WorldWideScience

Sample records for californium 254

  1. Californium-252 progress, report No. 7, April 1971

    Energy Technology Data Exchange (ETDEWEB)

    1971-12-31

    This report contains discusses of the following topics on Californium-252: First sales of californium-252; encapsulation services discussed; three new participants in market evaluation program; summer training programs to use californium; Californium-252 shipping casks available; Californium-252 questions and answers, radiotherapy; neutron radiography; natural resources exploration; nuclear safeguards; process control; dosimetry; neutron radiography; neutron shielding; and nuclear safeguards.

  2. Historical review of californium-252 discovery and development

    Science.gov (United States)

    Stoddard, D. H.

    This paper discusses the discovery and history of californium 252. This isotope may be synthesized by irradiating plutonium 239, plutonium 242, americium 243, or curium 244 with neutrons in a nuclear reactor. Various experiments and inventions involving (252)Cf conducted at the Savannah River Plant are discussed. The evolution of radiotherapy using californium 252 is reviewed.

  3. Californium-252: a remarkable versatile radioisotope

    Energy Technology Data Exchange (ETDEWEB)

    Osborne-Lee, I.W.; Alexander, C.W.

    1995-10-10

    A product of the nuclear age, Californium-252 ({sup 252}Cf) has found many applications in medicine, scientific research, industry, and nuclear science education. Californium-252 is unique as a neutron source in that it provides a highly concentrated flux and extremely reliable neutron spectrum from a very small assembly. During the past 40 years, {sup 252}Cf has been applied with great success to cancer therapy, neutron radiography of objects ranging from flowers to entire aircraft, startup sources for nuclear reactors, fission activation for quality analysis of all commercial nuclear fuel, and many other beneficial uses, some of which are now ready for further growth. Californium-252 is produced in the High Flux Isotope Reactor (HFIR) and processed in the Radiochemical Engineering Development Center (REDC), both of which are located at the Oak Ridge National Laboratory (ORNL) in Oak Ridge, Tennessee. The REDC/HFIR facility is virtually the sole supplier of {sup 252}Cf in the western world and is the major supplier worldwide. Extensive exploitation of this product was made possible through the {sup 252}Cf Market Evaluation Program, sponsored by the United States Department of Energy (DOE) [then the Atomic Energy Commission (AEC) and later the Energy Research and Development Administration (ERDA)]. This program included training series, demonstration centers, seminars, and a liberal loan policy for fabricated sources. The Market Evaluation Program was instituted, in part, to determine if large-quantity production capability was required at the Savannah River Laboratory (SRL). Because of the nature of the product and the means by which it is produced, {sup 252}Cf can be produced only in government-owned facilities. It is evident at this time that the Oak Ridge research facility can meet present and projected near-term requirements. The production, shipment, and sales history of {sup 252}Cf from ORNL is summarized herein.

  4. Production, Distribution, and Applications of Californium-252 Neutron Sources

    Energy Technology Data Exchange (ETDEWEB)

    Balo, P.A.; Knauer, J.B.; Martin, R.C.

    1999-10-03

    The radioisotope {sup 252}Cf is routinely encapsulated into compact, portable, intense neutron sources with a 2.6-year half-life. A source the size of a person's little finger can emit up to 10{sup 11} neutrons/s. Californium-252 is used commercially as a reliable, cost-effective neutron source for prompt gamma neutron activation analysis (PGNAA) of coal, cement, and minerals, as well as for detection and identification of explosives, laud mines, and unexploded military ordnance. Other uses are neutron radiography, nuclear waste assays, reactor start-up sources, calibration standards, and cancer therapy. The inherent safety of source encapsulations is demonstrated by 30 years of experience and by U.S. Bureau of Mines tests of source survivability during explosions. The production and distribution center for the U. S Department of Energy (DOE) Californium Program is the Radiochemical Engineering Development Center (REDC) at Oak Ridge National Laboratory (ORNL). DOE sells The radioisotope {sup 252}Cf is routinely encapsulated into compact, portable, intense neutron sources with a 2.6- year half-life. A source the size of a person's little finger can emit up to 10 neutrons/s. Californium-252 is used commercially as a reliable, cost-effective neutron source for prompt gamma neutron activation analysis (PGNAA) of coal, cement, and minerals, as well as for detection and identification of explosives, laud mines, and unexploded military ordnance. Other uses are neutron radiography, nuclear waste assays, reactor start-up sources, calibration standards, and cancer therapy. The inherent safety of source encapsulations is demonstrated by 30 years of experience and by U.S. Bureau of Mines tests of source survivability during explosions. The production and distribution center for the U. S Department of Energy (DOE) Californium Program is the Radiochemical Engineering Development Center (REDC) at Oak Ridge National Laboratory(ORNL). DOE sells {sup 252}Cf to commercial

  5. Unusual structure, bonding and properties in a californium borate

    Energy Technology Data Exchange (ETDEWEB)

    Polinski, Matthew J.; Garner, Edward B.; Maurice, Rémi; Planas, Nora; Stritzinger, Jared T.; Parker, T. Gannon; Cross, Justin N.; Green, Thomas D.; Alekseev, Evgeny V.; Van Cleve, Shelley M.; Depmeier, Wulf; Gagliardi, Laura; Shatruk, Michael; Knappenberger, Kenneth L.; Liu, Guokui; Skanthakumar, S.; Soderholm, Lynda; Dixon, David A.; Albrecht-Schmitt, Thomas E.

    2014-03-23

    The participation of the valence orbitals of actinides in bonding has been debated for decades. Recent experimental and computational investigations demonstrated the involvement of 6p, 6d and/or 5f orbitals in bonding. However, structural and spectroscopic data, as well as theory, indicate a decrease in covalency across the actinide series, and the evidence points to highly ionic, lanthanide-like bonding for late actinides. Here we show that chemical differentiation between californium and lanthanides can be achieved by using ligands that are both highly polarizable and substantially rearrange on complexation. A ligand that suits both of these desired properties is polyborate. We demonstrate that the 5f, 6d and 7p orbitals are all involved in bonding in a Cf(III) borate, and that large crystal-field effects are present. Synthetic, structural and spectroscopic data are complemented by quantum mechanical calculations to support these observations.

  6. 27 CFR 44.254 - Shipping containers.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 2 2010-04-01 2010-04-01 false Shipping containers. 44.254 Section 44.254 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU... Requirements § 44.254 Shipping containers. Each shipping case, crate, or other container, in which cigars are...

  7. 38 CFR 17.254 - Applications.

    Science.gov (United States)

    2010-07-01

    ... 38 Pensions, Bonuses, and Veterans' Relief 1 2010-07-01 2010-07-01 false Applications. 17.254 Section 17.254 Pensions, Bonuses, and Veterans' Relief DEPARTMENT OF VETERANS AFFAIRS MEDICAL Grants for Exchange of Information § 17.254 Applications. Each application for a grant shall be submitted to the Under...

  8. 36 CFR 254.25 - Survey.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Survey. 254.25 Section 254.25... National Forest Townsites § 254.25 Survey. The authorized Forest Service official shall conduct or provide for the necessary tract survey and boundary posting of National Forest System land. ...

  9. 20 CFR 632.254 - Program startup.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Program startup. 632.254 Section 632.254 Employees' Benefits EMPLOYMENT AND TRAINING ADMINISTRATION, DEPARTMENT OF LABOR INDIAN AND NATIVE AMERICAN EMPLOYMENT AND TRAINING PROGRAMS Summer Youth Employment and Training Programs § 632.254 Program startup...

  10. Biomedical neutron research at the Californium User Facility for neutron science

    Energy Technology Data Exchange (ETDEWEB)

    Martin, R.C. [Oak Ridge National Lab., TN (United States); Byrne, T.E. [Roane State Community College, Harriman, TN (United States); Miller, L.F. [Univ. of Tennessee, Knoxville, TN (United States)

    1997-04-01

    The Californium User Facility for Neutron Science has been established at Oak Ridge National Laboratory (ORNL). The Californium User Facility (CUF) is a part of the larger Californium Facility, which fabricates and stores compact {sup 252}Cf neutron sources for worldwide distribution. The CUF can provide a cost-effective option for research with {sup 252}Cf sources. Three projects at the CUF that demonstrate the versatility of {sup 252}Cf for biological and biomedical neutron-based research are described: future establishment of a {sup 252}Cf-based neutron activation analysis system, ongoing work to produce miniature high-intensity, remotely afterloaded {sup 252}Cf sources for tumor therapy, and a recent experiment that irradiated living human lung cancer cells impregnated with experimental boron compounds to test their effectiveness for boron neutron capture therapy.

  11. 36 CFR 254.10 - Bargaining; arbitration.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Bargaining; arbitration. 254... LANDOWNERSHIP ADJUSTMENTS Land Exchanges § 254.10 Bargaining; arbitration. (a) Unless the parties to an exchange... exchange, the appraisal(s), at the initiative of either party, must be submitted to arbitration, unless, in...

  12. Apparatus for the measurement of total body nitrogen using prompt neutron activation analysis with californium-252.

    Science.gov (United States)

    Mackie, A; Hannan, W J; Smith, M A; Tothill, P

    1988-01-01

    Details of clinical apparatus designed for the measurement of total body nitrogen (as an indicator of body protein), suitable for the critically ill, intensive-care patient are presented. Californium-252 radio-isotopic neutron sources are used, enabling a nitrogen measurement by prompt neutron activation analysis to be made in 40 min with a precision of +/- 3.2% for a whole body dose equivalent of 0.145 mSv. The advantages of Californium-252 over alternative neutron sources are discussed. A comparison between two irradiation/detection geometries is made, leading to an explanation of the geometry adopted for the apparatus. The choice of construction and shielding materials to reduce the count rate at the detectors and consequently to reduce the pile-up contribution to the nitrogen background is discussed. Salient features of the gamma ray spectroscopy system to reduce spectral distortion from pulse pile-up are presented.

  13. Safety Analysis Report for Packaging (SARP) of the Oak Ridge National Laboratory TRU Californium Shipping Container

    Energy Technology Data Exchange (ETDEWEB)

    Box, W.D.; Shappert, L.B.; Seagren, R.D.; Klima, B.B.; Jurgensen, M.C.; Hammond, C.R.; Watson, C.D.

    1980-01-01

    An analytical evaluation of the Oak Ridge National Laboratory TRU Californium Shipping Container was made in order to demonstrate its compliance with the regulations governing off-site shipment of packages that contain radioactive material. The evaluation encompassed five primary categories: structural integrity, thermal resistance, radiation shielding, nuclear criticality safety, and quality assurance. The results of this evaluation demonstrate that the container complies with the applicable regulations.

  14. 48 CFR 53.303-DD-254 - Department of Defense DD Form 254, Contract Security Classification Specification.

    Science.gov (United States)

    2010-10-01

    ... Illustrations of Forms 53.303-DD-254 Department of Defense DD Form 254, Contract Security Classification... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Department of Defense DD Form 254, Contract Security Classification Specification. 53.303-DD-254 Section 53.303-DD-254 Federal...

  15. Dicty_cDB: CHR254 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHR254 (Link to dictyBase) - - - Contig-U11845-1 | Contig-U13149-1 CHR...254P (Link to Original site) CHR254F 130 CHR254Z 620 CHR254P 730 - - Show CHR254 Library CH (Link to library) Clone ID CHR...45-1 | Contig-U13149-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CH/CHR2-C/CHR...254Q.Seq.d/ Representative seq. ID CHR254P (Link to Original site) Representative DNA sequence >CHR254 (CHR...254Q) /CSM/CH/CHR2-C/CHR254Q.Seq.d/ CNNAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAACCCCCCCCCNTTTTTTTT

  16. 36 CFR 254.2 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... disposal of National Forest System lands administered by the Secretary of Agriculture. Reserved interest... Secretary of the Interior to allow for the orderly administration of the Federal lands. Statement of value... ADJUSTMENTS Land Exchanges § 254.2 Definitions. For the purposes of this subpart, the following terms have the...

  17. 50 CFR 216.254 - Mitigation.

    Science.gov (United States)

    2010-10-01

    ... detecting marine mammals, detonation must be delayed until adequate sea conditions exist for aerial..., DEPARTMENT OF COMMERCE MARINE MAMMALS REGULATIONS GOVERNING THE TAKING AND IMPORTING OF MARINE MAMMALS Taking Marine Mammals Incidental to Conducting Precision Strike Weapon Missions in the Gulf of Mexico § 216.254...

  18. 14 CFR 254.5 - Notice requirement.

    Science.gov (United States)

    2010-01-01

    ... REGULATIONS DOMESTIC BAGGAGE LIABILITY § 254.5 Notice requirement. In any flight segment using large aircraft... large aircraft, an air carrier shall provide to passengers, by conspicuous written material included on... passengers; or (b) The following notice: “Federal rules require any limit on an airline's baggage liability...

  19. 38 CFR 21.254 - Supportive services.

    Science.gov (United States)

    2010-07-01

    ...-employment as defined in § 21.257(b) if VA determines that the following conditions are met: (1) The...) VOCATIONAL REHABILITATION AND EDUCATION Vocational Rehabilitation and Employment Under 38 U.S.C. Chapter 31 Employment Services § 21.254 Supportive services. (a) General. Supportive services which may be provided...

  20. Inactivation of oxytocin by 254 nm radiation

    Energy Technology Data Exchange (ETDEWEB)

    Erndt, A.; Karolczyk-Kostuch, S.; Polaczek, E.

    1975-01-01

    Irradiation of oxytocin in diluted solutions with 254 nm light reduced markedly the hormone activity. The decrease in activity in the range between 0 and 20 percent was nearly proportional to the increase in sulfhydryl group concentration. In view of the fundamental role of cystyl residue in holding the oxytocin native backbone conformation the results suggest that disulfide bond cleavage makes an essential contribution to photoinactivation of this hormone under the conditions used.

  1. 36 CFR 254.11 - Exchanges at approximately equal value.

    Science.gov (United States)

    2010-07-01

    ... attributes; and (4) There are no significant elements of value requiring complex analysis. (b) The authorized... equal value. 254.11 Section 254.11 Parks, Forests, and Public Property FOREST SERVICE, DEPARTMENT OF AGRICULTURE LANDOWNERSHIP ADJUSTMENTS Land Exchanges § 254.11 Exchanges at approximately equal value. (a) The...

  2. 29 CFR 1910.254 - Arc welding and cutting.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 5 2010-07-01 2010-07-01 false Arc welding and cutting. 1910.254 Section 1910.254 Labor... OCCUPATIONAL SAFETY AND HEALTH STANDARDS Welding, Cutting and Brazing § 1910.254 Arc welding and cutting. (a... following limits shall not be exceeded: (i) Alternating-current machines (A) Manual arc welding and cutting...

  3. 36 CFR 254.34 - Mineral survey fractions.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Mineral survey fractions. 254... LANDOWNERSHIP ADJUSTMENTS Conveyance of Small Tracts § 254.34 Mineral survey fractions. (a) Mineral survey fractions subject to conveyance under this subpart are limited to those tracts which: (1) Cannot be...

  4. Application of TSH bioindicator for studying the biological efficiency of neutrons from californium-252 source

    Energy Technology Data Exchange (ETDEWEB)

    Cebulska-Wasilewska, A.; Rekas, K. [Institute of Nuclear Physics, Cracow (Poland); Kim, J.K. [Korea Atomic Energy Research Inst., Taejon (Korea, Republic of)

    1997-12-31

    The effectiveness of neutrons from a Californium-252 source in the induction of various abnormalities in the Tradescantia clone 4430 stamen hair cells (TSH-assay) was studied. The special attention was paid to check whether any enhancement in effects caused by process of boron neutron capture is visible in the cells enriched with boron ions. Two chemicals (borax and BSH) were applied to introduce boron-10 ions into cells. Inflorescence, normal or pretreated with chemicals containing boron, were irradiated in the air with neutrons from a Cf-252 source at KAERI, Taejon, Korea. To estimate the relative biological effectiveness (RBE) in the induction of gene mutations of the neutron beam under the study, Tradescantia inflorescences, without any chemical pretreatment, were irradiated with various doses of X-rays. The ranges of radiation doses used were 0-0.1 Gy in neutrons and 0-0.5 Gy in X-rays. After the time needed to complete the postirradiation repair Tradescantia cuttings were transferred to Cracow, where screening of gene and lethal; mutations, cell cycle alterations in somatic cells have been done, and dose response relationships were figured. The maximal RBE values were estimated in the range of 4.6-6.8. Alterations of RBE value were observed; from 6.8 to 7.8 in the case of plants pretreated with 240 ppm of B-10 from borax, and 4.6 to 6.1 in the case of 400 ppm of B-10 from BSH. Results showed a slight, although statistically insignificant increase in biological efficacy of radiation from the Cf-252 source in samples pretreated with boron containing chemicals. (author)

  5. Study of the shielding for spontaneous fission sources of Californium-252; Estudio de blindaje para fuentes de fision espontanea de Californio-252

    Energy Technology Data Exchange (ETDEWEB)

    Davila R, I

    1991-06-15

    A shielding study is made to attenuate, until maximum permissible levels, the neutrons radiation and photons emitted by spontaneous fission coming from a source of Californium-252. The compound package by a database (Library DLC-23) and the ANISNW code is used, in it version for personal computer. (Author)

  6. Susceptibility to Stress Corrosion Cracking of 254SMO SS

    Directory of Open Access Journals (Sweden)

    De Micheli Lorenzo

    2002-01-01

    Full Text Available The susceptibility to stress corrosion cracking (SCC of solubilized and sensitized 254SMO SS was studied in sodium chloride, and sodium fluoride solutions at 80 °C and sulfuric acid solutions in presence of sodium chloride at 25 °C. The influence of salt concentration, pH values and the addition of thiosulfate was examined. The susceptibility to SCC was evaluated by Slow Strain Rate Tests (SSRT, at 1.5 x 10-6 s-1 strain rate. The behavior of 254SMO was compared to those of AISI 316L SS and Hastelloy C276. 254SMO showed an excellent resistance to SCC in all conditions, except in the more acidic solutions (pH <= 1 where, in the sensitized conditions, intergranular stress corrosion cracking occurred.

  7. Simulation and design of an electron beam ion source charge breeder for the californium rare isotope breeder upgrade

    Directory of Open Access Journals (Sweden)

    Clayton Dickerson

    2013-02-01

    Full Text Available An electron beam ion source (EBIS will be constructed and used to charge breed ions from the californium rare isotope breeder upgrade (CARIBU for postacceleration into the Argonne tandem linear accelerator system (ATLAS. Simulations of the EBIS charge breeder performance and the related ion transport systems are reported. Propagation of the electron beam through the EBIS was verified, and the anticipated incident power density within the electron collector was identified. The full normalized acceptance of the charge breeder with a 2 A electron beam, 0.024π  mm mrad for nominal operating parameters, was determined by simulating ion injection into the EBIS. The optics of the ion transport lines were carefully optimized to achieve well-matched ion injection, to minimize emittance growth of the injected and extracted ion beams, and to enable adequate testing of the charge bred ions prior to installation in ATLAS.

  8. Extraction of Trivalent Actinides and Lanthanides from Californium Campaign Rework Solution Using TODGA-based Solvent Extraction System

    Energy Technology Data Exchange (ETDEWEB)

    Benker, Dennis [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Delmau, Laetitia Helene [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Dryman, Joshua Cory [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States)

    2017-07-01

    This report presents the studies carried out to demonstrate the possibility of quantitatively extracting trivalent actinides and lanthanides from highly acidic solutions using a neutral ligand-based solvent extraction system. These studies stemmed from the perceived advantage of such systems over cationexchange- based solvent extraction systems that require an extensive feed adjustment to make a low-acid feed. The targeted feed solutions are highly acidic aqueous phases obtained after the dissolution of curium targets during a californium (Cf) campaign. Results obtained with actual Cf campaign solutions, but highly diluted to be manageable in a glove box, are presented, followed by results of tests run in the hot cells with Cf campaign rework solutions. It was demonstrated that a solvent extraction system based on the tetraoctyl diglycolamide molecule is capable of quantitatively extracting trivalent actinides from highly acidic solutions. This system was validated using actual feeds from a Cf campaign.

  9. Beyond Californium-A Neutron Generator Alternative for Dosimetry and Instrument Calibration in the U.S.

    Science.gov (United States)

    Piper, Roman K; Mozhayev, Andrey V; Murphy, Mark K; Thompson, Alan K

    2017-09-01

    Evaluations of neutron survey instruments, area monitors, and personal dosimeters rely on reference neutron radiations, which have evolved from the heavy reliance on (α,n) sources to a shared reliance on (α,n) and the spontaneous fission neutrons of californium-252 (Cf). Capable of producing high dose equivalent rates from an almost point source geometry, the characteristics of Cf are generally more favorable when compared to the use of (α,n) and (γ,n) sources or reactor-produced reference neutron radiations. Californium-252 is typically used in two standardized configurations: unmoderated, to yield a fission energy spectrum; or with the capsule placed within a heavy-water moderating sphere to produce a softened spectrum that is generally considered more appropriate for evaluating devices used in nuclear power plant work environments. The U.S. Department of Energy Cf Loan/Lease Program, a longtime origin of affordable Cf sources for research, testing and calibration, was terminated in 2009. Since then, high-activity sources have become increasingly cost-prohibitive for laboratories that formerly benefited from that program. Neutron generators, based on the D-T and D-D fusion reactions, have become economically competitive with Cf and are recognized internationally as important calibration and test standards. Researchers from the National Institute of Standards and Technology and the Pacific Northwest National Laboratory are jointly considering the practicality and technical challenges of implementing neutron generators as calibration standards in the U.S. This article reviews the characteristics of isotope-based neutron sources, possible isotope alternatives to Cf, and the rationale behind the increasing favor of electronically generated neutron options. The evaluation of a D-T system at PNNL has revealed characteristics that must be considered in adapting generators to the task of calibration and testing where accurate determination of a dosimetric quantity is

  10. Californium-252 Brachytherapy Combined With External-Beam Radiotherapy for Cervical Cancer: Long-Term Treatment Results

    Energy Technology Data Exchange (ETDEWEB)

    Lei Xin; Qian Chengyuan; Qing Yi; Zhao Kewei; Yang Zhengzhou; Dai Nan; Zhong Zhaoyang; Tang Cheng; Li Zheng; Gu Xianqing; Zhou Qian; Feng Yan; Xiong Yanli; Shan Jinlu [Cancer Center, Research Institute of Surgery and Daping Hospital, Third Military Medical University, Chongqing (China); Wang Dong, E-mail: dongwang64@hotmail.com [Cancer Center, Research Institute of Surgery and Daping Hospital, Third Military Medical University, Chongqing (China)

    2011-12-01

    Purpose: To observe, by retrospective analysis, the curative effects and complications due to californium-252 ({sup 252}Cf) neutron intracavitary brachytherapy (ICBT) combined with external-beam radiotherapy (EBRT) in the treatment of cervical cancer. Methods and Materials: From February 1999 to December 2007, 696 patients with cervical cancer (Stages IB to IIIB) were treated with {sup 252}Cf-ICBT in combination of EBRT. Of all, 31 patients were at Stage IB, 104 at IIA, 363 at IIB, 64 at IIIA, and 134 at IIIB. Californium-252 ICBT was delivered at 7-12 Gy per insertion per week, with a total dose of 29-45 Gy to reference point A in three to five insertions. The whole pelvic cavity was treated with 8-MV X-ray external irradiation at 2 Gy per fraction, four times per week. After 16-38 Gy of external irradiation, the center of the whole pelvic field was blocked with a 4-cm-wide lead shield, with a total external irradiation dose of 44-56 Gy. The total treatment course was 5 to 6 weeks. Results: Overall survival rate at 3 and 5 years for all patients was 76.0% and 64.9%, respectively. Disease-free 3- and 5-year survival rates of patients were 71.2% and 58.4%, respectively. Late complications included vaginal contracture and adhesion, radiation proctitis, radiation cystitis, and inflammatory bowel, which accounted for 5.8%, 7.1%, 6.2%, and 4.9%, respectively. Univariate analysis results showed significant correlation of stage, age, histopathologic grade, and lymph node status with overall survival. Cox multiple regression analysis showed that the independent variables were stage, histopathologic grade, tumor size, and lymphatic metastasis in all patients. Conclusion: Results of this series suggest that the combined use of {sup 252}Cf-ICBT with EBRT is an effective method for treatment of cervical cancer.

  11. 7 CFR 1220.254 - Patents, copyrights, inventions, and publications.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 10 2010-01-01 2010-01-01 false Patents, copyrights, inventions, and publications... Miscellaneous § 1220.254 Patents, copyrights, inventions, and publications. (a) Any patents, copyrights..., franchising, or other uses of such patents, copyrights, inventions, or publications, inure to the benefit of...

  12. 19 CFR 10.254 - Certificate of Origin.

    Science.gov (United States)

    2010-04-01

    ... article described in § 10.253(a) being exported from an ATPDEA beneficiary country to the United States... TREASURY ARTICLES CONDITIONALLY FREE, SUBJECT TO A REDUCED RATE, ETC. Andean Trade Promotion and Drug Eradication Act Extension of Atpa Benefits to Tuna and Certain Other Non-Textile Articles § 10.254 Certificate...

  13. Cold valleys in the radioactive decay of 248−254Cf isotopes

    Indian Academy of Sciences (India)

    Geiger–Nuttal plots of log10(T1/2) vs. Q−1/2 for 48−52Ca emitting from various californium isotopes. Acknowledgement. One of the authors (KPS) would like to thank University Grants Commis- sion, Govt. of India for the financial support under project No. MRP(S)-. 352/2005(X Plan)/KLKA 002/UGC-SWRO. References.

  14. Photodegradation and ecotoxicology of acyclovir in water under UV254and UV254/H2O2processes.

    Science.gov (United States)

    Russo, Danilo; Siciliano, Antonietta; Guida, Marco; Galdiero, Emilia; Amoresano, Angela; Andreozzi, Roberto; Reis, Nuno M; Li Puma, Gianluca; Marotta, Raffaele

    2017-10-01

    The photochemical and ecotoxicological fate of acyclovir (ACY) through UV 254 direct photolysis and in the presence of hydroxyl radicals (UV 254 /H 2 O 2 process) were investigated in a microcapillary film (MCF) array photoreactor, which provided ultrarapid and accurate photochemical reaction kinetics. The UVC phototransformation of ACY was found to be unaffected by pH in the range from 4.5 to 8.0 and resembled an apparent autocatalytic reaction. The proposed mechanism included the formation of a photochemical intermediate (ϕ ACY  = (1.62 ± 0.07)·10 -3  mol ein -1 ) that further reacted with ACY to form by-products (k' = (5.64 ± 0.03)·10 -3  M -1  s -1 ). The photolysis of ACY in the presence of hydrogen peroxide accelerated the removal of ACY as a result of formation of hydroxyl radicals. The kinetic constant for the reaction of OH radicals with ACY (k OH/ACY ) determined with the kinetic modeling method was (1.23 ± 0.07)·10 9  M -1  s -1 and with the competition kinetics method was (2.30 ± 0.11)·10 9  M -1  s -1 with competition kinetics. The acute and chronic effects of the treated aqueous mixtures on different living organisms (Vibrio fischeri, Raphidocelis subcapitata, D. magna) revealed significantly lower toxicity for the samples treated with UV 254 /H 2 O 2 in comparison to those collected during UV 254 treatment. This result suggests that the addition of moderate quantity of hydrogen peroxide (30-150 mg L -1 ) might be a useful strategy to reduce the ecotoxicity of UV 254 based sanitary engineered systems for water reclamation. Copyright © 2017 Elsevier Ltd. All rights reserved.

  15. Phenotype abnormality: 254 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 254 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u1ria224u760i delayed whole p...lant flowering stage in presence of gibberellin in presence of gibberellins http://metadb.riken.jp/db/SciNetS_ria224i/cria224u2ria224u46i ... delayed ... whole plant flowering stage ...

  16. 16 CFR 254.3 - Misrepresentation of extent or nature of accreditation or approval.

    Science.gov (United States)

    2010-01-01

    ... to an accredited institution of higher education. (b) It is deceptive for an industry member to... accreditation or approval. 254.3 Section 254.3 Commercial Practices FEDERAL TRADE COMMISSION GUIDES AND TRADE PRACTICE RULES GUIDES FOR PRIVATE VOCATIONAL AND DISTANCE EDUCATION SCHOOLS § 254.3 Misrepresentation of...

  17. 47 CFR 1.254 - Nature of the hearing; burden of proof.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 1 2010-10-01 2010-10-01 false Nature of the hearing; burden of proof. 1.254 Section 1.254 Telecommunication FEDERAL COMMUNICATIONS COMMISSION GENERAL PRACTICE AND PROCEDURE Hearing Proceedings Hearing and Intermediate Decision § 1.254 Nature of the hearing; burden of proof. Any hearing upon...

  18. 37 CFR 2.54 - Requirements for drawings submitted on paper.

    Science.gov (United States)

    2010-07-01

    ... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Requirements for drawings submitted on paper. 2.54 Section 2.54 Patents, Trademarks, and Copyrights UNITED STATES PATENT AND TRADEMARK OFFICE, DEPARTMENT OF COMMERCE RULES OF PRACTICE IN TRADEMARK CASES Drawing § 2.54 Requirements for...

  19. Long-term effects of an intracavitary treatment with californium-252 on normal tissue. [Swine, /sup 226/Ra

    Energy Technology Data Exchange (ETDEWEB)

    Sullivan, M.F.; Beamer, J.L.; Mahony, T.D.; Cross, F.T.; Lund, J.E.; Endres, G.W.R.

    1976-01-01

    About one hundred fifty swine were exposed to either radium-226 or californium-252 sources in the uterine cervix to determine an RBE for both acute and long-term effects. That value for early changes in the tissues at risk in the treatment of cervical cancer was between 6.2 and 6.8. The incidence of complications increased with time after exposure, especially among animals treated with /sup 252/Cf. Analysis of rectal injury showed that ulceration occurred frequently within a year postexposure at doses between 1600 and 2400 rad calculated at 2 cm lateral to the source midline. Fat necrosis and smooth muscle atrophy, resulting in a local rectal stricture, were delayed changes observed in some animals. The lower ureter was the site for a greater frequency of complications than the GI tract. Ureteral stricture often occurred at doses of 1200 rad from /sup 252/Cf and 7000 rad from /sup 226/Ra. Observation of delayed effects in the uterine-cervix in animals held up to 4 years postexposure indicate that the RBE for /sup 252/Cf may be increased to a value as high as 18, while repair may have even decreased it to about 5.6 in the rectum. Fifty swine are still being observed for long-term effects after doses above 800 rad from /sup 252/Cf and 5000 rad from /sup 226/Ra.

  20. Ab initio full-potential study of mechanical properties and magnetic phase stability of californium monopnictides (CfN and CfP)

    Energy Technology Data Exchange (ETDEWEB)

    Amari, S., E-mail: siham_amari@yahoo.fr [Faculté des Sciences de la Nature et de la Vie, Université Hassiba Benbouali, Chlef, 02000 (Algeria); Bouhafs, B. [Laboratoire de Modélisation et Simulation en Sciences des Matériaux, Université Djillali Liabès de Sidi Bel-Abbés, Sidi Bel-Abbés, 22000 (Algeria)

    2016-09-15

    Based on the first-principles methods, the structural, elastic, electronic, properties and magnetic ordering of californium monopnictides CfX (X = P) have been studied using the full-potential augmented plane wave plus local orbitals (FP-L/APW + lo) method within the framework of density functional theory (DFT). The electronic exchange correlation energy is described by generalized gradient approximation GGA and GGA+U (U is the Hubbard correction). The GGA+U method is applied to the rare-earth 5f states. We have calculated the lattice parameters, bulk modulii and the first pressure derivatives of the bulk modulii. The elastic properties of the studied compounds are only investigated in the most stable calculated phase. In order to gain further information, we have calculated Young’s modulus, shear modulus, anisotropy factor and Kleinman parameter by the aid of the calculated elastic constants. The results mainly show that californium monopnictides CfX (X = P) have an antiferromagnetic spin ordering. Density of states (DOS) and charge densities for both compounds are also computed in the NaCl (B1) structure.

  1. Low-Dose-Rate Californium-252 Neutron Intracavitary Afterloading Radiotherapy Combined With Conformal Radiotherapy for Treatment of Cervical Cancer

    Energy Technology Data Exchange (ETDEWEB)

    Zhang Min [Department of Oncology, Armed Police Hospital of Hangzhou, Hangzhou, Zhejiang Province (China); Xu Hongde [Cancer Center, Armed Police Hospital of Hangzhou, Hangzhou, Zhejiang Province (China); Pan Songdan; Lin Shan; Yue Jianhua [Department of Oncology, Armed Police Hospital of Hangzhou, Hangzhou, Zhejiang Province (China); Liu Jianren, E-mail: liujianren0571@hotmail.com [Second Affiliated Hospital, School of Medicine, Zhejiang University, Hangzhou, Zhejiang Province (China)

    2012-07-01

    Purpose: To study the efficacy of low-dose-rate californium-252 ({sup 252}Cf) neutron intracavitary afterloading radiotherapy (RT) combined with external pelvic RT for treatment of cervical cancer. Methods and Materials: The records of 96 patients treated for cervical cancer from 2006 to 2010 were retrospectively reviewed. For patients with tumors {<=}4 cm in diameter, external beam radiation was performed (1.8 Gy/day, five times/week) until the dose reached 20 Gy, and then {sup 252}Cf neutron intracavitary afterloading RT (once/week) was begun, and the frequency of external beam radiation was changed to four times/week. For patients with tumors >4 cm, {sup 252}Cf RT was performed one to two times before whole-pelvis external beam radiation. The tumor-eliminating dose was determined by using the depth limit of 5 mm below the mucosa as the reference point. In all patients, the total dose of the external beam radiation ranged from 46.8 to 50 Gy. For {sup 252}Cf RT, the dose delivered to point A was 6 Gy/fraction, once per week, for a total of seven times, and the total dose was 42 Gy. Results: The mean {+-} SD patient age was 54.7 {+-} 13.7 years. Six patients had disease assessed at stage IB, 13 patients had stage IIA, 49 patients had stage IIB, 3 patients had stage IIIA, 24 patients had stage IIIB, and 1 patient had stage IVA. All patients obtained complete tumor regression (CR). The mean {+-} SD time to CR was 23.5 {+-} 3.4 days. Vaginal bleeding was fully controlled in 80 patients within 1 to 8 days. The mean {+-} SD follow-up period was 27.6 {+-} 12.7 months (range, 6-48 months). Five patients died due to recurrence or metastasis. The 3-year survival and disease-free recurrence rates were 89.6% and 87.5 %, respectively. Nine patients experienced mild radiation proctitis, and 4 patients developed radiocystitis. Conclusions: Low-dose-rate {sup 252}Cf neutron RT combined with external pelvic RT is effective for treating cervical cancer, with a low incidence of

  2. 29 CFR 25.4 - Contents of requests; service on other parties; answer; intervention.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 1 2010-07-01 2010-07-01 true Contents of requests; service on other parties; answer; intervention. 25.4 Section 25.4 Labor Office of the Secretary of Labor RULES FOR THE NOMINATION OF ARBITRATORS...; intervention. (a) Requests for nominations 1 shall be in triplicate and contain the following information: 1...

  3. 48 CFR 53.303-254-53.303-347 - Illustration of agency forms.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Illustration of agency... FEDERAL ACQUISITION REGULATION (CONTINUED) CLAUSES AND FORMS FORMS Illustrations of Forms 53.303-254—53.303-347 Illustration of agency forms. Editorial Note: The forms appearing in sections 53.303-DD-254...

  4. 48 CFR 53.204-1 - Safeguarding classified information within industry (DD Form 254, DD Form 441).

    Science.gov (United States)

    2010-10-01

    ... information within industry (DD Form 254, DD Form 441). 53.204-1 Section 53.204-1 Federal Acquisition....204-1 Safeguarding classified information within industry (DD Form 254, DD Form 441). The following... specified in subpart 4.4 and the clause at 52.204-2: (a) DD Form 254 (Department of Defense (DOD)), Contract...

  5. 30 CFR 254.46 - Whom do I notify if an oil spill occurs?

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Whom do I notify if an oil spill occurs? 254.46... Outer Continental Shelf Facilities § 254.46 Whom do I notify if an oil spill occurs? (a) You must immediately notify the National Response Center (1-800-424-8802) if you observe: (1) An oil spill from your...

  6. cdc-25.4, a Caenorhabditis elegans Ortholog of cdc25, Is Required for Male Mating Behavior

    Directory of Open Access Journals (Sweden)

    Sangmi Oh

    2016-12-01

    Full Text Available Cell division cycle 25 (cdc25 is an evolutionarily conserved phosphatase that promotes cell cycle progression. Among the four cdc25 orthologs in Caenorhabditis elegans, we found that cdc-25.4 mutant males failed to produce outcrossed progeny. This was not caused by defects in sperm development, but by defects in male mating behavior. The cdc-25.4 mutant males showed various defects during male mating, including contact response, backing, turning, and vulva location. Aberrant turning behavior was the most prominent defect in the cdc-25.4 mutant males. We also found that cdc-25.4 is expressed in many neuronal cells throughout development. The turning defect in cdc-25.4 mutant males was recovered by cdc-25.4 transgenic expression in neuronal cells, suggesting that cdc-25.4 functions in neurons for male mating. However, the neuronal morphology of cdc-25.4 mutant males appeared to be normal, as examined with several neuronal markers. Also, RNAi depletion of wee-1.3, a C. elegans ortholog of Wee1/Myt1 kinase, failed to suppress the mating defects of cdc-25.4 mutant males. These findings suggest that, for successful male mating, cdc-25.4 does not target cell cycles that are required for neuronal differentiation and development. Rather, cdc-25.4 likely regulates noncanonical substrates in neuronal cells.

  7. Degradation of highly consumed fluoroquinolones, penicillins and cephalosporins in distilled water and simulated hospital wastewater by UV254 and UV254/persulfate processes.

