder showed a ten-fold reduction in radon background when it was tested in a high radon atmosphere. A convenient mechanical shock resistance was achieved in LiF converters by sintering to 11 tons pressure LiF powder at 650 deg. C, during one hour.

  4. Fabrication of 50-mg 252Cf neutron sources for the FDA [Food and Drug Administration] activation analysis facility

    International Nuclear Information System (INIS)

    Bigelow, J.E.; Cagle, E.B.; Knauer, J.B.

    1987-01-01

    The Transuranium Processing Plant (TPP) at ORNL has been requested by the Food and Drug Administration (FDA) to furnish 200 mg of 252 Cf for use in their new activation analysis facility. This paper discusses the procedure to be employed in fabricating the californium into four neutron sources, each containing a nominal 50-mg of 252 Cf. The ORNL Model LSD (Large, Stainless steel, Doubly encapsulated) neutron source consists of a 6.33-mm-diam aluminum pellet doubly encapsulated in Type 304L stainless steel. The pellet is comprised of an aluminum tube holding Cf 2 O 2 SO 4 microspheres confined by pressed aluminum powder. The microspheres are prepared in a separate vessel and then transferred into the specially designed aluminum tube prior to pressing

  5. Nuclear fission and the transuranium elements

    Energy Technology Data Exchange (ETDEWEB)

    Seaborg, G.T.

    1989-02-01

    Many of the transuranium elements are produced and isolated in large quantities through the use of neutrons furnished by nuclear fission reactions: plutonium (atomic number 94) in ton quantities; neptunium (93), americium (95), and curium (96) in kilogram quantities; berkelium (97) in 100 milligram quantities; californium (98) in gram quantities; and einsteinium (99) in milligram quantities. Transuranium isotopes have found many practical applications---as nuclear fuel for the large-scale generation of electricity, as compact, long-lived power sources for use in space exploration, as means for diagnosis and treatment in the medical area, and as tools in numerous industrial processes. Of particular interest is the unusual chemistry and impact of these heaviest elements on the periodic table. This account will feature these aspects. 9 refs., 5 figs.

  6. Spectrum-averaged cross-section measurement of /sup 103/Rh(n,n)/sup 103m/Rh in the /sup 252/Cf fission neutron spectrum

    International Nuclear Information System (INIS)

    Lamaze, G.P.; Schima, F.J.; Eisenhauer, C.M.; Spiegel, V.

    1988-01-01

    Because of the similarity in energy dependence of the /sup 103/Rh(n,n') differential cross section to the kerma muscle response function for neutrons, rhodium may be useful as a neutron kerma monitor. In support of its use as a neutron monitor, the spectrum-averaged cross section σ-bar has been measured for a /sup 252/Cf fission neutron spectrum. Pairs of thin rhodium samples were irradiated on opposite sides of a thinly encapsulated /sup 252/Cf neutron source. The neutron emission rate of the /sup 252/Cf source was determined by the manganous sulfate (MnSO/sub 4/) bath technique. In this method, the californium source emission rate is determined by comparison to the known emission rate of NBS-I, a standard radium-beryllium neutron source. The neutron fluence incident on the rhodium samples is determined from the californium source strength, average sample-to-source distance, and the duration of the irradiation. Corrections are made for neutron scattering saturation of activity, and attenuation of the X rays by the sample during counting. The X rays were detected with an intrinsic germanium detector designed specifically for low-energy X-ray detection. The activity was not determined by absolute counting so that the final results depend on the value of P/sub Κx/, to total Κ X-ray emission probability. The results of five separate irradiations yield a value of σ-bar . P/sub Κx/ = 62.3 +- 1.9 mb. Using the most recently published value of P/sub Κx/ gives a value of σ-bar = 739 +- 22 mb. A discussion of systematic uncertainties is given

  7. Study of reproducibility of measurements with the spectrometer of Bonner multispheres

    International Nuclear Information System (INIS)

    Azevedo, G.A.; Pereira, W.W.; Patrao, K.C.S.; Fonseca, E.S.

    2013-01-01

    This work aims to study the metrological behavior of the Bonner Multisphere Spectrometer (BMS) of the LN / LNMRI / IRD - Laboratorio Metrologia de Neutrons / Laboratorio Nacional de Metrologia e Radiacao Ionizante / Instituto de Radioprotecao e Dosimetria, for measurements in repeatability and reproducibility conditions. Initially, a simulation was done by applying the Monte Carlo method, using the MCNP code and respecting the ISO 8529-1 (2001), using the sources of Californium ( 252 Cf), Americium-Beryllium ( 241 AmBe) and californium in heavy water (Cf + D 2 O), all located at a distance of 100 cm from the neutron detector ( 6 Li (Eu) - crystal scintillator). In this program, the counting of neutrons that are captured by the detector was made. The source is located in the center of a sphere of radius 300 cm. Analyzes the impact of these neutrons in a point of the sphere wall, which in this case acted as a neutron detector and from there, it is estimated the number of neutrons that collide in the whole sphere. The purpose is to obtain the neutron count for different energy bands in a solid field of neutrons, since they have a spectrum ranging from a low to a high energy that can also vary within a particular environment. Wishes to obtain new fields with different sources and moderators materials to be used as new reference fields. Measurements are being conducted for these fields, with the aim of analyzing the variability conditions of the measurement (repeatability and reproducibility) in LEN - Laboratorio de Espectrometria de Neutrons of the LN/LMNRI/IRD. Thus, the spectrometer will be used to improve both the knowledge of the spectrum as the standard of neutrons of the lab, proving that a spectrometry is essential for correct measurement

  8. Communications dated 15 and 22 March 1994 received from the permanent mission of South Africa to the International Atomic Energy Agency

    International Nuclear Information System (INIS)

    1994-01-01

    The Director General received notes verbales dated 15 and 22 March 1994 from the Permanent Mission of South Africa providing information on the nuclear export policies and practices of the Government of South Africa. These notes verbales contain, in their attachments, copies of the relevant legislation and other documentation pertaining to South Africa's policy to act in accordance with the provisions of INFCIRC/254/Rev.1/Part 1 and INFCIRC/254/Rev.1/Part 1/Mod.1 and INFCIRC/254/Rev.1/Part 2 as amended. The documents are available on request from the Secretariat of the IAEA

  9. 75 FR 39040 - National Register of Historic Places; Notification of Pending Nominations and Related Actions

    Science.gov (United States)

    2010-07-07

    ... Manistee Iron Works Machine Shop, 254 River St., Manistee, 10000477 Wayne County Rosedale Gardens Historic... Berry Morot Car Service Building, (Auto-Related Resources of St. Louis, Missouri [[Page 39041

  10. Genetic diversity and population structure in Meconopsis ...

    African Journals Online (AJOL)

    STORAGESEVER

    2010-05-24

    May 24, 2010 ... The location and main ecological characteristics of sample sites are shown in ..... suggest that this is wind-pollinated and allogamous plant species ... (Teleostei, Characidae) from an urban stream, Hydrobiology, 553: 245-254 ...

  11. Opava (K. Ú. Kateřinky u Opavy, Malé Hoštice, okres Opava). " Na hoštických lukách". LnK. Sídliště. Záchranný výzkum.

    Czech Academy of Sciences Publication Activity Database

    Juchelka, Jiří

    2009-01-01

    Roč. 50, 1-2 (2009), s. 254 ISSN 1211-7250 Institutional research plan: CEZ:AV0Z80010507 Keywords : Czech Silesia * Cultur of linear potter * archaeological research Subject RIV: AC - Archeology, Anthropology, Ethnology

  12. 2018-05-09T14:12:40Z https://www.ajol.info/index.php/all/oai oai:ojs ...

    African Journals Online (AJOL)

    ... by upper respiratory tract (catarrh) 28.3%, typhoid 25.4%, roundworm 14.1% and ... all the girls expressed in terms of standard deviation (Z-score) below median ... including reprints, photographic reproduction and translation are published.

  13. Tuli, Dr Rakesh

    Indian Academy of Sciences (India)

    Date of birth: 21 September 1953. Specialization: Plant Biotechnology, Genetic Engineering and Molecular Biology, Secondary Metabolism Address: Senior Research Adviser, University Institute of Engineering & Technology, Panjab University, Sector 25, Chandigarh 160 014, Panjab Contact: Office: (0172) 254 4107

  14. Assessment of Phaseolus vulgaris L and Vigna unguiculata (L ...

    African Journals Online (AJOL)

    SAM

    2014-04-09

    Apr 9, 2014 ... searching natural compounds with biological activity. .... remain permanently open access under the terms of the Creative Commons Attribution License 4.0 ... (TLC) plate silica gel 60 F254 (Merck 2 × 6 cm), each plate was.

  15. 76 FR 12364 - Agency Information Collection Activities: Bonded Warehouse Regulations

    Science.gov (United States)

    2011-03-07

    ... respondents or record keepers from the collection of information (a total capital/ startup costs and... Total Annual Responses: 9,254. Estimated Time per Response: 32 minutes. Estimated Total Annual Burden...

  16. Magnetically responsive biological materials and their applications

    Czech Academy of Sciences Publication Activity Database

    Šafařík, Ivo; Pospíšková, K.; Baldíková, E.; Šafaříková, Miroslava

    2016-01-01

    Roč. 7, č. 4 (2016), s. 254-261 ISSN 0976-3961 Institutional support: RVO:60077344 Keywords : adsorbents * biological materials * carriers * magnetic modification * whole-cell biocatalyst Subject RIV: EI - Biotechnology ; Bionics

  17. Enforcement and Effectiveness of Consumer Law in the Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Pauknerová, Monika; Skalská, H.

    2017-01-01

    Roč. 7, č. 4 (2017), s. 243-254 ISSN 1805-8396 Institutional support: RVO:68378122 Keywords : consumer law * enforcement * alternative dispute resolution Subject RIV: AG - Legal Sciences OBOR OECD: Law

  18. Antagonistic effects of three species of Trichoderma sp. on ...

    African Journals Online (AJOL)

    Francis

    This research was funded by a grant (Project No. 247) from National ... quantities of protein utilizing the principle of protein-dye binding, Analytical Biochemistry 72, 248-254. ... Innovative approaches to plant disease control. John Wiley &.

  19. Browse Title Index

    African Journals Online (AJOL)

    Items 151 - 200 of 254 ... Vol 28, No 3-4 (2016), Nutrition knowledge of young, post-year one, ... Obstructive Adenoid Hypertrophy in the Adult: A Case Report ... OA Egwuonwu, SNC Anyanwu, EC Ihekwoaba, GU Chianakwana, IBC Iloabachie.

  20. Joint analysis of Rayleigh-wave dispersion and HVSR of lunar seismic data from the Apollo 14 and 16 sites

    Czech Academy of Sciences Publication Activity Database

    Dal Moro, Giancarlo

    2015-01-01

    Roč. 254, JUL 1 (2015), s. 338-349 ISSN 0019-1035 Institutional support: RVO:67985891 Keywords : moon * Regoliths * geophysics * surface- wave Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 3.383, year: 2015

  1. Gender differences in seasonal movement of dice snakes in Histria, southeastern Romania

    Czech Academy of Sciences Publication Activity Database

    Kärvemo, S.; Carlsson, M.; Tudor, M.; Sloboda, M.; Mihalca, A. D.; Ghira, I.; Bel, L.; Modrý, David

    2011-01-01

    Roč. 18, 20 September 2011 (2011), s. 245-254 ISSN 0934-6643 Institutional support: RVO:60077344 Keywords : Squamata * Natrix tessellata * dice snake * seasonal movements * activity patterns * sex ratio Subject RIV: EG - Zoology

  2. ORF Alignment: NT_033779 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available n-like protein CL3 [Periplaneta americana] ... Length = 128 ... Query: 1 ... MVLDNQEDKLLTTTFLKSMGLSFTQSWHH... NT_033779 gi|21357645 >1qddA 26 143 127 254 1e-07 ... dbj|BAA82266.1| Cockroach lecti

  3. Arno Rafael Cederberg ja Eesti ajalooteadus / Hans Kruus

    Index Scriptorium Estoniae

    Kruus, Hans, 1891-1976

    2005-01-01

    Soome ajalooprofessorist Arno Rafael Cederbergist (1885-1948). Tartu Ülikoolis töötades oli tema peamine õppe-ja uurimisaine Eesti ja Põhjamaade ajalugu. Ilm.: Eesti Kirjandus, 1935, nr. 6., lk. 254-255

  4. Arsenic mineralogy of near-neutral soils and mining waste at the Smolotely-Líšnice historical gold district, Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Drahota, P.; Kulakowski, O.; Culka, A.; Knappová, M.; Rohovec, Jan; Veselovský, F.; Racek, M.

    2018-01-01

    Roč. 89, February (2018), s. 243-254 ISSN 0883-2927 Institutional support: RVO:67985831 Keywords : soil * mining waste * pharmacosiderite * yukonite * arseniosiderite Subject RIV: DB - Geology ; Mineralogy OBOR OECD: Mineralogy Impact factor: 2.581, year: 2016

  5. ISSN 2073-9990 East Cent Afr J Surg

    African Journals Online (AJOL)

    Appendicular perforation (25.4%) and gangrenous intussusception (23.8%) were the ... Successful management of peritonitis requires timely surgical intervention to ... perforations (especially peptic ulcer perforations) are more common in ...

  6. Changes in endogenous hormone concentrations during ...

    African Journals Online (AJOL)

    Administrator

    2011-09-14

    Sep 14, 2011 ... The flowering initiation of pineapple plants is affected by the plant weight, ... mediate growth response on external factors such as light and temperature. ... vvv), and the detecting wavelength was 254 nm. Standards of ABA,.

  7. Je to neobyčejně milý člověk, ten znamenitý Einstein! (Reflexe Viktora Trkala ze studijního pobytu na univerzitě v Leidenu v letech 1919-1920)

    Czech Academy of Sciences Publication Activity Database

    Těšínská, Emilie

    2015-01-01

    Roč. 60, č. 3 (2015), s. 239-254 ISSN 0032-2423 Institutional support: RVO:68378114 Keywords : general theory of relativity * Albert Einstein * history of science * Viktor Trkal Subject RIV: AB - History

  8. 14 CFR 103.1 - Applicability.

    Science.gov (United States)

    2010-01-01

    ... the air by a single occupant; (b) Is used or intended to be used for recreation or sport purposes only... than 155 pounds; or (e) If powered: (1) Weighs less than 254 pounds empty weight, excluding floats and...

  9. Download this PDF file

    African Journals Online (AJOL)

    Ayodele Azeez A

    Sample of gypsum from the site was obtained and its physical and chemical properties were determined. It was o ... of sisal fiber showed lower rate of 25.4% water absorbency. The result confirmed ..... Crystal System Habit. Cleavage. Lusture.

  10. (Catharanthus roseus) tissue culture

    African Journals Online (AJOL)

    STORAGESEVER

    2008-08-18

    Aug 18, 2008 ... Abbreviations: NAA, Naphthalen acetic acid; Kin, Kinetin; MS,. Murashige and .... Acidic phase was isolated by sulphuric acid (5%) and ... reaction with Ceric Ammonium Sulfate (CAS) and Ultra violet (UV) detection (λ=254 ...

  11. Johannes Müller, Exile Memories and the Dutch Revolt: The Narrated Diaspora, 1550-1750

    Directory of Open Access Journals (Sweden)

    C.A. (Annemieke Romein

    2017-10-01

    Full Text Available Johannes Müller, Exile Memories and the Dutch Revolt: The Narrated Diaspora, 1550-1750 (Dissertation Leiden University 2014; Leiden/ Boston: Brill. 2016, 254 pp., ISBN 9789004315914.

  12. Glia: the fulcrum of brain diseases

    Czech Academy of Sciences Publication Activity Database

    Giaume, C.; Kirchhoff, F.; Matute, C.; Reichenbach, A.; Verkhratsky, Alexei

    2007-01-01

    Roč. 14, - (2007), s. 1324-1335 ISSN 1350-9047 Institutional research plan: CEZ:AV0Z50390512 Keywords : Glia * Astrocyte * Oligodendrocyte Subject RIV: FH - Neurology Impact factor: 8.254, year: 2007

  13. CAMEX-4 NOAA LYMAN-ALPHA HYGROMETER V1

    Data.gov (United States)

    National Aeronautics and Space Administration — Ozone is measured in situ using a photometer consisting of a mercury lamp, two sample chambers and two detectors. The detectors measure the 254nm radiation...

  14. 2018-05-13T09:08:56Z https://www.ajol.info/index.php/all/oai oai:ojs ...

    African Journals Online (AJOL)

    ... carbon footprint, green and blue water, human nutrition, production systems, ... is a major contributor to global warming resulted mainly from the FAO publication, ... animal production, from environment to human health; 247-254 2221-4062 ...

  15. KWIC Index of nuclear codes (1975 edition)

    International Nuclear Information System (INIS)

    Akanuma, Makoto; Hirakawa, Takashi

    1976-01-01

    It is a KWIC Index for 254 nuclear codes in the Nuclear Code Abstracts (1975 edition). The classification of nuclear codes and the form of index are the same as those in the Computer Programme Library at Ispra, Italy. (auth.)

  16. Using GeoEye-1 Imagery for Multi-Temporal Object-Based Detection of Canegrub Damage in Sugarcane Fields in Queensland, Australia

    KAUST Repository

    Johansen, Kasper; Sallam, Nader; Robson, Andrew; Samson, Peter; Chandler, Keith; Derby, Lisa; Eaton, Allen; Jennings, Jillian

    2017-01-01

    mapping approaches suitable for risk mapping. The GEOBIA mapping approach for canegrub damage detection was evaluated over three selected study sites in Queensland, covering a total of 254 km2 and included five main steps developed in the e

  17. 75 FR 74608 - Airworthiness Directives; CENTRAIR Models 101, 101A, 101P, and 101AP Gliders

    Science.gov (United States)

    2010-12-01

    ....societe.com . You may review copies of the referenced service information at the FAA, Small Airplane..., France; telephone: +33 (0)254 370796; fax: +33 (0)54. 374864; Internet: http://www.societe.com . (3) You...

  18. 48 CFR 3025.7002-3 - Specific application of trade agreements.

    Science.gov (United States)

    2010-10-01

    ...-discriminatory treatment under the World Trade Organization Agreement on Government Procurement (WTO GPA), or any... the WTO GPA, or any FTA listed in (FAR) 48 CFR subpart 25.4, apply the restrictions of (HSAR) 48 CFR...

  19. Carotenoid-protein interaction alters the S1 energy of hydroxyechinenone in the Orange Carotenoid Protein

    Czech Academy of Sciences Publication Activity Database

    Polívka, Tomáš; Chábera, P.; Kerfeld, C.A.

    2013-01-01

    Roč. 1827, č. 3 (2013), s. 248-254 ISSN 0005-2728 Institutional support: RVO:60077344 Keywords : orange-carotenoid protein * excited states * photoprotection Subject RIV: BO - Biophysics Impact factor: 4.829, year: 2013

  20. Protective effects of two Astragalus species on ulcerative colitis in rats

    African Journals Online (AJOL)

    management of UC are corticosteroids, 5- ... toothache, and neck pain, or orally for treating .... Macroscopic assessment of ulcerative colitis ... (version 8) software package (SPSS Inc, USA). ..... University Press, Edinburgh, 1970: 49–254. 6.

  1. Small molecule inhibitors of protein interaction with glycosaminoglycans (SMIGs), a novel class of bioactive agents with anti-inflammatory properties

    Czech Academy of Sciences Publication Activity Database

    Harris, N.; Kogan, F. Y.; Ilková, G.; Juhás, Štefan; Lahmy, O.; Gregor, Y. I.; Koppel, J.; Zhuk, R.; Gregor, P.

    2014-01-01

    Roč. 1840, č. 1 (2014), s. 245-254 ISSN 0304-4165 Institutional support: RVO:67985904 Keywords : heparan sulfate * heparin binding protein * glycosaminoglycan Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 4.381, year: 2014

  2. 78 FR 4381 - Foreign-Trade Zone 45-Portland, Oregon; Application for Reorganization and Expansion Under...

    Science.gov (United States)

    2013-01-22

    ... following sites: Site 1 (1,830 acres)--Rivergate Industrial Park, Port Terminal Nos. 5 and 6, and the... Way and NE Alderwood Road, Portland; Site 3 (254 acres)--Portland Ship Repair Yard, 5555 N. Channel...

  3. Zero-ODP Refrigerants for Low Tonnage Centrifugal Chiller Systems

    National Research Council Canada - National Science Library

    Gui, Fulin

    1996-01-01

    ..., HFC-236cb, HFC-236fa, HFC-245cb, and HFC-254cb, for centrifugal chiller applications. We took into account the thermodynamic properties of the refrigerant and aerodynamic properties of the impeller compression process to this evaluation...

  4. Intact brown seaweed (Ascophyllum nodosum) in diets of weaned piglets: Effects on performance, gut bacteria and morphology and plasma oxidative status

    Czech Academy of Sciences Publication Activity Database

    Michiels, J.; Skřivanová, E.; Missotten, J.; Ovyn, A.; Mrázek, Jakub; De Smet, S.; Dierick, N.

    2012-01-01

    Roč. 96, č. 6 (2012), s. 1101-1111 ISSN 0931-2439 Institutional support: RVO:67985904 Keywords : antioxidant * gut function * weaning piglets Subject RIV: FB - Endocrinology, Diabetology, Metabolism, Nutrition Impact factor: 1.254, year: 2012

  5. 37(4) All.cdr

    African Journals Online (AJOL)

    HP

    . 254 responses or injuries to asphyxia. (Shakespare, 2012). Although overwhelming aspiration of regurgitated contents had been considered a potential cause of instant death in mature bovines (Lopez, 2012, Shakespare,. 2012; McEwen ...

  6. The Association between Oxidative Stress and Metabolic Syndrome in Adults

    OpenAIRE

    Chung, So-Won; Kang, Sung-Goo; Rho, Jun-Seung; Kim, Ha-Na; Song, In-Sun; Lee, Yun-Ah; Heo, Soo-Jeong; Song, Sang-Wook

    2013-01-01

    Background In this Study, we investigated the effects of lifestyle and metabolic syndrome on free oxygen radical levels in men and women in Korea. Methods A total of 254 adults were included in this study from February 2011 to June 2012 at a health promotion center. Information of the lifestyles and presence of metabolic syndrome factors was obtained. Biochemical markers were measured and free oxygen radicals test (FORT) was performed on the blood. Results Of the 254 subjects, 86 (33.9%) had ...

  7. Time resolution measurements with an improved discriminator and conical scintillators

    International Nuclear Information System (INIS)

    McGervey, J.D.; Vogel, J.; Sen, P.; Knox, C.

    1977-01-01

    A new constant fraction discriminator with improved stability and walk characteristics is described. The discriminator was used with RCA C31024 photomultiplier tubes to test scintillators of conical and cylindrical shapes. Conical scintillators of 2.54 cm base diameter, 1.0 cm top diameter, and 2.54 cm height gave a fwhm of 155 ps for 60 Co gamma rays; larger conical scintillators gave an improvement of 10-15% in fwhm over cylindrical scintillators of equal volume. (Auth.)

  8. Regional variation in wood modulus of elasticity (stiffness) and modulus of rupture (strength) of planted loblolly pine in the United States

    Science.gov (United States)

    Antony Finto; Lewis Jordan; Laurence R. Schimleck; Alexander Clark; Ray A. Souter; Richard F. Daniels

    2011-01-01

    Modulus of elasticity (MOE), modulus of rupture (MOR), and specific gravity (SG) are important properties for determining the end-use and value of a piece of lumber. This study addressed the variation in MOE, MOR, and SG with physiographic region, tree height, and wood type. Properties were measured from two static bending samples (dimensions 25.4 mm × 25.4 mm × 406.4...

  9. UV-radiation and the flavonoid content in callus culture of Ononis arvensis L

    International Nuclear Information System (INIS)

    Tumowa, L.; Psotowa, R.

    1998-01-01

    The paper discussed a possible influence on the production of secondary metabolites - the flavonoids, by the method of elicitation in the callus cultures of Ononis arvensis L., the elicitor employed being the UV 254 and 366 nm and the sun-lamp. In some cases there was an increase in the production of flavonoids particularly 60, 120, 240 and 300 s after sun-lamp irradiation and in case of 15 and 30 min irradiation with UV-254 nm

  10. Iranian Influence in Iraqi Shi’a Groups

    Science.gov (United States)

    2012-06-01

    Movement in Iraq, 254. 60 Jabar, The Shīʻite Movement in Iraq, 254. 61 Robert Fisk, The Great War For Civilisation : the Conquest of the Middle East...by Iran in 62 Fisk, The Great War For Civilisation : the Conquest of the Middle East, 647. 63 John...U.S. soldier missing in Iraq. AAH sources indicated that the group was not behind the killing but rather just mediators in the process of returning

  11. Therapeutic Efficacy of the Small Molecule GS-5734 against Ebola virus in Rhesus Monkeys

    Science.gov (United States)

    2016-03-02

    culture. The diastereomeric mixture at phosphorous 858 containing GS-5734 was incubated continuously for 72 h at 1 µM and levels of intracellular NTP...constants (J) in Hertz. Analytical thin–layer chromatography was performed using Merck KGaA Silica gel 60 F254 glassplates with UV visualization. Preparative...trifluoroacetic acid in water and 0.1% trifluoroacetic acid in acetonitrile; flow rate, 2 mL/min; acquisition time, 6 min; wavelength, UV 214 and 254 nm

  12. Crevice Corrosion Behavior of 45 Molybdenum-Containing Stainless Steels in Seawater.

    Science.gov (United States)

    1981-12-01

    Armco, Avesta Jernverks, Cabot, Carpenter Technology, Crucible, Eastern, Firth-Brown, Huntington, Jessup, Langley Alloys, and Uddeholm. 16...Department of Energy, Report ANL/OTEC-BCM-022. 7. Wallen, B., and M. Liljas, " Avesta 254 SMO - A New, High Molybdenum Stainless Steel," presented at NKM8...1977).; 11. Wallen, B., " Avesta 254 SMO - A Stainless Steel for Seawater Service," presented at the Advanced Stainless Steels for Turbine Condensors

  13. Dissolved organic carbon in coral-reef lagoons, by high temperature catalytic oxidation and UV spectrometry

    Science.gov (United States)

    Pagès, Jean; Torréton, Jean-Pascal; Sempéré, Richard

    1997-06-01

    Two surveys were carried out on ten atolls in the Tuamotu archipelago (French Polynesia, Pacific Ocean). In vitro UV (250-400 nm) spectra of water samples gave absorption at 254 nm, A 254, and spectrum slope, S ⋆ (computed from In A λ versus λ).These two descriptors are negatively correlated, and data points are arrayed along a hyperbola spanned between an oceanic pole (high S ⋆, low A 254) and a confined pole (low 5 ⋆, high A 254). Dissolved organic carbon (DOC) concentrations, [C], as assessed by HTCO, exhibit a narrow range (0.7-1.0 mg C.L -1 for most lagoons) contrasting with the wide diversity of optical characteristics. [C] and A 254 are positively correlated, with a significant intercept (0.5 mg C.L -1) representing non-chromophoric DOC. Carbon-specific absorption, ɛ 254 increases (from 0.4 to 1.3 m 2.g -1) with increasing [C], mainly according to the literature) owing to increased average molecular weight (MW) of the chromophoric DOC fraction, which also lowers S ⋆. Our optical data thus illustrate a gradient of confinement (or residence time) that corresponds to a continuum in DOC nature, especially in MW and hence in bioavailability. Optical methods are confirmed as quick and effective means of assessing DOM distribution.

  14. Dimeric Structure of the Blue Light Sensor Protein Photozipper in the Active State.

    Science.gov (United States)

    Ozeki, Kohei; Tsukuno, Hiroyuki; Nagashima, Hiroki; Hisatomi, Osamu; Mino, Hiroyuki

    2018-02-06

    The light oxygen voltage-sensing (LOV) domain plays a crucial role in blue light (BL) sensing in plants and microorganisms. LOV domains are usually associated with the effector domains and regulate the activities of effector domains in a BL-dependent manner. Photozipper (PZ) is monomeric in the dark state. BL induces reversible dimerization of PZ and subsequently increases its affinity for the target DNA sequence. In this study, we report the analyses of PZ by pulsed electron-electron double resonance (PELDOR). The neutral flavin radical was formed by BL illumination in the presence of dithiothreitol in the LOV-C254S (without the bZIP domain) and PZ-C254S mutants, where the cysteine residue responsible for adduct formation was replaced with serine. The magnetic dipole interactions of 3 MHz between the neutral radicals were detected in both LOV-C254S and PZ-C254S, indicating that these mutants are dimeric in the radical state. The PELDOR simulation showed that the distance between the radical pair is close to that estimated from the dimeric crystal structure in the "light state" [Heintz, U., and Schlichting, I. (2016) eLife 5, e11860], suggesting that in the radical state, LOV domains in PZ-C254S form a dimer similar to that of LOV-C254S, which lacks the bZIP domain.