    Science.gov (United States)

    Serna-Galvis, Efraím A; Ferraro, Franklin; Silva-Agredo, Javier; Torres-Palma, Ricardo A

    2017-10-01

    In this work, three penicillins (ampicillin "AMP", oxacillin "OXA" and cloxacillin "CLO"), two cephalosporins (cephalexin "CPX" and cephadroxyl "CPD") and three fluoroquinolones (levofloxacin "LEV", norfloxacin "NOR" and ciprofloxacin "CIP") were initially treated by UV254 and persulfate activated by UV254 (UV/PS). Significant differences in degradation kinetics under UV254 irradiation were found. Photodegradation followed the order: OXA > CPX > CPD > CLO > CIP > NOR > AMP ≫ LEV. Then, in order to study the participation of direct photolysis and reactive oxygen species (ROS) in photodegradation a model antibiotic of each class (OXA, CPX and CIP) was considered. OXA and CPX were mainly degraded by direct photolysis, whereas the CIP removal involved ROS and photolysis. On the other hand, the persulfate addition (UV/PS process) improved the removals due to sulfate radical formation, especially, in the case of antibiotics with lower photodegradation levels (i.e. LEV, AMP and NOR). Computational calculations on the representative antibiotics were applied to determine the regions susceptible to electrophilic attacks by degrading agents. The functional groups of OXA and CPX followed the reactivity order: thioether ≫ β-lactam ring > benzene ring. For CIP, the piperazyl moiety presented higher reactivity than the quinolone ring. Also, the antimicrobial activity (AA) evolution during the treatments was tested. In the cases of CPX and CIP, both UV254 and UV/PS removed the AA; which were associated with structural changes in their reactive moieties: β-lactam ring and piperazyl ring, respectively. However, in the case of OXA only the UV/PS system decreased AA, which was attributed to transformations in its penicillin electron-rich nucleus (thioether + β-lactam). Finally, the applicability of UV254 and UV/PS was assessed using synthetic hospital wastewater (HWW). The processes comparison showed that for practical purposes, OXA and CIP in HWW should be

  8. Enhanced escape rate for Hg 254 nm resonance radiation in fluorescent lamps

    Science.gov (United States)

    Lawler, James E.; Raizen, Mark G.

    2013-10-01

    The potential of the low-cost MAGIS isotopic separation method to improve fluorescent lamp efficacy is explored using resonance radiation transport simulations. New Hg isotopic mixes are discovered that yield escape rates for 254 nm Hg I resonance radiation equal to 117% to 122% of the rate for a natural isotopic mix under the same lamp conditions.

  9. 6 CFR 25.4 - Designation of qualified anti-terrorism technologies.

    Science.gov (United States)

    2010-01-01

    ... 6 Domestic Security 1 2010-01-01 2010-01-01 false Designation of qualified anti-terrorism... REGULATIONS TO SUPPORT ANTI-TERRORISM BY FOSTERING EFFECTIVE TECHNOLOGIES § 25.4 Designation of qualified anti-terrorism technologies. (a) General. The Under Secretary may Designate as a Qualified Anti-Terrorism...

  10. Cold valleys in the radioactive decay of 248− 254Cf isotopes

    Indian Academy of Sciences (India)

    Based on the concept of cold valley in cold fission and fusion, we have investigated the cluster decay process in 248-254Cf isotopes. In addition to alpha particle minima, other deep minima occur for S, Ar and Ca clusters. It is found that inclusion of proximity potential does not change the position of minima but minima ...

  11. Californium-252 neutron intracavity brachytherapy alone for T1N0 low-lying rectal adenocarcinoma: A definitive anal sphincter-preserving radiotherapy

    Science.gov (United States)

    Xiong, Yanli; Shan, Jinlu; Liu, Jia; Zhao, Kewei; Chen, Shu; Xu, Wenjing; Zhou, Qian; Yang, Mei; Lei, Xin

    2017-01-01

    This study evaluated the 4-year results of 32 patients with T1N0 low-lying rectal adenocarcinoma treated solely with californium-252 (Cf-252) neutron intracavity brachytherapy (ICBT). Patients were solicited into the study from January 2008 to June 2011. All the patients had refused surgery or surgery was contraindicated. The patients were treated with Cf-252 neutron ICBT using a novel 3.5-cm diameter off-axis 4-channel intrarectal applicator designed by the authors. The dose reference point was defined on the mucosa surface, with a total dose of 55–62 Gy-eq/4 f (13–16 Gy-eq/f/wk). All the patients completed the radiotherapy in accordance with our protocol. The rectal lesions regressed completely, and the acute rectal toxicity was mild (≤G2). The 4-year local control, overall survival, disease-free survival, and late complication (≥G2) rates were 96.9%, 90.6%, 87.5% and 15.6%, respectively. No severe late complication (≥G3) occurred. The mean follow-up was 56.1 ± 16.0 months. At the end of last follow-up, 29 patients remained alive. The mean survival time was 82.1 ± 2.7 months. Cf-252 neutron ICBT administered as the sole treatment (without surgery) for patients with T1N0 low-lying rectal adenocarcinoma is effective with acceptable late complications. Our study and method offers a definitive anal sphincter-preserving radiotherapy for T1N0 low-lying rectal adenocarcinoma patients. PMID:28094790

  12. Coulomb dissociation of {sup 8}B at 254 A MeV

    Energy Technology Data Exchange (ETDEWEB)

    Suemmerer, K.; Boue, F.; Baumann, T.; Geissel, H.; Hellstroem, M.; Koczon, P.; Schwab, E.; Schwab, W.; Senger, P.; Surowiecz, A. [Gesellschaft fuer Schwerionenforschung (GSI), Darmstadt (Germany); Iwasa, N.; Ozawa, A. [Gesellschaft fuer Schwerionenforschung (GSI), Darmstadt (Germany)]|[RIKEN Institute of Physical and Chemical Research, Saitama (Japan); Surowka, G. [Gesellschaft fuer Schwerionenforschung (GSI), Darmstadt (Germany)]|[Jagiellonian Univ., Krakow (Poland). Inst. of Physics; Blank, B.; Czajkowski, S.; Marchand, C.; Pravikoff, M.S. [Centre d`Etudes Nucleaires de Bordeaux-Gradignan, 33 (France); Foerster, A.; Lauer, F.; Oeschler, H.; Speer, J.; Sturm, C.; Uhlig, F.; Wagner, A. [Technische Univ. Darmstadt (Germany); Gai, M. [Connecticut Univ., Storrs, CT (United States). Dept. of Physics; Grosse, E. [Inst. fuer Kern- und Hadronenphysik, Forschungszentrum Rossendorf, Dresden (Germany); Kohlmeyer, B. [Philipps Univ., Marburg (Germany). Fachbereich Physik; Kulessa, R.; Walus, W. [Jagiellonian Univ., Krakow (Poland). Inst. of Physics; Motobayashi, T. [Rikkyo Univ., Tokyo (Japan). Dept. of Physics; Teranishi, T. [RIKEN Institute of Physical and Chemical Research, Saitama (Japan)

    1998-06-01

    As an alternative method for determining the astrophysical S-factor for the {sup 7}Be(p,{gamma}){sup 8}B reaction we have measured the Coulomb dissociation of {sup 8}B at 254 A MeV. From our preliminary results, we obtain good agreement with both the accepted direct-reaction measurements and the low-energy Coulomb dissociation study of Iwasa et al. performed at about 50 A MeV. (orig.)

  13. Ferric ion mediated photochemical decomposition of perfluorooctanoic acid (PFOA) by 254 nm UV light

    Energy Technology Data Exchange (ETDEWEB)

    Wang Yuan [State Key Laboratory of Environmental Aquatic Chemistry, Research Center for Eco-Environmental Science, Chinese Academy of Science, Beijing 100085 (China); Department of Environmental Science and Engineering, Tsinghua University, Beijing 100084 (China); Zhang Pengyi [Department of Environmental Science and Engineering, Tsinghua University, Beijing 100084 (China)], E-mail: zpy@tsinghua.edu.cn; Pan Gang; Chen Hao [State Key Laboratory of Environmental Aquatic Chemistry, Research Center for Eco-Environmental Science, Chinese Academy of Science, Beijing 100085 (China)

    2008-12-15

    The great enhancement of ferric ion on the photochemical decomposition of environmentally persistent perfluorooctanoic acid (PFOA) under 254 nm UV light was reported. In the presence of 10 {mu}M ferric ion, 47.3% of initial PFOA (48 {mu}M) was decomposed and the defluorination ratio reached 15.4% within 4 h reaction time. While the degradation and defluorination ratio greatly increased to 80.2% and 47.8%, respectively, when ferric ion concentration increased to 80 {mu}M, and the corresponding half-life was shortened to 103 min. Though the decomposition rate was significantly lowered under nitrogen atmosphere, PFOA was efficiently decomposed too. Other metal ions like Cu{sup 2+} and Zn{sup 2+} also slightly improved the photochemical decomposition of PFOA under irradiation of 254 nm UV light. Besides fluoride ion, other intermediates during PFOA decomposition including formic acid and five shorter-chain perfluorinated carboxylic acids (PFCAs) with C7, C6, C5, C4 and C3, respectively, were identified and quantified by IC or LC/MS. The mixture of PFOA and ferric ion had strong absorption around 280 nm. It is proposed that PFOA coordinates with ferric ion to form a complex, and its excitation by 254 nm UV light leads to the decomposition of PFOA in a stepwise way.

  14. Bibliography of ground-water references for all 254 counties in Texas, 1886-2001

    Science.gov (United States)

    Baker, E.T.

    2005-01-01

    PrefaceThis bibliography comprises more than 10,000 citations of ground-water references involving all 254 counties in Texas. The reference citations date from 1886 and extend into 2001. Publications and reports from more than 30 agencies, universities, water districts, geological societies, cities, consultants, and private publication outlets are included in the bibliography. The bibliographic listing is, first, alphabetical by county and, second, chronological by date of the report, from oldest to most recent. The passing years have seen a proliferation in both published and unpublished reports, and such proliferation continues to expand at an accelerating pace. All 254 counties have had groundwater studies, either cursory or detailed. Investigation and development of the ground-water resources of the State of Texas resulted in reports that appear in a variety of formats, including Federal, State, and local agency reports; scholarly, professional, and trade journals; conference proceedings; guidebooks; maps; and theses and dissertations. The end result for the person seeking ground-water information about specific Texas counties is the increasing difficulty in locating pertinent data among the many and diverse ground-water reports in which the information is recorded. This bibliography, covering a span of 115 years, should have considerable utility in guiding those individuals seeking ground-water information.

  15. Action spectra (254-302 nm) for four human photosensitive cell lines

    Energy Technology Data Exchange (ETDEWEB)

    Coohill, T.P.; Moore, S.P.; Grider, R.A. (Western Kentucky Univ., Bowling Green (USA))

    1983-07-01

    The inactivation of cellular viral capacity for Herpes simplex type I growth in six separate wavelengths (254-302 nm) was measured in five human cell lines. These consisted of one ''normal''-skin fibroblast line (KD), and four photosensitive lines. Two lines of Xeroderma pigmentosum, one of Bloom's syndrome, and one of Cockayne's syndrome cells were used. Similar relative sensitivity were observed for the Bloom's syndrome. Xeroderma pigmentosum, and normal cell lines. The Cockayne's syndrome-line became relatively more sensitive at 289 nm and longer wavelengths. Absolute sensitivities varied. Some divergence in response was noted at the longest wavelength tested, 302 nm.

  16. Printed wax masks for 254 nm deep-UV pattering of PMMA-based microfluidics

    KAUST Repository

    Fan, Yiqiang

    2012-01-13

    This paper reports a new technique for masking deep-UV exposure of poly(methyl methacrylate) (PMMA) using a printed wax mask. This technique provides an inexpensive and bulk fabrication method for PMMA structures. The technique involves the direct printing of the mask onto a polymer sheet using a commercial wax printer. The wax layer was then transferred to a PMMA substrate using a thermal laminator, exposed using deep-UV (with a wavelength of 254 nm), developed in an IPA:water solution, and completed by bonding on a PMMA cap layer. A sample microfluidic device fabricated with this method is also presented, with the microchannel as narrow as 50 μm. The whole process is easy to perform without the requirement for any microfabrication facilities. © 2012 IOP Publishing Ltd.

  17. Kinetics and mechanism investigation on the destruction of oxytetracycline by UV-254 nm activation of persulfate

    Energy Technology Data Exchange (ETDEWEB)

    Liu, Yiqing [Faculty of Geosciences and Environmental Engineering, Southwest Jiaotong University, Chengdu 611756 (China); Environmental Engineering and Science Program, University of Cincinnati, Cincinnati, OH 45221-0012 (United States); He, Xuexiang [Environmental Engineering and Science Program, University of Cincinnati, Cincinnati, OH 45221-0012 (United States); Fu, Yongsheng [Faculty of Geosciences and Environmental Engineering, Southwest Jiaotong University, Chengdu 611756 (China); Dionysiou, Dionysios D., E-mail: dionysios.d.dionysiou@uc.edu [Environmental Engineering and Science Program, University of Cincinnati, Cincinnati, OH 45221-0012 (United States)

    2016-03-15

    Highlights: • The most effective destruction of OTC by UV/PS was achieved at near neutral pH. • Deprotonated HOTC{sup −} had the highest second-order rate constant with SO{sub 4}·{sup −}. • Presence of HCO{sub 3}{sup −} or Cu{sup 2+} enhanced the removal of OTC in UV/PS system. • Total organic carbon was degraded slowly during the mineralization of OTC. • Studies on the degradation mechanism revealed four different reaction pathways. - Abstract: Oxytetracycline (OTC), an important broad-spectrum antibiotic, has been detected extensively in various environmental systems, which may have a detrimental impact on ecosystem and human health through the development of drug resistant bacteria and pathogens. In this study, the degradation of OTC was evaluated by UV-254 nm activated persulfate (PS). The observed UV fluence based pseudo first-order rate constant (k{sub obs}) was found to be the highest at near neutral pH conditions (pH 5.5–8.5). Presence of various natural water constituents had different effects on OTC degradation, with a significant enhancement in the presence of bicarbonate or Cu{sup 2+}. Limited elimination of total organic carbon (TOC) and PS was observed during the mineralization of OTC. Transformation byproducts in the presence and absence of hydroxyl radical scavenging agent tert-butanol (t-BuOH) were identified using ultra-high definition accurate-mass quadrupole time-of-flight liquid chromatography/mass spectrometer (LC-QTOF/MS). Potential OTC degradation mechanism was subsequently proposed revealing four different reaction pathways by SO{sub 4}·{sup −} reaction including hydroxylation (+16 Da), demethylation (−14 Da), decarbonylation (−28 Da) and dehydration (−18 Da). This study suggests that UV-254 nm/PS is a promising treatment technology for the control of water pollution caused by emerging contaminants such as OTC.

  18. Spitzer Observations of the Massive Star-forming Complex S254-S258: Structure and Evolution

    Science.gov (United States)

    Chavarría, Luis A.; Allen, Lori E.; Hora, Joseph L.; Brunt, Christopher M.; Fazio, Giovanni G.

    2008-07-01

    We present Spitzer IRAC, NOAO 2.1 m Flamingos, Keck NIRC, and FCRAO SEQUOIA observations of the massive star-forming complex S254-S258, covering an area of 25' × 20'. Using a combination of the IRAC and NIR data, we identify and classify the young stellar objects (YSOs) in the complex. We detect 510 sources with near- or mid-IR excess, and we classify 87 Class I and 165 Class II sources. The YSOs are found in clusters surrounded by isolated YSOs in a low-density distributed population. The ratio of clustered to total YSOs is 0.8. We identify six new clusters in the complex. One of them, G192.63-00, is located around the ionizing star of the H II region S255. We hypothesize that the ionizing star of S255 was formed in this cluster. We also detect a southern component of the cluster in H II region S256. The cluster G192.54-0.15, located inside H II region S254 has a VLSR of 17 km s-1 with respect to the main cloud, and we conclude that it is located in the background of the complex. The structure of the molecular cloud is examined using 12CO and 13CO , as well as a near-IR extinction map. The main body of the molecular cloud has VLSR between 5 and 9 km s-1. The arc-shaped structure of the molecular cloud following the border of the H II regions and the high column density in the border of the H II regions support the idea that the material has been swept up by the expansion of the H II regions.

  19. Californium-252 Program Equipment Evaluation

    Energy Technology Data Exchange (ETDEWEB)

    Chattin, Fred Rhea [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Wilson, Kenton [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Ezold, Julie G. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States)

    2017-12-01

    To successfully continue the 252Cf production and meet the needs of the customers, a comprehensive evaluation of the Building 7920 processing equipment was requested to identify equipment critical to the operational continuity of the program.

  20. A prospective study on time to recovery in 254 injured novice runners.

    Directory of Open Access Journals (Sweden)

    Rasmus Oestergaard Nielsen

    Full Text Available Describe the diagnoses and the time to recovery of running-related injuries in novice runners.Prospective cohort study on injured runners.This paper is a secondary data analysis of a 933-person cohort study (DANO-RUN aimed at characterizing risk factors for injury in novice runners. Among those sustaining running-related injuries, the types of injuries and time to recovery is described in the present paper. All injured runners were diagnosed after a thorough clinical examination and then followed prospectively during their recovery. If they recovered completely from injury, time to recovery of each injury was registered.A total of 254 runners were injured. The proportion of runners diagnosed with medial tibial stress syndrome was 15%, 10% for patellofemoral pain, 9% for medial meniscal injury, 7% for Achilles tendinopathy and 5% for plantar fasciitis. Among the 220 runners (87% recovering from their injury, the median time to recovery was 71 days (minimum  = 9 days, maximum  = 617 days.Medial tibial stress syndrome was the most common injury followed by patellofemoral pain, medial meniscal injury and Achilles tendinopathy. Half of the injured runners were unable to run 2×500 meters without pain after 10 weeks. Almost 5% of the injured runners received surgical treatment.

  1. A prospective study on time to recovery in 254 injured novice runners.

    Science.gov (United States)

    Nielsen, Rasmus Oestergaard; Rønnow, Lotte; Rasmussen, Sten; Lind, Martin

    2014-01-01

    Describe the diagnoses and the time to recovery of running-related injuries in novice runners. Prospective cohort study on injured runners. This paper is a secondary data analysis of a 933-person cohort study (DANO-RUN) aimed at characterizing risk factors for injury in novice runners. Among those sustaining running-related injuries, the types of injuries and time to recovery is described in the present paper. All injured runners were diagnosed after a thorough clinical examination and then followed prospectively during their recovery. If they recovered completely from injury, time to recovery of each injury was registered. A total of 254 runners were injured. The proportion of runners diagnosed with medial tibial stress syndrome was 15%, 10% for patellofemoral pain, 9% for medial meniscal injury, 7% for Achilles tendinopathy and 5% for plantar fasciitis. Among the 220 runners (87%) recovering from their injury, the median time to recovery was 71 days (minimum  = 9 days, maximum  = 617 days). Medial tibial stress syndrome was the most common injury followed by patellofemoral pain, medial meniscal injury and Achilles tendinopathy. Half of the injured runners were unable to run 2×500 meters without pain after 10 weeks. Almost 5% of the injured runners received surgical treatment.

  2. Photodegradation of iodinated trihalomethanes in aqueous solution by UV 254 irradiation.

    Science.gov (United States)

    Xiao, Yongjun; Fan, Rongli; Zhang, Lifeng; Yue, Junqi; Webster, Richard D; Lim, Teik-Thye

    2014-02-01

    Photodegradation of 6 iodinated trihalomethanes (ITHMs) under UV irradiation at 254 nm was investigated in this study. ITHMs underwent a rapid photodegradation process through cleavage of carbon-halogen bond with first-order rate constants in the range of 0.1-0.6 min(-1). The effects of matrix species including nitrate, humic acid (HA), bicarbonate, sulfate, and chloride were evaluated. The degradation rate increased slightly in the presence of nitrate possibly due to generation of HO at a low quantum yield via direct photolysis of nitrate, while HA lowered the photodegradation rate of ITHMs due to its competitive UV absorption. Moreover, bicarbonate, sulfate, and chloride had no significant effect on photodegradation kinetics, as there is no UV absorption for these 3 species. In the study using surface water, treated water, and secondary effluent from a wastewater treatment plant, high turbidity and natural organic matters present in the water inhibited the photodegradation of ITHMs. The degradation rates of 6 ITHMs in UV/H2O2 system were rather comparable and significantly higher than those achieved in the UV system without H2O2. To develop a quantitative structure-reactivity relationship (QSAR) model, the logarithm of measured first-order rate constants was correlated with a number of molecular descriptors. The best correlation was obtained with a combination of 3 molecular descriptors, namely the bond strength of carbon-halogen to be broken in the rate-determining step, steric and electronic effects of all substituents to the carbon center. Copyright © 2013 Elsevier Ltd. All rights reserved.

  3. Manganese determination om minerals by activation analysis, using the californium-252 as a neutron source; Determinacao de manganes em minerios, por analise por ativacao, usando californio-252 como fonte de neutrons

    Energy Technology Data Exchange (ETDEWEB)

    Cardoso, Antonio

    1976-07-01

    Neutron Activation Analysis, using a Californium-252 neutron source, has been applied for the determination of manganese in ores such as pyrolusite, rodonite (manganese silicate)' and blending used in dry-batteries The favorable nuclear properties of manganese, such as high thermal neutron cross-section for the reaction {sup 55}Mn (n.gamma){sup 56} Mn, high concentration of manganese in the matrix and short half - life of {sup 56}Mn, are an ideal combination for non-destructive analysis of manganese in ores. Samples and standards of manganese dioxide were irradiated for about 20 minutes, followed by a 4 to 15 minutes decay and counted in a single channel pulse-height discrimination using a NaI(Tl) scintillation detector. Counting time was equal to 10 minutes. The interference of nuclear reactions {sup 56}Fe(n,p){sup 56}Mn and {sup 59} Co (n, {alpha}){sup 56} were studied, as well as problems in connection with neutron shadowing during irradiation, gamma-rays attenuation during counting and influence of granulometry of samples. One sample,was also analysed by wet-chemical method (sodium bismuthate) in order to compare results. As a whole, i t was shown that the analytical method of neutron activation for manganese in ores and blending, is a method simple, rapid and with good precision and accuracy. (author)

  4. Design of a homogeneous subcritical nuclear reactor based on thorium with a source of californium 252; Diseno de un reactor nuclear subcritico homogeneo a base de Torio con una fuente de Californio 252

    Energy Technology Data Exchange (ETDEWEB)

    Delgado H, C. E.; Vega C, H. R. [Universidad Autonoma de Zacatecas, Unidad Academica de Estudios Nucleares, Cipres No. 10, Fracc. La Penuela, 98068 Zacatecas, Zac. (Mexico); Sajo B, L., E-mail: ce_delgado89@hotmail.com [Universidad Simon Bolivar, Laboratorio de Fisica Nuclear, Apdo. 89000, 1080A Caracas (Venezuela, Bolivarian Republic of)

    2015-10-15

    Full text: One of the energy alternatives to fossil fuels which do not produce greenhouse gases is the nuclear energy. One of the drawbacks of this alternative is the generation of radioactive wastes of long half-life and its relation to the generation of nuclear materials to produce weapons of mass destruction. An option to these drawbacks of nuclear energy is to use Thorium as part of the nuclear fuel which it becomes in U{sup 233} when capturing neutrons, that is a fissile material. In this paper Monte Carlo methods were used to design a homogeneous subcritical reactor based on thorium. As neutron reflector graphite was used. The reactor core is homogeneous and is formed of 70% light water as moderator, 12% of enriched uranium UO{sub 2}(NO{sub 3}){sub 4} and 18% of thorium Th(NO{sub 3}){sub 4} as fuel. To start the nuclear fission chain reaction an isotopic source of californium 252 was used with an intensity of 4.6 x 10{sup 7} s{sup -1}. In the design the value of the effective multiplication factor, whose value turned out k{sub eff} <1 was calculated. Also, the neutron spectra at different distances from the source and the total fluence were calculated, as well as the values of the ambient dose equivalent in the periphery of the reactor. (Author)

  5. Induction of micronuclei by 2-hydroxypyridine in water and elimination of solution genotoxicity by UVC (254 nm) photolysis

    Energy Technology Data Exchange (ETDEWEB)

    Skoutelis, Charalambos G. [Department of Environmental and Natural Resources Management, University of Ioannina, Seferi 2, Agrinio 30100 (Greece); Vlastos, Dimitris, E-mail: dvlastos@cc.uoi.gr [Department of Environmental and Natural Resources Management, University of Ioannina, Seferi 2, Agrinio 30100 (Greece); Kortsinidou, Marianna C.; Theodoridis, Ioannis T.; Papadaki, Maria I. [Department of Environmental and Natural Resources Management, University of Ioannina, Seferi 2, Agrinio 30100 (Greece)

    2011-12-15

    Highlights: Black-Right-Pointing-Pointer 2-Hydroxypyridine (2-HPY) is the major metabolite of 2-halogenated pyridines photolysis. Black-Right-Pointing-Pointer We examine the genotoxicity of 2-HPY in cultured human lymphocytes applying the micronucleus assay. Black-Right-Pointing-Pointer 2-HPY was found to be genotoxic. Black-Right-Pointing-Pointer Aqueous solutions of 2-HPY were irradiated by UV at 254 nm. Black-Right-Pointing-Pointer Solution genotoxicity can be completely removed after prolonged phototreatment. - Abstract: 2-Hydroxypyridine (2-HPY) is a major first-stage product formed upon the photolytic destruction of 2-halogenated pyridines. Genotoxicity of 2-HPY in water was studied as a function of concentration. Aqueous solutions of 2-HPY were irradiated by ultraviolet (UV) at 254 nm. 2-HPY concentration, solution total organic carbon (TOC) concentration and solution genotoxicity were measured as a function of treatment time and their profile as a function of time is presented in this work. 2-HPY was found to be genotoxic at all concentrations in the range of 5-400 {mu}g ml{sup -1}. 2-HPY mineralises completely upon prolonged UV irradiation. All untreated and irradiated solution samples, taken at different photo-treatment times, were tested in cultured human lymphocytes applying the cytokinesis block micronucleus (CBMN) assay. The genotoxicity of the solution was reduced near to the control level after prolonged UV irradiation.

  6. Closure Report for Corrective Action Unit 254: Area 25, R-MAD Decontamination Facility, Nevada Test Site, Nevada

    Energy Technology Data Exchange (ETDEWEB)

    G. N. Doyle

    2002-02-01

    Corrective Action Unit (CAU) 254 is located in Area 25 of the Nevada Test Site (NTS), approximately 100 kilometers (km) (62 miles) northwest of Las Vegas, Nevada. The site is located within the Reactor Maintenance, Assembly and Disassembly (R-MAD) compound and consists of Building 3126, two outdoor decontamination pads, and surrounding areas within an existing fenced area measuring approximately 50 x 37 meters (160 x 120 feet). The site was used from the early 1960s to the early 1970s as part of the Nuclear Rocket Development Station program to decontaminate test-car hardware and tooling. The site was reactivated in the early 1980s to decontaminate a radiologically contaminated military tank. This Closure Report (CR) describes the closure activities performed to allow un-restricted release of the R-MAD Decontamination Facility.

  7. Induction of micronuclei by 2-hydroxypyridine in water and elimination of solution genotoxicity by UVC (254 nm) photolysis.

    Science.gov (United States)

    Skoutelis, Charalambos G; Vlastos, Dimitris; Kortsinidou, Marianna C; Theodoridis, Ioannis T; Papadaki, Maria I

    2011-12-15

    2-Hydroxypyridine (2-HPY) is a major first-stage product formed upon the photolytic destruction of 2-halogenated pyridines. Genotoxicity of 2-HPY in water was studied as a function of concentration. Aqueous solutions of 2-HPY were irradiated by ultraviolet (UV) at 254 nm. 2-HPY concentration, solution total organic carbon (TOC) concentration and solution genotoxicity were measured as a function of treatment time and their profile as a function of time is presented in this work. 2-HPY was found to be genotoxic at all concentrations in the range of 5-400 μg ml(-1). 2-HPY mineralises completely upon prolonged UV irradiation. All untreated and irradiated solution samples, taken at different photo-treatment times, were tested in cultured human lymphocytes applying the cytokinesis block micronucleus (CBMN) assay. The genotoxicity of the solution was reduced near to the control level after prolonged UV irradiation. Copyright © 2011 Elsevier B.V. All rights reserved.

  8. Cross section limits for the Cm248(Mg25,4n-5n)Hs268,269 reactions

    Science.gov (United States)

    Dvorak, J.; Brüchle, W.; Düllmann, Ch. E.; Dvorakova, Z.; Eberhardt, K.; Eichler, R.; Jäger, E.; Nagame, Y.; Qin, Z.; Schädel, M.; Schausten, B.; Schimpf, E.; Schuber, R.; Semchenkov, A.; Thörle, P.; Türler, A.; Wegrzecki, M.; Yakushev, A.

    2009-03-01

    We report on an attempt to produce and detect Hs268 and Hs269 in the nuclear fusion reaction Mg25+Cm248 using the gas phase chemistry apparatus COMPACT. No decay chains attributable to the decay of hassium isotopes were observed during the course of this experiment. From the nonobservation of Hs269 we derive a cross section limit of 0.4 pb (63% confidence limit) for the reaction Cm248(Mg25,4n)Hs269 at a center-of-target beam energy of 140 MeV. The evaluated cross section limit for the Cm248(Mg25,5n)Hs268 reaction depends on the assumed half-life of unknown Hs268. Current systematics of the half-lives for even-even Hs isotopes suggests a value of 0.5 s, resulting in a cross section limit of 1.3 pb.

  9. A clinico-radiological study on 254 cases of pontine high signals on magnetic resonance imaging in relation to brain stem semiology

    Energy Technology Data Exchange (ETDEWEB)

    Watanabe, Masaki; Takahashi, Akira (Nagoya Univ. (Japan). Faculty of Medicine); Arahata, Yutaka; Motegi, Yoshimasa; Furuse, Masahiro

    1993-11-01

    A total of 254 patients who were proved to have pontine high intensity areas on T[sub 2]-weighted magnetic resonance imaging (MRI) were analyzed in relation to brain stem semiology. A comparative study on MRI and MR angiography was made between 254 patients with pontine high signals and 276 control cases showing no abnormality either on T[sub 1] or T[sub 2]-weighted images. Of the 254 patients, 62 had transient subjective complaints such as vertigo-dizziness. Supratentorial high signals, basilar artery tortuousness and vertebral artery asymmetry on MR angiography were seen more frequently in patients with pontine high signals than in the controls. In conclusion, pontine high signals may result from diffuse arteriosclerosis and MR angiography is considered to be a useful screening method. (author).

  10. Comparison of the disinfection effects of vacuum-UV (VUV) and UV light on Bacillus subtilis spores in aqueous suspensions at 172, 222 and 254 nm.

    Science.gov (United States)

    Wang, Ding; Oppenländer, Thomas; El-Din, Mohamed Gamal; Bolton, James R

    2010-01-01

    The efficacy of UV and vacuum-UV (VUV) disinfection of Bacillus subtilis spores in aqueous suspensions at wavelengths of 172, 222 and 254 nm was evaluated. A Xe(2)* excilamp, a KrCl* excilamp and a low-pressure mercury lamp were used as almost monochromatic light sources at these three wavelengths. The first-order inactivation rate constants at 172, 222 and 254 nm were 0.0023, 0.122 and 0.069 cm(2) mJ(-1), respectively. Therefore, a 2 log reduction of B. subtilis spores was reached with fluences (UV doses) of 870, 21.6 and 40.4 mJ cm(-2) at these individual wavelengths. Consequently, for the inactivation of B. subtilis spores, VUV exposure at 172 nm is much less efficient than exposure at the other two wavelengths, while exposure at 222 nm is more efficient than that at 254 nm, which is probably because triplet energy transfer from DPA to thymine bases at 222 nm is higher than that at 254 nm. This research indicated quantitatively that VUV light is not practicable for microorganism disinfection in water and wastewater treatment. However, in comparison with other advanced oxidation processes (e.g. UV/TiO(2), UV/H(2)O(2) or O(3)/H(2)O(2)) the VUV-initiated photolysis of water is likely more efficient in generating hydroxyl radicals and more effective for the inactivation of microorganisms.

  11. Added value of interpreter experience in occult and suspect hip fractures: a retrospective analysis of 254 patients.

    Science.gov (United States)

    Collin, David; Göthlin, Jan H; Nilsson, Martin; Hellström, Mikael; Geijer, Mats

    2016-06-01

    The influence of experience in categorizing suspect and occult fractures on radiography compared to MRI and clinical outcome has not been studied. The aim of this study is to evaluate the importance of experience in diagnosing normal or suspect hip radiographs compared to MRI. Primarily reported normal or suspect radiography in 254 patients with low-energy hip trauma and subsequent MRI was re-evaluated by two experienced reviewers. Primary readings and review were compared. The prevalence of fractures among normal and suspect radiographic studies was assessed. Clinical outcome was used as reference. At review of radiography, 44 fractures (17 %) were found. Significantly more fractures were found among suspect cases than among normal cases. At MRI, all 44 fractures were confirmed, and further 64 fractures were detected (25 %). MRI detected all fractures with no missed fractures revealed at follow-up. There were a significantly higher proportion of fractures at MRI among the suspect radiographic diagnoses for both the primary report and at review than among occult cases. The more experienced reviewers classified radiography examinations with higher accuracy than primary reporting general radiologists. There was almost complete agreement on MRI diagnoses.

  12. Prevalence of inherited disorders among mixed-breed and purebred dogs: 27,254 cases (1995-2010).

    Science.gov (United States)

    Bellumori, Thomas P; Famula, Thomas R; Bannasch, Danika L; Belanger, Janelle M; Oberbauer, Anita M

    2013-06-01

    To determine the proportion of mixed-breed and purebred dogs with common genetic disorders. Case-control study. 27,254 dogs with an inherited disorder. Electronic medical records were reviewed for 24 genetic disorders: hemangiosarcoma, lymphoma, mast cell tumor, osteosarcoma, aortic stenosis, dilated cardiomyopathy, hypertrophic cardiomyopathy, mitral valve dysplasia, patent ductus arteriosus, ventricular septal defect, hyperadrenocorticism, hypoadrenocorticism, hypothyroidism, elbow dysplasia, hip dysplasia, intervertebral disk disease, patellar luxation, ruptured cranial cruciate ligament, atopy or allergic dermatitis, bloat, cataracts, epilepsy, lens luxation, and portosystemic shunt. For each disorder, healthy controls matched for age, body weight, and sex to each affected dog were identified. Genetic disorders differed in expression. No differences in expression of 13 genetic disorders were detected between purebred dogs and mixed-breed dogs (ie, hip dysplasia, hypo- and hyperadrenocorticism, cancers, lens luxation, and patellar luxation). Purebred dogs were more likely to have 10 genetic disorders, including dilated cardiomyopathy, elbow dysplasia, cataracts, and hypothyroidism. Mixed-breed dogs had a greater probability of ruptured cranial cruciate ligament. Prevalence of genetic disorders in both populations was related to the specific disorder. Recently derived breeds or those from similar lineages appeared to be more susceptible to certain disorders that affect all closely related purebred dogs, whereas disorders with equal prevalence in the 2 populations suggested that those disorders represented more ancient mutations that are widely spread through the dog population. Results provided insight on how breeding practices may reduce prevalence of a disorder.

  13. International travel in the immunocompromised patient: a cross-sectional survey of travel advice in 254 consecutive patients.

    Science.gov (United States)

    Bialy, C; Horne, K; Dendle, C; Kanellis, J; Littlejohn, G; Ratnam, I; Woolley, I

    2015-06-01

    Our primary aim was to determine the rate of overseas travel in immunocompromised individuals attending appropriate clinics at an Australian tertiary care hospital. We also aimed to characterise health-seeking behaviour prior to travel and investigated sources of pre-travel advice, compared travel patterns and activities between three specific immunosuppressed groups, and examined pre-immunosuppression patient serology. We implemented a cross-sectional survey of patients between February and August 2012. This survey was implemented among three outpatient populations at Monash Medical Centre, an Australian tertiary care hospital. We recruited 254 immunosuppressed adults from three patient populations: human immunodeficiency virus-positive individuals, renal transplant patients and rheumatology patients requiring immunosuppressive therapy. No clinical intervention was performed. In the 10 years preceding the survey, 153 (60.2%) participants reported international travel. Of these, 105 (68.6%) were immunosuppressed at the time of travel. These patients were 47.6% male and 60% Australian born. Forty per cent were visiting friends and relatives as part of their travel. Fifty-four per cent of those immunocompromised at the time of travel were going to high-risk destinations. Pathology files indicated that serological screening was frequently not performed prior to immunosuppression in the renal transplant and rheumatology groups. Immunocompromised patients often travel to high-risk destinations with limited or inadequate pre-travel preparations. Doctors caring for the immunocompromised should be aware of travel risks, suitable vaccination protocols and when to refer to specialist travel clinics. © 2015 Royal Australasian College of Physicians.

  14. Chemical, optical and other data collected aboard the THOMAS G. THOMPSON during cruise TN254 in the Coastal Waters of SE Alaska and North Pacific Ocean from 2010-09-09 to 2010-10-11 (NODC Accession 0104359)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NODC Accession 0104359 includes chemical, optical and other data collected aboard the THOMAS G. THOMPSON during cruise TN254 in the Coastal Waters of SE Alaska and...

  15. Surface modification of Sylgard 184 polydimethylsiloxane by 254 nm excimer radiation and characterization by contact angle goniometry, infrared spectroscopy, atomic force and scanning electron microscopy

    Energy Technology Data Exchange (ETDEWEB)

    Waddell, Emanuel A. [University of Alabama in Huntsville, Huntsville, AL (United States)], E-mail: ewaddell@chemistry.uah.edu; Shreeves, Stephen [University of Alabama in Huntsville, Huntsville, AL (United States); Carrell, Holly; Perry, Christopher [Oakwood College, Huntsville, AL (United States); Reid, Branden A. [Morgan State University, Baltimore, MD (United States); McKee, James [University of Alabama in Birmingham, Birmingham, AL (United States)

    2008-06-30

    The modification of polydimethylsiloxane (PDMS) by narrow band 254 nm excimer radiation under a nitrogen atmosphere was characterized by contact angle goniometry, attenuated total reflectance infrared spectroscopy, atomic force and scanning electron microscopy. UV irradiation results in the formation of the carboxylic acids that influences the wettability of the surface. Continued exposure results in the formation of an inorganic surface (SiO{sub x} (1 < x < 2)) which hinders the ability to continually increase the wettability. The continuity of this inorganic layer is disrupted by the formation of surface cracks. These results have implications in the fabrication and chemical modification of microfluidic or micro-electro-mechanical systems.