  15. Adaptive changes in NAD+ metabolism in ultraviolet light-irradiated murine lymphoma cells

    International Nuclear Information System (INIS)

    Kleczkowska, H.E.; Szumiel, I.; Althaus, F.R.

    1990-01-01

    We have determined the ability of UV254nm-irradiated murine lymphoma cells to adapt their NAD+ metabolism to the increased NAD+ consumption for the poly ADP-ribosylation of chromatin proteins. Two murine lymphoma sublines with differential UV-sensitivity and poly(ADP-ribose) turnover were used as a model system. The first subline, designated LY-R is UV254nm-sensitive and tumorigenic in DBA/2 mice. The second subline, LY-S is UV254nm-resistant and nontumorigenic. Following treatment of these cells with 2 mM benzamide, an inhibitor of the NAD(+)-utilizing enzyme poly(ADP-ribose) polymerase, NAD+ levels slowly increased up to about 160% of control levels after 3 hours. When benzamide was added to these cultures 20 min after UV254nm irradiation, a dramatic transient increase of NAD+ levels was observed within 4 min in LY-R cells and more moderately in LY-S cells. At later times after UV254nm irradiation, the NAD+ levels increased in both sublines reaching up to 200% of the concentrations prior to benzamide treatment. These results demonstrate an adaptative response of NAD+ metabolism to UV254nm irradiation. In parallel, we observed a differential repartitioning of ADP-ribosyl residues between the NAD+ and poly(ADP-ribose) pools of LY-R and LY-S cells that correlates with the differential UV sensitivity of these cells

  16. A new type-B cask design for transporting 252Cf

    International Nuclear Information System (INIS)

    Simmons, C.M.

    2000-01-01

    A project to design, certify, and build a new US Department of Energy (DOE) Type B container for transporting >5 mg of 252 Cf is more than halfway to completion. This project was necessitated by the fact that the existing Oak Ridge National Laboratory (ORNL) Type B containers were designed and built many years ago and thus do not have the records and supporting data that current regulations require. Once the new cask is available, it will replace the existing Type B containers. The cask design is driven by the unique properties of 252 Cf, which is a very intense spontaneous fission neutron source and necessitates a large amount of neutron shielding. The cask is designed to contain up to 60 mg of 252 Cf in the form of californium oxide or californium oxysulfate, in pellet, wire, or sintered material forms that are sealed inside small special-form capsules. The new cask will be capable of all modes of transport (land, sea, and air). The ORNL team, composed of technical and purchasing personnel and using rigorous selection criteria, chose NAC, International (NAC), as the subcontractor for the project. In January 1997, NAC started work on developing the conceptual design and performing the analyses. The original design concept was for a tungsten alloy gamma shield surrounded by two concentric shells of NS-4-FR neutron shield material. A visit to US Nuclear Regulatory Commission (NRC) regulators in November 1997 to present the conceptual design for their comments resulted in a design modification when the question of potential straight-line cracking in the NS-4-FR neutron shield material arose. NAC's modified design includes offset, wedgelike segments of the neutron shield material. The new geometry eliminates concerns about straight-line cracking but increases the weight of the packaging and makes the fabrication more complex. NAC has now completed the cask design and performed the analyses (shielding, structural, thermal, etc.) necessary to certify the cask. The cask

  17. Transuranium Processing Plant semiannual report of production, status, and plans for period ending June 30, 1975

    Energy Technology Data Exchange (ETDEWEB)

    King, L.J.; Bigelow, J.E.; Collins, E.D.

    1976-03-01

    During the period January 1, 1975, through June 30, 1975, the following amounts of transuranium elements were recovered from 22 irradiated HFIR targets: 2g /sup 243/Am, 59 g /sup 244/Cm, 51 mg /sup 249/Bk, 465 mg /sup 252/Cf, 2.5 mg /sup 253/Es, and 1.4 pg /sup 257/Fm. In addition, 45 mg of high-purity /sup 248/Cm was operated from /sup 252/Cf which had been recovered and purified during earlier periods, and 56 mg of a lower-quality /sup 248/Cm was separated from californium purification rework solutions. Five HFIR targets, each containing approximately 9 g of actinides (predominantly curium), were fabricated. A new long-term projection showed that /sup 252/Cf production in the TRU-HFIR complex could increase to as much as 2.5 g/year. During the next 18 months, we expect to recover totals of 46 mg of /sup 249/Bk, 520 mg of /sup 252/Cf, 2.0 mg of /sup 253/Es (in a mixture of isotopes), 220 ..mu..g of high-purity /sup 253/Es, and 1.6 pg of /sup 257/Fm. We also expect to obtain 125 mg of high-purity /sup 248/Cm from purified californium now in storage. There are no plans to process any of the remaining SRP Pu-Al tubes or to irradiate any plutonium targets in the HFIR; thus, we do not expect to recover any /sup 244/Pu. No changes were made in the chemical processing flowsheets normally used at TRU. Two neutron sources were fabricated, bringing the total fabricated to 77. In special projects, we (1) produced about 1 mg of /sup 250/Cf by irradiation of /sup 249/Bk in HFIR rabbits, and (2) processed some irradiated /sup 248/Cm samples and obtained yield and isotopic composition data for use in determining the capture cross section of /sup 249/Cm in the HFIR. The values that are currently being used for transuranium element decay data and for cross-section data in planning irradiation-processing cycles, calculating production forecasts, and assaying products are tabulated in the Appendix.

  18. Transuranium Processing Plant semiannual report of production, status, and plans for period ending June 30, 1975

    International Nuclear Information System (INIS)

    King, L.J.; Bigelow, J.E.; Collins, E.D.

    1976-03-01

    During the period January 1, 1975, through June 30, 1975, the following amounts of transuranium elements were recovered from 22 irradiated HFIR targets: 2g 243 Am, 59 g 244 Cm, 51 mg 249 Bk, 465 mg 252 Cf, 2.5 mg 253 Es, and 1.4 pg 257 Fm. In addition, 45 mg of high-purity 248 Cm was operated from 252 Cf which had been recovered and purified during earlier periods, and 56 mg of a lower-quality 248 Cm was separated from californium purification rework solutions. Five HFIR targets, each containing approximately 9 g of actinides (predominantly curium), were fabricated. A new long-term projection showed that 252 Cf production in the TRU-HFIR complex could increase to as much as 2.5 g/year. During the next 18 months, we expect to recover totals of 46 mg of 249 Bk, 520 mg of 252 Cf, 2.0 mg of 253 Es (in a mixture of isotopes), 220 μg of high-purity 253 Es, and 1.6 pg of 257 Fm. We also expect to obtain 125 mg of high-purity 248 Cm from purified californium now in storage. There are no plans to process any of the remaining SRP Pu-Al tubes or to irradiate any plutonium targets in the HFIR; thus, we do not expect to recover any 244 Pu. Two neutron sources were fabricated, bringing the total fabricated to 77. Two sources that had been used previously in various projects were returned to the TRU inventory and are available for reassignment. In special projects, we (1) produced about 1 mg of 250 Cf by irradiation of 249 Bk in HFIR rabbits, and (2) processed some irradiated 248 Cm samples and obtained yield and isotopic composition data for use in determining the capture cross section of 249 Cm in the HFIR. The values that are currently being used for transuranium element decay data and for cross-section data in planning irradiation-processing cycles, calculating production forecasts, and assaying products are tabulated in the Appendix

  19. A tetrameric peptide derived from bovine lactoferricin as a potential therapeutic tool for oral squamous cell carcinoma: A preclinical model.

    Directory of Open Access Journals (Sweden)

    Víctor Alfonso Solarte

    Full Text Available Oral squamous cell carcinoma is the fifth most common epithelial cancer in the world, and its current clinical treatment has both low efficiency and poor selectivity. Cationic amphipathic peptides have been proposed as new drugs for the treatment of different types of cancer. The main goal of the present work was to determine the potential of LfcinB(20-254, a tetrameric peptide based on the core sequence RRWQWR of bovine lactoferricin LfcinB(20-25, for the treatment of OSCC. In brief, OSCC was induced in the buccal pouch of hamsters by applying 7,12-Dimethylbenz(aanthracene, and tumors were treated with one of the following peptides: LfcinB(20-254, LfcinB(20-25, or vehicle (control. Lesions were macroscopically evaluated every two days and both histological and serum IgG assessments were conducted after 5 weeks. The size of the tumors treated with LfcinB(20-254 and LfcinB(20-25 was smaller than that of the control group (46.16±4.41 and 33.92±2.74 mm3 versus 88.77±10.61 mm3, respectively. Also, LfcinB(20-254 caused acellularity in the parenchymal tumor compared with LfcinB(20-25 and vehicle treatments. Furthermore, our results demonstrated that both LfcinB(20-254 and LfcinB(20-25 induced higher degree of apoptosis relative to the untreated tumors (75-86% vs 8%, respectively. Moreover, although the lowest inflammatory response was achieved when LfcinB(20-254 was used, this peptide appeared to induce higher levels of IgG antibodies relative to the vehicle and LfcinB(20-25. In addition the cellular damage and selectivity of the LfcinB(20-254 peptide was evaluated in vitro. These assays showed that LfcinB(20-254 triggers a selective necrotic effect in the carcinoma cell line. Cumulatively, these data indicate that LfcinB(20-254 could be considered as a new therapeutic agent for the treatment of OSCC.

  20. Modification of a hydrophobic layer by a point mutation in syntaxin 1A regulates the rate of synaptic vesicle fusion.

    Directory of Open Access Journals (Sweden)

    Robert D Lagow

    2007-04-01

    Full Text Available Both constitutive secretion and Ca(2+-regulated exocytosis require the assembly of the soluble N-ethylmaleimide-sensitive factor attachment protein receptor (SNARE complexes. At present, little is known about how the SNARE complexes mediating these two distinct pathways differ in structure. Using the Drosophila neuromuscular synapse as a model, we show that a mutation modifying a hydrophobic layer in syntaxin 1A regulates the rate of vesicle fusion. Syntaxin 1A molecules share a highly conserved threonine in the C-terminal +7 layer near the transmembrane domain. Mutation of this threonine to isoleucine results in a structural change that more closely resembles those found in syntaxins ascribed to the constitutive secretory pathway. Flies carrying the I254 mutant protein have increased levels of SNARE complexes and dramatically enhanced rate of both constitutive and evoked vesicle fusion. In contrast, overexpression of the T254 wild-type protein in neurons reduces vesicle fusion only in the I254 mutant background. These results are consistent with molecular dynamics simulations of the SNARE core complex, suggesting that T254 serves as an internal brake to dampen SNARE zippering and impede vesicle fusion, whereas I254 favors fusion by enhancing intermolecular interaction within the SNARE core complex.

  1. Estimation of the sub-criticality of the sodium-cooled fast reactor Monju using the modified neutron source multiplication method

    International Nuclear Information System (INIS)

    Truchet, G.; Van Rooijen, W. F. G.; Shimazu, Y.; Yamaguchi, K.

    2012-01-01

    The Modified Neutron Source Method (MNSM) is applied to the Monju reactor. This static method to estimate sub-criticality has already given good results on commercial Pressurized Water Reactors. The MNSM consists both in the extraction of the fundamental mode seen by a detector to avoid the effect of higher modes near sources, and the correction of flux distortion effects due to control rod movement. Among Monju's particularities that have a big influence on MNSM factors are: the presence of two californium sources and the position of the detector which is located far from the core outside of the reactor vessel. The importance of spontaneous fission and (α, n) reactions which have increased during the shutdown period of 15 years will also be discussed. The relative position of detectors and sources deeply affect the correction factors in some regions. In order to evaluate the detector count rate, an analytical propagation has been conducted from the reactor vessel. For two subcritical states, an estimation of the reactivity has been made and compared to experimental data obtained in the restart experiments at Monju (2010). (authors)

  2. Cleanex process: a versatile solvent extraction process for recovery and purification of lanthanides, americium, and curium

    International Nuclear Information System (INIS)

    Bigelow, J.E.; Collins, E.D.; King, L.J.

    1979-01-01

    At a concentration of 1 M in straight-chain hydrocarbon diluent, HDEHP will extract americium, curium, and other trivalent actinide and lanthanide elements from dilute acid or salt solutions. The solute is back-extracted with more concentrated acid, either nitric or hydrochloric. The process has been used in the continuous, countercurrent mode, but its greatest advantage arises in batch extractions where the excess acid can be titrated with NaOH to produce a final acidity of about 0.03 M. Under these conditions, 99% recovery can be achieved, usually in one stage. Cleanex was used on the 50-liter scale at the Transuranium Processing Plant at Oak Ridge for 12 years to provide a broad spectrum cleanup to transuranium elements before applying more sophisticated techniques for separating individual products. The process is also used routinely to recover excessive losses of curium and/or californium from plant waste streams. The solvent system is relatively resistant to radiation damage, being usable up to 200 W-h/liter

  3. Fission-fragment attachment to aerosols and their transport through capillary tubes

    International Nuclear Information System (INIS)

    Novick, V.J.; Alvarez, J.L.; Greenwood, R.C.

    1981-01-01

    The transport of radioactive aerosols was studied using equipment, collectively called the Helium jet, that has been constructed to provide basic nuclear physics data on fission product nuclides. The transport of the fission products in the system depends on their attachment to aerosol particles. The system consists of 1) a tube furnace which generates aerosols by the sublimation or evaporation of source material, 2) a helium stream used to transport the aerosols, 3) a 25 m settling tube to eliminate the larger aerosols and smaller aerosols that would deposit in the capillary, 4) a Californium-252 self-fissioning source of fission product nuclides, and 5) a small capillary to carry the radioactive aerosols from the hot cell to the laboratory. Different source materials were aerosolized but NaCl is generally used because it yielded the highest transport efficiencies through the capillary. Particle size measurments were made with NaCl aerosols by using a cascade impactor, an optical light scattering device, and the capillary itself as a diffusion battery by performing radiation measurements and/or electrical conductivity measurements. Both radioactive and nonradioactive aerosols were measured in order to investigate the possibility of a preferential size range for fission product attachment. The measured size distributions were then used to calculate attachment coefficients and finally an attachment time

  4. Monitoring taconite process streams with thermal neutron capture-gamma ray analysis. Report of investigations/1980

    International Nuclear Information System (INIS)

    Woodbury, F.B.W.

    1980-12-01

    The Bureau of Mines is evaluating alternative technologies to treat oxidized taconites. Since process control is an essential element in the application of these process technologies, research was performed on a prototype monitoring system utilizing a californium-252 (252-Cf) neutron source and a thermal neutron capture-gamma ray spectra analysis method to measure the amount of iron and percent solids in process slurries. The prototype system was used to monitor the concentrate and tailing streams in a 900-lb/hr flotation pilot plant during continuous around-the-clock tests. The iron content of the process slurries was determined by measuring the total peak areas under the capture spectrum peaks at 7.626-7.632 MeV, the associated escape peaks at 7.136-7.122 and 6.626-6.612 MeV, and the iron doublets at 4.900 and 4.998 MeV. A potential method for determining the percent solids in process slurries using the 2.22 MeV hydrogen capture peak is discussed

  5. The significance of chromosome deletions in atomic-bomb survivors

    International Nuclear Information System (INIS)

    Tanaka, Kimio; Shigeta, Chiharu; Oguma, Nobuo; Kamada, Nanao; Deng, Z.; Niimi, Masanobu; Aisaka, Tadaichi.

    1986-01-01

    In 39 A-bomb survivors 40 years after exposure at ≤ 1,000 m from ground zero, the frequency and features of chromosome deletions in peripheral lymphocytes were examined using a differential staining technique. Simultaneously, in vitro irradiation experiment with Cf-252 was made to infer chromosome aberrations occuring immediately after exposure. Californium-252 with 100 rad induced dicentric and ring chromosomes in 40 % of the cells and acentric fragments in 44 %. Among the A-bomb survivors, chromosome aberrations were observed in 651 (21 %) of the total 3,136 cells. There were 146 cells with deletions (22 % of abnormal cells; 5 % of the total cells), and 10 cells with acentric fragment (0.3 % of the total cells). The figure for deletions was far higher than that reported in the literature. A large number of deletions were seen in chromosomes no.4, no.21, and no.22, and a few deletions in chromosomes no.7 and no.20. Significance of chromosome deletions is discussed. (Namekawa, K.)

  6. Time-of-flight mass spectrometry with desorption-ionization multiprobes (UV photons and KeV and MeV particles). Cluster atoms are used as projectiles

    International Nuclear Information System (INIS)

    Brunelle, A.

    1990-09-01

    A new time-of-flight mass spectrometer, Super-Depil, is used to study secondary ion emission from solid surfaces bombarded by various kinds of primary particles. Three different desorption probes were set up on this machine: a 252 californium source, providing by spontaneous fission about 1 MeV/u energy heavy ions, a 5 to 30 keV energy pulsed caesium ion gun and a pulsed nitrogen laser, which wavelength is 337 mm. A two stages electrostatic mirror was added to the spectrometer. The time spread due to the initial kinetic energy of secondary ions leaving the surface was minimized. The mass resolution is greater than 5000. The analysis of glycosidic terpenes showed the complementarity of the three probes. The study of such metastable ions, with the electrostatic mirror, showed that some fragment ions may conserve the memory of the stereochemistry of the neutral lost. Clusters ions were used as projectiles in the energy range 5-60 keV. A strong non linear enhancement was observed in the secondary ion yield from various targets [fr

  7. Measurement of neutron dose and spectra at light-water reactors

    International Nuclear Information System (INIS)

    Soldat, K.L.; Endres, G.W.R.; Cummings, F.M.

    1982-08-01

    In choosing one dosimeter over another, both sensitivity and precision must be addressed. It has been determined that dosimeters employing NTA film lack adequate sensitivity for use inside containment of nuclear plants. From this study, it is apparent that CR-39 and polycarbonate track etch films used without radiators are also inadequate. The rest of the dosimeters tested displayed adequate sensitivity. The two general types of dosimeters which comprise that group are: (1) TLDs and (2) the polycarbonate track etch which was used in conjunction with (n, α) radiators. The precision of the TLD dosimeter depends on the calibration technique and response correction technique. TLD dosimeters calibrated to D 2 O-moderated californium-252 or corrected based on 9- to 3-in. sphere response rates seemed to function best inside reactor containment. Polycarbonate track etch film with (n, α) radiators was found to be sensitive enough for use inside reactor containment; however, the standard deviation for the results was roughly twice the value of the most precise TLD albedo dosimeters. Also, several of the polycarbonate dosimeters saturated, rendering any evaluation impossible

  8. Robotics at Savannah River site: activity report

    International Nuclear Information System (INIS)

    Byrd, J.S.

    1984-09-01

    The objectives of the Robotics Technology Group at the Savannah River Laboratory are to employ modern industrial robots and to develop unique automation and robotic systems to enhance process operations at the Savannah River site (SRP and SRL). The incentives are to improve safety, reduce personnel radiation exposure, improve product quality and productivity, and to reduce operating costs. During the past year robotic systems have been installed to fill chemical dilution vials in a SRP laboratory at 772-F and remove radioactive waste materials in the SRL Californium Production Facility at 773-A. A robotic system to lubricate an extrusion press has been developed and demonstrated in the SRL robotics laboratory and is scheduled for installation at the 321-M fuel fabrication area. A mobile robot was employed by SRP for a radiation monitoring task at a waste tank top in H-Area. Several other robots are installed in the SRL robotics laboratories and application development programs are underway. The status of these applications is presented in this report

  9. Production of medical radioisotopes in the ORNL High Flux Isotope Reactor (HFIR) for cancer treatment and arterial restenosis therapy after PTCA

    International Nuclear Information System (INIS)

    Knapp, F.F. Jr.; Beets, A.L.; Mirzadeh, S.; Alexander, C.W.; Hobbs, R.L.

    1998-01-01

    The High Flux Isotope Reactor (HFIR) at the Oak Ridge National Laboratory (ORNL) represents an important resource for the production of a wide variety of medical radioisotopes. In addition to serving as a key production site for californium-252 and other transuranic elements, important examples of therapeutic radioisotopes which are currently routinely produced in the HFIR for distribution include dysprosium-166 (parent of holmium-166), rhenium-186, tin-117m and tungsten-188 (parent of rhenium-188). The nine hydraulic tube (HT) positions in the central high flux region permit the insertion and removal of targets at any time during the operating cycle and have traditionally represented a major site for production of medical radioisotopes. To increase the irradiation capabilities of the HFIR, special target holders have recently been designed and fabricated which will be installed in the six Peripheral Target Positions (PTP), which are also located in the high flux region. These positions are only accessible during reactor refueling and will be used for long-term irradiations, such as required for the production of tin-117m and tungsten-188. Each of the PTP tubes will be capable of housing a maximum of eight HT targets, thus increasing the total maximum number of HT targets from the current nine, to a total of 57. In this paper the therapeutic use of reactor-produced radioisotopes for bone pain palliation and vascular brachytherapy and the therapeutic medical radioisotope production capabilities of the ORNL HFIR are briefly discussed

  10. Fast neutron tomography with real-time pulse-shape discrimination in organic scintillation detectors

    Energy Technology Data Exchange (ETDEWEB)

    Joyce, Malcolm J., E-mail: m.joyce@lancaster.ac.uk [Department of Engineering, Lancaster University, Lancaster, Lancashire LA1 4YW (United Kingdom); Agar, Stewart [Department of Engineering, Lancaster University, Lancaster, Lancashire LA1 4YW (United Kingdom); Aspinall, Michael D. [Hybrid Instruments Ltd., Gordon Manley Building, Lancaster Environment Centre, Lancaster University, Lancaster LA1 4YW (United Kingdom); Beaumont, Jonathan S.; Colley, Edmund; Colling, Miriam; Dykes, Joseph; Kardasopoulos, Phoevos; Mitton, Katie [Department of Engineering, Lancaster University, Lancaster, Lancashire LA1 4YW (United Kingdom)

    2016-10-21

    A fast neutron tomography system based on the use of real-time pulse-shape discrimination in 7 organic liquid scintillation detectors is described. The system has been tested with a californium-252 source of dose rate 163 μSv/h at 1 m and neutron emission rate of 1.5×10{sup 7} per second into 4π and a maximum acquisition time of 2 h, to characterize two 100×100×100 mm{sup 3} concrete samples. The first of these was a solid sample and the second has a vertical, cylindrical void. The experimental data, supported by simulations with both Monte Carlo methods and MATLAB®, indicate that the presence of the internal cylindrical void, corners and inhomogeneities in the samples can be discerned. The potential for fast neutron assay of this type with the capability to probe hydrogenous features in large low-Z samples is discussed. Neutron tomography of bulk porous samples is achieved that combines effective penetration not possible with thermal neutrons in the absence of beam hardening.

  11. [Fast neutron cross section measurements]: Progress report

    International Nuclear Information System (INIS)

    1988-01-01

    As projected in our previous proposal, the past year on the cross section project at the University of Michigan has been one primarily of construction and assembly of our 14 MeV pulsed Neutron Facility. All the components of the system have now been either purchased or fabricated in our shop facilities and have been assembled in their final configuration. We are now in the process of testing the rf components that have been designed to deliver voltage to both the pulser and buncher stages. We expect that the system will be operational by the end of the current contract year. We have also accomplished the design and construction of several other major pieces of equipment that are needed to begin fast neutron time-of-flight measurements. These include the primary proton recoil detector, and a californium fission chamber needed in the efficiency calibration of the primary detector. We have also added considerable concrete shielding designed to lower the neutron background in the experimental area. 10 figs., 5 tabs

  12. A review of neutron scattering correction for the calibration of neutron survey meters using the shadow cone method

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Sang In; Kim, Bong Hwan; Kim, Jang Lyul; Lee, Jung Il [Health Physics Team, Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of)

    2015-12-15

    The calibration methods of neutron-measuring devices such as the neutron survey meter have advantages and disadvantages. To compare the calibration factors obtained by the shadow cone method and semi-empirical method, 10 neutron survey meters of five different types were used in this study. This experiment was performed at the Korea Atomic Energy Research Institute (KAERI; Daejeon, South Korea), and the calibration neutron fields were constructed using a {sup 252}Californium ({sup 252}Cf) neutron source, which was positioned in the center of the neutron irradiation room. The neutron spectra of the calibration neutron fields were measured by a europium-activated lithium iodide scintillator in combination with KAERI's Bonner sphere system. When the shadow cone method was used, 10 single moderator-based survey meters exhibited a smaller calibration factor by as much as 3.1 - 9.3% than that of the semi-empirical method. This finding indicates that neutron survey meters underestimated the scattered neutrons and attenuated neutrons (i.e., the total scatter corrections). This underestimation of the calibration factor was attributed to the fact that single moderator-based survey meters have an under-ambient dose equivalent response in the thermal or thermal-dominant neutron field. As a result, when the shadow cone method is used for a single moderator-based survey meter, an additional correction and the International Organization for Standardization standard 8529-2 for room-scattered neutrons should be considered.

  13. Transuranium Processing Plant semiannual report of production, status, and plans for period ending December 31, 1976

    International Nuclear Information System (INIS)

    King, L.J.; Bigelow, J.E.; Collins, E.D.

    1977-10-01

    During the period July 1, 1976, through December 31, 1976, transuranium elements were obtained from 11 irradiated HFIR targets; products recovered are 0.3 g 243 Am, 16.6 g 244 Cm, 23 g 249 Bk, 211 g 252 Cf, 1.15 mg 253 Es, and 0.4 pg 247 Fm. Two batches of high-purity 248 Cm were purified chemically for shipment, and another batch containing about 62 mg of 248 Cm was separated from 252 Cf. Thirty shipments were made from TRU during the period; recipients and the amounts of nuclides are listed in tabular form. Nine HFIR targets, each containing 8 to 9 g of curium, were fabricated. The sequence of chemical processing steps used to purify the californium product was changed; this change yielded a shorter recovery time for high-purity 253 Es, which enabled a 50% increase in the amount obtained. Eight neutron sources were fabricated during this report period, bringing the total fabricated to date to 92. Three sources that had previously been returned to TRU were reassigned; two others are also available for reassignment. The values currently being used for transuranium element decay data and for cross-section data in planning irradiation-processing cycles, calculating production forecasts, and assaying products are tabulated in the Appendix

  14. Nuclear Chemistry Institute, Mainz University. Annual Report 1995

    International Nuclear Information System (INIS)

    Denschlag, H.O.

    1996-03-01

    The annual report of the Institut fuer Kernchemie addresses inter alia three main research activities. The first belongs to the area of basic research, covering studies in the fields of nuclear fission, chemistry of the super-heavy elements and of heavy-ion reactions extending from the Coulomb barrier to relativistic energies, and nuclear astrophysics in connection with the ''r process''. By means of laser technology, high-precision data could be measured of the ionization energies of berkelium and californium. Studies of atomic clusters in the vacuum of an ionization trap revealed interesting aspects. The second major activity was devoted to the analysis of environmental media, applying inter alia neutron activation analysis and resonance ionization mass spectroscopy (RIMS). The third activity resulted in the development of novel processes, or the enhancement of existing processes or methods, for applications in basic research work and in environmental analytics. Another item of interest is the summarizing report on the operation of the TRIGA research reactor. (orig./SR) [de

  15. An Account of Oak Ridge National Laboratory's Thirteen Research Reactors

    International Nuclear Information System (INIS)

    Rosenthal, Murray Wilford

    2009-01-01

    The Oak Ridge National Laboratory has built and operated 13 nuclear reactors in its 66-year history. The first was the graphite reactor, the world's first operational nuclear reactor, which served as a plutonium production pilot plant during World War II. It was followed by two aqueous-homogeneous reactors and two red-hot molten-salt reactors that were parts of power-reactor development programs and by eight others designed for research and radioisotope production. One of the eight was an all-metal fast burst reactor used for health physics studies. All of the others were light-water cooled and moderated, including the famous swimming-pool reactor that was copied dozens of times around the world. Two of the reactors were hoisted 200 feet into the air to study the shielding needs of proposed nuclear-powered aircraft. The final reactor, and the only one still operating today, is the High Flux Isotope Reactor (HFIR) that was built particularly for the production of californium and other heavy elements. With the world's highest flux and recent upgrades that include the addition of a cold neutron source, the 44-year-old HFIR continues to be a valuable tool for research and isotope production, attracting some 500 scientific visitors and guests to Oak Ridge each year. This report describes all of the reactors and their histories.

  16. Peculiarities of extraction of carbonate complexes of trivalent transplutonium elements by alkylpyrocatechins

    International Nuclear Information System (INIS)

    Karalova, Z.K.; Bukina, T.I.; Myasoedov, B.F.; Fedorov, L.A.; Sokolovskij, S.A.