  16. Surface modification of Sylgard 184 polydimethylsiloxane by 254 nm excimer radiation and characterization by contact angle goniometry, infrared spectroscopy, atomic force and scanning electron microscopy

    Science.gov (United States)

    Waddell, Emanuel A.; Shreeves, Stephen; Carrell, Holly; Perry, Christopher; Reid, Branden A.; McKee, James

    2008-06-01

    The modification of polydimethylsiloxane (PDMS) by narrow band 254 nm excimer radiation under a nitrogen atmosphere was characterized by contact angle goniometry, attenuated total reflectance infrared spectroscopy, atomic force and scanning electron microscopy. UV irradiation results in the formation of the carboxylic acids that influences the wettability of the surface. Continued exposure results in the formation of an inorganic surface (SiO x (1 < x < 2)) which hinders the ability to continually increase the wettability. The continuity of this inorganic layer is disrupted by the formation of surface cracks. These results have implications in the fabrication and chemical modification of microfluidic or micro-electro-mechanical systems.

  17. Cytochrome P450 CYP716A254 catalyzes the formation of oleanolic acid from β-amyrin during oleanane-type triterpenoid saponins biosynthesis in Anemone flaccida.

    Science.gov (United States)

    Zhan, Chuansong; Ahmed, Shakeel; Hu, Sheng; Dong, Shuang; Cai, Qian; Yang, Tewu; Wang, Xuekui; Li, Xiaohua; Hu, Xuebo

    2018-01-01

    Anemone flaccida Fr. Shmidt (Ranunculaceae), known as 'Di Wu' in China, is a perennial herb which has long been used to treat arthritis. The rhizome of A. flaccida contains pharmacologically active components i.e. oleanane-type triterpenoid saponins. Oleanolic acid is natural triterpenoid in plants with diverse biological activities. The biosynthesis of oleanolic acid involves cyclization of 2,3-oxidosqualene to the oleanane-type triterpenoid skeleton, followed by a series of oxidation reactions catalyzed by cytochrome P450 monooxygenase (CYP450). Previously, we identified four possible cytochrome P450 genes belonging to CYP716A subfamily from the transcriptome of A. flaccida. In this study, we identified one of those genes "CYP716A254" encoding a cytochrome P450 monooxygenase from A. flaccida that catalyzes the conversion of the β-amyrin into oleanolic acid. The heterologous expression of CYP716A254 in yeast resulted in oxidation of β-amyrin at the C-18 position to oleanolic acid production. These results provide an important basis for further studies of oleanane-type triterpenoid saponins synthesis in A. flaccida. Copyright © 2017 Elsevier Inc. All rights reserved.

  18. The fate of silica based Stöber particles soaked into growth media (RPMI and M254): A DLS and ζ-potential study.

    Science.gov (United States)

    Branda, Francesco; Silvestri, Brigida; Costantini, Aniello; Luciani, Giuseppina

    2015-11-01

    Understanding the mechanisms involved in the interaction of biological systems with inorganic materials is of great importance and interest in both fundamental and applied disciplines in several different fields such as astrobiology, ecology, biology, biotechnology, engineering, and medicine. In this context, this paper investigates the interaction of biomacromolecules with submicrometric silica gel particles (NP) obtained through the Stöber method. Surprisingly, particles size reduction is observed after their dispersion into two different reconstituted growth media (RPMI and M254). This effect was related to the nature of the Stöber particles and the mechanism of their formation. The experimental results can be explained arguing that a biomacromolecule corona rapidly forms on NP incubated in both RPMI and M254 growth media. The results suggest that hydrolytic attack at incompletely condensed internal surface valence sites as well as interactions between NPs surface and the components of the growth media reverse the aggregation process, giving smaller disaggregated particles surrounded by a biomacromolecule corona. Moreover it was assessed that, at longer incubation time, the particles slightly grow probably due to interlocking of biomacromolecules in the corona. Furthermore, experimental results confirm that formation of this corona is a competitive and dynamic process. The present paper shows that the described effects (as size changes) are strongly dependent on the nature of the growth medium. Copyright © 2015 Elsevier B.V. All rights reserved.

  19. Abundancias químicas de la compañera visible del agujero negro binario V4641 Sgr (XTE J1819-254)

    Science.gov (United States)

    Cúneo, V. A.; Jofré, E.; Pintado, O. I.; Gómez, M. N.

    2015-08-01

    In this work we expose an analysis of the chemical abundances of the optical companion of the confirmed black hole binary V4641 Sgr (XTE J1819-254) from GMOS spectra obtained with the Gemini North telescope. This analysis allowed to observe an enhancement of N, O, Mg and Si, attributed to the contamination of heavy elements generated during the supernova explosion that gave birth to the black hole. It was also observed that Cr and Fe were subabundant. The aim of this study is to test the formation scenario of a binary system containing a black hole as remnant of the supernova explosion of a massive star, and to provide information to better understand the final stages in the evolution of massive stars and black hole progenitors.

  20. Mitotic recombination and inactivation in Saccharomyces cerevisiae induced by UV-radiation (254 nm) and hyperthermia depend on UV fluence rate.

    Science.gov (United States)

    Petin, V G; Kim, J K; Rassokhina, A V; Zhurakovskaya, G P

    2001-07-01

    In experiments with wild-type diploid yeast cells of Saccharomyces cerevisiae, the synergistic interaction of ultraviolet (UV) light (wavelength, 254 nm) and heat (45--60 degrees C) was studied both for mutagenic and inactivation effects. Simultaneous hyperthermia and UV light treatments increase the frequency of UV-induced mitotic intergenic recombination (crossing-over) and cell inactivation. The enhancing effect was a function of UV light fluence rate. It is concluded that the effect of hyperthermia on low fluence UV or high fluence UV irradiation results in comparable effects on survival and mitotic recombination suggesting similar modulation by hyperthermia of the effects induced by UV at different fluence rates. The interpretation of the data obtained was carried out within the widely accepted point of view considering the synergistic effects as a result of repair ability damage.

  1. Atomic gas temperature in a nonequilibrium high-intensity discharge lamp determined from the red wing of the resonance mercury line 254 nm

    Energy Technology Data Exchange (ETDEWEB)

    Drakakis, E. [Technological Educational Institute, Department of Electrical Engineering, 71004 Heraklion (Greece); Karabourniotis, D. [Institute of Plasma Physics, Department of Physics, University of Crete, 71003 Heraklion (Greece)

    2012-09-01

    For developing low-wattage high intensity discharge (HID) lamps, a better understanding of the relatively unexplored nonequilibrium phenomena is essential. This needs interpretation of diagnostic results by methods free from equilibrium assumptions. In this paper, the atomic temperature is determined from the simulation of a quasistatic broadened resonance line by distinguishing between atomic temperature and excitation temperature in the equation of radiative transfer. The proposed method is applied to the red wing of the resonance mercury line 254 nm emitted from a HID lamp working on ac. The experimental results show severe deviation from local thermodynamic equilibrium. More than one thousand degrees difference was obtained between atomic and electron temperatures at the maximum current phase.

  2. The minimal domain of adipose triglyceride lipase (ATGL ranges until leucine 254 and can be activated and inhibited by CGI-58 and G0S2, respectively.

    Directory of Open Access Journals (Sweden)

    Irina Cornaciu

    Full Text Available Adipose triglyceride lipase (ATGL is the rate-limiting enzyme of lipolysis. ATGL specifically hydrolyzes triacylglycerols (TGs, thereby generating diacylglycerols and free fatty acids. ATGL's enzymatic activity is co-activated by the protein comparative gene identification-58 (CGI-58 and inhibited by the protein G0/G1 switch gene 2 (G0S2. The enzyme is predicted to act through a catalytic dyad (Ser47, Asp166 located within the conserved patatin domain (Ile10-Leu178. Yet, neither an experimentally determined 3D structure nor a model of ATGL is currently available, which would help to understand how CGI-58 and G0S2 modulate ATGL's activity. In this study we determined the minimal active domain of ATGL. This minimal fragment of ATGL could still be activated and inhibited by CGI-58 and G0S2, respectively. Furthermore, we show that this minimal domain is sufficient for protein-protein interaction of ATGL with its regulatory proteins. Based on these data, we generated a 3D homology model for the minimal domain. It strengthens our experimental finding that amino acids between Leu178 and Leu254 are essential for the formation of a stable protein domain related to the patatin fold. Our data provide insights into the structure-function relationship of ATGL and indicate higher structural similarities in the N-terminal halves of mammalian patatin-like phospholipase domain containing proteins, (PNPLA1, -2,- 3 and -5 than originally anticipated.

  3. Prospective analysis of the use of OnabotulinumtoxinA (BOTOX) in the treatment of chronic migraine; real-life data in 254 patients from Hull, U.K.

    Science.gov (United States)

    Khalil, Modar; Zafar, Hassan W; Quarshie, Victoria; Ahmed, Fayyaz

    2014-09-01

    Chronic migraine affects 2% of the population. It results in substantial disability and reduced quality of life. Medications used for prophylaxis in episodic migraine may also work in chronic migraine. The efficacy and safety of OnabotulinumtoxinA (BOTOX) in adults with chronic migraine was confirmed in the PREEMPT programme. However, there are few real-life data of its use. 254 adults with chronic migraine were injected with OnabotulinumtoxinA BOTOX as per PREEMPT Protocol between July 2010 and May 2013, their headache data were collected using the Hull headache diary and analysed to look for headache, migraine days decrements, crystal clear days increment in the month post treatment, we looked at the 50% responder rate as well. Our prospective analysis shows that OnabotulinumtoxinA, significantly, reduced the number of headache and migraine days, and increased the number of headache free days. OnabotulinumtoxinA Botox also improved patients' quality of life. We believe that these results represent the largest post-marketing cohort of patients treated with OnabotulinumtoxinA in the real-life clinical setting. OnabotulinumtoxinA is a valuable addition to current treatment options in patients with chronic migraine. Our results support findings of PREEMPT study in a large cohort of patients, we believe, is representative of the patients seen in an average tertiary headache centre. While it can be used as a first line prophylaxis its cost may restrict its use to more refractory patients who failed three oral preventive treatments.

  4. Use of mussel casts from archaeological sites as paleoecological indicators: An example from CA-MRN-254, Marin County, Alta California

    Science.gov (United States)

    McGann, Mary; Starratt, Scott W.; Powell, Charles L.; Bieling, David G

    2016-01-01

    Archaeological investigations at prehistoric site CA-MRN-254 at the Dominican University of California in Marin County, California, revealed evidence of Native American occupation spanning the past 1,800 years. A dominant source of food for the inhabitants in the San Francisco Bay area was the intertidal, quiet-water dwelling blue mussel (Mytilus trossulus), although rare occurrences of the open coast-dwelling California mussel (Mytilus californianus) suggest that this species was also utilized sporadically. On rare occasions, cultural horizons at this site contain abundant sediment-filled casts of the smaller mussel Modiolus sp. These casts were formed soon after death when the shells filled with sediment and were roasted along with living bivalve shellfish for consumption. Thin sections of these mussel casts display sedimentological and microbiological constituents that shed light on the paleoenvironmental conditions when they were alive. Fine-grained sediment and pelletal muds comprising these casts suggest that the mussels were collected in a low energy, inner bay environment. The rare presence of the diatoms Triceratium dubium and Thalassionema nitzschioides indicate more normal marine (35 psu) and possibly warmer conditions than presently exist in San Francisco Bay. Radiocarbon dating of charcoal associated with the mussel casts containing these diatoms correlates with a 600-year period of warming from ca. A.D. 700–1300, known as the Medieval Climatic Anomaly. Results of this mussel cast study demonstrate that they have great potential for providing paleoenvironmental information at this and other archaeological sites.

  5. Investigation of Free-Standing Plasmonic Mesoporous Ag/CMK-8-Nafion Composite Membrane for the Removal of Organic Pollutants with 254-nm UV Irradiation

    Science.gov (United States)

    Tseng, Chuan Ming; Chen, Hsin Liang; Lai, Sz Nian; Chen, Ming Shiung; Peng, Chien Jung; Li, Chia Jui; Hung, Wei Hsuan

    2017-05-01

    "Carbon-based material" has demonstrated a great potential on water purification due to its strong physical adsorption to organic pollutants in the water. Three-dimensional cubic ordered mesoporous carbon (CMK-8), one of the well-known ordered mesoporous carbons, was prepared by using nanocasting method with mesoporous silica (KIT-6) as the template. In this study, CMK-8 blended with Nafion polymer to form a free-standing mesoporous CMK-8-Nafion composite membrane. The synthesis of high crystallinity CMK-8 was characterized by X-ray diffraction (XRD) and transmission electron microscopy (TEM). More than 80% methyl orange (MO) removal efficiency was observed under 254-nm UV irradiation after 120 min. Ninety-two percent recycling performance was remained after four recycling tests, which indicated a reliable servicing lifetime for the water purification. Furthermore, an additional layer of plasmonic silver nanoparticles (Ag NPs) was integrated into this CMK-8-Nafion membrane for higher pollutant removal efficiency, attributing from the generation of plasmon-resonance hot electrons from Ag NPs. A 4-in. CMK-8-Nafion composite membrane was also fabricated for the demonstration of potential large-scale utilization.

  6. DD Form 254 Preparation Guide

    Science.gov (United States)

    1994-07-01

    DATA is iequired. e. INTELLIGENCE INFORMATION. This information is tinder the jurisdiction and control of the Directo : of Central Intelligence (DCI...une this cort •b. ia•r otosubl .t y qusetone for Inter•retat•jo• of this ggdacn• tothe *Offldasl imufleid below Ft•d"rIg final decision. the 0• n sol

  7. Flow measurements in ONKALO at Olkiluoto probe holes and investigation holes ONK-PP201, -PP254, -PP262, -PP263, -PP274, -PVA8 and -KR13

    Energy Technology Data Exchange (ETDEWEB)

    Pekkanen, J. [Poeyry Finland Oy, Vantaa (Finland)

    2011-10-15

    The Posiva Flow Log, Difference Flow Method (PFL DIFF) uses a flowmeter that incorporates a flow guide and can be used for relatively quick determination of hydraulic conductivity and hydraulic head in fractures/fractured zones in cored drillholes. This report presents the principles of the method and the results of measurements carried out in several drillholes during the excavation of the underground access tunnel ONKALO at Olkiluoto. Phase 1, phase 2, phase 3 and phase 4 of the probe hole measurements in the access tunnel started when the tunnel was 15 m long and finished at the tunnel length of 3976 m. The results of phases 1, 2, 3 and 4 are presented in reports 2006-65 (Phase 1) (Reiman, M., Vaeisaesvaara, J and Poellaenen, J. 2006), 2008-37 (Phase 2) (Pekkanen, J., 2008), 2010-02 (Phase 3) (Pekkanen, J and Vaeisaesvaara, J., 2010) and 2010-32 (Phase 4) (Pekkanen, J, 2010). Probe hole measurements were continued normally in phase 5. The phase 5 results are presented in this report. Flow measurements started on July 15, 2010 when tunnel length was 4357 m and ended on February 3, 2011, at tunnel length 4399 m. Probe hole measurements will continue normally below 4399 m. The probe hole measurements were continued after the phase 4 with a manual device. The flow along the probe hole was measured using manual measurement setup with a 1.0 m point interval. In addition to probe holes, shallow core-drilled drillholes were also measured in ONKALO. The drillholes discussed in this report are ONK-PP201, ONK-PP254, ONKPP262, ONK-PP263, ONK-PP274, ONK-PVA8 and ONK-KR13. The PFL DIFF probe was used to detect flow within single fractures in the drillhole. The method utilizes rubber disks to isolate the flow in a test section from that in the rest of the drillhole. Core-drilled drillholes were measured using a 0.5 m section length (the distance isolated with the rubber disks). Alternatively the flow along the drillhole were measured without the lower rubber disks. The

  8. Effect of Key Parameters on the Photocatalytic Oxidation of Toluene at Low Concentrations in Air under 254 + 185 nm UV Irradiation

    Energy Technology Data Exchange (ETDEWEB)

    Quici, Natalia; Vera, Maria L.; Choi, Hyeok; Puma, Gianluca Li; Dionysiou, Dionysios D.; Litter, Marta I.; Destaillats, Hugo

    2009-07-01

    The effect of key experimental parameters on the removal of toluene under 254 + 185 nm irradiation was investigated using a benchtop photocatalytic flow reactor. Toluenewas introduced at low concentrations between 10 and 500 ppbv, typical of indoorenvironments, and reacted on TiO2-coated Raschig rings. Two different TiO2-coated rings were prepared: in one case, by dip-coating using a P25 aqueous suspension and, on the other, using an organic/inorganic sol-gel method that produced thin films of mesoporous anatase. Flow rates in the photoreactor varied between 4 L min-1 and 125 mL min-1, leading to residence times in the range 100 ms< tau< 2 s. For these conditions, toluene removal efficiencies were between 30 and 90percent, indicating that the system did not achieve total conversion in any case. For each air flow rate, the conversion oftoluene was significantly higher when the reactor length was 10 cm, as compared with 5 cm; however, only marginal increases in conversions were achieved in the two reactor lengths at equal residence time and different concentration of toluene, suggesting that that the reactor is effectively behaving as an ideal reactor and that the reaction is first-order in the concentration of toluene. Experiments were carried out between 0 and 66percent relative humidity (RH), the fastest reaction rate being observed at moderately low humidity conditions (10percent RH), with respect to both dry air and higher humidity levels. Formaldehyde was formed as a partial oxidation byproduct at low and at high residence times (240 and 960 ms), although higher formaldehyde molar yields (up to 20percent) were observed at low tau (240 ms) and moderate humidity conditions (10 and 33percent), suggesting that both tau and RH can be optimized toreduce the formation of harmful intermediates. Toluene removal efficiency increased with the TiO2 thickness (i.e., mass) until a maximum value of 500 nm, beyond which the removal efficiency decreased. This should be

  9. Automated absolute activation analysis with californium-252 sources

    Energy Technology Data Exchange (ETDEWEB)

    MacMurdo, K.W.; Bowman, W.W.

    1978-09-01

    A 100-mg /sup 252/Cf neutron activation analysis facility is used routinely at the Savannah River Laboratory for multielement analysis of many solid and liquid samples. An absolute analysis technique converts counting data directly to elemental concentration without the use of classical comparative standards and flux monitors. With the totally automated pneumatic sample transfer system, cyclic irradiation-decay-count regimes can be pre-selected for up to 40 samples, and samples can be analyzed with the facility unattended. An automatic data control system starts and stops a high-resolution gamma-ray spectrometer and/or a delayed-neutron detector; the system also stores data and controls output modes. Gamma ray data are reduced by three main programs in the IBM 360/195 computer: the 4096-channel spectrum and pertinent experimental timing, counting, and sample data are stored on magnetic tape; the spectrum is then reduced to a list of significant photopeak energies, integrated areas, and their associated statistical errors; and the third program assigns gamma ray photopeaks to the appropriate neutron activation product(s) by comparing photopeak energies to tabulated gamma ray energies. Photopeak areas are then converted to elemental concentration by using experimental timing and sample data, calculated elemental neutron capture rates, absolute detector efficiencies, and absolute spectroscopic decay data. Calculational procedures have been developed so that fissile material can be analyzed by cyclic neutron activation and delayed-neutron counting procedures. These calculations are based on a 6 half-life group model of delayed neutron emission; calculations include corrections for delayed neutron interference from /sup 17/O. Detection sensitivities of < or = 400 ppB for natural uranium and 8 ppB (< or = 0.5 (nCi/g)) for /sup 239/Pu were demonstrated with 15-g samples at a throughput of up to 140 per day. Over 40 elements can be detected at the sub-ppM level.

  10. Metastable charge-transfer state of californium(iii) compounds.

    Science.gov (United States)

    Liu, Guokui; Cary, Samantha K; Albrecht-Schmitt, Thomas E

    2015-06-28

    Among a series of anomalous physical and chemical properties of Cf(iii) compounds revealed by recent investigations, the present work addresses the characteristics of the optical spectra of An(HDPA)3·H2O (An = Am, Cm, and Cf), especially the broadband photoluminescence from Cf(HDPA)3·H2O induced by ligand-to-metal charge transfer (CT). As a result of strong ion-ligand interactions and the relative ease of reducing Cf(iii) to Cf(ii), a CT transition occurs at low energy (transfer state undergoes radiative and non-radiative relaxations. Broadening of the CT transition arises from strong vibronic coupling and hole-charge interactions in the valence band. The non-radiative relaxation of the metastable CT state results from a competition between phonon-relaxation and thermal tunneling that populates the excited states of Cf(iii).

  11. Corrective Action Investigation Plan for Corrective Action Unit 254: Area 25 R-MAD Decontamination Facility, Nevada Test Site, Nevada (includes ROTC No. 1, date 01/25/1999)

    Energy Technology Data Exchange (ETDEWEB)

    DOE/NV

    1999-07-29

    This Corrective Action Investigation Plan contains the US Department of Energy, Nevada Operations Office's approach to collect the data necessary to evaluate corrective action alternatives appropriate for the closure of Corrective Action Unit (CAU) 254 under the Federal Facility Agreement and Consent Order. Corrective Action Unit 254 consists of Corrective Action Site (CAS) 25-23-06, Decontamination Facility. Located in Area 25 at the Nevada Test Site (NTS), CAU 254 was used between 1963 through 1973 for the decontamination of test-car hardware and tooling used in the Nuclear Rocket Development Station program. The CAS is composed of a fenced area measuring approximately 119 feet by 158 feet that includes Building 3126, an associated aboveground storage tank, a potential underground storage area, two concrete decontamination pads, a generator, two sumps, and a storage yard. Based on site history, the scope of this plan is to resolve the problem statement identified during the Data Quality Objectives process that decontamination activities at this CAU site may have resulted in the release of contaminants of concern (COCs) onto building surfaces, down building drains to associated leachfields, and to soils associated with two concrete decontamination pads located outside the building. Therefore, the scope of the corrective action field investigation will involve soil sampling at biased and random locations in the yard using a direct-push method, scanning and static radiological surveys, and laboratory analyses of all soil/building samples. Historical information provided by former NTS employees indicates that solvents and degreasers may have been used in the decontamination processes; therefore, potential COCs include volatile/semivolatile organic compounds, Resource Conservation and Recovery Act metals, petroleum hydrocarbons, polychlorinated biphenyls, pesticides, asbestos, gamma-emitting radionuclides, plutonium, uranium, and strontium-90. The results of this

  12. A abordagem sociotécnica na investigação e na prevenção de acidentes aéreos: o caso do vôo RG-254

    Directory of Open Access Journals (Sweden)

    Vitor Alexandre de Freitas Cardoso

    Full Text Available Este artigo apresenta estudo de caso do acidente ocorrido com o vôo RG-254 da Varig, em setembro de 1989. Partindo de informações de investigações oficiais, publicações, material audiovisual, entrevistas com envolvidos no acidente e especialistas em segurança de vôo, os autores re-analisam o acidente com enfoque sociotécnico referenciado na teoria ator-rede e no conceito de acidente "normal". O texto apresenta novo entendimento para a investigação de acidentes na aviação criticando a tradicional repartição de causas entre os chamados fatores "humanos", "técnicos" e "operacionais" e sugere aplicação do conceito de multicausalidade que não se restringe à mera listagem de "fatores contribuintes", mas que analisa as relações entre atores-redes envolvidos no sistema de aviação em que ocorreu o acidente. O acidente do RG-254 é descrito como sintoma do rompimento de relações entre os atores que atuam no sistema.

  13. Cross-species analysis of Fc engineered anti-Lewis-Y human IgG1 variants in human neonatal receptor transgenic mice reveal importance of S254 and Y436 in binding human neonatal Fc receptor

    Science.gov (United States)

    Burvenich, Ingrid J. G.; Farrugia, William; Lee, Fook T.; Catimel, Bruno; Liu, Zhanqi; Makris, Dahna; Cao, Diana; O'Keefe, Graeme J.; Brechbiel, Martin W.; King, Dylan; Spirkoska, Violeta; Allan, Laura C.; Ramsland, Paul A.; Scott, Andrew M.

    2016-01-01

    ABSTRACT IgG has a long half-life through engagement of its Fc region with the neonatal Fc receptor (FcRn). The FcRn binding site on IgG1 has been shown to contain I253 and H310 in the CH2 domain and H435 in the CH3 domain. Altering the half-life of IgG has been pursued with the aim to prolong or reduce the half-life of therapeutic IgGs. More recent studies have shown that IgGs bind differently to mouse and human FcRn. In this study we characterize a set of hu3S193 IgG1 variants with mutations in the FcRn binding site. A double mutation in the binding site is necessary to abrogate binding to murine FcRn, whereas a single mutation in the FcRn binding site is sufficient to no longer detect binding to human FcRn and create hu3S193 IgG1 variants with a half-life similar to previously studied hu3S193 F(ab')2 (t1/2β, I253A, 12.23 h; H310A, 12.94; H435A, 12.57; F(ab')2, 12.6 h). Alanine substitutions in S254 in the CH2 domain and Y436 in the CH3 domain showed reduced binding in vitro to human FcRn and reduced elimination half-lives in huFcRn transgenic mice (t1/2β, S254A, 37.43 h; Y436A, 39.53 h; wild-type, 83.15 h). These variants had minimal effect on half-life in BALB/c nu/nu mice (t1/2β, S254A, 119.9 h; Y436A, 162.1 h; wild-type, 163.1 h). These results provide insight into the interaction of human Fc by human FcRn, and are important for antibody-based therapeutics with optimal pharmacokinetics for payload strategies used in the clinic. PMID:27030023

  14. Cross-species analysis of Fc engineered anti-Lewis-Y human IgG1 variants in human neonatal receptor transgenic mice reveal importance of S254 and Y436 in binding human neonatal Fc receptor.

    Science.gov (United States)

    Burvenich, Ingrid J G; Farrugia, William; Lee, Fook T; Catimel, Bruno; Liu, Zhanqi; Makris, Dahna; Cao, Diana; O'Keefe, Graeme J; Brechbiel, Martin W; King, Dylan; Spirkoska, Violeta; Allan, Laura C; Ramsland, Paul A; Scott, Andrew M

    2016-01-01

    IgG has a long half-life through engagement of its Fc region with the neonatal Fc receptor (FcRn). The FcRn binding site on IgG1 has been shown to contain I253 and H310 in the CH2 domain and H435 in the CH3 domain. Altering the half-life of IgG has been pursued with the aim to prolong or reduce the half-life of therapeutic IgGs. More recent studies have shown that IgGs bind differently to mouse and human FcRn. In this study we characterize a set of hu3S193 IgG1 variants with mutations in the FcRn binding site. A double mutation in the binding site is necessary to abrogate binding to murine FcRn, whereas a single mutation in the FcRn binding site is sufficient to no longer detect binding to human FcRn and create hu3S193 IgG1 variants with a half-life similar to previously studied hu3S193 F(ab')2 (t1/2β, I253A, 12.23 h; H310A, 12.94; H435A, 12.57; F(ab')2, 12.6 h). Alanine substitutions in S254 in the CH2 domain and Y436 in the CH3 domain showed reduced binding in vitro to human FcRn and reduced elimination half-lives in huFcRn transgenic mice (t1/2β, S254A, 37.43 h; Y436A, 39.53 h; wild-type, 83.15 h). These variants had minimal effect on half-life in BALB/c nu/nu mice (t1/2β, S254A, 119.9 h; Y436A, 162.1 h; wild-type, 163.1 h). These results provide insight into the interaction of human Fc by human FcRn, and are important for antibody-based therapeutics with optimal pharmacokinetics for payload strategies used in the clinic.

  15. Reference: 254 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available ers A et al. 2005 Sep. Plant Cell 17(9):2554-63. TIP GROWTH DEFECTIVE1 (TIP1) of Arabidopsis thaliana affects...rol of protein hydrophobicity and affects protein association with membranes, signal transduction, and vesic

  16. 36 CFR 254.40 - Applications.

    Science.gov (United States)

    2010-07-01

    ... System land must be made in writing to the District Ranger or the Forest Supervisor who has administrative jurisdiction over the land. (b) The applicant shall bear all reasonable costs of administration...

  17. Publications | Page 254 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Through books, articles, research publications, and studies, we aim to widen the impact of our investment and advance development research. ... This important and well-researched book examines the challenges to private sector growth in 12 Middle East and North African countries, assessing comparative performance ...

  18. 30 CFR 254.6 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... injection into a pipeline. It does not include petroleum, including crude oil or any fraction thereof, which... and greases and fish and marine mammal oils, within the meaning of paragraph (2) of section 61(a) of... Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR OFFSHORE OIL-SPILL RESPONSE REQUIREMENTS...

  19. Publications | Page 254 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Much of this biodiversity is highly vulnerable to climate change. So too are the rainfed agriculture,... Understanding adaptation decisions in Morocco's plains and mountains. In Morocco, the threat posed by climate change has been recognized for some time by decision-makers at national and provincial levels. Erratic rainfall ...

  20. 36 CFR 254.9 - Appraisals.

    Science.gov (United States)

    2010-07-01

    ... Acquisition Conference 1992 (Washington, DC, 1992), ISBN 0-16-038050-2 when appraising the values of the..., impartial, and has training and experience in appraising property similar to the property involved in the...: (i) Determine the highest and best use of the property to be appraised; (ii) Estimate the value of...

  1. 36 CFR 254.3 - Requirements.

    Science.gov (United States)

    2010-07-01

    ... supporting rationale shall be documented and made part of the administrative record. (c) Equal value... appraisal(s), through bargaining based on appraisal(s), through other acceptable and commonly recognized... in the exchange and shall provide notice of known storage, release, or disposal of hazardous...

  2. Publications | Page 254 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Seeing climate vulnerabilities through lived experience in Madagascar. Madagascar, the world's fourth largest island, is home to an astonishing range of life forms found nowhere else on the planet. Much of this biodiversity is highly vulnerable to climate change. So too are the rainfed agriculture,... CCAA resources on M&E.

  3. 254-IJBCS-Article-Prof. Msafiri Jackson

    African Journals Online (AJOL)

    Dr Gatsing

    Atomic Absorption Spectrometric methods were correspondingly used for analysis of NO2, SPM, and particulate lead. Results have shown that ... junction, and bus stations and quantified air pollutants such as sulphur dioxide (SO2), ... pollutants include industries (large and small scale), construction, traffic, open burning of.

  4. Degradation kinetics and mechanism of β-lactam antibiotics by the activation of H{sub 2}O{sub 2} and Na{sub 2}S{sub 2}O{sub 8} under UV-254 nm irradiation

    Energy Technology Data Exchange (ETDEWEB)

    He, Xuexiang [Environmental Engineering and Science Program, University of Cincinnati, Cincinnati, OH 45221-0012 (United States); Department of Civil and Environmental Engineering and Nireas-International Water Research Centre, School of Engineering, University of Cyprus, PO Box 20537, 1678 Nicosia (Cyprus); Mezyk, Stephen P. [Department of Chemistry and Biochemistry, California State University Long Beach, 1250 Bellflower Blvd., Long Beach, CA 90840 (United States); Michael, Irene; Fatta-Kassinos, Despo [Department of Civil and Environmental Engineering and Nireas-International Water Research Centre, School of Engineering, University of Cyprus, PO Box 20537, 1678 Nicosia (Cyprus); Dionysiou, Dionysios D., E-mail: dionysios.d.dionysiou@uc.edu [Environmental Engineering and Science Program, University of Cincinnati, Cincinnati, OH 45221-0012 (United States); Department of Civil and Environmental Engineering and Nireas-International Water Research Centre, School of Engineering, University of Cyprus, PO Box 20537, 1678 Nicosia (Cyprus)

    2014-08-30

    Graphical abstract: - Highlights: • Removal efficiency was comparable at different UV fluence rates but same fluence. • Reducing pH to 3 or 2 did not inhibit the removal of nitrobenzene by UV/S{sub 2}O{sub 8}{sup 2−}. • 1.84 × 10{sup −14} M [HO{sup •} ]{sub ss} and 3.10 × 10{sup −13} M [SO{sub 4}{sup •} {sup −}]{sub ss} in UV/S{sub 2}O{sub 8}{sup 2−} were estimated. • HO{sup •} reacted faster with the β-lactams than SO{sub 4}{sup •} {sup −} but sharing similar byproducts. • Transformation pathways included hydroxylation, hydrolysis and decarboxylation. - Abstract: The extensive production and usage of antibiotics have led to an increasing occurrence of antibiotic residuals in various aquatic compartments, presenting a significant threat to both ecosystem and human health. This study investigated the degradation of selected β-lactam antibiotics (penicillins: ampicillin, penicillin V, and piperacillin; cephalosporin: cephalothin) by UV-254 nm activated H{sub 2}O{sub 2} and S{sub 2}O{sub 8}{sup 2−} photochemical processes. The UV irradiation alone resulted in various degrees of direct photolysis of the antibiotics; while the addition of the oxidants improved significantly the removal efficiency. The steady-state radical concentrations were estimated, revealing a non-negligible contribution of hydroxyl radicals in the UV/S{sub 2}O{sub 8}{sup 2−} system. Mineralization of the β-lactams could be achieved at high UV fluence, with a slow formation of SO{sub 4}{sup 2−} and a much lower elimination of total organic carbon (TOC). The transformation mechanisms were also investigated showing the main reaction pathways of hydroxylation (+16 Da) at the aromatic ring and/or the sulfur atom, hydrolysis (+18 Da) at the β-lactam ring and decarboxylation (–44 Da) for the three penicillins. Oxidation of amine group was also observed for ampicillin. This study suggests that UV/H{sub 2}O{sub 2} and UV/S{sub 2}O{sub 8}{sup 2−} advanced

  5. Neutron Protection Factor Determination and Validation for a Vehicle Surrogate Using a Californium Fission Source

    Science.gov (United States)

    2017-06-01

    a 4 mm x 4 mm (0.157" x 0.157") LiI(Eu) crystal with 96% enrichment of lithium -6. The crystal is connected to a photomultiplier tube (PMT) which...32 Figure 17. Lithium -6 Iodide, Europium Doped Scintillation Detector. Source: [27...Alamos National Laboratory LiI(Eu) Lithium Iodide Europium Doped LLD Low Level Discriminator LLNL Lawrence Livermore National Laboratory MASH Monte

  6. Exploration of allosteric agonism structure-activity relationships within an acetylene series of metabotropic glutamate receptor 5 (mGlu5) positive allosteric modulators (PAMs): discovery of 5-((3-fluorophenyl)ethynyl)-N-(3-methyloxetan-3-yl)picolinamide (ML254).

    Science.gov (United States)

    Turlington, Mark; Noetzel, Meredith J; Chun, Aspen; Zhou, Ya; Gogliotti, Rocco D; Nguyen, Elizabeth D; Gregory, Karen J; Vinson, Paige N; Rook, Jerri M; Gogi, Kiran K; Xiang, Zixiu; Bridges, Thomas M; Daniels, J Scott; Jones, Carrie; Niswender, Colleen M; Meiler, Jens; Conn, P Jeffrey; Lindsley, Craig W; Stauffer, Shaun R

    2013-10-24

    Positive allosteric modulators (PAMs) of metabotropic glutamate receptor 5 (mGlu5) represent a promising therapeutic strategy for the treatment of schizophrenia. Both allosteric agonism and high glutamate fold-shift have been implicated in the neurotoxic profile of some mGlu5 PAMs; however, these hypotheses remain to be adequately addressed. To develop tool compounds to probe these hypotheses, the structure-activity relationship of allosteric agonism was examined within an acetylenic series of mGlu5 PAMs exhibiting allosteric agonism in addition to positive allosteric modulation (ago-PAMs). PAM 38t, a low glutamate fold-shift allosteric ligand (maximum fold-shift ~ 3.0), was selected as a potent PAM with no agonism in the in vitro system used for compound characterization and in two native electrophysiological systems using rat hippocampal slices. PAM 38t (ML254) will be useful to probe the relative contribution of cooperativity and allosteric agonism to the adverse effect liability and neurotoxicity associated with this class of mGlu5 PAMs.

  7. Dicty_cDB: VFM254 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available (All Frames) Frame A: ---xxxxxxxxxxxxxxxxvxxxxxxxrxxxxxxxxxxxxxxxkvxxxxxkxxfxxvxnx xmvvlxxittfkrnplsi*ssd*ev...vckflskpslvrllhxklkvlitlrmlkpksktkk vfhqinnvsfspvnnwrmvvlslittfkrnplsi*fsd*evvckfl*klslvkplhsklk vvttlrm*kqkfktkkvshq Frame B: ---xxx...xxxxxxxxxxxxwxxxxxxsxgxxxxxxcxxxxxxxxryxxxxxxxxfxw*xix x

  8. Dicty_cDB: VSK254 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available |BQ633139.1 PfESToab38c04.y1 Plasmodium falciparum 3D7 asexual cDNA Plasmodium falciparum cDNA 5', mRNA sequence...|BU496524.1 PfESToab51c12.y1 Plasmodium falciparum 3D7 asexual cDNA Plasmodium falciparum cDNA 5', mRNA sequence...|BU496772.1 PfESToab58f06.y1 Plasmodium falciparum 3D7 asexual cDNA Plasmodium falciparum cDNA 5', mRNA sequence

  9. Dicty_cDB: VFA254 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available *ktcqny*fycyyhwllqsfqlhwmimsmlltiptsgh*iiqlnmkllqvtf*s*h hkhgwlknqigqfgnigfqfvyqkvlqlqlhlymlmvvqmitgkyqvqwik...ic*kfnr**iys*ihf*schctkyftirfmlli*cmgxesrxsa sstat Translated Amino Acid sequence (All Frames) Frame A: ikdw

  10. 36 CFR 254.23 - Studies, assessments, and approval.

    Science.gov (United States)

    2010-07-01

    ... applied for would serve indigenous community objectives that outweigh other public objectives and values... rights and uses; and (6) Determine if zoning ordinances, covenants, or standards are needed to protect adjacent National Forest land and to protect or mitigate valid existing rights and uses. (b) Upon approval...