    1987-01-01

    Extraction of trivalent americium, curium, californium and europium by technical mixture of mono- and didecylpyrocatechin (TAP) in various diluents from carbonate solutions is investigated. Effect of many factors (pH, K 2 CO 3 concentration, TAP, metal; the time of phase contact) on the completeness of element isolation and separation is clarified. It is ascertained that the elements listed are quantitatively extracted by TAP solution in toluene and cyclohexane in the range of K 2 CO 3 concentrations from 0.25 to 1.5 mol/l. The difference in americium and curium distribution coefficient during their extraction by TAP from 0.25 mol/l of K 2 CO 3 solution is detected. Separation coefficients of the pair increase with the increase of carbonate solution pH. The separation can be improved at the stage of element reextraction by the mixture of K 2 CO 3 and DTPA or EDTA from alkylpyrocatechin, sunce rate constants of americium and curium reextraction differ greatly. Using 13 C NMR the composition of compounds in organic phase on the basis of 4-(α, α-dioctylethyl)pyrocatechin is investigated

  17. The creation of new nuclei

    International Nuclear Information System (INIS)

    Armbruster, P.; Hessberger, F.P.

    1998-01-01

    In the last 60 years physicists have created 20 artificial elements beyond uranium. In 1934 Enrico Fermi predicted the creation of new elements by bombarding atoms with neutrons. This method led to the discovery of neptunium (Z=93), plutonium, americium, curium, berkelium, californium, einsteinium and fermium (Z=100). In fact the capture of a neutron is followed by a beta-decay which increases the atomic number (Z) by one unit. Beyond Z=100 beta-decay no more occurs so a new approach was necessary. Between the American Lawrence Berkeley Laboratory and the Russian Dubna Institute a fierce competition broke out to produce new elements by bombarding transuranium nuclei with light elements such as helium, carbon, nitrogen. This new method required heavy equipment: ion accelerator and detectors but led to the creation of all the elements from Z=101 to Z=106. A new idea was to provoke the fusion of heavy nuclei such as lead and bismuth with colliding argon, nickel or zinc ion beams. This method called 'cold fusion' opened the way to reach the nuclei beyond Z=107. In 1996 the element Z=112 was the last discovered. The next step could be the element Z=114 for which a particular stability is expected. (A.C.)

  18. In-situ elemental analysis of coal by neutron activation

    International Nuclear Information System (INIS)

    Mikesell, J.L.; Senftle, F.E.; Tanner, A.B.

    1986-01-01

    The U.S. Geological Survey (USGS) has worked to develop neutron techniques for the borehole measurement of the elemental composition of ores since 1969, and first demonstrated a borehole ultimate analysis of coal in 1977. Borehole measurements such as these permit real-time evaluation of coal quality without the expense of coring or the delays associated with laboratory analyses. Two technological innovations make such measurements possible: the availability, from Savannah River Operations Office, DOE, of small californium-252 (/sup 252/Cf) fission neutron sources, and the development, by USGS and Princeton Gamma-Techn, of the melting-cryogen-cooled high-purity germanium borehole gamma-ray detector. A technique of relating mass fractions to measured gamma-ray intensities, which eliminates the need for detailed knowledge of the geometry of the neutron distribution, is used to calculate elemental compositions without resorting to the test pits or computer borehole modeling. In coal, all of the major constituents (C, H, N, S, Si, Al, Fe, Ti) except oxygen can be determined quantitatively by thermal neutron capture gamma-ray spectroscopy

  19. Evolution of the Argonne Tandem Linear Accelerator System (ATLAS) control system

    International Nuclear Information System (INIS)

    Power, M.; Munson, F.

    2012-01-01

    Given that the Argonne Tandem Linear Accelerator System (ATLAS) recently celebrated its 25. anniversary, this paper will explore the past, present, and future of the ATLAS Control System, and how it has evolved along with the accelerator and control system technology. ATLAS as we know it today, originated with a Tandem Van de Graff in the sixties. With the addition of the Booster section in the late seventies, came the first computerized control. ATLAS itself was placed into service on June 25, 1985, and was the world's first superconducting linear accelerator for ions. Since its dedication as a National User Facility, more than a thousand experiments by more than 2,000 users worldwide, have taken advantage of the unique capabilities it provides. Today, ATLAS continues to be a user facility for physicists who study the particles that form the heart of atoms. Its most recent addition, CARIBU (Californium Rare Isotope Breeder Upgrade), creates special beams that feed into ATLAS. ATLAS is similar to a living organism, changing and responding to new technological challenges and research needs. As it continues to evolve, so does the control system: from the original days using a DEC PDP-11/34 computer and two CAMAC crates, to a DEC Alpha computer running Vsystem software and more than twenty CAMAC crates, to distributed computers and VME systems. Future upgrades are also in the planning stages that will continue to evolve the control system. (authors)

  20. Report on the workshop "Decay spectroscopy at CARIBU: advanced fuel cycle applications, nuclear structure and astrophysics". 14-16 April 2011, Argonne National Laboratory, USA.

    Energy Technology Data Exchange (ETDEWEB)

    Kondev, F.; Carpenter, M.P.; Chowdhury, P.; Clark, J.A.; Lister, C.J.; Nichols, A.L.; Swewryniak, D. (Nuclear Engineering Division); (Univ. of Massachusetts); (Univ. of Surrey)

    2011-10-06

    A workshop on 'Decay Spectroscopy at CARIBU: Advanced Fuel Cycle Applications, Nuclear Structure and Astrophysics' will be held at Argonne National Laboratory on April 14-16, 2011. The aim of the workshop is to discuss opportunities for decay studies at the Californium Rare Isotope Breeder Upgrade (CARIBU) of the ATLAS facility with emphasis on advanced fuel cycle (AFC) applications, nuclear structure and astrophysics research. The workshop will consist of review and contributed talks. Presentations by members of the local groups, outlining the status of relevant in-house projects and availabile equipment, will also be organized. time will also be set aside to discuss and develop working collaborations for future decay studies at CARIBU. Topics of interest include: (1) Decay data of relevance to AFC applications with emphasis on reactor decay heat; (2) Discrete high-resolution gamma-ray spectroscopy following radioactive decya and related topics; (3) Calorimetric studies of neutron-rich fission framgents using Total ABsorption Gamma-Ray Spectrometry (TAGS) technique; (4) Beta-delayed neutron emissions and related topics; and (5) Decay data needs for nuclear astrophysics.

  1. Actinide metals

    Energy Technology Data Exchange (ETDEWEB)

    Brown, Paul L. [Geochem Australia, Kiama, NSW (Australia); Ekberg, Christian [Chalmers Univ. of Technology, Goeteborg (Sweden). Nuclear Chemistry/Industrial Materials Recycling

    2016-07-01

    All isotopes of actinium are radioactive and exist in aqueous solution only in the trivalent state. There have been very few studies on the hydrolytic reactions of actinium(III). The hydrolysis reactions for uranium would only be important in alkaline pH conditions. Thermodynamic parameters for the hydrolysis species of uranium(VI) and its oxide and hydroxide phases can be determined from the stability and solubility constants. The hydrolytic behaviour of neptunium(VI) is quite similar to that of uranium(VI). The solubility constant of NpO{sub 2}OH(am) has been reported a number of times for both zero ionic strength and in fixed ionic strength media. Americium can form four oxidation states in aqueous solution, namely trivalent, tetravalent, pentavalent and hexavalent. Desire, Hussonnois and Guillaumont determined stability constants for the species AmOH{sup 2+} for the actinides, plutonium(III), americium(III), curium(III), berkelium(III) and californium(III) using a solvent extraction technique.

  2. Test and evaluation of infrared detectors and arrays; Proceedings of the Meeting, Orlando, FL, Mar. 27-29, 1989

    Science.gov (United States)

    Hoke, Forney M.

    Papers on the testing and evaluation of IR detectors and arrays are presented, covering topics such as a short wavelength IR test system, pulse height analysis, the use of an expert system for IR detector testing, low-background IR focal plane testing, electron beam testing, high performance silicide Schottky photodiodes, the SDI organization focal plane test program, the absorption cross section of arsenic in silicon, and long wavelength IR hybrids. Other topics include low background radiometric detector measurements, an ultralow background dewar for IR detector characterization studies, a computer assisted mosaic array test station, a configurable detector array test station, automated detector material characterization capabilities, and a test system for mercury cadmium telluride photoconductor arrays. Additional topics include ionization dosimetry measurements inside a dewar for linac electron and californium-252 neutron environments, a radiation test facility using a variable-flux electron beam source, automated visual inspection of IR focal plane arrays, a titanium cryostat for low temperature radiation effects studies, a low dose rate gamma test facility, and the test and evaluation of stability in IR staring focal plane arrays after nonuniformity correction.

  3. The cross sections of fusion-evaporation reactions: the most promising route to superheavy elements beyond Z=118

    Directory of Open Access Journals (Sweden)

    Jadambaa Khuyagbaatar

    2017-01-01

    Full Text Available The synthesis of superheavy elements beyond oganesson (Og, which has atomic number Z = 118, is currently one of the main topics in nuclear physics. An absence of sufficient amounts of target material with atomic numbers heavier than californium (Z = 98 forces the use of projectiles heavier than 48Ca (Z = 20, which has been successfully used for the discoveries of elements with Z = 114 - 118 in complete fusion reactions. Experimental cross sections of 48Ca with actinide targets behave very differently to “cold” and “hot” fusion-evaporation reactions, where doubly-magic lead and deformed actinides are used as targets, respectively. The known cross sections of these reactions have been analysed compared to calculated fission barriers. It has been suggested that observed discrepancies between the cross sections of 48Ca-induced and other fusionevaporation reactions originate from the shell structure of the compound nucleus, which lies in the island of the stability. Besides scarcely known data on other reactions involving heavier projectiles, the most promising projectile for the synthesis of the elements beyond Og seems to be 50Ti. However, detailed studies of 50Ti, 54Cr, 58Fe and 64Ni-induced reactions are necessary to be performed in order to fully understand the complexities of superheavy element formation.

  4. Activation analysis of stainless steel flux monitors using 252Cf neutron sources

    International Nuclear Information System (INIS)

    Williams, J.G.; Newton, T.H. Jr.; Cogburn, C.O.

    1984-01-01

    Activation analysis was performed on stainless steel beads from a chain which is used in reactor pressure vessel surveillance experiments at the Arkansas Power and Light Company reactors. The beads allow monitoring of two fast and three thermal neutron induced reactions: 58 Ni(n,p) 58 Co, 54 Fe(n,p) 54 Mn, 58 Fe(n,γ) 59 Fe, 59 Co(n,γ) 60 Co and 50 Cr(n,γ) 51 Cr. The analysis was performed using 12 beads from various positions along 5 different batches of chain and standard materials in an H 2 O moderator tank using two intense californium sources which had a total neutron emission rate of 3.97 x 10 10 /s. Semiconductor gamma spectrometers were used to count the products of the above reactions in the specimens. The percentage by weight of the iron, chromium and cobalt in the beads were found to be 62.1%, 20.2% and 0.120%, respectively. The excellent uniformity found in the bead compositions demonstrates the reproducibility of the experimental techniques and enhances considerably the value of the beads as neutron flux montitors

  5. Development of an analytical theory to describe the PNAR and CIPN nondestructive assay techniques

    International Nuclear Information System (INIS)

    Bolind, Alan Michael

    2014-01-01

    Highlights: • Neutron albedo is modeled by a discrete and iterative reflection process. • The theory enables the PNAR and CIPN NDA techniques to be compared quantitatively. • Improvements to the data analysis and to the CIPN instrument design are suggested. • A correction to translate real no-reflection PNAR data into ideal data is provided. - Abstract: This paper develops an analytical theory to describe how neutron albedo (reflection) increases the multiplication of neutrons by a used fuel assembly. With this theory, the two nondestructive assay (NDA) techniques of Passive Neutron Albedo Reactivity (PNAR) and Californium-252 Interrogation with Prompt Neutron Detection (CIPN) can be compared directly. Specifically, the theory derives expressions for the PNAR and CIPN metrics in terms of the physical properties of the used fuel assembly, such as the neutron multiplications and fate probabilities. The theory thus clarifies the interpretation of these two NDA techniques and suggests ways to improve both the design of the NDA instruments and the algorithms for analyzing the measurement results

  6. Design of the low energy beam transport line between CARIBU and the EBIS charge breeder

    Energy Technology Data Exchange (ETDEWEB)

    Perry, A., E-mail: aperry4@hawk.iit.edu [Argonne National Laboratory, Argonne, IL 60439, USA and Illinois Institute of Technology, Chicago, IL 60616 (United States); Ostroumov, P. N.; Barcikowski, A.; Dickerson, C.; Kondrashev, S. A.; Mustapha, B.; Savard, G. [Argonne National Laboratory, Argonne, IL 60439 (United States)

    2015-01-09

    An Electron Beam Ion Source Charge Breeder (EBIS-CB) has been developed to breed radioactive beams from the CAlifornium Rare Isotope Breeder Upgrade (CARIBU) facility at ATLAS. The EBIS-CB will replace the existing ECR charge breeder to increase the intensity and improve the purity of reaccelerated radioactive ion beams. The EBIS-CB is in the final stage of off-line commissioning. Currently, we are developing a low energy beam transport (LEBT) system to transfer CARIBU beams to the EBIS-CB. As was originally planned, an RFQ cooler-buncher will precede the EBIS-CB. Recently, it was decided to include a multi-reflection time-of-flight (MR-TOF) mass-spectrometer following the RFQ. MR-TOF is a relatively new technology used to purify beams with a mass-resolving power up to 3×10{sup 5} as was demonstrated in experiments at CERN/ISOLDE. Very high purity singly-charged radioactive ion beams will be injected into the EBIS for charge breeding and due to its inherent properties, the EBIS-CB will maintain the purity of the charge bred beams. Possible contamination of residual gas ions will be greatly suppressed by achieving ultra-high vacuum in the EBIS trap. This paper will present and discuss the design of the LEBT and the overall integration of the EBIS-CB into ATLAS.

  7. Neutron Detector Signal Processing to Calculate the Effective Neutron Multiplication Factor of Subcritical Assemblies

    Energy Technology Data Exchange (ETDEWEB)

    Talamo, Alberto [Argonne National Lab. (ANL), Argonne, IL (United States). Nuclear Engineering Division; Gohar, Yousry [Argonne National Lab. (ANL), Argonne, IL (United States). Nuclear Engineering Division

    2016-06-01

    This report describes different methodologies to calculate the effective neutron multiplication factor of subcritical assemblies by processing the neutron detector signals using MATLAB scripts. The subcritical assembly can be driven either by a spontaneous fission neutron source (e.g. californium) or by a neutron source generated from the interactions of accelerated particles with target materials. In the latter case, when the particle accelerator operates in a pulsed mode, the signals are typically stored into two files. One file contains the time when neutron reactions occur and the other contains the times when the neutron pulses start. In both files, the time is given by an integer representing the number of time bins since the start of the counting. These signal files are used to construct the neutron count distribution from a single neutron pulse. The built-in functions of MATLAB are used to calculate the effective neutron multiplication factor through the application of the prompt decay fitting or the area method to the neutron count distribution. If the subcritical assembly is driven by a spontaneous fission neutron source, then the effective multiplication factor can be evaluated either using the prompt neutron decay constant obtained from Rossi or Feynman distributions or the Modified Source Multiplication (MSM) method.

  8. MCNPX, MONK, and ERANOS analyses of the YALINA Booster subcritical assembly

    Energy Technology Data Exchange (ETDEWEB)

    Talamo, Alberto, E-mail: alby@anl.go [Argonne National Laboratory, 9700 S. Cass Avenue, Argonne, IL 60439 (United States); Gohar, Y.; Aliberti, G.; Cao, Y.; Smith, D.; Zhong, Z. [Argonne National Laboratory, 9700 S. Cass Avenue, Argonne, IL 60439 (United States); Kiyavitskaya, H.; Bournos, V.; Fokov, Y.; Routkovskaya, C.; Serafimovich, I. [Joint Institute for Power and Nuclear Research - Sosny, National Academy of Sciences of Belarus, 99 Acad. Krasin Str., Minsk 220109 (Belarus)

    2011-05-15

    This paper compares the numerical results obtained from various nuclear codes and nuclear data libraries with the YALINA Booster subcritical assembly (Minsk, Belarus) experimental results. This subcritical assembly was constructed to study the physics and the operation of accelerator-driven subcritical systems (ADS) for transmuting the light water reactors (LWR) spent nuclear fuel. The YALINA Booster facility has been accurately modeled, with no material homogenization, by the Monte Carlo codes MCNPX (MCNP/MCB) and MONK. The MONK geometrical model matches that of MCNPX. The assembly has also been analyzed by the deterministic code ERANOS. In addition, the differences between the effective neutron multiplication factor and the source multiplication factors have been examined by alternative calculational methodologies. The analyses include the delayed neutron fraction, prompt neutron lifetime, generation time, neutron flux profiles, and spectra in various experimental channels. The accuracy of the numerical models has been enhanced by accounting for all material impurities and the actual density of the polyethylene material used in the assembly (the latter value was obtained by dividing the total weight of the polyethylene by its volume in the numerical model). There is good agreement between the results from MONK, MCNPX, and ERANOS. The ERANOS results show small differences relative to the other results because of material homogenization and the energy and angle discretizations.The MCNPX results match the experimental measurements of the {sup 3}He(n,p) reaction rates obtained with the californium neutron source.

  9. Importance of (n,xn) reactions in evaluating kinetic parameters of subcritical assemblies: from classic to modern formalism

    Energy Technology Data Exchange (ETDEWEB)

    Talamo, Alberto; Gohar, Yousry, E-mail: alby@anl.gov [Argonne National Laboratory, Lemont, IL (United States); Dulla, Sandra; Ravetto, Piero [Politecnico di Torino (Italy)

    2011-07-01

    The importance of (n,xn) reactions must be taken into consideration while calculating the kinetic parameters of subcritical assemblies driven by an external neutron source. This study is divided into two parts, the first part is dedicated to the classic definition of the neutron source multiplication factor and two alternative calculation methodologies are compared. The second part considers a new definition of the kinetic parameters for subcritical assemblies, with particular emphasis on the delayed neutron fraction and generation time. This new definition has been modified to take into account the external neutron source and (n,xn) reactions, which increase the fraction of prompt neutrons. The developed theoretical framework has been applied by Monte Carlo and deterministic calculations to the YALINA Thermal subcritical assembly in Belarus. This facility can be driven by californium, deuterium-deuterium (D-D), or deuterium-tritium (D-T) external neutron sources. For the D-T neutron source, (n,xn) reactions must be taken into account in order to produce accurate results because the average energy of D-T source neutrons is 14.1 MeV, a value much higher than the threshold energy of the (n,2n) cross section of uranium isotopes. (author)

  10. Neutron Detector Signal Processing to Calculate the Effective Neutron Multiplication Factor of Subcritical Assemblies

    International Nuclear Information System (INIS)

    Talamo, Alberto; Gohar, Yousry

    2016-01-01

    This report describes different methodologies to calculate the effective neutron multiplication factor of subcritical assemblies by processing the neutron detector signals using MATLAB scripts. The subcritical assembly can be driven either by a spontaneous fission neutron source (e.g. californium) or by a neutron source generated from the interactions of accelerated particles with target materials. In the latter case, when the particle accelerator operates in a pulsed mode, the signals are typically stored into two files. One file contains the time when neutron reactions occur and the other contains the times when the neutron pulses start. In both files, the time is given by an integer representing the number of time bins since the start of the counting. These signal files are used to construct the neutron count distribution from a single neutron pulse. The built-in functions of MATLAB are used to calculate the effective neutron multiplication factor through the application of the prompt decay fitting or the area method to the neutron count distribution. If the subcritical assembly is driven by a spontaneous fission neutron source, then the effective multiplication factor can be evaluated either using the prompt neutron decay constant obtained from Rossi or Feynman distributions or the Modified Source Multiplication (MSM) method.

  11. MCNPX, MONK, and ERANOS analyses of the YALINA Booster subcritical assembly

    International Nuclear Information System (INIS)

    Talamo, Alberto; Gohar, Y.; Aliberti, G.; Cao, Y.; Smith, D.; Zhong, Z.; Kiyavitskaya, H.; Bournos, V.; Fokov, Y.; Routkovskaya, C.; Serafimovich, I.

    2011-01-01

    This paper compares the numerical results obtained from various nuclear codes and nuclear data libraries with the YALINA Booster subcritical assembly (Minsk, Belarus) experimental results. This subcritical assembly was constructed to study the physics and the operation of accelerator-driven subcritical systems (ADS) for transmuting the light water reactors (LWR) spent nuclear fuel. The YALINA Booster facility has been accurately modeled, with no material homogenization, by the Monte Carlo codes MCNPX (MCNP/MCB) and MONK. The MONK geometrical model matches that of MCNPX. The assembly has also been analyzed by the deterministic code ERANOS. In addition, the differences between the effective neutron multiplication factor and the source multiplication factors have been examined by alternative calculational methodologies. The analyses include the delayed neutron fraction, prompt neutron lifetime, generation time, neutron flux profiles, and spectra in various experimental channels. The accuracy of the numerical models has been enhanced by accounting for all material impurities and the actual density of the polyethylene material used in the assembly (the latter value was obtained by dividing the total weight of the polyethylene by its volume in the numerical model). There is good agreement between the results from MONK, MCNPX, and ERANOS. The ERANOS results show small differences relative to the other results because of material homogenization and the energy and angle discretizations.The MCNPX results match the experimental measurements of the 3 He(n,p) reaction rates obtained with the californium neutron source.

  12. Importance of (n,xn) reactions in evaluating kinetic parameters of subcritical assemblies: from classic to modern formalism

    International Nuclear Information System (INIS)

    Talamo, Alberto; Gohar, Yousry; Dulla, Sandra; Ravetto, Piero

    2011-01-01

    The importance of (n,xn) reactions must be taken into consideration while calculating the kinetic parameters of subcritical assemblies driven by an external neutron source. This study is divided into two parts, the first part is dedicated to the classic definition of the neutron source multiplication factor and two alternative calculation methodologies are compared. The second part considers a new definition of the kinetic parameters for subcritical assemblies, with particular emphasis on the delayed neutron fraction and generation time. This new definition has been modified to take into account the external neutron source and (n,xn) reactions, which increase the fraction of prompt neutrons. The developed theoretical framework has been applied by Monte Carlo and deterministic calculations to the YALINA Thermal subcritical assembly in Belarus. This facility can be driven by californium, deuterium-deuterium (D-D), or deuterium-tritium (D-T) external neutron sources. For the D-T neutron source, (n,xn) reactions must be taken into account in order to produce accurate results because the average energy of D-T source neutrons is 14.1 MeV, a value much higher than the threshold energy of the (n,2n) cross section of uranium isotopes. (author)

  13. Interface detection by neutron scattering

    International Nuclear Information System (INIS)

    De Monchy, A.R.; Kok, C.A.; Dorrepaal, J.

    1979-01-01

    A method and apparatus for detecting an interface of materials having different hydrogen content present in a metal vessel or pipe eg. made of steel, are described. Steel walls of columns, reactors, pipelines etc can be monitored. It is very suitable for detection of liquid water or hydrocarbons present in gas pipelines and also for the detection of a liquid hydrocarbon in a vessel or column. A series of measurements of the hydrogen density of the contents of a vessel or pipe are made using at least one californium-252 neutron source located near the outer side of the pipe. Neutrons are emitted and are scattered by the contents of the pipe. At least one neutron detector is located near the outer side of the metal wall. The detectors have a higher sensitivity for scattered neutrons (from the light hydrogen nuclei present in water or hydrocarbons). A source of 0.1 - 1 micrograms produces enough neutrons for most technical applications so the handling is relatively safe although shielding is advocated. The detectors contain helium-3 at a pressure of about 10 bar. Current pulses from the detector are counted. (U.K.)

  14. Toward achieving flexible and high sensitivity hexagonal boron nitride neutron detectors

    Science.gov (United States)

    Maity, A.; Grenadier, S. J.; Li, J.; Lin, J. Y.; Jiang, H. X.

    2017-07-01

    Hexagonal boron nitride (h-BN) detectors have demonstrated the highest thermal neutron detection efficiency to date among solid-state neutron detectors at about 51%. We report here the realization of h-BN neutron detectors possessing one order of magnitude enhancement in the detection area but maintaining an equal level of detection efficiency of previous achievement. These 3 mm × 3 mm detectors were fabricated from 50 μm thick freestanding and flexible 10B enriched h-BN (h-10BN) films, grown by metal organic chemical vapor deposition followed by mechanical separation from sapphire substrates. Mobility-lifetime results suggested that holes are the majority carriers in unintentionally doped h-BN. The detectors were tested under thermal neutron irradiation from californium-252 (252Cf) moderated by a high density polyethylene moderator. A thermal neutron detection efficiency of ˜53% was achieved at a bias voltage of 200 V. Conforming to traditional solid-state detectors, the realization of h-BN epilayers with enhanced electrical transport properties is the key to enable scaling up the device sizes. More specifically, the present results revealed that achieving an electrical resistivity of greater than 1014 Ωṡcm and a leakage current density of below 3 × 10-10 A/cm2 is needed to fabricate large area h-BN detectors and provided guidance for achieving high sensitivity solid state neutron detectors based on h-BN.

  15. Neutron activation determination of gold in technogenic raw materials with different mineral composition

    Directory of Open Access Journals (Sweden)

    Yudakov Aleksandr A.

    2015-01-01

    Full Text Available The methods used to determine the gold content in the technogenic objects of gold mining were analyzed regarding their non-homogeneity and complexity of chemical and mineral compositions. A possible application of the neutron activation analysis with the use of the californium source of neutrons for determining the content of fine-grained and extra-fine-grained gold in the technogenic objects, including the bottom-ash waste of energy providers, is considered. It was demonstrated that the chemical composition of the sample affects the neuron flux distribution in the sample, which can essentially distort the results of the neutron activation analysis. In order to eliminate possible systematic errors investigations of the effect of the sample mineral composition on the results of the gold determination using the neutron activation analysis were carried out. Namely, a large mass of rock (3-5 kg was loaded into an activation zone using four matrix types such as silicate, carbon-containing, iron-containing, and titanium magnetite. It was shown that there wereno significant difference between the dispersal of the fluxes of thermal and resonance neutrons emitted from 252Cf during activation of the gold-containing technogenic samples with different mineral compositions.

  16. Actinide metals

    International Nuclear Information System (INIS)

    Brown, Paul L.; Ekberg, Christian

    2016-01-01

    All isotopes of actinium are radioactive and exist in aqueous solution only in the trivalent state. There have been very few studies on the hydrolytic reactions of actinium(III). The hydrolysis reactions for uranium would only be important in alkaline pH conditions. Thermodynamic parameters for the hydrolysis species of uranium(VI) and its oxide and hydroxide phases can be determined from the stability and solubility constants. The hydrolytic behaviour of neptunium(VI) is quite similar to that of uranium(VI). The solubility constant of NpO 2 OH(am) has been reported a number of times for both zero ionic strength and in fixed ionic strength media. Americium can form four oxidation states in aqueous solution, namely trivalent, tetravalent, pentavalent and hexavalent. Desire, Hussonnois and Guillaumont determined stability constants for the species AmOH 2+ for the actinides, plutonium(III), americium(III), curium(III), berkelium(III) and californium(III) using a solvent extraction technique.

  17. Development and demonstration of a new SANEX Partitioning Process for selective actinide(III)/lanthanide(III) separation using a mixture of CyMe{sub 4}BTBP and TODGA

    Energy Technology Data Exchange (ETDEWEB)

    Modolo, G.; Wilden, A.; Daniels, H. [Forschungszentrum Juelich GmbH (Germany). Institute for Energy and Climate Research, IEK-6, Nuclear Waste Management and Reactor Safety; Geist, A.; Magnusson, D. [Karlsruher Institut fuer Technologie, Karlsruhe (Germany). Inst. fuer Nukleare Entsorgung; Malmbeck, R. [European Commission, JRC, Karlsruhe (Germany). Inst. for Transuranium Elements (ITU)

    2013-05-01

    Within the framework of the European collaborative project ACSEPT, a new SANEX partitioning process was developed at Forschungszentrum Juelich for the separation of the trivalent minor actinides americium, curium and californium from lanthanide fission products in spent nuclear fuels. The development is based on batch solvent extraction studies, single-centrifugal contactor tests and on flow-sheet design by computer code calculations. The used solvent is composed of 6,6{sup '}-bis(5,5,8,8-tetramethyl-5,6,7,8-tetrahydrobenzo-[1,2-4]trizazin-3-yl)-[2,2{sup '}]-bipyridine (CyMe{sub 4}BTBP) and N,N,N{sup '},N{sup '}-tetraoctyldiglycolamide (TODGA) dissolved in n-octanol. A spiked continuous counter-current test was carried out in miniature centrifugal contactors with the aid of a 20-stage flow-sheet consisting of 12 extraction, 4 scrubbing and 4 stripping stages. A product fraction containing more than 99.9% of the trivalent actinides Am(III), Cm(III) and Cf(III) was obtained. High product/feed decontamination factors >1000 were achieved for these actinides. The trivalent lanthanides were directed to the raffinate of the process with the actinide (III) product stream being contaminated with less than 0.5 mass-% in the initial lanthanides. (orig.)