  11. 40 CFR 264.254 - Monitoring and inspection.

    Science.gov (United States)

    2010-07-01

    ... liners and covers must be inspected to ensure tight seams and joints and the absence of tears, punctures... detection system under § 264.251(c) must record the amount of liquids removed from each leak detection...

  12. 24 CFR 221.254 - Mortgage insurance premiums.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Mortgage insurance premiums. 221... HOUSING AND URBAN DEVELOPMENT MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES LOW COST AND MODERATE INCOME MORTGAGE INSURANCE-SAVINGS CLAUSE Contract Rights and Obligations-Low...

  13. 24 CFR 236.254 - Termination of mortgage insurance.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Termination of mortgage insurance... HOUSING AND URBAN DEVELOPMENT MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES MORTGAGE INSURANCE AND INTEREST REDUCTION PAYMENT FOR RENTAL PROJECTS Contract Rights and...

  14. Dicty_cDB: SSC254 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available BH339179 |BH339179.1 CH230-41C3.TV CHORI-230 Segment 1 Rattus norvegicus genomic ...clone CH230-41C3, DNA sequence. 48 0.12 1 BH261451 |BH261451.1 CH230-90I24.TV CHORI-230 Segment 1 Rattus nor

  15. 36 CFR 254.8 - Notice of exchange proposal.

    Science.gov (United States)

    2010-07-01

    ... users, the jurisdictional State and local governments, and the congressional delegation and shall make... lands being considered for exchange; (3) A statement as to the effect of segregation from appropriation... writing any comments on or concerns about the exchange proposal, including advising the agency as to any...

  16. Dicty_cDB: VHE254 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available lnqfqwtqqfilkvqflingq niiiilkkptqevmlkplew*kqn*tqqqkfqnflqmilklhqih*vlcniqsylnitl...*fyh*fwv*v**lqslnqfqwtqqfilkvqflingq niiiilkkptqevmlkplew*kqn*tqqqkfqnflqmilklhqih*vlcniqsylnitlh qmlmhqhpkt

  17. Dicty_cDB: SHD254 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available -16-2_G01_sjs2-16-2G01-T3 SJS Schistosoma japonicum cDNA, mRNA sequence. 56 0.001 1 CV682907 |CV682907.1 service...43_H06_sjs2-16-2B11-T3 SJS Schistosoma japonicum cDNA, mRNA sequence. 56 0.001 1 CV682854 |CV682854.1 service

  18. Dicty_cDB: SHI254 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available eppox virus strain TU-V02127, complete genome. 46 1.0 1 AY077833 |AY077833.1 Shee...ppox virus A, complete genome. 46 1.0 1 AY077834 |AY077834.1 Sheeppox virus NISKHI,...3120 |AC173120.2 Bos taurus clone CH240-493D3, *** SEQUENCING IN PROGRESS ***, 41 unordered pieces. 46 1.0 1 AY077832 |AY077832.1 She

  19. Dicty_cDB: SSI254 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 2_F NXLV (Nsf Xylem Late wood Vertical) Pinus taeda cDNA clone NXLV130_B02 5', mRNA sequence. 36 1.2 2 CD018...464 |CD018464.1 NXLV_028_H10_F NXLV (Nsf Xylem Late wood Vertical) Pinus taeda cD

  20. 7 CFR 2018.254 - Requests for records.

    Science.gov (United States)

    2010-01-01

    ... Development Manager, and each Community Development Manager are delegated authority to act respectively at the... records are to be submitted in accordance with 7 CFR 1.3 and may be made to the appropriate Community Development Manager, Rural Development Manager, State Administrative Management Program Director (formerly...

  1. Dicty_cDB: CHM254 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available cds. 62 3e-05 2 CK808839 |CK808839.1 Rasgsc1686 Salivary Gland 4th instar 3rd period (spinning cocoon)...sequence. 34 3e-05 4 CK808739 |CK808739.1 Rasgsc1529 Salivary Gland 4th instar 3rd period (spinning cocoon)...cds. 58 4e-04 2 CK808037 |CK808037.1 Rasgsc0316 Salivary Gland 4th instar 3rd period (spinning cocoon)

  2. 24 CFR 92.254 - Qualification as affordable housing: Homeownership.

    Science.gov (United States)

    2010-04-01

    ... revitalization strategy under § 91.215(e)(2) of its consolidated plan or Empowerment Zone or Enterprise Community... a reasonable administrative cost of its HOME program, so that the additional HOME funds for the housing are not subject to the maximum per-unit subsidy amount. To the extent administrative funds are...

  3. Dicty_cDB: SSG254 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ssykilpaygfvstiaail iaiatmylryhyfvdflaalpvtifcllyggfytpsdfknvfvncfysiksifqnilskf nnk**iylknkkkkkk Translated...aiglssykilpaygfvstiaail iaiatmylryhyfvdflaalpvtifcllyggfytpsdfknvfvncfysiksifqnilskf nnk**iylknkkkkkk Frame

  4. Dicty_cDB: AHA254 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available LVQHXHELEVSHQLGSPXY FMPHVGQFFQGITLTISMELKYPMTKEQVVERYQKFYQNEPLIKIDXDGIPEVKSNSGKH Translated Amino Acid...LVQHXHELEVSHQLGSPXY FMPHVGQFFQGITLTISMELKYPMTKEQVVERYQKFYQNEPLIKIDXDGIPEVKSNSGKH Frame C: ---wriqvnh

  5. 36 CFR 254.22 - Designation and public notice.

    Science.gov (United States)

    2010-07-01

    ... the lands from other forms of entry as long as the application remains in force. (c) The designation... aside. (d) A Forest Service official must prepare a public notice of the proposed townsite sale to be... information on the proposed townsite sale and identify the applicant and responsible Forest Service official...

  6. Dicty_cDB: VHF254 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available EIIL--- ---TSSTITSSSSTTAAATATTTNNSGQQSPPLKEIITVKTANKKVSVKIRAIPLPKNIT NLIEQRSQQLRDLFLGGKNTNKELSDNKITK...rdhs--- ---TSSTITSSSSTTAAATATTTNNSGQQSPPLKEIITVKTANKKVSVKIRAIPLPKNIT NLIEQRSQQLRDLFLGGKNTNKELSDNKITK

  7. Dicty_cDB: SHK254 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available instar 3rd period (spinning cocoon) Rhynchosciara americana cDNA, mRNA sequence. 34 4e-05 3 CK808739 |CK808739...instar 3rd period (spinning cocoon) Rhynchosciara americana cDNA, mRNA sequence. 32 6e-04 3 AF066072 |AF066072...instar 3rd period (spinning cocoon) Rhynchosciara americana cDNA, mRNA sequence. 34 0.002 3 DT775356 |DT775356

  8. Dicty_cDB: VSI254 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available :VS... 515 e-142 1 ( EC825581 ) SME00002373 esmbsro2 Sawyeria marylandensis cDNA,... carnea cDNA 5'... 66 1e-12 3 ( EC821344 ) SME00006756 esmbsro2 Sawyeria marylandensis cDNA,... 86 2e-12 1 d

  9. 16 CFR 254.0 - Scope and application.

    Science.gov (United States)

    2010-01-01

    ..., social aptitude, personality, or other attributes. These Guides do not apply to resident primary or... guidance of the public in conducting its affairs in conformity with legal requirements. These Guides...

  10. All projects related to | Page 254 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    2012-02-10

    Violent conflict related to drug trafficking in Mexico has had a profound impact on the quality of life and health of affected communities. Start Date: February 10, 2012. End Date: May 10, 2014. Topic: NARCOTICS, VICTIMS, VIOLENCE, DRUG TRAFFIC, VULNERABLE GROUPS, JUDICIAL SYSTEM. Region: Mexico, North ...

  11. Dicty_cDB: VHL254 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AAAAAAA sequence update 2002.10.25 Translated Amino Acid sequence fkriyfegrsgegfhnngihlwvsrs*glg*lslirllghwieseggfntsdfig...mgapvrvm*pikhxiixkrkkk Frame C: fkriyfegrsgegfhnngihlwvsrs*glg*lslirllghwieseggfntsdfigrkgsg lkflhhrmgy*gnrs

  12. Dicty_cDB: SFK254 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available mology vs Protein Score E Sequences producing significant alignments: (bits) Value AB126005_1( AB126005 |pid:none) Orthetrum triangul...are melania mito... 32 8.5 protein update 2009. 1.13 PSO

  13. Dicty_cDB: VHA254 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available sequence. 44 0.004 7 CV301445 |CV301445.1 MM8_F01 Young roots probed with 3 week old root enriched transcripts...sequence. 54 0.011 1 CV301444 |CV301444.1 MM8_E01 Young roots probed with 3 week old root enriched transcripts

  14. 7 CFR 254.4 - Application by an ITO.

    Science.gov (United States)

    2010-01-01

    ... government programs, as well as its management and fiscal capabilities. Other factors for evaluation include... Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE GENERAL REGULATIONS AND POLICIES-FOOD DISTRIBUTION ADMINISTRATION OF THE FOOD DISTRIBUTION PROGRAM FOR...

  15. 7 CFR 1710.254 - Alternative sources of power.

    Science.gov (United States)

    2010-01-01

    ... facilities bears a significant relationship to the amount of the proposed loan. (2) If a borrower already... service, the short-term and long-term financial viability of the supplier, and the financial risk to the... effective alternative. (f) RUS may make independent inquiries with potential power suppliers as to the...

  16. Csapody, Tamás. 2014. Bortól Szombathelyig - Tanulmányok a bori munkaszolgálatról és a bori munkaszolgálatosok részleges névlistája ('From Bor to Szombathely- Studies on the Forced Labor Service at Bor Camp and the Partial List of the Forced Laborers in Bor'. Budapest: Zrinyi Kadó. 254 pp. ; Csapody, Tamás. 2015. A Cservenkai tömeggyilkosság ('The Mass Murder at Cservenka'. Budapest: Zsidó Tudományok Szabadegyeteme Alapítvány. 150 pp.

    Directory of Open Access Journals (Sweden)

    Julia Bock

    2016-10-01

    Full Text Available Csapody, Tamás. 2014. Bortól Szombathelyig - Tanulmányok a bori munkaszolgálatról és a bori munkaszolgálatosok részleges névlistája ('From Bor to Szombathely- Studies on the Forced Labor Service at Bor Camp and the Partial List of the Forced Laborers in Bor'. Budapest: Zrinyi Kadó. 254 pp. ; Csapody, Tamás. 2015. A Cservenkai tömeggyilkosság ('The Mass Murder at Cservenka'. Budapest: Zsidó Tudományok Szabadegyeteme Alapítvány. 150 pp. (e-book; a shorter version is accessible at: http://zsido.com/konyvek/a-cservenkai-tomeggyilkossag/.

  17. TASK 2.5.4 DEVELOPMENT OF AN ENERGY SAVINGS CALCULATOR

    Energy Technology Data Exchange (ETDEWEB)

    Miller, William A [ORNL; New, Joshua Ryan [ORNL; Desjarlais, Andre Omer [ORNL; Huang, Joe [Lawrence Berkeley National Laboratory (LBNL); Erdem, Ender [Lawrence Berkeley National Laboratory (LBNL); Ronnen, Levinson [Lawrence Berkeley National Laboratory (LBNL)

    2010-03-01

    California s major energy utilities and the California Energy Commission (CEC) are seeking to allocate capital that yields the greatest return on investment for energy infrastructure that meets any part of the need for reliable supplies of energy. The utilities are keenly interested in knowing the amount of electrical energy savings that would occur if cool roof color materials are adopted in the building market. To meet this need the Oak Ridge National Laboratory and the Lawrence Berkeley National Laboratory (LBNL) have been collaborating on a Public Interest Energy Research (PIER) project to develop an industry-consensus energy-savings calculator. The task was coordinated with an ongoing effort supported by the DOE to develop one calculator to achieve both the DOE and the EPA objectives for deployment of cool roof products. Recent emphasis on domestic building energy use has made the work a top priority by the Department of Energy s (DOE) Building Technologies Program. The Roof Savings Calculator (RSC) tool is designed to help building owners, manufacturers, distributors, contractors and practitioners easily run complex simulations. The latest web technologies and usability design were employed to provide an easy input interface to an annual simulation of hour-by-hour, whole-building performance using the world-class simulation tools DOE-2.1E and AtticSim. Building defaults were assigned based on the best available statistical evidence and can provide energy and cost savings after the user selects nothing more than the building location. A key goal for the tool is to promote the energy benefits of cool color tile, metal and asphalt shingle roof products and other energy saving systems. The RSC tool focuses on applications for the roof and attic; however, the code conducts a whole building simulation that puts the energy and heat flows of the roof and attic into the perspective of the whole house. An annual simulation runs in about 30 sec. In addition to cool reflective roofs, the RSC tool will simulate high- medium- and low-slope roofs, and has a custom selection for the user whose house has a unique inclination. There is an option for above sheathing ventilation, which is prevalent in tile and stone-coated metal roof assemblies. The tool also accommodates the effects of radiant barriers and low-emittance surfaces in the inclined air space above the sheathing. The practitioner can select to have air-conditioning ducts either in the conditioned space or in the attic. If in the attic, the user can select one of three air leakage options. Option 1 is an inspected duct having 4% leakage and code level of duct insulation; option 2 is a poorly insulated duct having 14% air leakage; and option 3 is a custom leakage rate specified by the user. The practitioner can setup multiple layers of ceiling insulation. AtticSim is benchmarked against the field data acquired for Ft. Irwin located near Barstow, CA, first as a standalone simulation program and then again integrated within the DOE-2.1E program. The standalone benchmark was very useful to determining how well AtticSim replicates the building physics of an attic. The coupled benchmark was useful to verify that the DOE-2.1E/AtticSim code is modeling correctly the dynamic relationship between the attic and the occupied space below, as well as the interactions between the attic and the HVAC system, in particular when the ducts are located in the attic.

  18. NIM: A Game-Playing Program. Artificial Intelligence Memo Number 254.

    Science.gov (United States)

    Papert, Seymour; Solomon, Cynthia

    Students learned to plan and write complex computer programs by writing a program for playing NIM, a game in which two players alternatively remove one, two, or three sticks from an original pile of 21, with the player taking the last one being the winner. The primary teaching purpose was to develop the idea that a final goal--i.e., winning--could…

  19. S. Afr. J. Anim. Sci. I I , 247- 254 ( I 981 ) PRACTICAL ...

    African Journals Online (AJOL)

    J. agric. Sci. Camb.,93,607. CRONJE, K.G., l9l3.Ondersoek na die invloed van verskillende drogingstegnieke op die samestelling van gedroogde groenvoer en kuilvoer. M.Sc. Tesis Universiteit van Stellenbosch-. DANLEY, M.M. & VETTER, R.L., l9l l. Changes in carbohydrate and nitrogen fractionsand digestibilityof orages:.

  20. S. Afr. J. Anim. Sci. I I , 247- 254 ( I 981 ) PRACTICAL ...

    African Journals Online (AJOL)

    through a Wiley mill with a I mm screen and stored in screw cap glass containers before being analyzed. The two-stage technique of Tilley & Terry ( 1963) with slight modifications described by Engels & van der Mer- we ( 1967) was used for the determination of in vitro digestibility. Nitrogen content was determined by means.

  1. 40 CFR 421.254 - Standards of performance for new sources.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 28 2010-07-01 2010-07-01 true Standards of performance for new... property Maximum for any 1 day Maximum for monthly average mg/troy ounce of gold and silver smelted Lead 0....000 Total suspended solids 19.500 15.600 pH (1) (1) 1 Within the range of 7.5 to 10.0 at all times. (b...

  2. The Impact of Baby Boomer Retirements on Teacher Labor Markets. Chicago Fed Letter. Number 254

    Science.gov (United States)

    Aaronson, Daniel; Meckel, Katherine

    2008-01-01

    This article explores the future of teacher labor markets. The authors find that teacher hiring needs will rise over the coming decade largely because of retirements. However, this increase will not be significantly different from that of past decades. (Contains 7 notes and 3 figures.)

  3. Yeast Interacting Proteins Database: YGL154C, YGL254W [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available overexpression suppresses sulfite-sensitivity of many unrelated mutants due to hyperactivation of SSU1...overexpression suppresses sulfite-sensitivity of many unrelated mutants due to hyperactivation of SSU1

  4. Yeast Interacting Proteins Database: YBR254C, YDR472W [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available mutations in the human homolog cause the spondyloepiphyseal dysplasia tarda (SEDL) disorder Rows with this bait...mutations in the human homolog cause the spondyloepiphyseal dysplasia tarda (SEDL) disorder Rows with this bait

  5. tert-Butyl 2-{[5-(4-cyanophenylpyridin-3-yl]sulfonyl}acetate

    Directory of Open Access Journals (Sweden)

    H. C. Devarajegowda

    2014-04-01

    Full Text Available In the title compound, C18H18N2O4S, the dihedral angle between the aromatic rings is 33.71 (9° and an intramolecular C—H...O hydrogen bond closes an S(6 ring. In the crystal, molecules are linked by C—H...O and C—H...N hydrogen bonds to generate a three-dimensional network. A very weak aromatic π–π stacking interction is also observed [centroid–centroid separation = 3.9524 (10 Å].

  6. Page 1 254 S. N. RAI AND or HERs cies va. vs and vs are bending ...

    Indian Academy of Sciences (India)

    J. Mol. Spectry., 1968, 26, 454. Austr. J. Chem., 1970 a, 23, 881. Ind. J. Pure and Appl. Phys. 1970 A, 8, 367. Joint Army-Navy-Airforce Thery, iodynamical Tahles, The. Advanced Research Projects Agency Programme, t .S.,. Air Force Contract No. AF33 (6, 6)-6149, The Low Cherani- cal Company, Midland, Michigan, 1962.

  7. : tous les projets | Page 254 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    L'élevage du mouton joue un rôle de premier plan pour ce qui est d'assurer la subsistance des ménages vivant en milieu rural au Mali et dans d'autres pays semi-arides d'Afrique de l'Ouest. Date de début : 1 mars 2011. End Date: 1 août 2014. Région: Mali. Programme: Fonds canadien de recherche sur la sécurité ...

  8. Yeast Interacting Proteins Database: YBR254C, YKR068C [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available oepiphyseal dysplasia tarda (SEDL) disorder Rows with this bait as bait (2) Rows with this bait as prey (0) YKR068C BET3 Hydrophilic...Rows with this bait as prey (0) Prey ORF YKR068C Prey gene name BET3 Prey description Hydrophilic protein th

  9. 30 CFR 254.47 - Determining the volume of oil of your worst case discharge scenario.

    Science.gov (United States)

    2010-07-01

    ... discharge scenario is the sum of the following: (1) The maximum capacity of all oil storage tanks and flow... stores, handles, transfers, processes, or transports oil does not fall into the categories listed in... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Determining the volume of oil of your worst...

  10. 40 CFR 98.254 - Monitoring and QA/QC requirements.

    Science.gov (United States)

    2010-07-01

    ... using any of the following methods, a method published by a consensus-based standards organization (e.g., ASTM, API, etc.) or follow the procedures specified by the flow meter manufacturer. Flow meters must...) Method 18 at 40 CFR part 60, appendix A-6. (2) ASTM D1945-03 Standard Test Method for Analysis of Natural...

  11. Yeast Interacting Proteins Database: YOR269W, YLR254C [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available hway; targets dynein to microtubule tips, which is necessary for sliding of microtubules along bud cortex; s...tin pathway; targets dynein to microtubule tips, which is necessary for sliding of microtubules along bud co

  12. 30 CFR 254.53 - Submitting a response plan developed under State requirements.

    Science.gov (United States)

    2010-07-01

    ...) Identify a qualified individual and require immediate communication between that person and appropriate... you submitted the plan to the State; (5) If the plan received formal approval, the name of the approving organization, the date of approval, and a copy of the State agency's approval letter if one was...

  13. Kuue kuuga on EAS toetanud uusi ideid 2,54 miljardi krooniga / Ülari Alamets

    Index Scriptorium Estoniae

    Alamets, Ülari, 1967-

    2009-01-01

    Ettevõtluse Arendamise Sihtasutus on enam arendanud tehnoloogia arenduskeskuseid, ettevõtete tootearendusprojekte, investeeringuid külakeskkonda ning kohalike avalike teenuste arendamist. Lisa: Põlvamaa suuremad projektid

  14. Page 1 254 H S Mukunda, U Shrinivasa and S DaSappa be ...

    Indian Academy of Sciences (India)

    necessary gap, efficiency increased to 42% and smoke was virtually eliminated, indicating the necessity of tuning this parameter for good stove performance. 6. Sooting of vessels. During early tests it was observed that Swosthee has the problem of sooting even though it does not produce any smoke. No measurements of ...

  15. Sterilization effect of 254 nm UV-C irradiation against cynaobacteria Microcystis aeruginosa

    Science.gov (United States)

    Harmful algal bloom (HAB) produced by several cyanobacterial species is a significant threat to many aquatic ecosystems around the world. Recently frequent occurrence of serious algal bloom in Lake Taihu, Lake Dianchi, and Lake Chaohu has become a serious concern in China. Although various methods a...

  16. A retrospective study of californium-252 neutron brachytherapy combined with EBRT versus 3D-CRT in the treatment of esophageal squamous cell cancer.

    Science.gov (United States)

    Wang, Qifeng; Li, Tao; Lang, Jinyi; Wang, Jie; Wang, Jian; Liu, Huiming; Jia, Xitang; Liu, Bo; Wang, C-K Chris

    2015-10-24

    We conducted a retrospective analysis on 884 patients who were diagnosed with esophageal squamous cell carcinoma (ESCC) and treated with either the neutron brachytherapy in combination with external beam radiotherapy (NBT + EBRT) or 3-dimensional conformal radiation therapy (3D-CRT) to determine the differences in efficacy and morbidity between the two treatment groups. The 884 ESCC patients treated with either NBT + EBRT or 3D-CRT between 2002 and 2012 were retrospectively reviewed and analyzed. Multivariable Cox regression was used to compare oncologic outcomes of the two groups of patients in the context of other clinically relevant variables. The acute and chronic toxicities associated with the two groups were compared using Fisher exact and log-rank tests, respectively. Among the 884 patients, 545 received NBT + EBRT and 339 received 3D-CRT (i.e. EBRT-only). The age range is 39-95 years (median 66). The follow-up time range is 3-145 months (median 32). The analysis shows that the NBT + EBRT group has higher overall survival rate and local control rate than that of the 3D-CRT group. The acute toxicity effects were acceptable for both groups of patients with the NBT + EBRT group showing higher rates of leukopenia and thrombocytopenia and the 3D-CRT group showing higher rates on fistula and massive bleeding. The patients treated with NBT + EBRT showed better oncologic outcomes than those treated with 3D-CRT. The toxicity effects were acceptable for both groups with the NBT + EBRT group showing higher rates on the acute effects and the 3D-CRT group showing higher rates on the late effects.

  17. Accurate determination of Curium and Californium isotopic ratios by inductively coupled plasma quadrupole mass spectrometry (ICP-QMS) in 248Cm samples for transmutation studies

    Energy Technology Data Exchange (ETDEWEB)

    Gourgiotis, A.; Isnard, H.; Aubert, M.; Dupont, E.; AlMahamid, I.; Cassette, P.; Panebianco, S.; Letourneau, A.; Chartier, F.; Tian, G.; Rao, L.; Lukens, W.

    2011-02-01

    The French Atomic Energy Commission has carried out several experiments including the mini-INCA (INcineration of Actinides) project for the study of minor-actinide transmutation processes in high intensity thermal neutron fluxes, in view of proposing solutions to reduce the radiotoxicity of long-lived nuclear wastes. In this context, a Cm sample enriched in {sup 248}Cm ({approx}97 %) was irradiated in thermal neutron flux at the High Flux Reactor (HFR) of the Laue-Langevin Institute (ILL). This work describes a quadrupole ICP-MS (ICP-QMS) analytical procedure for precise and accurate isotopic composition determination of Cm before sample irradiation and of Cm and Cf after sample irradiation. The factors that affect the accuracy and reproducibility of isotopic ratio measurements by ICP-QMS, such as peak centre correction, detector dead time, mass bias, abundance sensitivity and hydrides formation, instrumental background, and memory blank were carefully evaluated and corrected. Uncertainties of the isotopic ratios, taking into account internal precision of isotope ratio measurements, peak tailing, and hydrides formations ranged from 0.3% to 1.3%. This uncertainties range is quite acceptable for the nuclear data to be used in transmutation studies.

  18. Radiological Characterization Technical Report on Californium-252 Sealed Source Transuranic Debris Waste for the Off-Site Source Recovery Project at Los Alamos National Laboratory

    Energy Technology Data Exchange (ETDEWEB)

    Feldman, Alexander [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2014-04-24

    This document describes the development and approach for the radiological characterization of Cf-252 sealed sources for shipment to the Waste Isolation Pilot Plant. The report combines information on the nuclear material content of each individual source (mass or activity and date of manufacture) with information and data on the radionuclide distributions within the originating nuclear material. This approach allows for complete and accurate characterization of the waste container without the need to take additional measurements. The radionuclide uncertainties, developed from acceptable knowledge (AK) information regarding the source material, are applied to the summed activities in the drum. The AK information used in the characterization of Cf-252 sealed sources has been qualified by the peer review process, which has been reviewed and accepted by the Environmental Protection Agency.

  19. Involvement of recF in 254 nm ultraviolet radiation resistance in Deinococcus radiodurans and Escherichia coli.

    Science.gov (United States)

    Chang, Xiaosong; Yang, Lan; Zhao, Qing; Fu, Wenjuan; Chen, Hao; Qiu, Zhiqun; Chen, Ji-an; Hu, Ran; Shu, Weiqun

    2010-11-01

    recF is a critical gene involved in the RecFOR pathway of DNA repair in Deinococcus radiodurans (D. radiodurans). To investigate the role of recF in UV-C radiation resistance, we generated the recF-deficient D. radiodurans strain R1, expressed recF in Escherichia coli (E. coli) BL21 cells, and compared the ability of each to resist UV-C radiation by F (10), inactivation constant (IC), and extrapolation number (N). The mutation of recF in D. radiodurans R1 resulted in characteristic slow growth and dramatic sensitivity to UV-C irradiation. Transformation of recF into E. coli BL21 cells resulted in increased UV-C resistance compared to untransformed E. coli BL21 cells. These results suggested that recF is needed for the replication of D. radiodurans. Furthermore, as a part of the RecFOR pathway in D. radiodurans, disruption of recF could dramatically decrease the UV-C resistance of D. radiodurans and recF could increase the UV-C resistance of E. coli BL21 cells.

  20. Sum frequency generation of 254 nm light and its application as a diagnostic for supersonic vapor streams

    Energy Technology Data Exchange (ETDEWEB)

    Combs, R.L.; Chiba, Z.; Wooldridge, J.; Hill, R.; Chen, H.L.

    1986-10-01

    We describe a technique for generating a narrow linewidth, tuneable, continuous wave, ultraviolet diagnostic beam. The technique utilizes a sum frequency generation technique in which 657 nm and 413 nm light is combined in KDP to generate up to 0.1 mW of uv light. Results of the use of this diagnostic beam to determine vapor properties of a supersonic stream of mercy vapor will be presented. We will also describe the general technique for generation of other wavelengths from 236 to 274 nm.

  1. SU-F-T-254: Dose Volume Histogram (DVH) Analysis of Breath Hold Vs Free Breathing Techniques for Esophageal Tumors

    Energy Technology Data Exchange (ETDEWEB)

    Badkul, R; Doke, K; Pokhrel, D; Aguilera, N; Lominska, C [University of Kansas Medical Center, Kansas City, KS (United States)

    2016-06-15

    Purpose: Lung and heart doses and associated toxicity are of concern in radiotherapy for esophageal cancer. This study evaluates the dosimetry of deep-inspiration-breath-hold (DIBH) technique as compared to freebreathing( FB) using 3D-conformal treatment(3D-CRT) of esophageal cancer. Methods: Eight patients were planned with FB and DIBH CT scans. DIBH scans were acquired using Varian RPM system. FB and DIBH CTs were contoured per RTOG-1010 to create the planning target volume(PTV) as well as organs at risk volumes(OAR). Two sets of gross target volumes(GTV) with 5cm length were contoured for each patient: proximal at the level of the carina and distal at the level of gastroesophageal junction and were enlarged with appropriate margin to generate Clinical Target Volume and PTV. 3D-CRT plans were created on Eclipse planning system for 45Gy to cover 95% of PTV in 25 fractions for both proximal and distal tumors on FB and DIBH scans. For distal tumors celiac nodes were covered electively. DVH parameters for lung and heart OARs were generated and analyzed. Results: All DIBH DVH parameters were normalized to FB plan values. Average of heart-mean and heart-V40 was 0.70 and 0.66 for proximal lesions. For distal lesions ratios were 1.21 and 2.22 respectively. For DIBH total lung volume increased by 2.43 times versus FB scan. Average of lung-mean, V30, V20, V10, V5 are 0.82, 0.92, 0.76, 0.77 and 0.79 for proximal lesions and 1.17,0.66,0.87,0.93 and 1.03 for distal lesions. Heart doses were lower for breath-hold proximal lesions but higher for distal lesions as compared to free-breathing plans. Lung doses were lower for both proximal and distal breath-hold lesions except mean lung dose and V5 for distal lesions. Conclusion: This study showed improvement of OAR doses for esophageal lesions at mid-thoracic level utilizing DIBH vs FB technique but did not show consistent OAR sparing with DIBH for distal lesions.

  2. ARL: A Bimonthly Report on Research Library Issues and Actions from ARL, CNI, and SPARC. Number 254

    Science.gov (United States)

    Barrett, G. Jaia, Ed.

    2007-01-01

    ARL is the bimonthly report on research library issues and actions from ARL (Association of Research Libraries), CNI (Coalition of Networked Information), and SPARC (Scholarly Publishing and Academic Resources Coalition). ARL reports on current issues of interest to academic and research library administrators, staff, and users; higher education…

  3. Lack of arginine vasopressin-induced phosphorylation of aquaporin-2 mutant AQP2-R254L explains dominant nephrogenic diabetes insipidus.

    NARCIS (Netherlands)

    Mattia, F.P. de; Savelkoul, P.J.M.; Kamsteeg, E.J.; Konings, I.B.M.; Sluijs, P. van der; Mallmann, R.; Oksche, A.; Deen, P.M.T.

    2005-01-01

    Water homeostasis in humans is regulated by vasopressin, which induces the translocation of homotetrameric aquaporin-2 (AQP2) water channels from intracellular vesicles to the apical membrane of renal principal cells. For this process, phosphorylation of AQP2 at S256 by cAMP-dependent protein kinase

  4. 48 CFR 215.403-1 - Prohibition on obtaining cost or pricing data (10 U.S.C. 2306a and 41 U.S.C. 254b).

    Science.gov (United States)

    2010-10-01

    ... requirements—(1) Adequate price competition. For acquisitions under dual or multiple source programs: (A) The determination of adequate price competition must be made on a case-by-case basis. Even when adequate price competition exists, in certain cases it may be appropriate to obtain additional information to assist in price...

  5. N,N-Diethyl-2-[5-(4-methoxybenzylidene-2,4-dioxo-1,3-thiazolidin-3-yl]acetamide

    Directory of Open Access Journals (Sweden)

    Vijayan Viswanathan

    2017-05-01

    Full Text Available In the title compound, C17H20N2O4S, the thiazolidine (r.m.s. deviation = 0.022 Å and phenyl rings (major and minor occupancies are inclined to one another by 6.3 (3 and 10.5 (3°, respectively. The molecular conformation is stabilized by an intramolecular C—H...S interaction. In the crystal, molecules are linked by C—H...O hydrogen bonds, which generate R22(18, R22(24 and R21(7 ring motifs. Aromatic π–π stacking interactions are also observed.

  6. Effects of pH and H2O2 on ammonia, nitrite, and nitrate transformations during UV254nm irradiation: Implications to nitrogen removal and analysis.

    Science.gov (United States)

    Wang, Junli; Song, Mingrui; Chen, Baiyang; Wang, Lei; Zhu, Rongshu

    2017-10-01

    In order to achieve better removal and analyses of three dissolved inorganic nitrogen (DIN) species via ultraviolet-activated hydrogen peroxide (UV/H2O2) process, this study systematically investigated the rates of photo-oxidations of ammonia/ammonium (NH3/NH4+) and nitrite (NO2-) as well as the photo-reduction of nitrate (NO3-) at varying pH and H2O2 conditions. The results showed that the mass balances of nitrogen were maintained along irradiation despite of interconversions of DIN species, suggesting that no nitrogen gas (N2) or other nitrogen-containing compound was formed. NH3 was more reactive than NH4+ with hydroxyl radical (OH), and by a stepwise H2O2 addition method NH3/NH4+ can be completely converted to NOx-; NO2- underwent rapid oxidation to form NO3- when H2O2 was present, suggesting that it is an intermediate compound linking NH3/NH4+ and NO3-; but once H2O2 was depleted, NO3- can be gradually photo-reduced back to NO2- at high pH conditions. Other than H2O2, the transformation kinetics of DINs were all dependent on pH, but to varying aspects and extents: the NH3 photo-oxidation favored a pH of 10.3, which fell within the pKa values of NH4+ (9.24) and H2O2 (11.6); the NO3- photo-reduction increased with increasing pH provided that it exceeds the pKa of peroxynitrous acid (6.8); while the NO2- photo-oxidation remained stable unless the pH neared the pKa of H2O2 (11.6). The study thereby demonstrates a picture of the evolutions of DIN species together during UV/H2O2 irradiation process, and for the first time presents a method to achieve complete conversion of NH4+ to NO3- with UV/H2O2 process. Copyright © 2017 Elsevier Ltd. All rights reserved.

  7. 47 CFR 25.254 - Special requirements for ancillary terrestrial components operating in the 1610-1626.5 MHz/2483.5...

    Science.gov (United States)

    2010-10-01

    ... terrestrial component to be used in conjunction with a mobile-satellite service system using CDMA technology... Mobile Satellite Service (MSS) Networks Utilizing Code Division Multiple Access (CDMA) and Other Spread... in these bands must demonstrate that mobile terminals shall: (1) Meet the requirements contained in...

  8. Comparison of Recanalization and In-stent Stenosis between LVIS stent and Enterprise stent-assisted coiling for 254 intracranial aneurysms.

    Science.gov (United States)

    Feng, Xin; Qian, Zenghui; Liu, Peng; Zhang, Baorui; Wang, Luyao; Guo, Erkang; Wen, Xiaolong; Xu, Wenjuan; Jiang, Chuhan; Wu, Zhongxue; Li, Youxiang; Liu, Aihua

    2017-09-25

    We compared the rates of recanalization and in-stent stenosis between the Enterprise and Low-profile Visualized Intraluminal Support(LVIS) stent deployments for intracranial aneurysms(IAs), and the factors associated therein. In total, 142 patients with 161 IAs were treated by LVIS stent-assisted coiling and 111 patients with 142 IAs were treated by Enterprise stent-assisted coiling, respectively, from June 2014 to July 2016 at our institute. Procedure-related complications, angiographic follow-up results, and clinical outcomes were statistically analyzed. The rates of initially complete and near-complete occlusion of the IAs immediately after the procedure between the LVIS and Enterprise groups were similar(94.3% vs 89.9%, P=0.275). Follow-up data identified that the complete and near-complete occlusion rates and recanalization rates were similar for the two groups(96.6% vs 92.1%, P =0.330; 8.0%vs 13.5%; P=0.245). On logistic regression analysis,a higher size ratio(SR) was significantly associated with the recanalization of aneurysms in the Enterprise group,but not in the LVIS group. The rate of moderate and severe in-stent stenosis was lower in the LVIS group (10.2%) than in the Enterprise group (16.8%), with no statistically significant difference (P=0.198). Our study demonstrated acceptable rates of complete and near-complete occlusion with both LVIS and Enterprise stents. LVIS stents may achieve lower rate of recanalization and in-stent stenosis than Enterprise, although this difference was not significant. Higher SR (≥2) was a significant predictor of recanalization in IAs treated with Enterprise stents, but not those treated with LVIS stents. Copyright © 2017. Published by Elsevier Inc.

  9. Ethanogenic fermentation of co-cultures of Candida shehatae HM 52.2 and Saccharomyces cerevisiae ICV D254 in synthetic medium and rice hull hydrolysate.

    Science.gov (United States)

    Hickert, Lilian Raquel; da Cunha-Pereira, Fernanda; de Souza-Cruz, Priscila Brasil; Rosa, Carlos Augusto; Ayub, Marco Antônio Záchia

    2013-03-01

    The ability of Candida shehatae, Saccharomyces cerevisiae, or the combination of these two yeasts in converting the mixed sugar composition of rice hull hydrolysate (RHH) as substrate for ethanol production is presented. In shake flask experiments, co-cultures showed ethanol yields (YP/S) of 0.42 and 0.51 in synthetic medium simulating the sugar composition of RHH and in RHH, respectively, with both glucose and xylose being completely depleted, while pure cultures of C. shehatae produced slightly lower ethanol yields (0.40). Experiments were scaled-up to bioreactors, in which anaerobiosis and oxygen limitation conditions were tested. Bioreactor co-cultures produced similar ethanol yields in both conditions (0.50-0.51) in synthetic medium, while in RHH, yields of 0.48 and 0.44 were obtained, respectively. The results showed near-theoretical yields of ethanol. Results suggest the feasibility of co-cultures of C. shehatae, a newly isolated strain, and S. cerevisiae in RHH as substrate for second-generation ethanol production. Copyright © 2012 Elsevier Ltd. All rights reserved.