  18. Fundamental aspects of Am and Cm in zirconia-based materials. Investigations using X-ray diffraction and Raman spectroscopy

    International Nuclear Information System (INIS)

    Raison, P.E.; Haire, R.G.; Assefa, Z.

    2002-01-01

    We have investigated incorporation of americium and curium in selected zirconia-based materials. Fundamental aspects were explored via X-ray diffraction and Raman spectroscopy. First explored was the pseudo ternary system, AmO 2 -ZrO 2 -Y 2 O 3 . It was found that stable, cubic solid solutions (Am x Zr 1-x Y y )O 2-2/y can be obtained for selected compositions. The cell parameters of the cubic phases were established as being linear with the AmO 2 content. For the Cm 2 O 3 -ZrO 2 system, it was determined that diphasic materials are produced, except for two compositions: 25 mol% and 50 mol% of CmO 1.5 . For these compositions a single-phase cubic fluorite type solid solution (a=5.21A±0.01) and a pyrochlore oxide Cm 2 Zr 2 O 7 (a=10.63A±0.02) are formed, respectively. The stability of pyrochlore oxides is also being investigated as a function of self-irradiation, using shorter-lived isotopes, one being the californium pyrochlore 249 Cf 2 Zr 2 O 7 . We obtained evidence that after six months of storage the pyrochlore oxide is undergoing structural change. Additional studies are in progress. (author)

  19. Review of the accomplishments and promise of US transplutonium research, 1940-1981

    International Nuclear Information System (INIS)

    Keller, O.L.; Wymer, R.G.

    1982-01-01

    It has been just over 40 years since the identification of plutonium by Seaborg, McMillan, Kennedy, and Wahl at the University of California, Berkeley. This discovery, and the isolation of plutonium-239 a year later by Kennedy, Seaborg, Segre, and Wahl, laid the cornerstone of one of the most exciting and productive eras of research in American history - research on the transplutonium elements. This research was to span all fields of natural science, and indeed was to have many implications and applications in the biological sciences. In this brief document, we have attempted to touch on only some of the many achievements of the US heavy element program. Many of those whose work has been at the heart of this research have contributed to this report. They have summarized some of what was scientifically important and exciting and they have suggested some of the topics of important research remaining to be done. The following topics are covered in this review: historical account; plutonium; synthesis of transplutonium isotopes; nuclear fission and stability, heavy ion reactions and nuclear structure; chemistry of the transplutonium elements; optical and magnetic properties; electronic structure and solid state properties; environmental and biological behavior of transplutonium elements; heavy element production; application of californium-252

  20. Efficiency of interaction between various radiation and chemicals

    International Nuclear Information System (INIS)

    Kim, Jin Kyu; Song, H. S.; Kim, J. S.; Chun, K. J.; Lee, Y. K.; Lee, B. H.; Shin, H. S.; Lee, K. H.; Petin, Vladislav G.

    2002-01-01

    KAERI and INP (Poland) have been carried out parallel study and joint experiments on the major topics according to MOU about their cooperative project. Major experimental techniques were TSH assay, comet assay, and synergism assay. The research consisted of the following workscopes. 1) Application of TSH bioindicator for studying the biological efficiency of radiation, 2) Relative biological efficiency of californium-252 neutrons in the induction of gene and lethal mutations in TSH cells normal and enriched with boron compound, 3) Effect of pesticide on radiation-induced mutations in TSH cells, 4) Interaction of radiation with pesticide on DNA damage in human peripheral blood lymphocytes, 5) Radiomodifying effect of boron and gadolinium compounds in human peripheral blood lymphocytes, 6) Mathematical description of synergistic interactions, 7) General regularities of synergistic interactions, and 8) Determinant of synergistic interaction between radiation, heat and chemicals in cell killing. Both institutes have established wide variety of research techniques applicable to various radiation research through the cooperation. The results of research can make the role of fundamental basis for the better relationship between Korea and Poland

  1. Separation of Am-Cm from Al(NO3)3 waste solutions by in-canyon-tank precipitation as oxalates

    International Nuclear Information System (INIS)

    Gray, L.W.; Burney, G.A.; Wilson, T.W.; McKibben, J.M.; Bibler, N.E.; Holtzscheiter, E.W.; Campbell, T.G.

    1982-04-01

    A process for recovery of Am-Cm residues from high-activity waste concentrates has been developed specifically for application in Savannah River Plant (SRP) canyon tanks. The Am-Cm residues were collected from a campaign to produce plutonium containing high isotopic concentrations of 242 Pu. The separation of Am-Cm from the high-activity waste stream, containing about 2M Al(NO 3 ) 3 , is necessary to produce an acceptable feed solution for a later pressurized cation exchange chromatography separation and purification step. The new process includes formic acid denitration, adjustment of contaminating cations by evaporation and water dilution, and oxalate precipitation of the actinides and lanthanides. After washing, the precipitate was dissolved in 8M nitric acid and the oxalate was destroyed by nitric acid oxidation that was catalyzed by manganous ions. This new process generates about one-fourth the waste of the californium solvent extraction process, which it replaced. The new process also produces a cleaner feed solution for the pressurized cation exchange chromatography separation and purification step

  2. On-line charge breeding using ECRIS and EBIS

    Energy Technology Data Exchange (ETDEWEB)

    Vondrasek, Richard, E-mail: Vondrasek@anl.gov

    2016-06-01

    The efficient and rapid production of a high-quality, pure beam of highly charged ions is at the heart of any radioactive ion beam facility. Whether an electron cyclotron resonance (ECR) ion source or an electron beam ion source (EBIS) is used to produce these highly charged ions, their operating characteristics will set the boundaries on the range of experiments which can be performed. In addition, time structure and duty cycle have to be considered when defining the operating parameters of the accelerator system as a whole. At Argonne National Laboratory (ANL), an ECR charge breeder was developed as part of the Californium Rare Ion Breeder Upgrade (CARIBU) program. The charge breeding efficiency and high charge state production of the source is at the forefront of ECR charge breeders, but its overall performance as part of the accelerator system is limited by pervasive background and relatively long breeding times. As such, an EBIS charge breeder has been developed and is running in an off-line configuration. It has already demonstrated good breeding efficiencies, shorter residence times, and reduced background and is scheduled to replace the ECR charge breeder in late 2015. The resultant change in duty cycle and time structure necessitates changes to the overall operation of the facility. The experiences with these breeders, as well as from several other facilities which already utilize an ECR or EBIS for charge breeding, help to define the operational characteristics of each technology – their strengths, their weaknesses, and the possible paths to improvement.

  3. B(E2) ↑ (01+ -> 21+) predictions for even–even nuclei in the differential equation model

    International Nuclear Information System (INIS)

    Nayak, R.C.; Pattnaik, S.

    2015-01-01

    We use the recently developed differential equation model (DEM) for the reduced electric quadrupole transition probability B(E2)↑ for the transition from the ground to the first 2 + state for predicting its values for a wide range of even–even nuclides almost throughout the nuclear landscape from Neon to Californium. This is made possible as the principal equation in the model, namely, the differential equation connecting the B(E2)↑ value of a given even–even nucleus with its derivatives with respect to the neutron and proton numbers, provides two different recursion relations, each connecting three different neighboring even–even nuclei from lower- to higher-mass numbers and vice versa. These relations are primarily responsible in extrapolating from known to unknown terrain of the B(E2)↑-landscape and thereby facilitate the predictions throughout. As a result, we have succeeded in predicting its hitherto unknown value for the adjacent 251 isotopes lying on either side of the known B(E2)↑ database. (author)

  4. A technique for combining neutron and gamma-ray data into a single assay value

    International Nuclear Information System (INIS)

    Pickrell, M.M.; Mercer, D.; Sharpe, T.J.

    1998-01-01

    The authors explored the potentials of using both neutron and gamma-ray measurements on a single item and combining these data into a single assay value. The purpose was to improve assay capability for sample matrices that are difficult to measure. They chose an empirical approach because they wanted to address difficult-to-measure items for which the assay problem is complex. They used the tomographic gamma scanner; a passive, high-efficiency neutron counter with add-a-source and multiplicity; and an active neutron, californium shuffler to obtain measurements. Twenty-four 200-L drums were measured with various matrices using all three machines. The matrices were chosen specifically to spain the difficult-to-measure assay problems for some or all of the instruments. For example, the authors measured a drum filled with concrete and another filled with metal. The data from these measurements were analyzed using the alternating conditional expectation algorithm, which is one of a class of generalized additive models. Other data fusion algorithms are also possible and are being explored. The intent was to find ways to combine the data that would reduce the matrix-induced measurement error

  5. Reprocessing of nuclear fuels at the Savannah River Plant

    International Nuclear Information System (INIS)

    Gray, L.W.

    1986-01-01

    For more than 30 years, the Savannah River Plant (SRP) has been a major supplier of nuclear materials such as plutonium-239 and tritium-3 for nuclear and thermonuclear weapons, plutonium-238 for space exploration, and isotopes of americium, curium, and californium for use in the nuclear research community. SRP is a complete nuclear park, providing most of the processes in the nuclear fuel cycle. Key processes involve fabrication and cladding of the nuclear fuel, target, and control assemblies; rework of heavy water for use as reactor moderator; reactor loading, operation, and unloading; chemical recovery of the reactor transmutation products and spent fuels; and management of the gaseous, liquid, and solid nuclear and chemical wastes; plus a host of support operations. The site's history and the key processes from fabrication of reactor fuels and targets to finishing of virgin plutonium for use in the nuclear weapons complex are reviewed. Emphasis has been given to the chemistry of the recovery and purification of weapons grade plutonium from irradiated reactor targets

  6. Testing for moisture content in foods by neutron gaging

    International Nuclear Information System (INIS)

    Helf, S.

    1976-01-01

    Neutron gaging was applied to the testing for moisture content in bulk powdered foods and in canned Army field rations. The technique is based on the moderation or thermalization of fast neutrons by hydrogenous matter and the measurement of thermal neutron intensity as a function of moisture content. A small californium-252 capsule, of approximate output 10 7 neutrons per second, was used as the source of fast neutrons. It is concluded that a fast neutron moderation technique is feasible for the nondestructive measurement or control of moisture or both in near-dry bulk powdered foods. Samples must be measured under identical geometric conditions, that is, uniform bulk density and volume using a standard metal container or cell. For canned or otherwise prepacked rations, measurement of moisture is interfered with by variations in fill weight among cans or packages of the same product. A gamma-ray attenuation gaging method proved to be of insufficient sensitivity to correct for fill weight variation and was further complicated by nonuniformity in can wall dimensions. Neutron gaging, however, appears to be quite useful for monitoring a standard packaged item for fill weight since the neutron signal is virtually unaffected by variations in container dimensions. The radiation dose imparted to a sample or package of food subjected to such a test is judged to pose no threat to humans from subsequent consumption of the food. An estimate is given for the cost range of a commercial neutron gage and of encapsulated radioisotopic neutron sources

  7. About possibilities of obtaining focused beams of thermal neutrons of radionuclide source

    International Nuclear Information System (INIS)

    Aripov, G.A.; Kurbanov, B.I.; Sulaymanov, N.T.; Ergashev, A.

    2004-01-01

    Full text: In the last years significant progress is achieved in development of neutron focusing methods (concentrating neutrons in a given direction and a small area). In this, main attention is given to focusing of neutron beams of reactor, particularly cold neutrons and their applications. [1,2]. However, isotope sources also let obtain intensive neutron beams and solve quite important (tasks) problems (e.g. neutron capture therapy for malignant tumors) [3], and an actual problems is focusing of neutrons. We developed a device on the basis of californium source of neutrons, allowing to obtain focused (preliminarily) beam of thermal neutrons with the aid of respective choice of moderators, reflectors and geometry of their disposition. Here, fast neutrons and gamma rays in the beam are minimized. With the aid of the model we developed on the basis of Monte-Carlo method, it is possible to modify aforementioned device and dynamics of output neutrons in wide energy range and analyze ways of optimization of neutron beams of isotope sources with different neutron outputs. Device of preliminary focusing of thermal neutrons can serve as a basis for further focus of neutrons using micro- and nano-capillar systems. It is known that, capillary systems performed with certain technology can form beam of thermal neutrons increasing its density by more than two orders of magnitude and effectively divert beams up to 20 o with length of system 15 cm

  8. About possibilities of obtaining focused beams of thermal neutrons of radionuclide source

    International Nuclear Information System (INIS)

    Aripov, G.A.; Kurbanov, B.I.; Sulaymanov, N.T.; Ergashev, A.

    2004-01-01

    In the last years significant progress is achieved in development of neutron focusing methods (concentrating neutrons in a given direction and a small area). In this, main attention is given to focusing of neutron beams of reactor, particularly cold neutrons and their applications. [1,2]. However, isotope sources also let obtain intensive neutron beams and solve quite important (tasks) problems (e.g. neutron capture therapy for malignant tumors) [3], and an actual problems is focusing of neutrons. We developed a device on the basis of californium source of neutrons, allowing to obtain focused (preliminarily) beam of thermal neutrons with the aid of respective choice of moderators, reflectors and geometry of their disposition. Here, fast neutrons and gamma rays in the beam are minimized. With the aid of the model we developed on the basis of Monte-Carlo method, it is possible to modify aforementioned device and dynamics of output neutrons in wide energy range and analyze ways of optimization of neutron beams of isotope sources with different neutron outputs. Device of preliminary focusing of thermal neutrons can serve as a basis for further focus of neutrons using micro- and nano-capillary systems. It is known that, capillary systems performed with certain technology can form beam of thermal neutrons increasing its density by more than two orders of magnitude and effectively divert beams up to 20 o with length of system 15 cm. (author)

  9. Investigation of Workplace-like Calibration Fields via a Deuterium-Tritium (D-T) Neutron Generator.

    Science.gov (United States)

    Mozhayev, Andrey V; Piper, Roman K; Rathbone, Bruce A; McDonald, Joseph C

    2017-04-01

    Radiation survey meters and personal dosimeters are typically calibrated in reference neutron fields based on conventional radionuclide sources, such as americium-beryllium (Am-Be) or californium-252 (Cf), either unmodified or heavy-water moderated. However, these calibration neutron fields differ significantly from the workplace fields in which most of these survey meters and dosimeters are being used. Although some detectors are designed to yield an approximately dose-equivalent response over a particular neutron energy range, the response of other detectors is highly dependent upon neutron energy. This, in turn, can result in significant over- or underestimation of the intensity of neutron radiation and/or personal dose equivalent determined in the work environment. The use of simulated workplace neutron calibration fields that more closely match those present at the workplace could improve the accuracy of worker, and workplace, neutron dose assessment. This work provides an overview of the neutron fields found around nuclear power reactors and interim spent fuel storage installations based on available data. The feasibility of producing workplace-like calibration fields in an existing calibration facility has been investigated via Monte Carlo simulations. Several moderating assembly configurations, paired with a neutron generator using the deuterium tritium (D-T) fusion reaction, were explored.

  10. Calculated NWIS signatures for enriched uranium metal

    International Nuclear Information System (INIS)

    Valentine, T.E.; Mihalczo, J.T.; Koehler, P.E.

    1995-01-01

    Nuclear Weapons Identification System (NWIS) signatures have been calculated using a Monte Carlo transport code for measurement configurations of a 252 Cf source, detectors, and a uranium metal casting. NWIS signatures consist of a wide variety of time-and frequency-analysis signatures such as the time distribution of neutrons after californium fission, the time distribution of counts in a detector after a previous count, the number of times n pulses occur in a time interval, and various frequency-analysis signatures, such as auto-power and cross-power spectral densities, coherences, and a ratio of spectral densities. This ratio is independent of detection efficiency. The analysis presented here, using the MCNP-DSP code, evaluates the applicability of this method for measurement of the 235 U content of 19-kg castings of depleted uranium and uranium with enrichments of 20, 40, 60, 80, 90, and 93.2 wt % 235 U. The dependence of the wide variety of NWIS signatures on 235 U content and possible configurations of a measurement system are presented. These preliminary calculations indicate short measurement times. Additional calculations are being performed to optimize the source-detector-moderator-casting configuration for the shortest measurement time. Although the NWIS method was developed for nuclear weapons identification, the development of a small processor now allows it to be also applied in a practical way to subcriticality measurements, nuclear fuel process monitoring and qualitative nondestructive assay of special nuclear material

  11. Attachment and spreadout study of 3T3 cells onto PP track etched films

    International Nuclear Information System (INIS)

    Smolko, Eduardo; Mazzei, Ruben; Tadey, Daniel; Lombardo, Daniel

    2001-01-01

    Polymer surface modifications are obtained by the application of radiation treatments and other physico-chemical methods: fission fragment (ff) irradiation and etching. The biocompatibility of the surface is then observed by cell seeding and cell adhesion experiments. Approaches to improvement of the cell adhesion are obtained by different methods: for example, in PS, cell adhesion is improved after ion implantation; in PMMA, after bombarding the polymer, the surface is reconditioned with surfactants and proteins and in PVDF, cell adhesion is assayed on nuclear tracks membranes. In this work, we obtained important cell adhesion improvements in PP films by irradiation with swift heavy ions and subsequent etching of the nuclear tracks. We use BOPP (isotactic -25 μm thickness). Irrradiations were performed with a Cf-252 californium ff source. The source has a heavy ff and a light one, with 160-200 MeV energy divided among them corresponding to ff energies between 1 and 2 MeV/amu. A chemical etching procedure consisting of a solution of sulphuric acid and chromium three oxide at 85 deg. C was used. The 3T3 NIH fibroblast cell line was used for the cell adhesion experiment. Here we report for the first time, the results of a series of experiments by varying the ff fluence and the etching time showing that attachment and spreadout of cells are very much improved in this cell line according to the number of pores and the pore size

  12. 4π-spectrometer technique for measurements of secondary neutron average number in nuclear fission by 252Cf neutrons

    International Nuclear Information System (INIS)

    Vasil'ev, Yu.A.; Barashkov, Yu.A.; Golovanov, O.A.; Sidorov, L.V.

    1977-01-01

    A method for determining the average number of secondary neutrons anti ν produced in nuclear fission by the neutrons of the 252 Cf fission spectra by means of a 4π time-of-flight spectrometer is described. Layers of 252 Cf and an isotope studied are placed close to each other; if the isotope layer density is 1 mg/cm 2 probability of its fission is about 10 -5 per one spontaneous fission of californium. Fission fragments of 252 Cf and the isotope investigated have been detected by two surface-barrier counters with an efficiency close to 100%. The layers and the counters are situated in a measuring chamber placed in the center of the 4π time-of-flight spectrometer. The latter is utilized as a neutron counter because of its fast response. The method has been verified by carrying out measurements for 235 U and 239 Pu. A comparison of the experimental and calculated results shows that the method suggested can apply to determine the number of secondary neutrons in fission of isotopes that have not been investigated yet

  13. Perspectives for online analysis of raw material by pulsed neutron irradiation

    Science.gov (United States)

    Bach, Pierre; Le Tourneur, P.; Poumarede, B.

    1997-02-01

    On-line analysis by pulsed neutron irradiation is an example of an advanced technology application of nuclear techniques, concerning real problems in the cement, mineral and coal industries. The most significant of these nuclear techniques is their capability of continuous measurement without contact and without sampling, which can lead to improved control of processes and resultant large financial savings. Compared to Californium neutron sources, the use of electrical pulsed neutron generators allows to obtain a higher signal/noise ratio for a more sensitive measurement, and allows to overcome a number of safety problems concerning transportation, installation and maintenance. An experiment related to a possible new on-line raw material analyzer is described, using a pulsed neutron generator. The key factors contributing to an accurate measurement are related to a suitable generator, to a high count rate gamma ray spectroscopy electronics, and to computational tools. Calculation and results for the optimization of the neutron irradiation time diagram are reported. One of the operational characteristics of such an equipment is related to neutron flux available: it is possible to adjust it to the requested accuracy, i.e. for a high accuracy during a few hours/day and for a lower accuracy the rest of the time. This feature allows to operate the neutron tube during a longer time, and then to reduce the cost of analysis.

  14. Fabrication of intense neutron sources for medical applications

    International Nuclear Information System (INIS)

    Boulogne, A.R.; Walker, V.W.

    1975-01-01

    Simulated sources containing 252 Cf equivalents of 0.1 to 1.0 milligrams were prepared. Samarium was used as the simulant in a modified chemical plating technique similar to that used to prepare palladium-californium oxide cermet for industrial applications. The length of the platinum-10 percent iridium doubly encapsulated source with its protective sheath is 0.545 in. (14.1 mm). Outside dia of the source, including its sheath, is 0.109 in. (2.8 mm). Existing ''Brachytrons'' can accommodate this source form. This capsule system will withstand internal gas pressures from helium due to alpha decay and fission gases from a 1 mg 252 Cf source after ten years if the source is subjected to a maximum temperature of 800 0 C, the theoretical temperature of an accidental fire. Under these conditions the safety factor is 3. The capsule system is being tested with tracer amounts of 252 Cf to ensure that it will withstand adverse service conditions as well as tests specified for Special Form Materials. (auth)

  15. An Account of Oak Ridge National Laboratory's Thirteen Research Reactors

    Energy Technology Data Exchange (ETDEWEB)

    Rosenthal, Murray Wilford [ORNL

    2009-08-01

    The Oak Ridge National Laboratory has built and operated 13 nuclear reactors in its 66-year history. The first was the graphite reactor, the world's first operational nuclear reactor, which served as a plutonium production pilot plant during World War II. It was followed by two aqueous-homogeneous reactors and two red-hot molten-salt reactors that were parts of power-reactor development programs and by eight others designed for research and radioisotope production. One of the eight was an all-metal fast burst reactor used for health physics studies. All of the others were light-water cooled and moderated, including the famous swimming-pool reactor that was copied dozens of times around the world. Two of the reactors were hoisted 200 feet into the air to study the shielding needs of proposed nuclear-powered aircraft. The final reactor, and the only one still operating today, is the High Flux Isotope Reactor (HFIR) that was built particularly for the production of californium and other heavy elements. With the world's highest flux and recent upgrades that include the addition of a cold neutron source, the 44-year-old HFIR continues to be a valuable tool for research and isotope production, attracting some 500 scientific visitors and guests to Oak Ridge each year. This report describes all of the reactors and their histories.

  16. A review of neutron scattering correction for the calibration of neutron survey meters using the shadow cone method

    International Nuclear Information System (INIS)

    Kim, Sang In; Kim, Bong Hwan; Kim, Jang Lyul; Lee, Jung Il

    2015-01-01

    The calibration methods of neutron-measuring devices such as the neutron survey meter have advantages and disadvantages. To compare the calibration factors obtained by the shadow cone method and semi-empirical method, 10 neutron survey meters of five different types were used in this study. This experiment was performed at the Korea Atomic Energy Research Institute (KAERI; Daejeon, South Korea), and the calibration neutron fields were constructed using a 252 Californium ( 252 Cf) neutron source, which was positioned in the center of the neutron irradiation room. The neutron spectra of the calibration neutron fields were measured by a europium-activated lithium iodide scintillator in combination with KAERI's Bonner sphere system. When the shadow cone method was used, 10 single moderator-based survey meters exhibited a smaller calibration factor by as much as 3.1 - 9.3% than that of the semi-empirical method. This finding indicates that neutron survey meters underestimated the scattered neutrons and attenuated neutrons (i.e., the total scatter corrections). This underestimation of the calibration factor was attributed to the fact that single moderator-based survey meters have an under-ambient dose equivalent response in the thermal or thermal-dominant neutron field. As a result, when the shadow cone method is used for a single moderator-based survey meter, an additional correction and the International Organization for Standardization standard 8529-2 for room-scattered neutrons should be considered

  17. The cross sections of fusion-evaporation reactions: the most promising route to superheavy elements beyond Z=118

    Science.gov (United States)

    Jadambaa, Khuyagbaatar

    2017-11-01

    The synthesis of superheavy elements beyond oganesson (Og), which has atomic number Z = 118, is currently one of the main topics in nuclear physics. An absence of sufficient amounts of target material with atomic numbers heavier than californium (Z = 98) forces the use of projectiles heavier than 48Ca (Z = 20), which has been successfully used for the discoveries of elements with Z = 114 - 118 in complete fusion reactions. Experimental cross sections of 48Ca with actinide targets behave very differently to "cold" and "hot" fusion-evaporation reactions, where doubly-magic lead and deformed actinides are used as targets, respectively. The known cross sections of these reactions have been analysed compared to calculated fission barriers. It has been suggested that observed discrepancies between the cross sections of 48Ca-induced and other fusionevaporation reactions originate from the shell structure of the compound nucleus, which lies in the island of the stability. Besides scarcely known data on other reactions involving heavier projectiles, the most promising projectile for the synthesis of the elements beyond Og seems to be 50Ti. However, detailed studies of 50Ti, 54Cr, 58Fe and 64Ni-induced reactions are necessary to be performed in order to fully understand the complexities of superheavy element formation.

  18. Dust vortices, clouds, and jets in nuclear-induced plasmas

    International Nuclear Information System (INIS)

    Vladimirov, V.I.; Deputatova, L.V.; Nefedov, A.P.; Fortov, V.E.; Rykov, V.A.; Khudyakov, A.V.

    2001-01-01

    The collective movement of dust particles in a plasma formed during deceleration of decay products of californium nuclei in neon is investigated experimentally. For the first time, compact vortex structures containing a large number of coagulating dust particles and dense dust clouds evolving in time are observed. Dust formations have clearly defined boundaries and particles in them form ordered liquid-type structures. Under steady-state conditions, dust structures exist from several minutes to hours. An increase in the voltage applied to the high-voltage electrode leads to the formation of dust particle jets. A change in the electric field configuration transforms the structures from one type to another. A strong recombination of electrons and ions at dust particles is observed. The momentum transfer from ions drifting in an external field to gas molecules is studied using the Monte Carlo method. It is shown that the transferred momentum is so large that it may cause a gas flow. The characteristic features of vortex flow in neon and in air are explained

  19. Design of active-neutron fuel rod scanner

    International Nuclear Information System (INIS)

    Griffith, G.W.; Menlove, H.O.

    1996-01-01

    An active-neutron fuel rod scanner has been designed for the assay of fissile materials in mixed oxide fuel rods. A 252 Cf source is located at the center of the scanner very near the through hole for the fuel rods. Spontaneous fission neutrons from the californium are moderated and induce fissions within the passing fuel rod. The rod continues past a combined gamma-ray and neutron shield where delayed gamma rays above 1 MeV are detected. We used the Monte Carlo code MCNP to design the scanner and review optimum materials and geometries. An inhomogeneous beryllium, graphite, and polyethylene moderator has been designed that uses source neutrons much more efficiently than assay systems using polyethylene moderators. Layers of borated polyethylene and tungsten are used to shield the detectors. Large NaI(Tl) detectors were selected to measure the delayed gamma rays. The enrichment zones of a thermal reactor fuel pin could be measured to within 1% counting statistics for practical rod speeds. Applications of the rod scanner include accountability of fissile material for safeguards applications, quality control of the fissile content in a fuel rod, and the verification of reactivity potential for mixed oxide fuels. (orig.)

  20. Sources of Radioactive Isotopes for Dirty Bombs

    Science.gov (United States)

    Lubenau, Joel

    2004-05-01

    From the security perspective, radioisotopes and radioactive sources are not created equal. Of the many radioisotopes used in industrial applications, medical treatments, and scientific research, only eight, when present in relatively large amounts in radioactive sources, pose high security risks primarily because of their prevalence and physical properties. These isotopes are americium-241, californium-252, cesium-137, cobalt-60, iridium-192, radium-226, plutonium-238, and strontium-90. Except for the naturally occurring radium-226, nuclear reactors produce the other seven in bulk commercial quantities. Half of these isotopes emit alpha radiation and would, thus, primarily pose internal threats to health; the others are mainly high-energy gamma emitters and would present both external and internal health hazards. Therefore, the response to a "dirty bomb" event depends on what type of radioisotope is chosen and how it is employed. While only a handful of major corporations produce the reactor-generated radioisotopes, they market these materials to thousands of smaller companies and users throughout the world. Improving the security of the high-risk radioactive sources will require, among other efforts, cooperation among source suppliers and regulatory agencies.