  10. No 2965, No 254. Report on new energy technologies and carbon dioxide sequestration: scientifical and technical aspects; N. 2965, N. 254. Rapport sur les nouvelles technologies de l'energie et la sequestration du dioxyde de carbone: aspects scientifiques et techniques

    Energy Technology Data Exchange (ETDEWEB)

    Bataille, Ch.; Birraux, C

    2006-03-15

    The abatement of CO{sub 2} emissions is a huge technical and economical challenge. Fossil fuels, which represent 88% of the world primary energy consumption, are the main source of the 25 billions of CO{sub 2} released each year in the atmosphere. The mastery of CO{sub 2} emissions cannot come from a single technology but must result from the simultaneous implementation of several means, like the development of carbon-free energies and the mastery of fossil fuel emissions. The opportunities of progress are numerous and compatible with the economic development. This document presents, first, the different greenhouse gases, the CO{sub 2} emissions per country and the main sources of CO{sub 2} emissions (power and heat generation, transports). Then it presents different ways of abatement of CO{sub 2} emissions: clean coal technologies, gas combined cycles, CO{sub 2} sequestration, reduction of fuel consumption in transports, development of carbon-free energies: wind power, solar photovoltaic for decentralized power generation, nuclear energy for a competitive power generation and for CO{sub 2} abatement, biofuels of 2. generation and fuel cells. The conclusion stresses on the investments needed for the renewal and increase of energy capacities, and on the necessary visibility and moderation of emission abatement mechanisms (carbon trading and CO{sub 2} prices). (J.S.)

  11. National Program for Inspection of Non-Federal Dams. Abbott Memorial Trust Dam (NH 00260) (NHWRB 254.05) Merrimack River Basin, Wilton, New Hampshire. Phase I Inspection Report.

    Science.gov (United States)

    1979-04-01

    a more t1 pC rigorous program needed A-6 0 0 S S S a- a APPENDIX B FIGURE I Site Plan B- 2 FIGUE 2 Plan and Evaluation of Dar:.D- List of Pertinent...4> APPENDIX C LOCATION AND ORIENTATION OF PHOTOS w SABBOTT MEMORIA TRUST DAM NEW HAMPSHIRE SCALE 1 50SO IDATE NVME W C-2 1. View from right side of

  12. 48 CFR 15.403-1 - Prohibition on obtaining certified cost or pricing data (10 U.S.C. 2306a and 41 U.S.C. 254b).

    Science.gov (United States)

    2010-10-01

    ... data requirements—(1) Adequate price competition. A price is based on adequate price competition if— (i... offer; and (B) The determination that the proposed price is based on adequate price competition, is... and conditions under contracts that resulted from adequate price competition. (2) Prices set by law or...

  13. SU-E-J-254: Evaluating the Role of Mid-Treatment and Post-Treatment FDG-PET/CT in Predicting Progression-Free Survival and Distant Metastasis of Anal Cancer Patients Treated with Chemoradiotherapy

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, H; Wang, J; Chuong, M; D’Souza, W; Choi, W; Lu, W [University of Maryland School of Medicine, Baltimore, MD (United States); Latifi, K; Hoffe, S; Moros, E [Moffitt Cancer Center, Tampa, FL (United States); Saeed, Nadia [Brwon University, Providence, RI (United States); Tan, S [Huazhong University of Science & Technology, Wuhan (China); Shridhar, R [Florida Hospital, Orlando, FL (United States)

    2015-06-15

    Purpose: To evaluate the role of mid-treatment and post-treatment FDG-PET/CT in predicting progression-free survival (PFS) and distant metastasis (DM) of anal cancer patients treated with chemoradiotherapy (CRT). Methods: 17 anal cancer patients treated with CRT were retrospectively studied. The median prescription dose was 56 Gy (range, 50–62.5 Gy). All patients underwent FDG-PET/CT scans before and after CRT. 16 of the 17 patients had an additional FDG-PET/CT image at 3–5 weeks into the treatment (denoted as mid-treatment FDG-PET/CT). 750 features were extracted from these three sets of scans, which included both traditional PET/CT measures (SUVmax, SUVpeak, tumor diameters, etc.) and spatialtemporal PET/CT features (comprehensively quantify a tumor’s FDG uptake intensity and distribution, spatial variation (texture), geometric property and their temporal changes relative to baseline). 26 clinical parameters (age, gender, TNM stage, histology, GTV dose, etc.) were also analyzed. Advanced analytics including methods to select an optimal set of predictors and a model selection engine, which identifies the most accurate machine learning algorithm for predictive analysis was developed. Results: Comparing baseline + mid-treatment PET/CT set to baseline + posttreatment PET/CT set, 14 predictors were selected from each feature group. Same three clinical parameters (tumor size, T stage and whether 5-FU was held during any cycle of chemotherapy) and two traditional measures (pre- CRT SUVmin and SUVmedian) were selected by both predictor groups. Different mix of spatial-temporal PET/CT features was selected. Using the 14 predictors and Naive Bayes, mid-treatment PET/CT set achieved 87.5% accuracy (2 PFS patients misclassified, all local recurrence and DM patients correctly classified). Post-treatment PET/CT set achieved 94.0% accuracy (all PFS and DM patients correctly predicted, 1 local recurrence patient misclassified) with logistic regression, neural network or support vector machine model. Conclusion: Applying radiomics approach to either midtreatment or post-treatment PET/CT could achieve high accuracy in predicting anal cancer treatment outcomes. This work was supported in part by the National Cancer Institute Grant R01CA172638.

  14. Multibeam collection for TN254: Multibeam data collected aboard Thomas G. Thompson from 2010-09-09 to 2010-10-11, departing from Astoria, OR and returning to Seattle, WA

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set is part of a larger set of data called the Multibeam Bathymetry Database (MBBDB) where other similar data can be found at...

  15. A Faceted Catalogue Aids Doctoral-Level Searchers. A Review of: Olson, Tod A. “Utility of a Faceted Catalog for Scholarly Research” Library Hi Tech 25.4 (2007: 550-61.

    Directory of Open Access Journals (Sweden)

    Kurt Blythe

    2008-09-01

    Full Text Available Objective – To learn whether a faceted catalogue and word cloud aids in the discovery process. Design – User study.Setting – Large academic research library in the United States.Subjects – Twelve PhD candidates in the humanities, the majority of whom are engaged with researching, proposing, or writing their dissertations.Methods – The library’s entire catalogue of 5.2 million records was loaded into the AquaBrowser OPAC search interface. A pilot study was conducted using three humanities graduate students employed by the library. Following the pilot, the main study was conducted using graduate students in the humanities. Graduate students in the social sciences were desired for the study, but were not able to be contacted due to time constraints. Once selected, the test subjects were asked to use an interface that offered both facets and tag clouds for enhanced search quality. Test subjects were allowed to choose the topic they would like to research; all chose to research their dissertation topic. A moderator and recorder facilitated research conducted with the faceted catalogue. The moderator ensured that students commented on their findings, cleared up any confusion with using the interface, and kept the students on task. Only when students remarked that a new discovery had been made were those discoveries noted. The impact to the discovery process of faceted navigation and AquaBrowser’s word cloud was studied while the impact of relevance ranking was not.Main Results – The article asserts that results from both the pilot and main study were sufficiently similar to justify combining them for the paper, but the advantage that students employed by thelibrary might have over other students is not discussed. Nine of the twelve students used in the study found new results using the faceted catalogue and word cloud. The responses of the user group to the faceted catalogue and word cloud were “overwhelmingly positive” (555. However, since students were allowed to move freely between the word cloud and faceted navigation tool, it is difficult to attribute new discoveries solely to one or the other. However, when a new discovery could be “attributed primarily to one factor or another” (555 it was noted. The faceted navigation tool aided discovery at least four times and the word cloud aided discovery at least six.Conclusion – A faceted catalogue interface with a word cloud feature clearly aids in the discovery process for more advanced researchers — those with specialized subject knowledge, familiarity with their library’s collection, and experience in researching their area. However, facets and word clouds have limitations: records with limited cataloguing have little to offer faceted navigation; catalogue records from diverse providers introduce controlled vocabularies beyond LCSH and MeSH into searchreturns, resulting in the same word potentially appearing multiple times in the same return albeit with different meanings; the word cloud may contain certain words that researchers feel to be irrelevant. Despite these issues, the use of word clouds and faceted navigation (and relevance ranking appears to be beneficial to research conducted by experienced subject searchers in the humanities.

  16. Can neuromuscular fatigue threshold bedetermined by short and non-exhaustive bouts?. DOI: http://dx.doi.org/10.5007/1980-0037.2012v14n3p254

    Directory of Open Access Journals (Sweden)

    Alexandre Hideki Okano

    2012-05-01

    Full Text Available The present study determined the neuromuscular fatigue threshold (NFT using four different time-periods of analysis of the electromyographic signal and compared these estimations with critical power (CP. Fifteen healthy young men (73.6 ± 5.1 kg, 177.8 ± 7.0 cm, 23.4 ± 5.2 years performed 3-4 different severe constant workload trials until exhaustion on a cycle ergometer with simultaneous SEMG signals acquisition. The obtained data permitted NFT estimation with four different periods of analysis as follows: initial 30s (T30, 1min (T1, 2min (T2 and total time (TT, as well as CP. T30 and T1 were significantly higher than TT and CP and, T2 and TT did not differ between each other, and both were significantly higher than CP. In addition, TT was significantly correlated to CP (0.72; P < 0.05 and to T2 (0.58; P < 0.05. We conclude that NFT overestimates CP, independent of the time-period analysis used for its determination.

  17. A complexa convivência humana e os processos educativos libertadores (The human coexistence and the process of the liberating education - DOI: 10.5752/P.2175-5841.2013v11n29p254

    Directory of Open Access Journals (Sweden)

    Sergio Rogerio Junqueira

    2013-03-01

    Full Text Available Este artigo objetiva traçar o itinerário da educação libertadora na realidade social brasileira e refletir sobre a necessidade de se repensar a ação dessa modalidade de educação nos dias atuais. Ao se articular a realidade da época do surgimento da educação libertadora, que pretendia  responder aos apelos de libertação dos povos Latino-Americanos, com a realidade dos tempos atuais e suas implicações, este artigo busca respostas às questões postas por essa educação libertadora na atualidade. Para abordar as funções do processo educativo dentro do contexto de uma sociedade, é preciso situar as abordagens em sua realidade, contemporizando e adequando as suas ações. Essa temática representa um grande desafio, pois a concepção libertadora de educação extrapola os ambientes acadêmicos, visando sobretudo o bem comum do ser humano e o seu pleno desenvolvimento. Para a realização deste trabalho foram realizadas pesquisas bibliográficas e estudo da realidade desta época informatizada em que estamos inseridos, assim como suas consequências. Palavras-chave: Conscientização. Emancipação. Informatização. Educação Libertadora. Abstract This article aims to trace the route of liberating education in Brazilian social reality and reflect on the need to rethink the action of this type of education these days. In order to articulate the onset of liberating education that intended to respond to calls for liberation of Latin American peoples with the reality of the present time and its implications, this article seeks to answer to the questions posed by this liberating education today. To address the functions of the educational process within the context of a society, one must situate the approaches in their reality, compromising and adapting their actions. This theme represents a great challenge because the conception of such liberating education goes beyond the academic environments, seeking above all, the common good of the human being and its full development. The methodology used in this paper consisted of bibliographical research and a study of the reality of this computerized era in which we operate. Keywords: Awareness Empowerment. Information Technology. Liberating Education. 

  18. Discovery of isotopes of the transuranium elements with 93≤Z≤98

    Energy Technology Data Exchange (ETDEWEB)

    Fry, C.; Thoennessen, M., E-mail: thoennessen@nscl.msu.edu

    2013-01-15

    One hundred and five isotopes of the transuranium elements neptunium, plutonium, americium, curium, berkelium, and californium have been observed so far; the discovery of these isotopes is described. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  19. Separation of Transplutonium Elements from Neutron Irradiated Americium-241

    National Research Council Canada - National Science Library

    UENO, Kaoru; WATANABE, Kenju; SAGAWA, Chiaki; ISHIMORI, Tomitaro

    1974-01-01

    .... The ratios of the amounts present of these isotopes were determined by mass spectrometry. It was not possible to identify 249Bk in the berkelium fraction owing to the interference from other β-ray emitting nuclides. In the californium fraction, both spontaneous fission and a-activities due to 250, 252 were observed.

  20. Neutron-Activated Gamma-Emission: Technology Review

    Science.gov (United States)

    2012-01-01

    flux sources developed for boron neutron capture therapy ( BNCT ), found to be an experimental success in cancer treatment (26). 30 Improved flux on...achievable Am americium API associated particle imaging B boron Be beryllium BNCT boron neutron capture therapy C carbon Cf californium Cl

  1. ORF Alignment: NC_006513 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available Length = 66 ... Query: 254 MAGDLARTDADRALILAGVSHDLRTPLARLRLGVEMSGAPETEVAAMVADVEEMDRIIGQ 313 ... MAGDLA...RTDADRALILAGVSHDLRTPLARLRLGVEMSGAPETEVAAMVADVEEMDRIIGQ Sbjct: 1 ... MAGDLARTDADRALILAGVSHDLRTPLARLRLGVEMSGAPETEVAAMVADVEEMDRIIGQ 60 ...

  2. Isotopic and chemical composition (δ13C, Δ14C, δ15N, C:N, SUVA254nm, % HPOA) of aquatic carbon and field conditions (water temperature, pH, discharge) in the Upper Mississippi River Basin, October 2014 – February 2016

    Data.gov (United States)

    Department of the Interior — This dataset contains stable isotope (δ13C) and radioisotope (Δ14C) compositions of dissolved inorganic carbon, dissolved organic carbon, particulate organic carbon,...

  3. Gregory Nagy. Poetry as Performance, Homer and Beyond y Homeric Questions : Cambridge-New York-Melbourne, Cambridge University Press, 1996, ix + 254 pp. y Austin, University of Texas Press, 1996, ix + 180 pp., respectivamente

    OpenAIRE

    Zecchin de Fasano, Graciela Cristina

    1997-01-01

    Abordar la épìca homérica desde la perspectiva del canto-recitación involucrado en ella ha sido la premisa definitoria en la corriente crítica inaugurada por A. Lord, en la que debemos ubicar Poetry as performance de Nagy, resultado de su exposición en J. H. Gray Lectures, en la University of Cambridge durante 1993. El aporte particular de Nagy, carácter distintivo de su posición crítica, consiste en analizar la épica homérica desde la perspectiva de los conceptos performance y composition, e...

  4. Retraction Notice to ;Fabrication, electromagnetic characteristics of microwave absorbers containing Li0.35Zn0.3Fe2.35O4 micro-belts, nickel-coated carbon fibers; [J. Magn. Magn. Mater. 345 (2013) 249-254

    Science.gov (United States)

    Zhao, Bin; Wang, Qilei; Zhang, Cunrui

    2017-08-01

    This article has been retracted: please see Elsevier Policy on Article Withdrawal This article has been retracted at the request of the Editor-in-Chief. The authors have plagiarized part of a paper that had already appeared in Ceram. Int., 39 (2013) 2317-2322,

  5. Solid-State Neutron Multiplicity Counting System Using Commercial Off-the-Shelf Semiconductor Detectors

    Energy Technology Data Exchange (ETDEWEB)

    Rozhdestvenskyy, S. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

    2017-08-09

    This work iterates on the first demonstration of a solid-state neutron multiplicity counting system developed at Lawrence Livermore National Laboratory by using commercial off-the-shelf detectors. The system was demonstrated to determine the mass of a californium-252 neutron source within 20% error requiring only one-hour measurement time with 20 cm2 of active detector area.

  6. Directed evolution of the periodic table: probing the electronic structure of late actinides.

    Science.gov (United States)

    Marsh, M L; Albrecht-Schmitt, T E

    2017-07-25

    Recent investigations of the coordination chemistry and physical properties of berkelium (Z = 97) and californium (Z = 98) have revealed fundamental differences between post-curium elements and lighter members of the actinide series. This review highlights these developments and chronicles key findings and concepts from the last half-century that have helped usher in a new understanding of the evolution of electronic structure in the periodic table.

  7. Open Source: Potential in Latin America for Radiological Weapons

    Science.gov (United States)

    2010-03-01

    terrorist group would need to acquire a radioactive isotope with a relatively short half-life. 36,37 As an aside, the IAEA verified that depleted...cns.miis.edu/npr/pdfs/123salama.pdf (accessed March 3, 2010), Useful RDD isotopes include cobalt-60, strontium-90, yttrium-90, iridium-192, cesium-137...plutonium-238, radium -226, americium-241, and californium-252. 37 Hansell and Salama, “Does intent equal capability?,” 640-641. 38 Internation Atomic

  8. ORF Alignment: NC_004463 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available QLVVDAIKAEG Sbjct: 1 ... LDGKVALITGAGGGLGEAYAKLFAREGASVVVNDLGGPRDGSGADKSMAQLVVDAIKAEG 60 ... Query: 134 LKGTFCCTMPVFRWMRENGGGVIVNTSSTSGLI...GNFGQTNYGAAKGGIWGLSNVLAIEGR 193 ... LKGTFCCTMPVFRWMRENGGGVIVNTSSTSGLIGNFGQTNY...GAAKGGIWGLSNVLAIEGR Sbjct: 121 LKGTFCCTMPVFRWMRENGGGVIVNTSSTSGLIGNFGQTNYGAAKGGIWGLSNVLAIEGR 180 ... Query: 254 G 254 ... G Sbjct: 241 G 241

  9. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFC254 (Link to dictyBase) - - - Contig-U15456-1 VFC254P (Link... to Original site) VFC254F 509 VFC254Z 569 VFC254P 1078 - - Show VFC254 Library VF (Link to library) Clone ID VFC254 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15456-1 Original site URL http://dict...mology vs DNA Score E Sequences producing significant alignments: (bits) Value N Y16962 |Y16962.1 Dictyostel...ium discoideum mRNA for cathepsin D. 910 0.0 3 AJ243946 |AJ243946.1 Dictyostelium

  10. PROCEEDINGS OF THE SYMPOSIUM COMMEMORATING THE 25th ANNIVERSARY OF ELEMENTS 97 and 98 HELD ON JAN. 20, 1975

    Energy Technology Data Exchange (ETDEWEB)

    Seaborg, Glenn T.; Street Jr., Kenneth; Thompson, Stanley G.; Ghiorso, Albert

    1976-07-01

    This volume includes the talks given on January 20, 1975, at a symposium in Berkeley on the occasion of the celebration of the 25th anniversary of the discovery of berkelium and californium. Talks were given at this symposium by the four people involved in the discovery of these elements and by a number of people who have made significant contributions in the intervening years to the investigation of their nuclear and chemical properties. The papers are being published here, without editing, in the form in which they were submitted by the authors in the months following the anniversary symposium, and they reflect rather faithfully the remarks made on that occasion.

  11. Composition containing transuranic elements for use in the homeopathic treatment of aids

    Energy Technology Data Exchange (ETDEWEB)

    Lustig, D.

    1996-04-18

    A homeopathic remedy consisting of a composition containing one or more transuranic elements, particularly plutonium, for preventing and treating acquired immunodeficiency syndrome (AIDS) in humans, as well as seropositivity for human immunodeficiency virus (HIV). Said composition is characterized in that it uses any chemical or isotopic form of one or more transuranic elements (neptunium, plutonium, americium, curium, berkelium, californium or einsteinium), particularly plutonium, said form being diluted and dynamized according to conventional homeopathic methods, particularly the so-called Hahnemann and Korsakov methods, and provided preferably but not exclusively in the form of lactose and/or saccharose globules or granules impregnated with the active principle of said composition. (author).

  12. Advanced development of the spectrum sciences Model 5005-TF, single-event test fixture

    Energy Technology Data Exchange (ETDEWEB)

    Ackermann, M.R.; Browning, J.S. (Sandia National Labs., Albuquerque, NM (USA)); Hughlock, B.W. (Boeing Aerospace and Electronics Co., Seattle, WA (USA)); Lum, G.K. (Lockheed Missiles and Space Co., Sunnyvale, CA (USA)); Tsacoyeanes, W.C. (Draper (Charles Stark) Lab., Inc., Cambridge, MA (USA)); Weeks, M.D. (Spectrum Sciences, Inc., Santa Clara, CA (USA))

    1990-09-01

    This report summarizes the advanced development of the Spectrum Sciences Model 5005-TF, Single-Event Test Fixture. The Model 5005-TF uses a Californium-252 (Cf-252) fission-fragment source to test integrated circuits and other devices for the effects of single-event phenomena. Particle identification methods commonly used in high-energy physics research and nuclear engineering have been incorporated into the Model 5005-TF for estimating the particle charge, mass, and energy parameters. All single-event phenomena observed in a device under test (DUT) are correlated with an identified fission fragment, and its linear energy transfer (LET) and range in the semiconductor material of the DUT.

  13. TOWARD AN IMPROVED UNDERSTANDING OF STRUCTURE AND MAGNETISM IN NEPTUNIUM AND PLUTONIUM PHOSPHONATES AND SULFONATES

    Energy Technology Data Exchange (ETDEWEB)

    Albrecht-Schmitt, Thomas

    2012-03-01

    This grant supported the exploratory synthesis of new actinide materials with all of the actinides from thorium to californium with the exceptions of protactinium and berkelium. We developed detailed structure-property relationships that allowed for the identification of novel materials with selective ion-exchange, selective oxidation, and long-range magnetic ordering. We found novel bonding motifs and identified periodic trends across the actinide series. We identified structural building units that would lead to desired structural features and novel topologies. We also characterized many different spectroscopic trends across the actinide series. The grant support the preparation of approximately 1200 new compounds all of which were structurally characterized.

  14. Detection of rare earth elements in Powder River Basin sub-bituminous coal ash using laser-induced breakdown spectroscopy (LIBS)

    Energy Technology Data Exchange (ETDEWEB)

    Tran, Phuoc [National Energy Technology Lab. (NETL), Pittsburgh, PA, (United State; Mcintyre, Dustin [National Energy Technology Lab. (NETL), Pittsburgh, PA, (United State

    2015-10-01

    We reported our preliminary results on the use of laser-induced breakdown spectroscopy to analyze the rare earth elements contained in ash samples from Powder River Basin sub-bituminous coal (PRB-coal). We have identified many elements in the lanthanide series (cerium, europium, holmium, lanthanum, lutetium, praseodymium, promethium, samarium, terbium, ytterbium) and some elements in the actinide series (actinium, thorium, uranium, plutonium, berkelium, californium) in the ash samples. In addition, various metals were also seen to present in the ash samples

  15. Removal efficiency and economic cost comparison of hydrated electron-mediated reductive pathways for treatment of bromate

    DEFF Research Database (Denmark)

    Nawaz, Shah; Shah, Noor S.; Khan, Javed Ali

    2017-01-01

    , and different pH (highly acidic to highly basic) proved that UV-254/sulfite successfully provides aqueous electron that effectively participate in bromate removal from water. Significant removal, 86%, of initially 39.0µM bromate was achieved by UV-254/sulfite under conditions that dominate aqueous electron...... decomposition of bromate into bromide proved UV-254/sulfite-based ARPs to be economical and highly rewarding in efficient decomposition of bromate and other inorganic oxyhalides....

  16. Systema Naturae. Classification of living things.

    OpenAIRE

    Alexey Shipunov

    2007-01-01

    Original classification of living organisms containing four kingdoms (Monera, Protista, Vegetabilia and Animalia), 60 phyla and 254 classes, is presented. The classification is based on latest available information.

  17. ORF Alignment: NC_000911 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ALVETVCKLIGQGHRVVLVSSGAIGVGCSRLGLTE 60 ... Query: 129 FELGVIAIVNENDTVAIDELKFGDNDTLSALVASLVEADWLFLLTDVDRLYSSDPRL...DPD 188 ... FELGVIAIVNENDTVAIDELKFGDNDTLSALVASLVEADWLFLLTDVDRLYSSDPRLDPD S...bjct: 121 FELGVIAIVNENDTVAIDELKFGDNDTLSALVASLVEADWLFLLTDVDRLYSSDPRLDPD 180 ... Query: 249 AILQGANLGTQFEA 262 ... AILQGANLGTQFEA Sbjct: 241 AILQGANLGTQFEA 254

  18. ORF Alignment: NC_002935 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available erium ... diphtheriae] ... Length = 254 ... Query: 160 LDKDMPTNTFADVAGADEAIDELHEIKDFLEDPTRYEALGAK...IPRGVLLYGPPGTGKTLL 219 ... LDKDMPTNTFADVAGADEAIDELHEIKDFLEDPTRYEALGAKIPRGV...LLYGPPGTGKTLL Sbjct: 1 ... LDKDMPTNTFADVAGADEAIDELHEIKDFLEDPTRYEALGAKIPRGVLLYGPPGTGKTLL 60 ... Query: 280 XXXXXXH

  19. Estimation of out-crossing rate in a natural breeding population of ...

    African Journals Online (AJOL)

    SERVER

    2008-01-18

    Jan 18, 2008 ... *Corresponding author. E-mail: a.muchugi@cgiar.org. Tel: +254. 733946793. Fax: +254 7224001. cially and marketed at highly competitive prices in South. Africa (Botha et ... provide a sound basis in the conservation strategies planting ... 3730TM) was used to resolve selective amplification products. From.

  20. Nitroketene dithioacetal chemistry: Synthesis of coumarins ...

    Indian Academy of Sciences (India)

    Thin layer chromatography (TLC) was car- ried out using silica gel 60 F254 plates. The developed chromatogram was analysed by UV lamp (254 nm) or iodine vapors. The crude compounds were puri- fied by flash chromatography on silica gel (230–. 400 mesh) using hexanes-EtOAc mixture (10% to. 50% EtOAc) as eluent.

  1. Gclust Server: 119747 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available 119747 CEL_R05H5.2_17532605 Cluster Sequences Related Sequences(24) 372 cdc-25.4: Cell Division Cycle...nces Related Sequences(24) Sequence length 372 Representative annotation cdc-25.4: Cell Division Cycle

  2. The Fundamental Skills Training Project

    Science.gov (United States)

    2003-08-01

    Computers in Human Behavior . 1. 59-74. Slavin, R. E. (1990). Cooperative learning and the gifted: Who benefits? Journal for the... Computers in Human Behavior , 15, 243-254. ISIS Scores on Design Experiment Subscale (Skills Test) By Skill Level 1997-1998 0% 10% 20% 30% 40% 50...word problem solving. Computers in Human Behavior , 15, 243-254. ________________________________________________________________________

  3. Gclust Server: 29597 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available Eco_b3479=nikD Cluster Sequences Related Sequences(293) 254 nickel transporter subunit 3 1.00e-70 0.0 0.0 0.0 6.67...Sequences(293) Sequence length 254 Representative annotation nickel transporter subunit Number of Sequences 3 Homologs

  4. Book Review: John M. Hobson and Leonard Seabrooke (2007) (eds) Everyday Politics of the World Economy

    DEFF Research Database (Denmark)

    Strange, Michael Stewart

    2009-01-01

    Book Review: John M. Hobson and Leonard Seabrooke (2007) (eds) Everyday Politics of the World Economy (Cambridge: Cambridge University Press), 254pp. Udgivelsesdato: 2009......Book Review: John M. Hobson and Leonard Seabrooke (2007) (eds) Everyday Politics of the World Economy (Cambridge: Cambridge University Press), 254pp. Udgivelsesdato: 2009...

  5. Two new isoflavanoids from Bolusanthus speciosus

    African Journals Online (AJOL)

    showed the presence of six methines, two methylenes and two methyl carbons. The mass fragment at m/z 220 showed that the 2-epoxy-3-methylbutyl .... (Merck); Sephadex LH-20 (Sigma); preparative TLC: silica gel 60 PF254 + 366 for preparative layer chromatography (Merck); analytical TLC: silica gel 60-F254 precoated ...

  6. 76 FR 51415 - Ideal Pharmacy Care, Inc., D/B/A Esplanade Pharmacy; Revocation of Registration

    Science.gov (United States)

    2011-08-18

    ... formulations of hydrocodone, a schedule III controlled substance, and alprazolam 2 mg (generic for Xanax), a... the accountable total; (5) 83,254 dosage units of alprazolam 2 mg, 96 percent of the accountable total... for which it was accountable; 5. A shortage of 83,254 dosage units of alprazolam 2 mg., which was also...

  7. Modeling temperature effect on dynamic modulus of elasticity of red pine (Pinus resinosa) in frozen and non-frozen states

    Science.gov (United States)

    Shan Gao; Xiping Wang; Lihai Wang

    2015-01-01

    The response of dynamic and static modulus of elasticity (MOEdyn and MOEsta) of red pine small clear wood (25.4 × 25.4 × 407 mm3) within the temperature range -40 to 40°C has been investigated. The moisture content (MC) of the specimens ranged from 0 to 118%. The MOEdyn was...

  8. 76 FR 23837 - Certain Ceramic Capacitors and Products Containing Same; Notice of the Commission's Final...

    Science.gov (United States)

    2011-04-28

    ... Electronics North America, Inc. of Smyrna, Georgia (collectively, ``Murata''). 74 FR 57193-94 (Nov. 4, 2009...''); 6,243,254 (``the '254 patent''); and 6,377,439 (subsequently terminated from the investigation). The... issues it determined to review, and on remedy, the public interest and bonding. 76 FR 11275 (Mar. 1, 2011...

  9. Characterization of the Effect of Fiber Undulation on Strength and Stiffness of Composite Laminates

    Science.gov (United States)

    2015-03-01

    introduced several textile composite models, such as the fiber crimp model, to address the effect of fiber undulation for plain and harness satin weaves. The...used during image correlation. A size 5 strain filter and Lagrange tensor type were used. The area of interest was nominally 25.4 mm wide × 25.4 mm

  10. 75 FR 17920 - Agency Information Collection Activities: Proposed Collection: Comment Request

    Science.gov (United States)

    2010-04-08

    ... Public Health Service Act (42 U.S.C. 254d-254q). Under these NHSC programs, health professionals agree to provide primary health services in health professional shortage areas. Health professionals who have... communicate with each other, and enable the Bureau to communicate with NHSC Alumni (e.g., send updates, plan...

  11. Dicty_cDB: Contig-U13159-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ntities = 254/254 (100%) Strand = Plus / Plus Query: 13 aaaaagggacttgngagtttgntgatttngatccnaaaccnttnntttgnaa...aactgntg 72 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 13 aaaaagggacttgngagtttgntgatttngatccna...ttttggtggnaaaaaaggttntgnctactggaaancaagtcaaggngntncna 192 Query: 193 nggccncntnaaangccna...||||| Sbjct: 193 nggccncntnaaangccnatcccctttangaaancnatccntcaggnggngaaaanncna 252 Query: 253 tttntnctagcccc .../235 (97%) Strand = Plus / Plus Query: 13 aaaaagggacttgngagtttgntgatttngatccnaaaccnttnntttgnaaaactgntg 72 ||

  12. Becoming a Blood Stem Cell Donor

    Medline Plus

    Full Text Available ... are most commonly used in the treatment of cancers like leukemia and lymphoma to restore stem cells that have been destroyed by high doses of ... 514 views 3:28 Cancer symptom pains - Pancreatic Cancer - Duration: 2:54. ... 2:54 Calum's stem cell donation for Anthony Nolan - Duration: 3:35. Anthony ...

  13. Measurements of the neutron capture cross sections and incineration potentials of minor-actinides in high thermal neutron fluxes: Impact on the transmutation of nuclear wastes; Mesures des sections efficaces de capture et potentiels d'incineration des actinides mineurs dans les hauts flux de neutrons: Impact sur la transmutation des dechets

    Energy Technology Data Exchange (ETDEWEB)

    Bringer, O

    2007-10-15

    This thesis comes within the framework of minor-actinide nuclear transmutation studies. First of all, we have evaluated the impact of minor actinide nuclear data uncertainties within the cases of {sup 241}Am and {sup 237}Np incineration in three different reactor spectra: EFR (fast), GT-MHR (epithermal) and HI-HWR (thermal). The nuclear parameters which give the highest uncertainties were thus highlighted. As a result of fact, we have tried to reduce data uncertainties, in the thermal energy region, for one part of them through experimental campaigns in the moderated high intensity neutron fluxes of ILL reactor (Grenoble). These measurements were focused onto the incineration and transmutation of the americium-241, the curium-244 and the californium-249 isotopes. Finally, the values of 12 different cross sections and the {sup 241}Am isomeric branching ratio were precisely measured at thermal energy point. (author)

  14. A gas secondary electron detector

    CERN Document Server

    Drouart, A; Alamanos, N; Auger, F; Besson, P; Bougamont, E; Bourgeois, P; Lobo, G; Pollacco, E C; Riallot, M

    2002-01-01

    A new Secondary Electron gas Detector (SED) is under development to be used in conjunction with an emissive foil to detect low energy heavy ions as an alternative to micro-channel plates. It could measure position and time of flight. Secondary electrons are accelerated to 10 keV so that they can cross through the 0.9 mu m Mylar entrance window. The electrons then are multiplied in the isobutane gas of the detector at 4-10 Torr. A time resolution of 150 ps and a spatial resolution of 3 mm have been obtained by using californium fission fragments on a prototype detector of 7x7 cm sup 2. The advantage of the SED against MCP is that its size is not limited. Our final goal is to build a large size detector (15x40 cm sup 2) that will operate at the focal plane of the VAMOS magnetic spectrometer at GANIL.

  15. Environmental assessment of the thermal neutron activation explosive detection system for concourse use at US airports

    Energy Technology Data Exchange (ETDEWEB)

    Jones, C.G.

    1990-08-01

    This document is an environmental assessment of a system designed to detect the presence of explosives in checked airline baggage or cargo. The system is meant to be installed at the concourse or lobby ticketing areas of US commercial airports and uses a sealed radioactive source of californium-252 to irradiate baggage items. The major impact of the use of this system arises from direct exposure of the public to scattered or leakage radiation from the source and to induced radioactivity in baggage items. Under normal operation and the most likely accident scenarios, the environmental impacts that would be created by the proposed licensing action would not be significant. 44 refs., 19 figs., 18 tabs.

  16. Chelation and stabilization of berkelium in oxidation state +IV

    Science.gov (United States)

    Deblonde, Gauthier J.-P.; Sturzbecher-Hoehne, Manuel; Rupert, Peter B.; An, Dahlia D.; Illy, Marie-Claire; Ralston, Corie Y.; Brabec, Jiri; de Jong, Wibe A.; Strong, Roland K.; Abergel, Rebecca J.

    2017-09-01

    Berkelium (Bk) has been predicted to be the only transplutonium element able to exhibit both +III and +IV oxidation states in solution, but evidence of a stable oxidized Bk chelate has so far remained elusive. Here we describe the stabilization of the heaviest 4+ ion of the periodic table, under mild aqueous conditions, using a siderophore derivative. The resulting Bk(IV) complex exhibits luminescence via sensitization through an intramolecular antenna effect. This neutral Bk(IV) coordination compound is not sequestered by the protein siderocalin—a mammalian metal transporter—in contrast to the negatively charged species obtained with neighbouring trivalent actinides americium, curium and californium (Cf). The corresponding Cf(III)-ligand-protein ternary adduct was characterized by X-ray diffraction analysis. Combined with theoretical predictions, these data add significant insight to the field of transplutonium chemistry, and may lead to innovative Bk separation and purification processes.

  17. The CARIBU EBIS control and synchronization system

    Science.gov (United States)

    Dickerson, Clayton; Peters, Christopher

    2015-01-01

    The Californium Rare Isotope Breeder Upgrade (CARIBU) Electron Beam Ion Source (EBIS) charge breeder has been built and tested. The bases of the CARIBU EBIS electrical system are four voltage platforms on which both DC and pulsed high voltage outputs are controlled. The high voltage output pulses are created with either a combination of a function generator and a high voltage amplifier, or two high voltage DC power supplies and a high voltage solid state switch. Proper synchronization of the pulsed voltages, fundamental to optimizing the charge breeding performance, is achieved with triggering from a digital delay pulse generator. The control system is based on National Instruments realtime controllers and LabVIEW software implementing Functional Global Variables (FGV) to store and access instrument parameters. Fiber optic converters enable network communication and triggering across the platforms.

  18. Off-line commissioning of EBIS and plans for its integration into ATLAS and CARIBU

    Energy Technology Data Exchange (ETDEWEB)

    Ostroumov, P. N., E-mail: ostroumov@anl.gov; Barcikowski, A.; Dickerson, C. A.; Mustapha, B.; Perry, A.; Sharamentov, S. I.; Vondrasek, R. C.; Zinkann, G. [Argonne National Laboratory, Argonne, Illinois 60439 (United States)

    2016-02-15

    An Electron Beam Ion Source Charge Breeder (EBIS-CB) has been developed at Argonne to breed radioactive beams from the CAlifornium Rare Isotope Breeder Upgrade (CARIBU) facility at Argonne Tandem Linac Accelerator System (ATLAS). The EBIS-CB will replace the existing ECR charge breeder to increase the intensity and significantly improve the purity of reaccelerated radioactive ion beams. The CARIBU EBIS-CB has been successfully commissioned offline with an external singly charged cesium ion source. The performance of the EBIS fully meets the specifications to breed rare isotope beams delivered from CARIBU. The EBIS is being relocated and integrated into ATLAS and CARIBU. A long electrostatic beam transport system including two 180° bends in the vertical plane has been designed. The commissioning of the EBIS and the beam transport system in their permanent location will start at the end of this year.

  19. Populations of selected microbial and fungal species growing on the surface of rape seeds following treatment with desiccants or plant growth regulators.

    Science.gov (United States)

    Frac, Magdalena; Jezierska-Tys, Stefania; Tys, Jerzy

    2010-01-01

    The aim of this study was to determine the effects of desiccants and plant growth regulators on selected microbial species affecting rape seeds, with special emphasis on the growth of fungi and identification of the genus and species composition. The experimental material in the study was seeds of winter rape cv. Californium that were collected from the field during combine harvest. The chemical agents applied, both desiccants and growth regulators, generally decreased the populations of bacteria occurring on the surface of rape seeds. The responses of fungi depended upon the type of agent applied and were manifested as either stimulation or inhibition of the growth of the fungal species. The fungi isolated from the surface of rape seeds were characteristic of those found in the field environment (Cladosporium and Penicillium) and typical for those present on the surface of rape seeds (Alternaria).

  20. Reliability of semiconductor and gas-filled diodes for over-voltage protection exposed to ionizing radiation

    Directory of Open Access Journals (Sweden)

    Stanković Koviljka

    2009-01-01

    Full Text Available The wide-spread use of semiconductor and gas-filled diodes for non-linear over-voltage protection results in a variety of possible working conditions. It is therefore essential to have a thorough insight into their reliability in exploitation environments which imply exposure to ionizing radiation. The aim of this paper is to investigate the influence of irradiation on over-voltage diode characteristics by exposing the diodes to californium-252 combined neutron/gamma radiation field. The irradiation of semiconductor over-voltage diodes causes severe degradation of their protection characteristics. On the other hand, gas-filled over-voltage diodes exhibit a temporal improvement of performance. The results are presented with the accompanying theoretical interpretations of the observed changes in over-voltage diode behaviour, based on the interaction of radiation with materials constituting the diodes.

  1. Triton and alpha-particle contribution from LiF converter for neutron dosimeter

    CERN Document Server

    Camacho, M E; Balcazar, M

    1999-01-01

    A personnel neutron dosimeter prototype based on chemical and electrochemical etched CR-39 detector, combined with LiF converter, has been calibrated using an ICRP-like phantom, under a heavy-water moderated Californium source neutron spectra; A conversion factor of 1.052+-126 spots cm sup - sup 2 mSv sup - sup 1 was obtained. The sealing properties of the detector holder showed a ten-fold reduction in radon background when it was tested in a high radon atmosphere. A convenient mechanical shock resistance was achieved in LiF converters by sintering to 11 tons pressure LiF powder at 650 deg. C, during one hour.

  2. Study of reproducibility of measurements with the spectrometer of Bonner multispheres

    Energy Technology Data Exchange (ETDEWEB)

    Azevedo, G.A.; Pereira, W.W.; Patrao, K.C.S.; Fonseca, E.S., E-mail: geisadeazevedo@gmail.com, E-mail: walsan@ird.gov.br, E-mail: karla@ird.gov.br, E-mail: evaldo@ird.gov.br [Instituto de Radionprotecao e Dosimetria (IRD/CNEN-RJ), Rio de Janeiro, RJ (Brazil)

    2013-07-01

    This work aims to study the metrological behavior of the Bonner Multisphere Spectrometer (BMS) of the LN / LNMRI / IRD - Laboratorio Metrologia de Neutrons / Laboratorio Nacional de Metrologia e Radiacao Ionizante / Instituto de Radioprotecao e Dosimetria, for measurements in repeatability and reproducibility conditions. Initially, a simulation was done by applying the Monte Carlo method, using the MCNP code and respecting the ISO 8529-1 (2001), using the sources of Californium ({sup 252} Cf), Americium-Beryllium ({sup 241} AmBe) and californium in heavy water (Cf + D{sub 2}O), all located at a distance of 100 cm from the neutron detector ({sup 6}Li (Eu) - crystal scintillator). In this program, the counting of neutrons that are captured by the detector was made. The source is located in the center of a sphere of radius 300 cm. Analyzes the impact of these neutrons in a point of the sphere wall, which in this case acted as a neutron detector and from there, it is estimated the number of neutrons that collide in the whole sphere. The purpose is to obtain the neutron count for different energy bands in a solid field of neutrons, since they have a spectrum ranging from a low to a high energy that can also vary within a particular environment. Wishes to obtain new fields with different sources and moderators materials to be used as new reference fields. Measurements are being conducted for these fields, with the aim of analyzing the variability conditions of the measurement (repeatability and reproducibility) in LEN - Laboratorio de Espectrometria de Neutrons of the LN/LMNRI/IRD. Thus, the spectrometer will be used to improve both the knowledge of the spectrum as the standard of neutrons of the lab, proving that a spectrometry is essential for correct measurement.

  3. Stress Analysis of Aircraft Modifications (C-141B Aircraft). Joint Airborne Communications Center/Command Post (JACC/CP) Provisions,

    Science.gov (United States)

    1980-10-27

    the Is oie. .,906 dl::nw/eer ho,/e c/r,’//ec/ o7 l’ cenIer o-f +he clo &i k le r Re fe rc ) e Tra w.’nS 4c - 79c?7 -Tn s//~v e4- ,, Doub /lerJ C Co...80E6 ALL POISSON *33 ALL E 100E7 201 TO 254 G 3480E6 201 TO 254 POISSON .33 201 TO 254 SSIZE CODE IDENT DWG NO.I .-- i, ii P4 oA 11 4 ) 1 649-2924-001

  4. Joint analysis of Rayleigh-wave dispersion and HVSR of lunar seismic data from the Apollo 14 and 16 sites

    Czech Academy of Sciences Publication Activity Database

    Dal Moro, Giancarlo

    2015-01-01

    Roč. 254, JUL 1 (2015), s. 338-349 ISSN 0019-1035 Institutional support: RVO:67985891 Keywords : moon * Regoliths * geophysics * surface- wave Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 3.383, year: 2015

  5. THE LIVED ExPERIENCES OF LATE -ADOLESCENT FEMALE ...

    African Journals Online (AJOL)

    2010-06-08

    18). A phenomenological psychology research approach focuses on the psychological meanings of research participants' lived experiences in their particular life worlds. (Giorgi 1997:252–254; Kruger 1988:37–38). An arts- ...

  6. Shorelines Extracted from 1984-2015 Landsat Imagery: Horn Island, Mississippi (Polygon: Individual Dates)

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — Shorelines Extracted from 1984-2015 Landsat Imagery: Horn Island, Mississippi (Polygon: Individual Dates) is a dataset consisting of 254 polygon shapefiles...

  7. 77 FR 75159 - Information Collection Being Submitted to the Office of Management and Budget for Emergency...

    Science.gov (United States)

    2012-12-19

    .... Statutory authority for this information collection is contained in 47 U.S.C. section 254(b) of the... to the legitimate distribution of universal service support to rural, high cost carriers. After the...

  8. 7 CFR 1767.15 - General instructions.

    Science.gov (United States)

    2010-01-01

    ... the expense of issuance shall be recorded in Account 181, Unamortized Debt Expense. (iii) The premium... gain shall be deferred in Account 254, Other Regulatory Liabilities, pending resolution of the...

  9. 466 EAST AFRICAN MEDICAL JOURNAL 0ct0ber2007

    African Journals Online (AJOL)

    REVSS. KENYA MEDICAL ASSOCIATION HOUSE P. 0. BOX 41632-00100. CHYULU ROAD NAIROBI. OFF NGONG ROAD 'l'liL: 254-0202712010. I'AX: 2540202724617. Ii—muil: emnj@wananehi.eom. Website: www.cnmjeom. SUBSCRIBE ...

  10. Batch culture fermentation of Penicillium chrysogenum and a report on the isolation, purification, identification and antibiotic activity of citrinin

    Digital Repository Service at National Institute of Oceanography (India)

    PrabhaDevi; DeSouza, L.; Kamat, T.; Rodrigues, C.; Naik, C.G.

    ) plates. Repeated chromatographic separation (column and TLC) yielded pure citrinin. Analytical methods Thin Layer Chromatography (TLC) TLC was performed on aluminium sheets precoated with silica gel 60 F254 (Merk KgaA, Damstadt, Germany, Cat No. 1...

  11. The structure of the desiccated Richtersius coronifer (Richters, 1903)

    Czech Academy of Sciences Publication Activity Database

    Czerneková, Michaela; Jönsson, K. I.; Chajec, Ł.; Student, S.; Poprawa, I.

    2017-01-01

    Roč. 254, č. 3 (2017), s. 1367-1377 ISSN 0033-183X Institutional support: RVO:67985823 Keywords : anhydrobiosis * cryptobiosis * tardigrades * tun * ultrastructure Subject RIV: ED - Physiology Impact factor: 2.870, year: 2016

  12. The Role of Personalities in Passing-Down the Tradition within the System of Culture

    Czech Academy of Sciences Publication Activity Database

    Pospíšilová, Jana; Stefanović-Banović, Milesa

    LXV, č. 2 (2017), s. 249-254 ISSN 0350-0861 Institutional support: RVO:68378076 Keywords : Personalities * Ethnology * Tradition * System of Culture Subject RIV: AC - Archeology, Anthropology, Ethnology

  13. 78 FR 49693 - Speech-to-Speech and Internet Protocol (IP) Speech-to-Speech Telecommunications Relay Services...

    Science.gov (United States)

    2013-08-15

    ... that this proposal deserves consideration, but defers its resolution until after the Commission seeks.... 104-104, 110 Stat. 56. Interpret or apply 47 U.S.C. 201, 218, 222, 225, 226, 227, 228, 254(k), 616...

  14. 76 FR 40909 - Information Collection Being Submitted for Review and Approval to the Office of Management and...

    Science.gov (United States)

    2011-07-12

    .... 56. Interpret or apply ] 47 U.S.C. 201, 218, 222, 225, 226, 228, 254(k), and 620. Total Annual Burden... complaints and their resolution; and The number of qualified applicants on waiting lists to receive equipment...

  15. 76 FR 26727 - Information Collection Being Reviewed by the Federal Communications Commission

    Science.gov (United States)

    2011-05-09

    ..., 218, 222, 225, 226, 228, 254(k), and 620. Total Annual Burden: 21,412 hours. Total Annual Cost: None... number and types of such complaints and their resolution; and The number of qualified applicants on...

  16. 76 FR 58412 - Relay Services for Deaf-Blind Individuals

    Science.gov (United States)

    2011-09-21

    ..., 218, 222, 225, 226, 228, 254(k), and 620. Total Annual Burden: 21,412 hours. Total Annual Cost: None... number and types of such complaints and their resolution; and The number of qualified applicants on...

  17. Gclust Server: 90058 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available Sequences Related Sequences(254) 441 periplasmic sensor signal transduction histidine kinase 1 9.98e-01...length 441 Representative annotation periplasmic sensor signal transduction histidine kinase Number of

  18. African Journal of Urology - Vol 13, No 4 (2007)

    African Journals Online (AJOL)

    Pediatric Urinary Tract Infections and Vesicoureteral Refl ux: What Have We Learned? EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. A A Cadamone, M A Koyle, 242-254 ...

  19. Dicty_cDB: AFO243 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available |AE008995.1 Agrobacterium tumefaciens strain C58 circular chromosome, section 21 of 256 of the complete...|AE007962.1 Agrobacterium tumefaciens strain C58 circular chromosome, section 20 of 254 of the complete

  20. Pharmacognostic evaluation of the leaves of Dissotis rotundifolia ...

    African Journals Online (AJOL)

    STORAGESEVER

    2009-01-05

    2001). Medicinal plants used in intestinal diseases in. Mbalmayo Region, Fitoterapia, pp. 246-254. Wagner WL, Herbst DR, Sohmer SH (1990). Manual of flowering plants of Hawaii. University of Hawaii Press, Bishop Museum, ...

  1. New Approaches to Underwater Surface Preparation and Painting (USPPT) Techniques (CD-ROM)

    National Research Council Canada - National Science Library

    Ledda, Jeffrey

    2006-01-01

    ...: 1 CD-ROM; 4 3/4 in.; 25.4 MB. ABSTRACT: This paper summarizes Oceaneering's findings for the ONR work entitled "New Approaches to Underwater Surface Preparation and Painting Techniques, Phase 2 Final Report...

  2. Zero-ODP Refrigerants for Low Tonnage Centrifugal Chiller Systems

    National Research Council Canada - National Science Library

    Gui, Fulin

    1996-01-01

    ..., HFC-236cb, HFC-236fa, HFC-245cb, and HFC-254cb, for centrifugal chiller applications. We took into account the thermodynamic properties of the refrigerant and aerodynamic properties of the impeller compression process to this evaluation...

  3. Arno Rafael Cederberg ja Eesti ajalooteadus / Hans Kruus

    Index Scriptorium Estoniae

    Kruus, Hans, 1891-1976

    2005-01-01

    Soome ajalooprofessorist Arno Rafael Cederbergist (1885-1948). Tartu Ülikoolis töötades oli tema peamine õppe-ja uurimisaine Eesti ja Põhjamaade ajalugu. Ilm.: Eesti Kirjandus, 1935, nr. 6., lk. 254-255

  4. Living and Working Beneath the Sea – Next Approach

    National Research Council Canada - National Science Library

    Lech Rowiński

    2017-01-01

    ... as well ideas of European Commision regarding development of the “blue economy” (doc COM (2014) 254). Several basic research and design experiments were required to achieve current understanding of the concept requirements..

  5. Gastrointestinal helminths of arctic foxes (Alopex lagopus) from different bioclimatological regions in Greenland

    DEFF Research Database (Denmark)

    Kapel, C. M O; Nansen, P.

    1996-01-01

    Nine species of gastrointestinal helminths were recovered from 254 arctic foxes (Alopex lagopus) from 8 different localities in Greenland. Prevalences of infection with the helminth species differed from area to area: Toxascaris leonina (3968%), Strongyloides stercoralis (0-14%), Mesocestoides...

  6. Helicobacter pylori prevalence in dyspeptic patients in the Eastern ...

    African Journals Online (AJOL)

    related morbidities at Livingstone Hospital, Port Elizabeth, to determine the prevalence and risk factors for infection according to race, endoscopic diagnosis, age and sex. Methods. Gastric biopsies were collected from 254 consecutive patients ...

  7. Gclust Server: 122813 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available Sequences 1 Homologs 1 Clustering threshold 1.00e-99 Plants and algae (7species) (%) 0.0 Other Bikonts (Chr...th 254 Representative annotation transcriptional regulator, TetR family Number of

  8. CAMEX-4 NOAA LYMAN-ALPHA HYGROMETER V1

    Data.gov (United States)

    National Aeronautics and Space Administration — Ozone is measured in situ using a photometer consisting of a mercury lamp, two sample chambers and two detectors. The detectors measure the 254nm radiation...

  9. A description of the early life history stages of the kob, Argyrosomus ...

    African Journals Online (AJOL)

    1989-09-12

    1990, 25(4). Richardson, S.L. pp. 35-37. Special Publication 1. American. Association of Ichthyologists and Herpetologists. RUSSELL, F.S. 1976. The eggs and planktonic stages of British marine flShes. Academic Press, London.

  10. Tuli, Dr Rakesh

    Indian Academy of Sciences (India)

    Date of birth: 21 September 1953. Specialization: Plant Biotechnology, Genetic Engineering and Molecular Biology, Secondary Metabolism Address: Senior Research Adviser, University Institute of Engineering & Technology, Panjab University, Sector 25, Chandigarh 160 014, Panjab Contact: Office: (0172) 254 4107

  11. 75 FR 32920 - Publication of State Plan Pursuant to the Help America Vote Act

    Science.gov (United States)

    2010-06-10

    ... administrative complaint procedure and improvements to the administration of elections for federal office, and... Overseas Voter Empowerment Act (MOVE Act). In accordance with HAVA section 254(a)(12), all the state plans...

  12. GETDB: 104381 [GETDB

    Lifescience Database Archive (English)

    Full Text Available cluster table 254 1 Request - weak sg sg internal, blood - - - - - - - Show 104381 DGRC Number 104381 Link...Larval GFP sg Larval X-gal sg Adult GFP internal, blood Lethality - Also known as - Original Comments -

  13. Enzymatic Hydrolysate of a Whey Protein Concentrate by Alcalase…

    African Journals Online (AJOL)

    Luciano

    2012-02-09

    Feb 9, 2012 ... results indicate that the hydrolysate obtained by treatment with alcalase demonstrated anti- inflammatory activity in the ... Abbreviations: WPH, Whey protein hydrolysate; LPS, ... and detected by UV (254 nm). Quantification ...

  14. 48 CFR 22.1503 - Procedures for acquiring end products on the List of Products Requiring Contractor Certification...

    Science.gov (United States)

    2010-10-01

    ... acquisition is $25,000 or more (see Subpart 25.4); (2) Israel, and the anticipated value of the acquisition is..., Estonia, Finland, France, Germany, Greece, Hong Kong, Hungary, Iceland, Ireland, Italy, Japan, Korea...

  15. Pobladoras, Indígenas, and the State: Difference, Equality, and Women’s Rights in Chile [book review

    OpenAIRE

    Valiente Fernández, Celia

    2004-01-01

    Este artículo reseña: Patricia Richards. Pobladoras, Indígenas, and the State: Difference, Equality, and Women’s Rights in Chile. New Brunswick: Rutgers University Press, 2004. p. 254. ISBN 0813534232

  16. The epidemiology of pharmacologically treated attention deficit hyperactivity disorder (ADHD) in children, adolescents and adults in UK primary care

    National Research Council Canada - National Science Library

    McCarthy, Suzanne; Wilton, Lynda; Murray, Macey L; Hodgkins, Paul; Asherson, Philip; Wong, Ian C K

    2012-01-01

    .... Estimates for the prevalence of ADHD in adults range from 2.5-4%. Few data exist on the prescribing trends of the stimulants methylphenidate and dexamfetamine, and the non-stimulant atomoxetine in the UK...

  17. Download this PDF file

    African Journals Online (AJOL)

    Prince Acheampong

    ABSTRACT. Phytochemical ... The NMR experiments performed included proton nuclear magnetic resonance ... Merck Silica gel 60 F254 pre-coated on aluminium sheet. ... This suggested a molecular formula of C15H1205 for compound 1.

  18. 78 FR 22560 - OMB Final Sequestration Report to the President and Congress for Fiscal Year 2013

    Science.gov (United States)

    2013-04-16

    ... further revised by P.L. 112-240, the American Taxpayer Relief Act of 2012 (ATRA). Section 254 of BBEDCA... required based on OMB scoring of enacted appropriations legislation against those limits. ATRA, however...

  19. Gclust Server: 89003 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available Rpa2_RPD_3337 Cluster Sequences Related Sequences(254) 709 sensory box histidine kinase/response regulator 1 1.00e-22...Sequence length 709 Representative annotation sensory box histidine kinase/response regulator Number

  20. Auditor tenure and audit quality in Spanish state-owned foundations/Permanencia del auditor y calidad de la auditoría en las fundaciones públicas estatales

    National Research Council Canada - National Science Library

    Belén González-Díaz; Roberto García-Fernández; Antonio López-Díaz

    2015-01-01

    .... Using a sample of 254 audits carried out between 2003 and 2010 on Spanish state-owned foundations, we find that, although foundation audit quality decreases as tenure length increases, this quality...

  1. Auditor tenure and audit quality in Spanish state-owned foundations

    National Research Council Canada - National Science Library

    González-Díaz, Belén; García-Fernández, Roberto; López-Díaz, Antonio

    2015-01-01

    .... Using a sample of 254 audits carried out between 2003 and 2010 on Spanish state-owned foundations, we find that, although foundation audit quality decreases as tenure length increases, this quality...

  2. 76 FR 22730 - Notice of Determinations Regarding Eligibility To Apply for Worker Adjustment Assistance

    Science.gov (United States)

    2011-04-22

    ... and Rubber Company. 75,254 Cima Labs, Manufacturing Operations, Cephalon Eden Prairie, MN.... February... 74,898 Fry Communications, Inc., Heat Set Press Mechanicsburg, PA... Department. 74,905 International...

  3. Regional variation in wood modulus of elasticity (stiffness) and modulus of rupture (strength) of planted loblolly pine in the United States

    Science.gov (United States)

    Antony Finto; Lewis Jordan; Laurence R. Schimleck; Alexander Clark; Ray A. Souter; Richard F. Daniels

    2011-01-01

    Modulus of elasticity (MOE), modulus of rupture (MOR), and specific gravity (SG) are important properties for determining the end-use and value of a piece of lumber. This study addressed the variation in MOE, MOR, and SG with physiographic region, tree height, and wood type. Properties were measured from two static bending samples (dimensions 25.4 mm × 25.4 mm × 406.4...

  4. Germicidal Efficacy and Mammalian Skin Safety of 222-nm UV Light

    OpenAIRE

    Buonanno, Manuela; Ponnaiya, Brian; Welch, David; Stanislauskas, Milda; Randers-Pehrson, Gerhard; Smilenov, Lubomir; Lowy, Franklin D.; Owens, David M.; Brenner, David J.

    2017-01-01

    We have previously shown that 207-nm ultraviolet (UV) light has similar antimicrobial properties as typical germicidal UV light (254 nm), but without inducing mammalian skin damage. The biophysical rationale is based on the limited penetration distance of 207-nm light in biological samples (e.g. stratum corneum) compared with that of 254-nm light. Here we extended our previous studies to 222-nm light and tested the hypothesis that there exists a narrow wavelength window in the far-UVC region,...

  5. Specific ultra-violet absorbance as an indicator measurement of merucry sources in an Adirondack River basin

    Science.gov (United States)

    Burns, Douglas A.; Aiken, George R.; Bradley, Paul M.; Journey, Celeste; Schelker, Jakob

    2013-01-01

    The Adirondack region of New York has been identified as a hot spot where high methylmercury concentrations are found in surface waters and biota, yet mercury (Hg) concentrations vary widely in this region. We collected stream and groundwater samples for Hg and organic carbon analyses across the upper Hudson River, a 493 km2 basin in the central Adirondacks to evaluate and model the sources of variation in filtered total Hg (FTHg) concentrations. Variability in FTHg concentrations during the growing seasons (May-Oct) of 2007-2009 in Fishing Brook, a 66-km2 sub-basin, was better explained by specific ultra-violet absorbance at 254 nm (SUVA254), a measure of organic carbon aromaticity, than by dissolved organic carbon (DOC) concentrations, a commonly used Hg indicator. SUVA254 was a stronger predictor of FTHg concentrations during the growing season than during the dormant season. Multiple linear regression models that included SUVA254 values and DOC concentrations could explain 75 % of the variation in FTHg concentrations on an annual basis and 84 % during the growing season. A multiple linear regression landscape modeling approach applied to 27 synoptic sites across the upper Hudson basin found that higher SUVA254 values are associated with gentler slopes, and greater riparian area, and lower SUVA254 values are associated with an increasing influence of open water. We hypothesize that the strong Hg?SUVA254 relation in this basin reflects distinct patterns of FTHg and SUVA254 that are characteristic of source areas that control the mobilization of Hg to surface waters, and that the seasonal influence of these source areas varies in this heterogeneous basin landscape.

  6. Dicty_cDB: CHH526 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available stercoralis cDNA 5' similar to WP:C41C4.8 CE05402 TRANSITIONAL ENDOPLASMIC RETICULUM ATPASE HOMOLOG 2 ;, mRNA...Full=Transitional endoplasmic reticulum ATPase... 257 2e-67 ( P54811 ) RecName: Full=Transitional endoplasmic...embryo spinal... 254 1e-66 S25197( S25197 ;S30329) transitional endoplasmic reticulum ATPase ... 254 1e-66

  7. 2397-IJBCS-Article-Mahama Ouattara

    African Journals Online (AJOL)

    hp

    25 mars 2014 ... par électrospray/quadripolaire). Les points de fusion (PF) ont été déterminés au moyen d'un banc de Kofler et ne sont pas corrigés. Les chromatographies sur couche mince (CCM) ont été effectuées sur plaques de silice. Macherey-Nagel Sil G/UV254 ou sur alumine. Macherey-Nagel ALOX N/UV254. Les.

  8. Degradation of methyl orange using short-wavelength UV irradiation with oxygen microbubbles.

    Science.gov (United States)

    Tasaki, Tsutomu; Wada, Tsubasa; Fujimoto, Kanji; Kai, Shinji; Ohe, Kaoru; Oshima, Tatsuya; Baba, Yoshinari; Kukizaki, Masato

    2009-03-15

    A novel wastewater treatment technique using 8 W low-pressure mercury lamps in the presence of uniform-sized microbubbles (diameter = 5.79 microm) was investigated for the decomposition of methyl orange as a model compound in aqueous solution. Photodegradation experiments were conducted with a BLB black light blue lamp (365 nm), a UV-C germicidal lamp (254 nm) and an ozone lamp (185 nm+254 nm) both with and without oxygen microbubbles. The results show that the oxygen microbubbles accelerated the decolorization rate of methyl orange under 185+254 nm irradiation. In contrast, the microbubbles under 365 and 254 nm irradiation were unaffected on the decolorization of methyl orange. It was found that the pseudo-zero order decolorization reaction constant in microbubble system is 2.1 times higher than that in conventional large bubble system. Total organic carbon (TOC) reduction rate of methyl orange was greatly enhanced by oxygen microbubble under 185+254 nm irradiation, however, TOC reduction rate by nitrogen microbubble was much slower than that with 185+254 nm irradiation only. Possible reaction mechanisms for the decolorization and mineralization of methyl orange both with oxygen and nitrogen mirobubbles were proposed in this study.

  9. Role of physiological mechanisms and EPSPS gene expression in glyphosate resistance in wild soybeans (Glycine soja).

    Science.gov (United States)

    Gao, Yue; Tao, Bo; Qiu, Lijuan; Jin, Longguo; Wu, Jing

    2014-02-01

    The physiological mechanisms underlying glyphosate resistance in wild soybean germplasm and relevant EPSPS gene expression were evaluated. These germplasms were selected by gradually increasing glyphosate selection pressure started from 2010. As indicated by a whole-plant dose response bioassay, ZYD-254 plants were resistant to glyphosate at concentrations of 1230gaeha(-1), but the susceptible plants (ZYD-16) were unable to survive in the presence of 300gaeha(-1) glyphosate. The ED50 values of resistant germplasm were approximately 8.8 times of the susceptible germplasm. Chlorophyll content was significantly decreased in ZYD-16 plants in comparison with ZYD-254 plants. ZYD-16 plants accumulated 10.1 times more shikimate in leaves at 5days after glyphosate treatment at 1230gaeha(-1) than ZYD-254 did. GST activity differed between ZYD-254 and ZYD-16 in three tissues. It was highest in leaves. There were no significant differences in EPSPS1 or EPSPS3 expression between two germplasms before exposure to glyphosate treatment. After glyphosate treatment, there was a 2- to 4-fold increase in EPSPS1 mRNA levels in ZYD-254, but there was no change in EPSPS3 mRNA levels in ZYD-254 or ZYD-16. Copyright © 2014 Elsevier Inc. All rights reserved.

  10. Ultraviolet-induced effects on chloramine and cyanogen chloride formation from chlorination of amino acids.

    Science.gov (United States)

    Weng, ShihChi; Blatchley, Ernest R

    2013-05-07

    Ultraviolet (UV)-based treatment is commonly used to augment chlorination in swimming pools. However, the effects of combined application of UV254/chlorine on disinfection byproduct (DBP) formation are incompletely defined. To examine this issue, experiments were conducted with amino acids (l-arginine, l-histidine, and glycine) that are representative of those introduced to swimming pools via human body fluids. For each precursor, stepwise experiments were conducted with chlorination and UV254 exposure, with/without post-chlorination. Net formation and decomposition of chloramines and cyanogen chloride (CNCl) were measured for a range of chlorine/precursor (Cl/P) molar ratios and UV254 doses. Substantial production of NH2Cl from l-arginine and l-histidine was observed at Cl/P = 1.0 and 2.0 when post-chlorination was applied to UV254-irradiated samples. These results suggested a mechanism of rapid N-chlorination, followed by cleavage of NH3 by UV254 irradiation. CNCl formation was observed from UV254-irradiated samples of l-arginine and l-histidine when Cl/P = 2.0 and 3.0, as well as from glycine for Cl/P ≤ 1. Structurally related precursor compounds were examined for CNCl formation potential in chlorination/UV experiments. CNCl formation was promoted by UV254 exposure of chlorinated imidazole and guanidine compounds, which suggested that these groups contributed to CNCl formation. The results have implications with respect to the application of chlorine and UV for water treatment in swimming pools and other settings, such as water reuse and advanced oxidation processes.

  11. Inpatient allergy/immunology consultations in a tertiary care setting.

    Science.gov (United States)

    Otto, Hans F; England, Ronald W; Quinn, James M

    2010-01-01

    Few studies have examined inpatient referral patterns for fellowship training programs and none for allergy/immunology (AI) since 2003. The primary end point was the reason for consultation, and secondary end points included the AI diagnosis made and outcomes. We retrospectively reviewed all inpatient AI consultations from July 1, 2001 through June 30, 2007. These 6 years of data were combined with 14 years of data examining the reason for consult from a previous study. The data were analyzed for trends and changes over the entire 20-year period. A total of 254 AI inpatient consults were reviewed over the 6 years studied. Thirty-six percent (92/254) of inpatient consults were for evaluation of adverse drug reactions (ADRs), 22% (55/254) miscellaneous reasons, 17% (43/254) urticaria/angioedema, 13% (32/254) for possible immunodeficiency, 9% (23/254) for anaphylaxis, and 3% (8/254) for asthma. AI inpatient consults show a significant decline over the recent 6-year period (p = 0.0023) despite stable total hospital admissions since 1998. Over the last 20 years, an 85% decrease (p < 0.00001) in inpatient asthma consults and increases (p < 0.05) in immunodeficiency, rash, and urticaria/angioedema evaluations have been observed. Not following AI recommendations resulted in a 16.6 odds ratio (95% CI, 5.55-49.93) that a patient's clinical status would be worse or unchanged. Inpatient AI consults have declined with associated reduction in asthma inpatient consults. Although ADRs and anaphylaxis consults have been stable, evaluations for immunodeficiency, rash, and urticaria/angioedema have increased. Following inpatient AI recommendations is associated with improved patient outcomes.

  12. Comparative effect of simulated solar light, UV, UV/H2O2 and photo-Fenton treatment (UV-Vis/H2O2/Fe2+,3+) in the Escherichia coli inactivation in artificial seawater.

    Science.gov (United States)

    Rubio, D; Nebot, E; Casanueva, J F; Pulgarin, C

    2013-10-15

    Innovative disinfection technologies are being studied for seawater, seeking a viable alternative to chlorination. This study proposes the use of H2O2/UV254 and photo-Fenton as disinfection treatment in seawater. The irradiations were carried out using a sunlight simulator (Suntest) and a cylindrical UV reactor. The efficiency of the treatment was compared for Milli-Q water, Leman Lake water and artificial seawater. The presence of bicarbonates and organic matter was investigated in order to evaluate possible effects on the photo-Fenton disinfection treatment. The photo-Fenton treatment, employing 1 mg L(-1) Fe(2+) and 10 mg L(-1) of H2O2, led to the fastest bacterial inactivation kinetics. Using H2O2/UV254 high disinfection rates were obtained similar to those obtained with photo-Fenton under UV254 light. In Milli-Q water, the rate of inactivation for Escherichia coli was higher than in Leman Lake water and seawater due to the lack of inorganic ions affecting negatively bacteria inactivation. The presence of bicarbonate showed scavenging of the OH(•) radicals generated in the treatment of photo-Fenton and H2O2/UV254. Despite the negative effect of inorganic ions, especially HCO3(-), the disinfection treatments with AOPs in lake water and seawater improved significantly the disinfection compared to light alone (simulated sunlight and UV254). In the treatment of photo-Fenton with simulated sunlight, dissolved organic matter had a beneficial effect by increasing the rate of inactivation. This is associated with the formation of Fe(3+)-organo photosensitive complexes leading to the formation of ROS able to inactivate bacteria. This effect was not observed in the photo-Fenton with UV254. Growth of E. coli surviving in seawater was observed 24 and 48 h after treatment with UV light. However, growth of surviving bacteria was not detected after photo-Fenton with UV254 and H2O2/UV254 treatments. This study suggests H2O2/UV254 and photo-Fenton treatments for the

  13. Effect of the semi-conductive properties of the passive layer on the current provided by stainless steel microbial cathodes

    Energy Technology Data Exchange (ETDEWEB)

    Pons, Liz; Delia, Marie-Line; Basseguy, Regine [Laboratoire de Genie Chimique, CNRS - Universite de Toulouse, 4 allee Emile Monso BP 84234, 31030 Toulouse (France); Bergel, Alain, E-mail: alain.bergel@ensiacet.f [Laboratoire de Genie Chimique, CNRS - Universite de Toulouse, 4 allee Emile Monso BP 84234, 31030 Toulouse (France)

    2011-02-15

    Geobacter sulfurreducens biofilms were formed under constant polarisation at -0.6 V vs. Ag/AgCl on stainless steel cathodes to catalyse the reduction of fumarate. The time-evolution of the current strongly depended on the quality of the inoculum. Inoculating with young cells significantly shortened the initial lag-phase and using the same inoculum improved the reproducibility of the current-time curves. The whole set of experiments showed that 254SMO stainless steel provided higher current densities (on average 14.1 A/m{sup 2}) than biofilms formed on 316L stainless steel (on average 4.5 A/m{sup 2}). Biofilm coverage assessed by epifluorescent microscopy showed that coverage ratios were generally higher for 316L than for 254SMO. It must be concluded that 254SMO is more efficient in transferring electrons to bacterial cells than 316L. Mott-Schottky diagrams recorded on both materials under conditions of electrolysis in the absence of microorganisms showed that the surface oxide layers had similar n-type semi-conductive behaviour for potential values higher than the flat band potential. In contrast, 316L exhibited slight p-type behaviour at potential lower than the flat band potential, while 254SMO did not. The higher electrochemical performances of biocathodes formed on 254SMO are explained by semi-conductive properties of its passive layer, which prevented the p-type behaviour occurring in cathodic electrolysis conditions.

  14. Structure-Based Mechanism for Early PLP-Mediated Steps of Rabbit Cytosolic Serine Hydroxymethyltransferase Reaction

    Directory of Open Access Journals (Sweden)

    Martino L. Di Salvo

    2013-01-01

    Full Text Available Serine hydroxymethyltransferase catalyzes the reversible interconversion of L-serine and glycine with transfer of one-carbon groups to and from tetrahydrofolate. Active site residue Thr254 is known to be involved in the transaldimination reaction, a crucial step in the catalytic mechanism of all pyridoxal 5′-phosphate- (PLP- dependent enzymes, which determines binding of substrates and release of products. In order to better understand the role of Thr254, we have expressed, characterized, and determined the crystal structures of rabbit cytosolic serine hydroxymethyltransferase T254A and T254C mutant forms, in the absence and presence of substrates. These mutants accumulate a kinetically stable gem-diamine intermediate, and their crystal structures show differences in the active site with respect to wild type. The kinetic and crystallographic data acquired with mutant enzymes permit us to infer that conversion of gem-diamine to external aldimine is significantly slowed because intermediates are trapped into an anomalous position by a misorientation of the PLP ring, and a new energy barrier hampers the transaldimination reaction. This barrier likely arises from the loss of the stabilizing hydrogen bond between the hydroxymethyl group of Thr254 and the ε-amino group of active site Lys257, which stabilizes the external aldimine intermediate in wild type SHMTs.

  15. Reduction of patulin in apple juice products by UV light of different wavelengths in the UVC range.

    Science.gov (United States)

    Zhu, Yan; Koutchma, Tatiana; Warriner, Keith; Zhou, Ting

    2014-06-01

    This study evaluated three UVC wavelengths (222, 254, and 282 nm) to degrade patulin introduced into apple juice or apple cider. The average UV fluences of 19.6, 84.3, 55.0, and 36.6 mJ·cm(-2) achieved through exposure to UV lamps at 222-, 254-, and 282-nm wavelengths and the combination of these wavelengths, respectively, resulted in 90% reduction of patulin in apple juice. Therefore, the order of efficiency of the three wavelength lamps was as follows: far UVC (222 nm) > far UVC plus (282 nm) > UVC (254 nm). In terms of color, treatment of apple juice with 222 nm resulted in an increase in the L* (lightness) value but decreases in a* (redness) and b* (yellowness) values, although the changes were insignificantly different from the values for nontreated controls based on a sensory evaluation. The ascorbic acid loss in juice treated at 222 nm to support 90% reduction of patulin was 36.5%, compared with ascorbic acid losses of 45.3 and 36.1% in samples treated at 254 and 282 nm, respectively. The current work demonstrated that the 222-nm wavelength possesses the highest efficiency for patulin reduction in apple juice when compared with the reductions by 254 and 282 nm, with no benefit gained from using a combination of wavelengths.

  16. Compensated bismuth-loaded plastic scintillators for neutron detection using low-energy pseudo-spectroscopy

    Energy Technology Data Exchange (ETDEWEB)

    Dumazert, Jonathan, E-mail: jonathan.dumazert@cea.fr [CEA, LIST, Laboratoire Capteurs Architectures Electroniques, 91191 Gif-sur-Yvette (France); Coulon, Romain; Bertrand, Guillaume H.V.; Normand, Stéphane [CEA, LIST, Laboratoire Capteurs Architectures Electroniques, 91191 Gif-sur-Yvette (France); Méchin, Laurence [CNRS, UCBN, Groupe de Recherche en Informatique, Image, Automatique et Instrumentation de Caen, 14050 Caen (France); Hamel, Matthieu [CEA, LIST, Laboratoire Capteurs Architectures Electroniques, 91191 Gif-sur-Yvette (France)

    2016-05-21

    Gadolinium-covered modified plastic scintillators show a high potential for the deployment of cost-effective neutron detectors. Taking advantage of the low-energy photon and electron signature of thermal neutron captures in gadolinium-155 and gadolinium-157 however requires a background correction. In order to display a trustable rate, dual compensation schemes appear as an alternative to Pulse Shape Discrimination. This paper presents the application of such a compensation scheme to a two-bismuth loaded plastic scintillator system. A detection scintillator interacts with incident photon and fast neutron radiations and is covered with a gadolinium converter to become thermal neutron-sensitive as well. In the meantime, an identical compensation scintillator, covered with terbium, solely interacts with the photon and fast neutron part of incident radiations. After the acquisition and the treatment of the counting signals from both sensors, a hypothesis test determines whether the resulting count rate after subtraction falls into statistical fluctuations or provides a robust image of neutron activity. A laboratory prototype is tested under both photon and neutron radiations, allowing us to investigate the performance of the overall compensation system. The study reveals satisfactory results in terms of robustness to a cesium-137 background and in terms of sensitivity in presence of a californium-252 source.

  17. Systematic studies of the fundamental chemistry of pyrochlore oxides. An{sub 2}Zr{sub 2}O{sub 7} [An=Pu, Am, Cm, Bk and Cf

    Energy Technology Data Exchange (ETDEWEB)

    Haire, R.G.; Assefa, Z. [Oak Ridge National Laboratory, Oak Ridge, TN (United States); Raison, P.E. [Commissariat a l' Energie Atomique, CEA-Cadarache DRN/DEC/SPUA/LACA (France)

    2002-11-01

    Our efforts to pursue the fundamental science of actinide pyrochlore oxides, An{sub 2}Zr{sub 2}O{sub 7}, (An=plutonium through californium), are presented. We have addressed their structural and chemical behavior via X-ray diffraction, Raman spectroscopy and by considering the pseudo-oxidation potentials of the actinides. The structure, fundamental chemistry, ionic radii and the electronic configuration of the specific actinide involved in these oxide systems all have a significant impact on their science. We are also exploring a calculational approach based on valence-bond relationships to assess the position of the oxygen atoms located at the general crystallographic position. The oxygen position is important regarding the chemical behavior and thermal stability of these materials. Also considered is the structural stability of the materials regarding self-irradiation, and with some compounds, their resistance towards oxidation. These aspects will be discussed using a systematic evaluation of the five-actinide systems together with comparable lanthanide systems studied. (author)

  18. 1982 US-CEC neutron personnel dosimetry intercomparison study

    Energy Technology Data Exchange (ETDEWEB)

    Swaja, R.E.; Sims, C.S.; Greene, R.T.; Schraube, H.; Burger, G.

    1983-11-01

    A neutron personnel dosimetry intercomparison study was conducted during April 19-23, 1982, as a joint effort between the United States and the Commission of European Communities. Dosimeters from 48 participating agencies were mounted on cylindrical phantoms and exposed to a range of low-level dose equivalents (0.48-13.91 mSv neutron and 0.02-1.32 mSv gamma) in nine different radiation fields. Exposure conditions considered in this study included four mixed-field spectra produced using the Health Physics Research Reactor, four monoenergetic neutron fields generated by accelerators, and one 15-cm D/sub 2/O-moderated californium source spectrum. In general, neutron results reported by the participating agencies were consistent with expected dosimeter performance based on energy response characteristics of the detection systems. Albedo dosimeters, which were the most popular neutron monitoring systems used in this study, provided the best overall accuracy for all exposure conditions. Film, Cr-39 recoil track, and Th-232 fission track systems generally underestimated dose equivalents relative to reference values. Associated gamma measurements showed that TLD monitors produced more accurate results than film dosimeters although both systems overestimated gamma dose equivalents in mixed radiation fields. 24 references, 10 figures, 19 tables.

  19. Application of the backward extrapolation method to pulsed neutron sources

    Energy Technology Data Exchange (ETDEWEB)

    Talamo, Alberto; Gohar, Yousry

    2018-01-01

    Particle detectors operated in pulse mode are subjected to the dead-time effect. When the average of the detector counts is constant over time, correcting for the dead-time effect is simple and can be accomplished by analytical formulas. However, when the average of the detector counts changes over time it is more difficult to take into account the dead-time effect. When a subcritical nuclear assembly is driven by a pulsed neutron source, simple analytical formulas cannot be applied to the measured detector counts to correct for the dead-time effect because of the sharp change of the detector counts over time. This work addresses this issue by using the backward extrapolation method. The latter can be applied not only to a continuous (e.g. californium) external neutron source but also to a pulsed external neutron source (e.g. by a particle accelerator) driving a subcritical nuclear assembly. The backward extrapolation method allows to obtain from the measured detector counts both the dead-time value and the real detector counts.

  20. The cross sections of fusion-evaporation reactions: the most promising route to superheavy elements beyond Z=118

    Science.gov (United States)

    Jadambaa, Khuyagbaatar

    2017-11-01

    The synthesis of superheavy elements beyond oganesson (Og), which has atomic number Z = 118, is currently one of the main topics in nuclear physics. An absence of sufficient amounts of target material with atomic numbers heavier than californium (Z = 98) forces the use of projectiles heavier than 48Ca (Z = 20), which has been successfully used for the discoveries of elements with Z = 114 - 118 in complete fusion reactions. Experimental cross sections of 48Ca with actinide targets behave very differently to "cold" and "hot" fusion-evaporation reactions, where doubly-magic lead and deformed actinides are used as targets, respectively. The known cross sections of these reactions have been analysed compared to calculated fission barriers. It has been suggested that observed discrepancies between the cross sections of 48Ca-induced and other fusionevaporation reactions originate from the shell structure of the compound nucleus, which lies in the island of the stability. Besides scarcely known data on other reactions involving heavier projectiles, the most promising projectile for the synthesis of the elements beyond Og seems to be 50Ti. However, detailed studies of 50Ti, 54Cr, 58Fe and 64Ni-induced reactions are necessary to be performed in order to fully understand the complexities of superheavy element formation.

  1. Report to the DOE nuclear data committee. [EV RANGE 10-100; CROSS SECTIONS; PHOTONEUTRONS; NEUTRONS; GAMMA RADIATION; COUPLED CHANNEL THEORY; DIFFERENTIAL CROSS SECTIONS; MEV RANGE 01-10; ; CAPTURE; GAMMA SPECTRA; THERMAL NEUTRONS; COMPUTER CALCULATIONS; DECAY; FISSION PRODUCTS; FISSION YIELD; SHELL MODELS; NUCLEAR DATA COLLECTIONS

    Energy Technology Data Exchange (ETDEWEB)

    Struble, G.L.; Haight, R.C.

    1981-03-01

    Topics covered include: studies of (n, charged particle) reactions with 14 to 15 MeV neutrons; photoneutron cross sections for /sup 15/N; neutron radiative capture; Lane-model analysis of (p,p) and (n,n) scattering on the even tin isotopes; neutron scattering cross sections for /sup 181/Ta, /sup 197/Au, /sup 209/Bi, /sup 232/Th, and /sup 238/U inferred from proton scattering and charge exchange cross sections; neutron-induced fission cross sections of /sup 245/Cm and /sup 242/Am; fission neutron multiplicities for /sup 245/Cm and /sup 242/Am; the transport of 14 MeV neutrons through heavy materials 150 < A < 208; /sup 249/Cm energy levels from measurement of thermal neutron capture gamma rays; /sup 231/Th energy levels from neutron capture gamma ray and conversion electron spectroscopy; new measurements of conversion electron binding energies in berkelium and californium; nuclear level densities; relative importance of statistical vs. valence neutron capture in the mass-90 region; determination of properties of short-lived fission products; fission yield of /sup 87/Br and /sup 137/I from 15 nuclei ranging from /sup 232/Th to /sup 249/Cf; evaluation of charged particle data for the ECPL library; evaluation of secondary charged-particle energy and angular distributions for ENDL; and evaluated nuclear structure libraries derived from the table of isotopes. (GHT)

  2. Activation analysis of ITER blanket first wall

    Energy Technology Data Exchange (ETDEWEB)

    Lopatkin, A.; Muratov, V. [RDIPE (NIKIET), Moscow (Russian Federation)

    1998-09-01

    To analyze the activation of ITER blanket structural components, the authors have prepared the AUCDAS code that calculates changes in nuclide concentrations and radioactivity characteristics during neutron irradiation and during cooling. UCDAS takes into account all neutron reactions and decay types, the prepared library of constants contains nuclear data of nuclides from hydrogen to californium. A comparative analysis of the results as obtained using UCDAS code and the widely known FISPACT code is given. The analysis of decay heat, gas generation and activity of ITER blanket first wall`s structural components was carried out. The beryllium coating, copper alloy and stainless steel were analysed. Calculations were performed for the first plasma burning pulse, 6 months and 1 year of operation in accordance with the ITER scenario. The materials recommended by ITER central team and their Russian analogs were considered: TGR and B1 (beryllium coating), GlidCop AL-25 Ds and Br-MKX (copper alloy), 316LN-IG and 12Cr18Ni10Ti (stainless steel). It has been demonstrated that there is a difference in all of the considered characteristics between the above materials. It is caused by impurities which are present in the materials. The report also considers the accumulation of gases (H, D, T, He{sup 3}, He{sup 4}) in the above materials. Besides, the change in the activity of irradiated materials during the cooling of up to 10{sup 7} years was calculated. (orig.) 7 refs.

  3. Toward achieving flexible and high sensitivity hexagonal boron nitride neutron detectors

    Science.gov (United States)

    Maity, A.; Grenadier, S. J.; Li, J.; Lin, J. Y.; Jiang, H. X.

    2017-07-01

    Hexagonal boron nitride (h-BN) detectors have demonstrated the highest thermal neutron detection efficiency to date among solid-state neutron detectors at about 51%. We report here the realization of h-BN neutron detectors possessing one order of magnitude enhancement in the detection area but maintaining an equal level of detection efficiency of previous achievement. These 3 mm × 3 mm detectors were fabricated from 50 μm thick freestanding and flexible 10B enriched h-BN (h-10BN) films, grown by metal organic chemical vapor deposition followed by mechanical separation from sapphire substrates. Mobility-lifetime results suggested that holes are the majority carriers in unintentionally doped h-BN. The detectors were tested under thermal neutron irradiation from californium-252 (252Cf) moderated by a high density polyethylene moderator. A thermal neutron detection efficiency of ˜53% was achieved at a bias voltage of 200 V. Conforming to traditional solid-state detectors, the realization of h-BN epilayers with enhanced electrical transport properties is the key to enable scaling up the device sizes. More specifically, the present results revealed that achieving an electrical resistivity of greater than 1014 Ωṡcm and a leakage current density of below 3 × 10-10 A/cm2 is needed to fabricate large area h-BN detectors and provided guidance for achieving high sensitivity solid state neutron detectors based on h-BN.

  4. Design of the low energy beam transport line between CARIBU and the EBIS charge breeder

    Energy Technology Data Exchange (ETDEWEB)

    Perry, A., E-mail: aperry4@hawk.iit.edu [Argonne National Laboratory, Argonne, IL 60439, USA and Illinois Institute of Technology, Chicago, IL 60616 (United States); Ostroumov, P. N.; Barcikowski, A.; Dickerson, C.; Kondrashev, S. A.; Mustapha, B.; Savard, G. [Argonne National Laboratory, Argonne, IL 60439 (United States)

    2015-01-09

    An Electron Beam Ion Source Charge Breeder (EBIS-CB) has been developed to breed radioactive beams from the CAlifornium Rare Isotope Breeder Upgrade (CARIBU) facility at ATLAS. The EBIS-CB will replace the existing ECR charge breeder to increase the intensity and improve the purity of reaccelerated radioactive ion beams. The EBIS-CB is in the final stage of off-line commissioning. Currently, we are developing a low energy beam transport (LEBT) system to transfer CARIBU beams to the EBIS-CB. As was originally planned, an RFQ cooler-buncher will precede the EBIS-CB. Recently, it was decided to include a multi-reflection time-of-flight (MR-TOF) mass-spectrometer following the RFQ. MR-TOF is a relatively new technology used to purify beams with a mass-resolving power up to 3×10{sup 5} as was demonstrated in experiments at CERN/ISOLDE. Very high purity singly-charged radioactive ion beams will be injected into the EBIS for charge breeding and due to its inherent properties, the EBIS-CB will maintain the purity of the charge bred beams. Possible contamination of residual gas ions will be greatly suppressed by achieving ultra-high vacuum in the EBIS trap. This paper will present and discuss the design of the LEBT and the overall integration of the EBIS-CB into ATLAS.

  5. Analysis of patents on mining technology

    Energy Technology Data Exchange (ETDEWEB)

    Menyailo, N.I.; Grishchenko, A.N.; Ratner, M.V.; Kobylyanskii, A.Ya.; Tyshlek, E.G.

    1987-09-01

    Analyses the current work being carried out with the aim of developing and perfecting coal mining technology with regard to improving safety and working conditions (equipment is currently responsible for 6.3% of all hazards in coal mines) by examining patents of class ES 21 S produced in the USSR, USA, UK, FRG, Japan and France between 1970-1984. By far the majority of patents is concerned with improving technology and productivity and a disappointing number deals with safety matters (only 7.2% of the patents for new cutter loader designs deal with dust suppression systems and most of these come from the FRG; no patents for powered mining complexes deal with the problem of noise and vibration reduction). The patents with the most direct relevance to health and safety concern remote control devices for mining equipment, in particular, devices based on radioactive isotopes (e.g. cesium-137, americum-241, selenium-75, californium-252) but measures for monitoring them and protecting against them are not found.

  6. MinT: Middleware for Cooperative Interaction of Things

    Directory of Open Access Journals (Sweden)

    Soobin Jeon

    2017-06-01

    Full Text Available This paper proposes an Internet of Things (IoT middleware called Middleware for Cooperative Interaction of Things (MinT. MinT supports a fully distributed IoT environment in which IoT devices directly connect to peripheral devices easily construct a local or global network, and share their data in an energy efficient manner. MinT provides a sensor abstract layer, a system layer and an interaction layer. These enable integrated sensing device operations, efficient resource management, and active interconnection between peripheral IoT devices. In addition, MinT provides a high-level API to develop IoT devices easily for IoT device developers. We aim to enhance the energy efficiency and performance of IoT devices through the performance improvements offered by MinT resource management and request processing. The experimental results show that the average request rate increased by 25% compared to Californium, which is a middleware for efficient interaction in IoT environments with powerful performance, an average response time decrease of 90% when resource management was used, and power consumption decreased by up to 68%. Finally, the proposed platform can reduce the latency and power consumption of IoT devices.

  7. MinT: Middleware for Cooperative Interaction of Things

    Science.gov (United States)

    Jeon, Soobin; Jung, Inbum

    2017-01-01

    This paper proposes an Internet of Things (IoT) middleware called Middleware for Cooperative Interaction of Things (MinT). MinT supports a fully distributed IoT environment in which IoT devices directly connect to peripheral devices easily construct a local or global network, and share their data in an energy efficient manner. MinT provides a sensor abstract layer, a system layer and an interaction layer. These enable integrated sensing device operations, efficient resource management, and active interconnection between peripheral IoT devices. In addition, MinT provides a high-level API to develop IoT devices easily for IoT device developers. We aim to enhance the energy efficiency and performance of IoT devices through the performance improvements offered by MinT resource management and request processing. The experimental results show that the average request rate increased by 25% compared to Californium, which is a middleware for efficient interaction in IoT environments with powerful performance, an average response time decrease of 90% when resource management was used, and power consumption decreased by up to 68%. Finally, the proposed platform can reduce the latency and power consumption of IoT devices. PMID:28632182

  8. An Account of Oak Ridge National Laboratory's Thirteen Research Reactors

    Energy Technology Data Exchange (ETDEWEB)

    Rosenthal, Murray Wilford [ORNL

    2009-08-01

    The Oak Ridge National Laboratory has built and operated 13 nuclear reactors in its 66-year history. The first was the graphite reactor, the world's first operational nuclear reactor, which served as a plutonium production pilot plant during World War II. It was followed by two aqueous-homogeneous reactors and two red-hot molten-salt reactors that were parts of power-reactor development programs and by eight others designed for research and radioisotope production. One of the eight was an all-metal fast burst reactor used for health physics studies. All of the others were light-water cooled and moderated, including the famous swimming-pool reactor that was copied dozens of times around the world. Two of the reactors were hoisted 200 feet into the air to study the shielding needs of proposed nuclear-powered aircraft. The final reactor, and the only one still operating today, is the High Flux Isotope Reactor (HFIR) that was built particularly for the production of californium and other heavy elements. With the world's highest flux and recent upgrades that include the addition of a cold neutron source, the 44-year-old HFIR continues to be a valuable tool for research and isotope production, attracting some 500 scientific visitors and guests to Oak Ridge each year. This report describes all of the reactors and their histories.

  9. Neutron Detector Signal Processing to Calculate the Effective Neutron Multiplication Factor of Subcritical Assemblies

    Energy Technology Data Exchange (ETDEWEB)

    Talamo, Alberto [Argonne National Lab. (ANL), Argonne, IL (United States). Nuclear Engineering Division; Gohar, Yousry [Argonne National Lab. (ANL), Argonne, IL (United States). Nuclear Engineering Division

    2016-06-01

    This report describes different methodologies to calculate the effective neutron multiplication factor of subcritical assemblies by processing the neutron detector signals using MATLAB scripts. The subcritical assembly can be driven either by a spontaneous fission neutron source (e.g. californium) or by a neutron source generated from the interactions of accelerated particles with target materials. In the latter case, when the particle accelerator operates in a pulsed mode, the signals are typically stored into two files. One file contains the time when neutron reactions occur and the other contains the times when the neutron pulses start. In both files, the time is given by an integer representing the number of time bins since the start of the counting. These signal files are used to construct the neutron count distribution from a single neutron pulse. The built-in functions of MATLAB are used to calculate the effective neutron multiplication factor through the application of the prompt decay fitting or the area method to the neutron count distribution. If the subcritical assembly is driven by a spontaneous fission neutron source, then the effective multiplication factor can be evaluated either using the prompt neutron decay constant obtained from Rossi or Feynman distributions or the Modified Source Multiplication (MSM) method.

  10. Fast neutron tomography with real-time pulse-shape discrimination in organic scintillation detectors

    Energy Technology Data Exchange (ETDEWEB)

    Joyce, Malcolm J., E-mail: m.joyce@lancaster.ac.uk [Department of Engineering, Lancaster University, Lancaster, Lancashire LA1 4YW (United Kingdom); Agar, Stewart [Department of Engineering, Lancaster University, Lancaster, Lancashire LA1 4YW (United Kingdom); Aspinall, Michael D. [Hybrid Instruments Ltd., Gordon Manley Building, Lancaster Environment Centre, Lancaster University, Lancaster LA1 4YW (United Kingdom); Beaumont, Jonathan S.; Colley, Edmund; Colling, Miriam; Dykes, Joseph; Kardasopoulos, Phoevos; Mitton, Katie [Department of Engineering, Lancaster University, Lancaster, Lancashire LA1 4YW (United Kingdom)

    2016-10-21

    A fast neutron tomography system based on the use of real-time pulse-shape discrimination in 7 organic liquid scintillation detectors is described. The system has been tested with a californium-252 source of dose rate 163 μSv/h at 1 m and neutron emission rate of 1.5×10{sup 7} per second into 4π and a maximum acquisition time of 2 h, to characterize two 100×100×100 mm{sup 3} concrete samples. The first of these was a solid sample and the second has a vertical, cylindrical void. The experimental data, supported by simulations with both Monte Carlo methods and MATLAB®, indicate that the presence of the internal cylindrical void, corners and inhomogeneities in the samples can be discerned. The potential for fast neutron assay of this type with the capability to probe hydrogenous features in large low-Z samples is discussed. Neutron tomography of bulk porous samples is achieved that combines effective penetration not possible with thermal neutrons in the absence of beam hardening.

  11. Report on the workshop "Decay spectroscopy at CARIBU: advanced fuel cycle applications, nuclear structure and astrophysics". 14-16 April 2011, Argonne National Laboratory, USA.

    Energy Technology Data Exchange (ETDEWEB)

    Kondev, F.; Carpenter, M.P.; Chowdhury, P.; Clark, J.A.; Lister, C.J.; Nichols, A.L.; Swewryniak, D. (Nuclear Engineering Division); (Univ. of Massachusetts); (Univ. of Surrey)

    2011-10-06

    A workshop on 'Decay Spectroscopy at CARIBU: Advanced Fuel Cycle Applications, Nuclear Structure and Astrophysics' will be held at Argonne National Laboratory on April 14-16, 2011. The aim of the workshop is to discuss opportunities for decay studies at the Californium Rare Isotope Breeder Upgrade (CARIBU) of the ATLAS facility with emphasis on advanced fuel cycle (AFC) applications, nuclear structure and astrophysics research. The workshop will consist of review and contributed talks. Presentations by members of the local groups, outlining the status of relevant in-house projects and availabile equipment, will also be organized. time will also be set aside to discuss and develop working collaborations for future decay studies at CARIBU. Topics of interest include: (1) Decay data of relevance to AFC applications with emphasis on reactor decay heat; (2) Discrete high-resolution gamma-ray spectroscopy following radioactive decya and related topics; (3) Calorimetric studies of neutron-rich fission framgents using Total ABsorption Gamma-Ray Spectrometry (TAGS) technique; (4) Beta-delayed neutron emissions and related topics; and (5) Decay data needs for nuclear astrophysics.

  12. The cross sections of fusion-evaporation reactions: the most promising route to superheavy elements beyond Z=118

    Directory of Open Access Journals (Sweden)

    Jadambaa Khuyagbaatar

    2017-01-01

    Full Text Available The synthesis of superheavy elements beyond oganesson (Og, which has atomic number Z = 118, is currently one of the main topics in nuclear physics. An absence of sufficient amounts of target material with atomic numbers heavier than californium (Z = 98 forces the use of projectiles heavier than 48Ca (Z = 20, which has been successfully used for the discoveries of elements with Z = 114 - 118 in complete fusion reactions. Experimental cross sections of 48Ca with actinide targets behave very differently to “cold” and “hot” fusion-evaporation reactions, where doubly-magic lead and deformed actinides are used as targets, respectively. The known cross sections of these reactions have been analysed compared to calculated fission barriers. It has been suggested that observed discrepancies between the cross sections of 48Ca-induced and other fusionevaporation reactions originate from the shell structure of the compound nucleus, which lies in the island of the stability. Besides scarcely known data on other reactions involving heavier projectiles, the most promising projectile for the synthesis of the elements beyond Og seems to be 50Ti. However, detailed studies of 50Ti, 54Cr, 58Fe and 64Ni-induced reactions are necessary to be performed in order to fully understand the complexities of superheavy element formation.

  13. Intracavitary moderator balloon combined with (252)Cf brachytherapy and boron neutron capture therapy, improving dosimetry in brain tumour and infiltrations.

    Science.gov (United States)

    Brandão, S F; Campos, T P R

    2015-07-01

    This article proposes a combination of californium-252 ((252)Cf) brachytherapy, boron neutron capture therapy (BNCT) and an intracavitary moderator balloon catheter applied to brain tumour and infiltrations. Dosimetric evaluations were performed on three protocol set-ups: (252)Cf brachytherapy combined with BNCT (Cf-BNCT); Cf-BNCT with a balloon catheter filled with light water (LWB) and the same set-up with heavy water (HWB). Cf-BNCT-HWB has presented dosimetric advantages to Cf-BNCT-LWB and Cf-BNCT in infiltrations at 2.0-5.0 cm from the balloon surface. However, Cf-BNCT-LWB has shown superior dosimetry up to 2.0 cm from the balloon surface. Cf-BNCT-HWB and Cf-BNCT-LWB protocols provide a selective dose distribution for brain tumour and infiltrations, mainly further from the (252)Cf source, sparing the normal brain tissue. Malignant brain tumours grow rapidly and often spread to adjacent brain tissues, leading to death. Improvements in brain radiation protocols have been continuously achieved; however, brain tumour recurrence is observed in most cases. Cf-BNCT-LWB and Cf-BNCT-HWB represent new modalities for selectively combating brain tumour infiltrations and metastasis.

  14. Intracavitary moderator balloon combined with 252Cf brachytherapy and boron neutron capture therapy, improving dosimetry in brain tumour and infiltrations

    Science.gov (United States)

    Brandão, S F

    2015-01-01

    Objective: This article proposes a combination of californium-252 (252Cf) brachytherapy, boron neutron capture therapy (BNCT) and an intracavitary moderator balloon catheter applied to brain tumour and infiltrations. Methods: Dosimetric evaluations were performed on three protocol set-ups: 252Cf brachytherapy combined with BNCT (Cf-BNCT); Cf-BNCT with a balloon catheter filled with light water (LWB) and the same set-up with heavy water (HWB). Results: Cf-BNCT-HWB has presented dosimetric advantages to Cf-BNCT-LWB and Cf-BNCT in infiltrations at 2.0–5.0 cm from the balloon surface. However, Cf-BNCT-LWB has shown superior dosimetry up to 2.0 cm from the balloon surface. Conclusion: Cf-BNCT-HWB and Cf-BNCT-LWB protocols provide a selective dose distribution for brain tumour and infiltrations, mainly further from the 252Cf source, sparing the normal brain tissue. Advances in knowledge: Malignant brain tumours grow rapidly and often spread to adjacent brain tissues, leading to death. Improvements in brain radiation protocols have been continuously achieved; however, brain tumour recurrence is observed in most cases. Cf-BNCT-LWB and Cf-BNCT-HWB represent new modalities for selectively combating brain tumour infiltrations and metastasis. PMID:25927876

  15. Investigation of Workplace-like Calibration Fields via a Deuterium-Tritium (D-T) Neutron Generator.

    Science.gov (United States)

    Mozhayev, Andrey V; Piper, Roman K; Rathbone, Bruce A; McDonald, Joseph C

    2017-04-01

    Radiation survey meters and personal dosimeters are typically calibrated in reference neutron fields based on conventional radionuclide sources, such as americium-beryllium (Am-Be) or californium-252 (Cf), either unmodified or heavy-water moderated. However, these calibration neutron fields differ significantly from the workplace fields in which most of these survey meters and dosimeters are being used. Although some detectors are designed to yield an approximately dose-equivalent response over a particular neutron energy range, the response of other detectors is highly dependent upon neutron energy. This, in turn, can result in significant over- or underestimation of the intensity of neutron radiation and/or personal dose equivalent determined in the work environment. The use of simulated workplace neutron calibration fields that more closely match those present at the workplace could improve the accuracy of worker, and workplace, neutron dose assessment. This work provides an overview of the neutron fields found around nuclear power reactors and interim spent fuel storage installations based on available data. The feasibility of producing workplace-like calibration fields in an existing calibration facility has been investigated via Monte Carlo simulations. Several moderating assembly configurations, paired with a neutron generator using the deuterium tritium (D-T) fusion reaction, were explored.

  16. Production of medical radioisotopes in the ORNL High Flux Isotope Reactor (HFIR) for cancer treatment and arterial restenosis therapy after PTCA

    Energy Technology Data Exchange (ETDEWEB)

    Knapp, F.F. Jr.; Beets, A.L.; Mirzadeh, S.; Alexander, C.W.; Hobbs, R.L.

    1998-06-01

    The High Flux Isotope Reactor (HFIR) at the Oak Ridge National Laboratory (ORNL) represents an important resource for the production of a wide variety of medical radioisotopes. In addition to serving as a key production site for californium-252 and other transuranic elements, important examples of therapeutic radioisotopes which are currently routinely produced in the HFIR for distribution include dysprosium-166 (parent of holmium-166), rhenium-186, tin-117m and tungsten-188 (parent of rhenium-188). The nine hydraulic tube (HT) positions in the central high flux region permit the insertion and removal of targets at any time during the operating cycle and have traditionally represented a major site for production of medical radioisotopes. To increase the irradiation capabilities of the HFIR, special target holders have recently been designed and fabricated which will be installed in the six Peripheral Target Positions (PTP), which are also located in the high flux region. These positions are only accessible during reactor refueling and will be used for long-term irradiations, such as required for the production of tin-117m and tungsten-188. Each of the PTP tubes will be capable of housing a maximum of eight HT targets, thus increasing the total maximum number of HT targets from the current nine, to a total of 57. In this paper the therapeutic use of reactor-produced radioisotopes for bone pain palliation and vascular brachytherapy and the therapeutic medical radioisotope production capabilities of the ORNL HFIR are briefly discussed.

  17. Variable color temperature fluorescent lamp

    Science.gov (United States)

    Ravi, J.; Maya, J.

    2000-05-01

    Color temperature change in a mercury-rare gas low pressure discharge has been investigated. Different pulse waveforms have been employed to increase the ratio of mercury upper level transitions with respect to the resonant 254 nm radiation. Low pressure fluorescent light sources were made with coatings consisting of a blue phosphor, sensitive to 365 nm ultraviolet radiation, blended with the standard 254 nm excited red/green phosphors. With a fast rise excitation waveform, a color temperature rise of as much as 1700 K was realized although at a cost of 26% in relative luminous efficacy. An improved scheme for greater color temperature change is proposed based on a phosphor that is excitable by the mercury 185 nm ultraviolet radiation but which does not absorb 254 nm radiation.

  18. Prompt neutron multiplicities for the transplutonium nuclides

    Energy Technology Data Exchange (ETDEWEB)

    Holden, N.E.; Zucker, M.S.

    1985-01-01

    The direct determination of the average prompt neutron emission values is reviewed, and a method of comparing different sites of neutron emission multiplicity distribution values is described. Measured and recommended values are tabulated for these nuclides: /sup 241/Am, /sup 242/Am, /sup 242/Cm, /sup 243/Cm, /sup 244/Cm, /sup 246/Cm, /sup 247/Cm, /sup 248/Cm, /sup 250/Cm, /sup 245/Cm, /sup 249/Bk, /sup 246/Cf, /sup 249/Cf, /sup 250/Cf, /sup 252/Cf, /sup 254/Cf, /sup 251/Cf, /sup 253/Es, /sup 254/Es, /sup 244/Fm, /sup 246/Fm, /sup 255/Fm, /sup 252/No, /sup 254/Fm, /sup 256/Fm, /sup 257/Fm. 59 refs., 24 tabs. (LEW)

  19. A preliminary parasitological survey of hepatozoon spp. Infection in dogs in mashhad, iran.

    Science.gov (United States)

    Amoli, Aa Rahmani; Khoshnegah, J; Razmi, Ghr

    2012-01-01

    We attempted to determine the prevalence of Hepatozoon spp. infection in Mashhad, northeast of Iran, via blood smear parasitology. The prevalence was investigated by examination of blood smear parasitology, using blood samples collected from 254 dogs (51 strays and 203 privately owned-dogs). Two stray dogs (2/51; 3.92%) and two privately-owned dogs (2/203; 0.98%) were infected with Hepatozoon spp. Therefore, as per blood smear parasitology, the prevalence of Hepatozoon spp. infection was 1.57% (4/254). Sixteen out of 254 dogs (6.29%) were infested with ticks; all of which were Rhipicephalus sanguineus. One of the dogs infected with Hepatozoon spp. exhibited ticks at the time of examination. Concurrent infection with Ehrlichia canis and Leishmania infantum was not detected in the four Hepatozoon spp. infected dogs. This is the first epidemiological study on the prevalence of Hepatozoon spp. infection in dogs in Iran.

  20. An Evaluation for Coupling of Human to Magnetic Fields in Human Ellipsoidal Models With Frequency up to 100kHz

    Science.gov (United States)

    2001-10-25

    fields to the ellipsoid human models were investigated. As ellipsoid human models, average man, average woman, average endomorphic (fat) man, 10- year-old...HUMAN MODELS[13] Selected Models a b c Average Man 0.875 0.195 0.098 Average Women( 0.805 0.2 0.091 Average Endomorphic (fat)man 0.88 0.225 0.17 10-Year...0.254 2.54 25.4 0.0545 0.545 5.451 54.51 Av. Endomorphic (fat)man 0.0381 0.381 3.809 38.094 0.0469 0.468 4.687 46.88 0.0612 0.612 6.122 61.22 10-Year

  1. Pilot investigation of two-stage biofiltration for removal of natural organic matter in drinking water treatment.

    Science.gov (United States)

    Fu, Jie; Lee, Wan-Ning; Coleman, Clark; Meyer, Melissa; Carter, Jason; Nowack, Kirk; Huang, Ching-Hua

    2017-01-01

    A pilot study employing two parallel trains of two-stage biofiltration, i.e., a sand/anthracite (SA) biofilter followed by a biologically-active granular activated carbon (GAC) contactor, was conducted to test the efficiency, feasibility and stability of biofiltration for removing natural organic matter (NOM) after coagulation in a drinking water treatment plant. Results showed the biofiltration process could effectively remove turbidity (24% of dissolved organic carbon (DOC), >57% of UV254, and >44% of SUVA254), where the SA biofilters showed a strong capacity for turbidity removal, while the GAC contactors played the dominant role in NOM removal. The vertical profile of water quality in the GAC contactors indicated the middle-upper portion was the critical zone for the removal of NOM, where relatively higher adsorption and enhanced biological removal were afforded. Fluorescence excitation-emission matrix (EEM) analysis of NOM showed that the GAC contactors effectively decreased the content of humic-like component, while protein-like component was refractory for the biofiltration process. Nutrients (NH4-N and PO4-P) supplementation applied upstream of one of the two-stage biofiltration trains (called engineered biofiltration) stimulated the growth of microorganisms, and showed a modest effect on promoting the biological removal of small non-aromatic compositions in NOM. Redundancy analysis (RDA) indicated influent UV254 was the most explanatory water quality parameter for GAC contactors' treatment performance, and a high load of UV254 would result in significantly reduced removals of UV254 and SUVA254. Copyright © 2016 Elsevier Ltd. All rights reserved.

  2. Differentiating ozone direct and indirect reactions on decomposition of humic substances.

    Science.gov (United States)

    Chiang, Yen-Pei; Liang, Yung-Ying; Chang, Cheng-Nan; Chao, Allen C

    2006-12-01

    The ozonation reaction is accomplished into two pathways: direct ozone oxidation and indirect free hydroxyl radical oxidation. Both reactions are proceeding simultaneously, thus, it is difficult to separate them and study their respective reaction mechanisms. Carbonate and bicarbonate react with free radicals that will effectively inhibit the indirect free radical oxidation without affecting the direct oxidation reaction. The feasibility of using these chemicals as scavengers to inhibit the hydroxyl radicals so that the direct ozone oxidation reaction and indirect free hydroxyl radical oxidation reaction can be differentiated is presented in this paper. The results will assist in achieving a better understanding of the ozone reaction mechanism in oxidizing organic substances. In this study, synthetic samples made of commercially available humic substance are used to carry out the inhibited and non-inhibited ozone oxidation experiments. The intersecting point of the ORP (oxidation reduction potential) time series curves of the inhibited and un-inhibited reactions, occurring at 120s after the onset of the oxidation reaction, marks the turning point at which all added scavenger chemicals have been completely exhausted. Based on the measured A(254) values, percentage distributions of direct ozone oxidation and indirect hydroxyl radical oxidation are estimated. The results indicate that the contribution of indirect reaction decreases with increasing amounts of inhibiting scavengers. The on-line ORP measurement results are simulated using a modified form of the Nernst equation expressed as ORP=11852-1196 pH+130 ln [(A(254,0)-A(254,t))(A(254,t))(-1)] with R(2) value of 0.99. In this equation, A(254) is the absorbance at 254 nm used to index the humic substance concentration while subscript 0 and t denote the initial and the final time, respectively.

  3. EST Table: FY744453 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available FY744453 E_FL_famL_24C03_F_0 11/11/04 82 %/255 aa ref|XP_002424214.1| Arsenical pump-driving... ATPase, putative [Pediculus humanus corporis] gb|EEB11476.1| Arsenical pump-driving ATPase, putati... 81 %/254 aa gnl|Amel|GB18636-PA 11/11/04 77 %/254 aa gi|91081505|ref|XP_974589.1| PREDICTED: similar to arsenical pump-driving atpase [Tribolium castaneum] FS918630 famL ...

  4. Distributed Mission Operations: Training Today’s Warfighters for Tomorrow’s Conflicts

    Science.gov (United States)

    2016-02-01

    their designated tactics without regard for FAA restrictions or artificially limited airspace. Instead, distributed mission operations trainees can...Aviation Psychology, Volume 21, Issue 3 (Jul-Sep 2011): [p254-268], 256. 11 AETC Syllabus HC/MC-130J-P-IQ, Air Education and Training Command HC/MC 130-J...Aviation Psychology, Volume 21, Issue 3 (Jul-Sep 2011): [p254-268], 265. 52 AETC Syllabus HC/MC-130J-P-IQ, Air Education and Training Command HC

  5. Synthesis, Characterization, and Application of Gold Nanoparticles in Green Nanochemistry Dye-Sensitized Solar Cells

    Science.gov (United States)

    2012-06-01

    3) created Au quantum dots by reducing HAuCl4 into alcoholic solutions of polyvinylpyrrolidone and ethylene glycol (C2H6O2). The quantum dots...anthocyanin, pH, the sugar attached, and where the sugar is located on the anthocyanin molecule structure, the anthocyanin will absorb different ultraviolet...acetic acid using a ceramic stirrer. The TiO2 solution was deposited using the doctor blading method in which the conductive sides of 2.54- × 2.54

  6. Optimizing and Evaluating an Integrated SPECT-CmT System Dedicated to Improved 3-D Breast Cancer Imaging

    Science.gov (United States)

    2009-05-01

    25.4mm height) and is attached to a laboratory jack (model M-EL120, Newport Corp., Irvine, CA) and goniometric cradle (model BGM200PE, Newport Corp... goniometric cradle, providing polar tilt; a motorized laboratory jack for radius-of-rotation (ROR) control; and a rotational stage for azimuthal...and 25.4 mm height). The camera is attached to a laboratory jack (model M-EL120, Newport Corp., Irvine, CA) and a goniometric cradle (model BGM200PE

  7. The pin pixel detector--X-ray imaging

    CERN Document Server

    Bateman, J E; Derbyshire, G E; Duxbury, D M; Marsh, A S; Simmons, J E; Stephenson, R

    2002-01-01

    The development and testing of a soft X-ray gas pixel detector, which uses connector pins for the anodes is reported. Based on a commercial 100 pin connector block, a prototype detector of aperture 25.4 mm centre dot 25.4 mm can be economically fabricated. The individual pin anodes all show the expected characteristics of small gas detectors capable of counting rates reaching 1 MHz per pin. A 2-dimensional resistive divide readout system has been developed to permit the imaging properties of the detector to be explored in advance of true pixel readout electronics.

  8. DEGRADATION OF NATURAL ORGANIC MATTER IN WATER BY USING UV-C/H2O2 PROCESS

    OpenAIRE

    Juretić, Hrvoje; Smoljanić, Goran; Barta, Marija

    2015-01-01

    This laboratory study evaluated the ultraviolet (UV) photolysis, H2O2 treatment and UV-C/H2O2 advanced oxidation for the degradation of natural organic matter (NOM) in raw groundwater having high alkalinity and elevated dissolved organic carbon (DOC) concentration. The treatment efficiency was evaluated in terms of the reduction of DOC and UV absorbance at 254 nm (A254). UV photolysis and H2O2 oxidation as standalone treatments were not effective at reducing DOC but the rate of DOC reduction ...

  9. 2010 CERT Research Report

    Science.gov (United States)

    2011-09-01

    Hermes Exchange Server 10.0.1.105 Achilles IIS Web Server 10.0.2.100 Ares Splunk Server 10.0.1.102 Socrates Master Snort/SiLK Sensor10.0.1.254 Internet...Client 1 10.0.3.100 Client 2 10.0.3.102 10.0.3.0/24 10.0.2.0/24 10.0.1.0/24 10.0.4.0/24 Plato Snort/SiLK Sensor 10.0.3.254 Aristotle Snort/SiLK Sensor

  10. Research

    African Journals Online (AJOL)

    abp

    10 oct. 2013 ... 2(5.4). Infarctus du myocarde. 1(0.6). 3(8.1). Varices. 7(4.7). 1(2.7). Tuberculose pulmonaire. 6(4.1). 0(0). Antécédents personnels de MTEV. 15(10.2). 7(18.9). Indeterminé. 14(9.5). 2(5.4). Valeurs exprimées en n(%), moyenne ± écart type pour l'âge ; AVC : accident vasculaire cérébral ; METV: Maladie.

  11. Knowledge, Attitudes, and Practices of Parents Facing Child and Adolescent Obesity in Brazzaville, Congo

    OpenAIRE

    Jean Robert Mabiala Babela MD; Evrard Romaric Nika MD; Kadidja Grâce Cléona Nkounkou Milandou MO; Steve Vassili Missambou Mandilou MD; Succes Brege Albert Bouangui Bazolana MO; Henri Germain Monabeka MD; Georges Moyen MD

    2016-01-01

    The study aimed to assess obesity-related knowledge, attitudes, and practices of parents when facing child and adolescent obesity in order to improve the quality of care. A case-control study was conducted from February 1 to July 1, 2013. The study compared parents of obese school children (group 1 or cases; n = 254) and those school children without obesity (group 2 or controls; n = 254). These children were drawn from public and private primary schools of Brazzaville (Congo). Obesity-relate...

  12. Accelerating the discovery of hidden two-dimensional magnets using machine learning and first principle calculations

    Science.gov (United States)

    Miyazato, Itsuki; Tanaka, Yuzuru; Takahashi, Keisuke

    2018-02-01

    Two-dimensional (2D) magnets are explored in terms of data science and first principle calculations. Machine learning determines four descriptors for predicting the magnetic moments of 2D materials within reported 216 2D materials data. With the trained machine, 254 2D materials are predicted to have high magnetic moments. First principle calculations are performed to evaluate the predicted 254 2D materials where eight undiscovered stable 2D materials with high magnetic moments are revealed. The approach taken in this work indicates that undiscovered materials can be surfaced by utilizing data science and materials data, leading to an innovative way of discovering hidden materials.

  13. Dicty_cDB: Contig-U05428-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ssful extensions: 42 Number of sequences better than 10.0: 1 length of query: 254... length of database: 5,674,871 effective HSP length: 15 effective length of query: 239 effective length of d... of extensions: 1064701 Number of successful extensions: 104445 Number of sequences better than 10.0: 0 Length of query...: 254 Length of database: 104,622,809,269 Length adjustment: 23 Effective length of query: 231 Ef...han 10.0: 0 Number of HSP's gapped: 0 Number of HSP's successfully gapped: 0 Length of query

  14. Phase II Archaeological Testing of the Helmkamp Site (11MS2025) in Support of the Proposed Grassy Lake Pump Station and Associated Ditch Work, Wood River Drainage and Levee District, Madison County, Illinois

    Science.gov (United States)

    2005-04-01

    usace.army.mil. The Contractor shall also notify Mr. Vince Milazzo, WRD&LD Superintendent, at (618) 254-7481, FAX (618) 254-7482, cell (618) 973-9176. The...print) ARCHIE C. RINGGENBERG I CONTRACTING OFFICER ~I’V’l G. IL~t14 1? rt4 le’s±t TEL~ 3114-3311.8506 EMAIL Archte.C.*gwtgg~mw02.umae.SrttnyfhIg 15B...conducted another surface collection and excavated seven one-meter-square test units to depths of 70-130 cm below surface. They also extracted two

  15. Ageing of Insensitive DNAN Based Melt-Cast Explosives

    Science.gov (United States)

    2014-08-01

    measures values by applying a thin film of sample to a ceramic tile and lowering the friction peg [8]. A maximum loading is placed on the tester and the...Mechanical strength testing (compression) was undertaken on an Instron 5500 (R1185) Universal Testing Machine with a 100 kN load cell set to a crosshead...rate of 1 mm/min. Testing was undertaken at 23 °C (room temperature) on machined sections (25.4 mm x 25.4 mm). The following parameters were recorded

  16. Kõrgõzstani vahevalitsus külmutas pangad / Hendrik Vosman

    Index Scriptorium Estoniae

    Vosman, Hendrik

    2010-01-01

    Kõrgõzstani pangasüsteem on külmutatud, sest võimult tõrjutud Kõrgõzstani president Kurmanbek Bakijev olevat enne pealinnast põgenemist tühjendanud riigikassa. Riigi arvel on vaid 254 mln. krooni

  17. Evaluation of Residential Consumers Knowledge of Wireless Network Security and Its Correlation with Identity Theft

    Science.gov (United States)

    Kpaduwa, Fidelis Iheanyi

    2010-01-01

    This current quantitative correlational research study evaluated the residential consumers' knowledge of wireless network security and its relationship with identity theft. Data analysis was based on a sample of 254 randomly selected students. All the study participants completed a survey questionnaire designed to measure their knowledge of…

  18. GENERAL SURGERY

    African Journals Online (AJOL)

    range 2-54) with a median volume of 1.1 mls/kg/% operated surface area (range 0.56-2.14) of packed cells transfused per operation. One hundred and fifty questionnaires were handed out and 103 (69%) were completed. The average proposed ...

  19. silicium amorphe h

    African Journals Online (AJOL)

    utilisateur

    état fondamental (61So) à l'état excité singulet 1P1 ou triplet 3P1 selon le processus [1-16]:. Hg(1S0) + hν (254 nm) -------------> Hg*(3P1). (1). Par collision sur l'atome de mercure excité, le silane se décompose principalement comme suit :.

  20. Perovskite solid solutions La0.75Bi0.25Fe1-xCrxO3: Preparation, structural, and magnetic properties

    Czech Academy of Sciences Publication Activity Database

    Ivanov, S. A.; Beran, Přemysl; Bazuev, G. V.; Tellgren, R.; Sarkar, T.; Nordblad, P.; Mathieu, R.

    2017-01-01

    Roč. 254, OCT (2017), s. 166-177 ISSN 0022-4596 R&D Projects: GA MŠk LM2015056 Institutional support: RVO:61389005 Keywords : ceramics * electronic materials * neutron scattering * X-ray diffraction * crystal structure * magnetic properties Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.299, year: 2016

  1. Gclust Server: 89939 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available Sequences(254) 223 Binding-protein-dependent transport systems inner membrane component 1 1.00e-40 0.0 0.0 0.0...annotation Binding-protein-dependent transport systems inner membrane component Number of Sequences 1

  2. Development of a Y-STR 12-plex PCR system and haplotype ...

    Indian Academy of Sciences (India)

    A Y-chromosomal short tandem repeat (Y-STR) dodecaplex. PCR system for 12 loci has been developed, and using this system allele frequencies and haplotypes were determined in a Korean male population. From a study of 320 unre- lated Korean males, 254 different haplotypes were identi- fied. The haplotype diversity ...

  3. 76 FR 41805 - Submission for OMB Review; Comment Request; Prostate, Lung, Colorectal and Ovarian Cancer...

    Science.gov (United States)

    2011-07-15

    ... Collection: Title: Prostate, Lung, Colorectal and Ovarian Cancer Screening Trial (PLCO) (NCI). Type of... ovarian cancer can reduce mortality from these cancers which currently cause an estimated 254,570 deaths... (prostate, lung, colorectal, and ovary). In addition, cancer incidence, stage shift, and case survival are...

  4. 76 FR 22108 - Proposed Collection; Comment Request; Prostate, Lung, Colorectal and Ovarian Cancer Screening...

    Science.gov (United States)

    2011-04-20

    ... to determine if screening for prostate, lung, colorectal and ovarian cancer can reduce mortality from these cancers which currently cause an estimated 254,570 deaths annually in the U.S. The design is a two... of the trial is cancer specific mortality for each of the four cancer sites (prostate, lung...

  5. Revue de Médecine et de Pharmacie - Vol 3, No 1 (2013)

    African Journals Online (AJOL)

    La corticothérapie dans la prise en charge hospitalière de l'asthme à Yaoundé : Connaissances, Attitudes et Pratiques · EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. EA Ze, AAM Kamgueng, G Nguefack-Tsague, J-B Bogne, 254-261 ...

  6. An Examination of the Child Rights Protection and Corporal

    African Journals Online (AJOL)

    Mofasony

    Child's Rights Act, Cap 2003 hereinafter referred to as CRA. 3. Convention on ... 2004) p.254. 8. Cap LI LFN, 2004 . 9 section 2,Cap 22,Laws of the Federation of Nigeria 2004. 10. Article 2, ACRWC 1999. 11. CRC, 1989 which Nigeria ratified in 1991 and domesticated in 2003. ...... sleeping pills and ice packs. The child had ...

  7. 2029-IJBCS-Article-Muhammad abdullahi

    African Journals Online (AJOL)

    hp

    JD, Nout MJR, Van Boekel MAJS. 2009. Baobab Food Products: A Review on their. Composition and Nutritional Value. Critical Reviews in Food Science and. Nutrition, 49:254-27. Hobart HW, ynne Jr. LM, Dean JA, Settle Jr. FA. (2007). Gaschromatography. In. Instrumental Methods of Analysis, (7th edn), Willard HH, Merritt ...

  8. Crystal structure of Pseudomonas aeruginosa lipase in the open conformation - The prototype for family I.1 of bacterial lipases

    NARCIS (Netherlands)

    Nardini, M; Lang, DA; Liebeton, K; Jaeger, KE; Dijkstra, BM

    2000-01-01

    The x-ray structure of the lipase from Pseudomonas aeruginosa PAO1 has been determined at 2.54 Angstrom resolution. It is the first structure of a member of homology family I.1 of bacterial lipases. The structure shows a variant of the alpha/beta hydrolase fold, with Ser(82), Asp(229), and His(251)

  9. Causes of death among the Caesars (27 BC-AD 476) | Retief | Acta ...

    African Journals Online (AJOL)

    During the Early Empire 55,6% of the emperors died of natural causes or illness, as against 25,4% during the Late Empire. Of the second group more were murdered or executed (55,9% versus 33,3%) and more died on the battlefield (5 versus none). The incidence of suicide was slightly higher among the early emperors ...

  10. Tidally Induced Variations of PMC Altitudes and Ice Water Content Using a Data Assimilation System

    Science.gov (United States)

    2010-04-01

    69° N ( Andenes , Norway) and 85 235 km geometric altitude in Figure 5. In addition, we performed five short term integrations of the 236 forecast...intercomparison between two approaches to calculating winds and the Andenes data. 251 252 2.2 Ice Particle Trajectories and CARMA 253 254 As noted

  11. The influence of the wavelength of ultraviolet radiation on survival, mutation induction and DNA repair in irradiated Chinese hamster cells

    NARCIS (Netherlands)

    Zelle, B.; Reynolds, R.J.; Kottenhagen, M.J.; Schuite, A.; Lohman, P.H.M.

    1980-01-01

    Chinese hamster ovary cells were used to compare the cytotoxicity and mutagenicity of far-UV radiation emitted by a low-pressure mercury, germicidal lamp (wavelength predominantly 254 nm) with that of near-UV radiation emitted by a fluorescent lamp with a continuous spectrum (Westinghouse 'Sun

  12. Dieren in het geding : een juridisch-historische analyse van het verbod op dierenmishandeling

    NARCIS (Netherlands)

    de Bordes, E.C.

    2010-01-01

    In 1886 the Criminal Code first came into effect. It stipulated, in article 254, that maltreatment of an animal was a crime. Sanctions could be imprisonment for a period of up to three months, or a fine of 120 guilders at most. Maltreatment was not defined. The basic principle underlying the penal

  13. The Supreme Court of Estonia constitutional judgement 3-3-1-35-10: judgment of the Supreme Court en banc : date of decision 31 August 2011

    Index Scriptorium Estoniae

    2013-01-01

    Kohtulahendi 3-3-1-35-10 (Riigiprokuratuuri ning Politsei- ja Piirivalveameti kassatsioonkaebused Tallinna Ringkonnakohtu 16. veebruari 2010. a otsuse peale haldusasjas nr 3-08-265 Ülar Kaasi (Kaas) kaebuses Eesti Vabariigi tekitatud 254 087 krooni suuruse kahju hüvitamise nõudes) tekst inglise keeles

  14. AcEST: DK952224 [AcEST

    Lifescience Database Archive (English)

    Full Text Available p|Q9UTC8|OS9_SCHPO Protein OS-9 homolog OS=Schizosaccharomyces ... 32 2.2 sp|Q8CGM2|RP1L1_MOUSE Retinitis pi...EVSSCAYSMTIHVPGLCSLPAF 253 Query: 392 QGTEEVESD 418 + E++ S+ Sbjct: 254 KIQEDIPSE 262 >sp|Q8CGM2|RP1L1_MOUSE Retinitis

  15. experience with norplant at a nigerian teaching hospital

    African Journals Online (AJOL)

    2010-11-11

    Nov 11, 2010 ... system released approximately 30 mcg /day of levo-norgestrel, and was said to be effective for at ... devices (IUDs) 25.4%, and Oral Contraceptive Pills (OCP) 22.9%. Female sterilisation ... safety, independence from user compliance, rapid return of pre-existing fertility after removal, good tolerability, and ...

  16. Simultaneous Determination of Cyanide and Thiocyanate in Plasma by Chemical Ionization Gas Chromatography Mass-Spectrometry (CI-GC-MS)

    Science.gov (United States)

    2012-09-04

    potassium cyanide. Arterial blood samples were drawn, and plasma was taken from those blood samples at 13 different time points, including a baseline, 15...44. Seto Y (1995) Oxidative conversion of thiocyanate to cyanide by oxyhemoglobin during acid denaturation. Arch Biochem Biophys 321(1):245–254. doi

  17. Dicty_cDB: Contig-U16469-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 9 1 ( AC140550 ) Medicago truncatula clone mth2-54a24, complete se... 44 8.9 1 ( DL083628 ) Listeria innocua, genome and applications.... 44 8.9 1 ( DL081582 ) Listeria innocua, genome and applications. 44 8.9 1 ( AX415

  18. Estimation of the type of adsorption, sorbent saturation capacities ...

    African Journals Online (AJOL)

    , relating to the heat of sorption (between 355 to 793 KJ/mol). The R-D model provided the mean free energy values as ED = 0.717-2.254 KJ/mol, which were indication of physical adsorption (ED<8 KJ/mol). The Gibbs free energy from kinetics ...

  19. Discrepancies between Parents' and Children's Attitudes toward TV Advertising

    Science.gov (United States)

    Baiocco, Roberto; D'Alessio, Maria; Laghi, Fiorenzo

    2009-01-01

    The authors conducted a study with 500 parent-child dyads. The sample comprised 254 boys and 246 girls. The children were grouped into 5 age groups (1 group for each age from 7 to 11 years), with each group comprising 100 children. The survey regards discrepancies between children and their parents on attitudes toward TV advertising to determine…

  20. Volume 9 No. 3 2009 May 2009 830 EFFECT OF SELECTED ...

    African Journals Online (AJOL)

    1. Mndeme YES Postharvest fish losses in Tanzania: a case study of Lake. Victoria and Mafia Islands fisheries In: Proceedings of FAO Expert. Consultation on Fish Technology in Africa (Kisumu, Kenya). Report no. 574. FAO (Rome). 1998: 254-260. 2. Gram l, Wedell NC and HH Huss The bacteriology of fresh and spoiling L.

  1. short communication polyvinylpyrrolidone-bromine complex

    African Journals Online (AJOL)

    Preferred Customer

    It displays a strong binding affinity toward small molecules. [15], its iodine complex, povidon-iodine, is widely used as ... by TLC on silica gel poly gram SIL G/UV 254 plates. Products identified by comparison IR, and ... Further purification performed through silica gel column chromatography. Caution: benzylic bromides can ...

  2. Relationship between leisure involvement and subjective well-being ...

    African Journals Online (AJOL)

    The purpose of this study was to examine the relationship between leisure involvement and subjective well-being and clarify the moderating effect of spousal support in this relationship. A total of 254 questionnaires were collected from a sample of players of slow pitch softball. Structural equation modelling was utilised to ...

  3. South African Journal of Education - Vol 23, No 4 (2003)

    African Journals Online (AJOL)

    Factors influencing academic success or failure of first-year and senior university students: do education students and lecturers perceive things differently? EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. William J Fraser, Roy Killen, 254-263 ...

  4. An Analysis of Organizational Behavior Management Research in Terms of the Three-Contingency Model of Performance Management

    Science.gov (United States)

    Weatherly, Nicholas L.; Malott, Richard W.

    2008-01-01

    The three-contingency model of performance management (Malott, 1992, 1993, 1999) was used to analyze interventions in the "Journal of Organizational Behavior Management (JOBM)" from the years 1990 through 2005 (Volume 11[1]-Volume 25[4]). The current article extends previous reviews (Malott, Shimamune, & Malott, 1992; Otto & Malott, 2004) by…

  5. Theoretical Analyses of the Functional Regions of the Heavy Chain of Botulinum Neurotoxin

    Science.gov (United States)

    1994-01-01

    hemifacial spasm . Mov Disord 1987:4:237-254. 5. Brin MF. Blitzer A, Fahn S, Gould W. Lovelace RE. Adductor laryngeal dystonia (spastic dysphonia): treatment... reviews (6-9). The primary toxic effect of all the BTX serotypes (excluding the C2 and C3 serotypes I10)) is flaccid paralysis. The toxin prevents

  6. Influence of untreated and bacterial-treated Yamuna water on the ...

    African Journals Online (AJOL)

    STORAGESEVER

    2009-09-01

    Sep 1, 2009 ... treated effluent for irrigation fields and grow vegetables and crop plant (Berman et al., 2001). Treatment methods for waste water which are being ..... growth, total chlorophyll and protein contents of Phaseolus aureus L,. J. Environ. Biol. 25(4): 381-385. Claus D, Berkeley RCW (1986). Genus Bacillus Cohn.

  7. Clinicopathological Characteristics of Odontogenic Myxoma in ...

    African Journals Online (AJOL)

    Odontogenic epithelium was rare and observed in 5 (9.5%) cases while calcific material was present in sixteen (25.4%) cases. Late presentation was a common feature and surgical excision was the treatment of choice. Conclusion: Odontogenic myxoma is un-common among Nigerians when compared with ameloblastoma ...

  8. Eray et al., Afr J Tradit Complement Altern Med. (2015) 12(5):8-13 ...

    African Journals Online (AJOL)

    Proff.Adewunmi

    knowledge of those methods (acupuncture, acupressure, yoga, reiki, prayer, meditation massage, dietary, spa). Prayer was the most known modality in all medical classes' students (first year students: 254, sixth year students: 192). The students who participated in the study stated that. 433 (%59.4) have some knowledge ...

  9. Focal ischaemia caused by instability of cerebrovascular tone during attacks of hemiplegic migraine. A regional cerebral blood flow study

    DEFF Research Database (Denmark)

    Friberg, L; Olsen, T S; Roland, P E

    1987-01-01

    During the course of hemiplegic migraine in 3 patients, changes in regional cerebral blood flow (rCBF) were recorded by the intracarotid 133Xe method and a 254 multidetector camera covering one hemisphere. The rCBF measurements were performed in conjunction with cerebral angiography. During repea...

  10. Cranial computed tomographic findings in Nigerian women with ...

    African Journals Online (AJOL)

    Results: In the 59 patients studied (mean age 50.9 years ± 11.75 SD), headache (40.7%) and hemiparesis/hemiplegia (16.9%) were the commonest clinical presentation. Lytic skull lesions were seen in 15 patients (25.4%), most commonly in the parietal bones. Thirty‑nine patients (66.1%), had parenchymal brain lesions, ...

  11. Parent-Endorsed Sex Differences in Toddlers with and without ASD: Utilizing the M-CHAT

    Science.gov (United States)

    Øien, Roald A.; Hart, Logan; Schjølberg, Synnve; Wall, Carla A.; Kim, Elizabeth S.; Nordahl-Hansen, Anders; Eisemann, Martin R.; Chawarska, Katarzyna; Volkmar, Fred R.; Shic, Frederick

    2017-01-01

    Sex differences in typical development can provide context for understanding ASD. Baron-Cohen ("Trends Cogn Sci" 6(6):248-254, 2002) suggested ASD could be considered an extreme expression of normal male, compared to female, phenotypic profiles. In this paper, sex-specific M-CHAT scores from N = 53,728 18-month-old toddlers, including n…

  12. 77 FR 10543 - Announcement of Funding Awards for the Capacity Building for Sustainable Communities Program for...

    Science.gov (United States)

    2012-02-22

    ... 2000, dba Envision 600,000 Utah, 254 South 600 East, Salt Lake City, UT Institute for Sustainable... URBAN DEVELOPMENT Announcement of Funding Awards for the Capacity Building for Sustainable Communities Program for Fiscal Year 2011 AGENCY: Office of Sustainable Housing and Communities, HUD. ACTION...

  13. Characterizing Lenses and Lensed Stars of High-magnification Single-lens Gravitational Microlensing Events with Lenses Passing over Source Stars

    DEFF Research Database (Denmark)

    Choi, J.-Y.; Shin, I.-G.; Park, S.-Y.

    2012-01-01

    We present the analysis of the light curves of nine high-magnification single-lens gravitational microlensing events with lenses passing over source stars, including OGLE-2004-BLG-254, MOA-2007-BLG-176, MOA-2007-BLG-233/OGLE-2007-BLG-302, MOA-2009-BLG-174, MOA-2010-BLG-436, MOA-2011-BLG-093, MOA-...

  14. Prognosis and outcome of acute stroke in the University College ...

    African Journals Online (AJOL)

    2011-03-02

    Mar 2, 2011 ... pathological process of blood vessel.[1] The incidence of stroke is 254/100,000 person years ... usually due to the consequences of immobilization, recurrent seizures, and stroke recurrence.[12] Because of .... gender and aging are known non-modifiable risk factors for stroke and several non-communicable ...

  15. Untitled

    African Journals Online (AJOL)

    254. Akhter, M. and Sneller CH. 1996. Genotype x planting date interaction and selection ofearly maturing soybean genotypes. Crop Science. 36:883-889. Becker, W.A. 1984. Manual of quantitative genetics. 4th ed. Academic Enterprise,. Pullman ...

  16. Stability-Indicating Reverse Phase HPLC Method for the ...

    African Journals Online (AJOL)

    ... phase consisting of phosphate buffer (pH 6.8) and methanol (5:2 v/v), and UV detection at 254 nm at a flow rate of 1 ml/min. The stress testing of cefazolin was carried out under acidic, alkaline, neutral, oxidation and thermal conditions. Results: The drug peak was well resolved from the peaks of the degradation products.

  17. Improved Oversight, but No Invoice Reviews and Potential Antideficiency Act Violation May Have Occurred on the Kuwait Observer Controller Team Task Orders

    Science.gov (United States)

    2012-08-02

    Statement (PWS)ISUW -Revised Pcrfonnancc Spccitication. if required -Sole Source Justification/Exception to I’ air Oppo11unity ( EFO ). if required...Spccification. etc. -IGCE -.’\\SSP. S.<’IS. AP. as required · Sole Source Justitk:uion (.lustificntion & ApprO\\’ai/ EFO , as required) - CDRLs - DD254. if

  18. ORF Alignment: NC_002678 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_002678 gi|13473528 >1u07A 4 89 172 254 2e-09 ... ref|NP_105096.1| energy transduce...r TonB [Mesorhizobium loti MAFF303099] ... dbj|BAB50882.1| energy transducer; TonB [Mesorhizobium ...

  19. : tous les projets | Page 232 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Sujet: SOCIAL WELFARE, SOCIAL SECURITY, HOUSEHOLD INCOME, YOUTH UNEMPLOYMENT. Région: South Africa, South of Sahara. Programme: Emploi et croissance. Financement total : CA$ 254,300.00. Productivité agricole et changements climatiques dans les régions arides et semi-arides du Kenya. Projet.

  20. Original Research Article

    African Journals Online (AJOL)

    Erah

    Treatment Panel III (ATP III) criteria] and cigarette smoking in Thai subjects. Methods: This study was carried out among 254 smokers and 144 nonsmokers from suburban and urban residential areas in Bangkok, ... 2Department of Tropical Nutrition and Food. Science, Faculty of Tropical Medicine,. Mahidol University, 420/6 ...

  1. The sponge-associated bacterium Bacillus licheniformis SAB1: A source of antimicrobial compounds

    Digital Repository Service at National Institute of Oceanography (India)

    PrabhaDevi; Wahidullah, S.; Rodrigues, C.; DeSouza, L.

    -coated with silica gel 60 F254 (Merk KgaA, Damstadt, Germany, Cat No. 1.05554). All the solvents used were glass distilled. 4. Conclusions The marine bacterium, Bacillus licheniformis SAB1, isolated from a Halichondria sp. sponge and identified by its 16S r...

  2. Trade, Standards and Vertical Coordination: Evidence from The ...

    African Journals Online (AJOL)

    This paper explores the impact on small farmers of several recent investments in the Rwandan coffee supply chain. The purpose of the investments was to modernize the coffee value chain and to promote the production of speciality coffee. A research team surveyed 254 small farmers and 16 washing stations to measure ...

  3. Trade, Standards and Vertical Coordination: Evidence from The ...

    African Journals Online (AJOL)

    Abstract. This paper explores the impact on small farmers of several recent investments in the Rwandan coffee supply chain. The purpose of the investments was to modernize the coffee value chain and to promote the production of speciality coffee. A research team surveyed 254 small farmers and 16 washing stations to ...

  4. Dicty_cDB: VFO725 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available phosphopyruvate hydratase (EC 4.2.1.11) - liver f... 264 1e-69 AM279157_1( AM279157 |pid:none) Echinostoma ...caproni mRNA for enola... 254 9e-67 DQ869009_1( DQ869009 |pid:none) Echinostoma caproni enolase mRNA, ... 25

  5. Photodegradable Toners for Electrophotography III. Accelerated Photodegradation and Suppressed Photocrosslinking of Matrix Resin-Their Dependence on Polymer Composition, UV-light Source, and Irradiation Conditions

    National Research Council Canada - National Science Library

    Sugita, Kazuyuki; Hosoda, Toshiko; Kushida, Masahito; Harada, Kieko; Saito, Kyoichi

    2003-01-01

    .... Clear 1.6μm thick polymer layers coated on glass plates were found to be removed by 2-3 times of repeated cycles of 254nm or 222nm deep ultraviolet irradiation for 3min at 80-120 ° C and brushing-off...

  6. Sustainability analysis of human settelements in South Africa

    CSIR Research Space (South Africa)

    Du Plessis, C

    2002-07-01

    Full Text Available indicators...............................................................................13 2.5.3 Sustainable urban structure and form .................................................................14 2.5.4 Sus tainable c ities... and degradation....................................................................................53 5.3.3 Protec tion of the envir onment .............................................................................54 5.4 Urban form and structure...

  7. Dicty_cDB: Contig-U15656-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ... 254 7e-98 2 ( DD258380 ) METHODS OF IDENTIFYING COMPOUNDS THAT MODULATE A ... 262 8e-98 2 ( AX957039 ) S...NTIFYING COMPOUNDS THAT MODULATE A ... 262 e-134 2 ( CS1...neo-CAT, complete sequence. 262 e-134 2 ( AY569778 ) Cloning vector pPRCG, complete sequence. 262 e-134 2 ( DD258381 ) METHODS OF IDE

  8. Environmental Compliance Assessment System (ECAS).

    Science.gov (United States)

    1993-03-01

    ienphos, Hinosan 2 252. 0-Ethyl S,S-dipropyl phosphorodithioate: Ethoprophos , Mocap, Prophos 253. Ethylene chiorohydrin: 2-chioroethanol 254. Ethyl 4...Phenylmercury acetate: PMA, PMAC 54. 0-Ethyl S.S-dipropyl phosphorodithioate: Ethoprophos . Mocap, Prophos 55. S-2-Ethylthioethyl 0.0-dimethyl

  9. Case, Teacher and School Characteristics Influencing Teachers' Detection and Reporting of Child Physical Abuse and Neglect: Results from an Australian Survey

    Science.gov (United States)

    Walsh, Kerryann; Bridgstock, Ruth; Farrell, Ann; Rassafiani, Mehdi; Schweitzer, Robert

    2008-01-01

    Objective: To identify the influence of multiple case, teacher and school characteristics on Australian primary school teachers' propensity to detect and report child physical abuse and neglect using vignettes as short hypothetical cases. Methods: A sample of 254 teachers completed a self-report questionnaire. They responded to a series of 32…

  10. Evaluation of a UV/Ozone Treatment Process for Removal of MTBE in Groundwater Supplies in New Mexico

    Science.gov (United States)

    EPA’s Office of Research and Development is funding pilot-scale studies on MTBE contaminated groundwater using UV/ozone treatment technology (254 nm UV, 5.8 mg/L ozone). The pilot-scale treatment system consists of a GW well pump, a feed tank, a pretreatment system (water softene...

  11. Supporting Information final.pdf

    Indian Academy of Sciences (India)

    RC

    Materials and apparatus. Spectroscopic grade organic solvents were obtained from Finar Chemicals. Starting and other chemicals and reagents were purchased from Sigma-Aldrich unless otherwise stated and were used without further purification. Thin layer chromatography (TLC) was performed on silica gel 60 F254 ...

  12. Effect of UV radiation on the surface of mammalian immunocompetent cells 2. The change of some surface characteristics of thymus lymphocytes in mice

    Energy Technology Data Exchange (ETDEWEB)

    Krylenkov, V.A.; Malygin, A.M. (AN SSSR, Leningrad. Inst. Tsitologii)

    1983-01-01

    The effect af short-wave (254 nm) and long-wave (365 nm) UV-rays in non-lethal and low lethal doses on thymus cells brings about the increase in the expression of surface markers characteristic of ..beta..-lymphocytes (MBLA-antigens and EAC-receptors) which do not reveal themselves in plasmatic membrane of non-irradiated thymocytes.

  13. Treatment Approach, Autism Severity and Intervention Outcomes in Young Children

    Science.gov (United States)

    Zachor, Ditza A.; Itzchak, Esther Ben

    2010-01-01

    The current study examined the relation between autism severity at baseline, type of intervention employed and outcomes in young children with autism spectrum disorder (ASD). Seventy-eight children with ASD, aged 15-35 months (M=25.4, SD=4.2), received either applied behavioral analysis (ABA) or integration of several intervention approaches…

  14. Analysis of Sensitivity Experiments - An Expanded Primer

    Science.gov (United States)

    2017-03-08

    science. Having terrorized dormitories and classrooms across the country, its late night, torturous study sessions have earned it a dubious “GPA-busting...system (2.5.4) may be solved for the increments by inverting H and multiplying from the left. The inverse 2 x 2 matrix 1−H is easily obtained as long

  15. Shyness and Vocabulary: The Roles of Executive Functioning and Home Environmental Stimulation

    Science.gov (United States)

    Blankson, A. Nayena; O'Brien, Marion; Leerkes, Esther M.; Marcovitch, Stuart; Calkins, Susan D.

    2011-01-01

    Although shyness has often been found to be negatively related to vocabulary, few studies have examined the processes that produce or modify this relation. The present study examined executive functioning skills and home environmental stimulation as potential mediating and moderating mechanisms. A sample of 3 1/2-year-old children (N = 254) was…

  16. QTL list: [PGDBj Registered plant list, Marker list, QTL list, Plant DB link and Genome analysis methods[Archive

    Lifescience Database Archive (English)

    Full Text Available QT75075 Solanum lycopersicum Solanaceae ... Seed quality_germination rate mean germin...ation rate (reciprocal of the mean germination time; MGT-1) 2 ... Chr12 49.5-63.0 2.54 ... 10.1111/j.1365-3040.2011.02463.x 22074055

  17. AcEST: DK951302 [AcEST

    Lifescience Database Archive (English)

    Full Text Available OS=Zea m... 75 3e-12 tr|A5ATK9|A5ATK9_VITVI Putative uncharacterized protein OS=Vitis... 75 3e-12 tr|B6TMJ7|B6TMJ...jct: 193 SESPNKIPEETGYGKYESSKTGLFVKINMDGVPIGRKVDLKACDSYEKLSYAVDDLFRGL 252 Query: 661 VS 666 +S Sbjct: 253 LS 254 >tr|B6TMJ7|B6TMJ

  18. 'A' by Aspergillus terreus through mutation

    African Journals Online (AJOL)

    The highest drug yielding isolate FCBP-58 was subjected to both physical and chemical mutation to increase the biosynthetic capabilities of Cyclosporin 'A'. In this study, mutation was carried out by ultraviolet radiation (254 nm) and alkylating agent ethylmethane sulphonate (EMS). UV 5 min time treatment was proved to be ...

  19. High performance liquid chromatographic determination of ...

    African Journals Online (AJOL)

    STORAGESEVER

    2010-02-08

    Feb 8, 2010 ... benzoxazole]. The derivatisation reaction was conducted in methanol at 60°C using sodium benzoxazole-2-sulphonate under alkaline conditions. The resulting derivative was extracted with chloroform after which the extract was observed under UV lamp at 254 nm before TLC and HPLC analysis. Similarly ...

  20. Comparative pesticidal activity of dichloromethane extracts of Piper ...

    African Journals Online (AJOL)

    Piperine a clinically established pesticide was investigated in the seeds, fruit and leaves of Piper nigrum. The dichloromethane extracts obtained from the parts of the plant were analysed through Thin Layer Chromatography (TLC) using silica gel-GF 254 impregnated aluminium plate and various solvent system consisting ...

  1. Supplimentary Information

    Indian Academy of Sciences (India)

    Elemental analyses (C,H,N) were performed with a Perkin-Elmer 2400 series CHN analyzer. All the reactions were monitored by TLC using 0.25 mm silica gel plates (Merck 60F254 UV indicator) while column chromatography was performed with silica gel (E.Merck India) 60–200 mesh. Starting materials and reagents used ...

  2. Degradation Mechanism of Cyanobacterial Toxin Cylindrospermopsin by Hydroxyl Radicals in Homogeneous UV/H2O2 Process

    Science.gov (United States)

    The degradation of cylindrospermopsin (CYN), a widely distributed and highly toxic cyanobacterial toxin (cyanotoxin), remains poorly elucidated. In this study, the mechanism of CYN destruction by UV-254 nm/H2O2 advanced oxidation process (AOP) was investigated by mass spectrometr...

  3. An overview of cancer research in South African academic and ...

    African Journals Online (AJOL)

    using an adapted Common Scientific Outline (CSO) categorisation. Results. Information was available on 556 cancer research projects. Overall, 301 projects were classified as clinical, 254 as basic science and. 71 as public health research. The most common cancers being researched were cancers of the breast (n=95 ...

  4. Book Review: C.F. Gronum, "Ou Marico" | Kruger | South African ...

    African Journals Online (AJOL)

    C.F. GRONUM Ou Marico Protea Boekhuis, Pretoria 2009. Slapband, 254 pp. ISBN 978-1-86919-299-0. R175. Full Text: EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Article Metrics. Metrics Loading ... Metrics powered by PLOS ALM

  5. Photocatalysis; IV. Preparation and characterization of a stable copper(I) triflate-trans-cycloheptene complex

    NARCIS (Netherlands)

    Evers, J.T.M.; Mackor, A.

    1979-01-01

    When copper(I) triflate·cis‐cycloheptene is irradiated at 254 nm in n‐hexane solution, cis → trans‐isomerization occurs and the stable complex copper (I) triflate·trans‐cycloheptene precipitates. This complex has been isolated, purified and characterized by elemental analysis and by its 1H and 13C

  6. Fishing gear selectivity for Lates niloticus L. , Oreochromis niloticus ...

    African Journals Online (AJOL)

    The concept of maximum sustainable yield on which collapse in the fishery. Similarly, Labeo victorianus. fisheries management .... fishery by reducing predation pressure on the two other. Moles Females. ,—50% maturity—j— |. 254 mm. Proportion of fish caught (°/o). 0 ' 2'0 40 so so “so rzo. Total length of the Nile perch (cml.

  7. Biochemical and quality parameters changes of green sweet bell ...

    African Journals Online (AJOL)

    In this research, the effects of different postharvest treatments on quality and biochemical properties of “Maxibell F1” California Wonder type peppers at green mature stage were determined. In this content, ultraviolet C (UV-C) at 254 nm treatments for 2.5, 5, 10 min and hot water dipping (HWD) treatments for 2 min at 40, 50, ...

  8. 2017-2018 Travel Expense Reports for Stephen McGurk, Vice ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    06-28 to 2017-06-29. Destination(s):. Vancouver. Airfare: $1,301.48. Other. Transportation: $78.00. Accommodation: $254.25. Meals and. Incidentals: $161.19. Other: $0.00. Total: $1,794.92. Comments: 2017-2018 Travel Expense Reports for ...

  9. Employability and lifelong learning in the knowledge society (1/2)

    NARCIS (Netherlands)

    Koper, Rob; Verjans, Steven

    2008-01-01

    Koper, R., & Verjans, S. (Eds.) (2008). Employability and lifelong learning in the knowledge society [special issue]. Campus-Wide Information Systems, 25(4). (Selected papers from the e-portfolio 2007 conference, October, 15-19, 2007, Maastricht, The Netherlands.)

  10. Profile of genetic disorders prevalent in northeast region of Cairo ...

    African Journals Online (AJOL)

    Rabah M. Shawky

    2012-02-04

    Feb 4, 2012 ... Down syndrome. 2523. 74.71. With maternal age >30 years. 1432. 42.40. With maternal age <30 years. 1091. 32.30. Other trisomies. 78. 2.30. Chromosome deletions. 143. 4.23. Sex chromosome abnormalities. 632. 18.72. Turner syndrome. 254. 7.52. Klinefelter syndrome. 130. 3.85. Fragile X syndrome.

  11. Categorizing by Social Dimensions: A Developmental Basis for Stereotyping?

    Science.gov (United States)

    Doyle, Anna-Beth; And Others

    The use by 254 Canadian children of the dimensions of gender, language/ethnicity, and body type as bases of categorization was examined. A developmental approach was taken to see whether a sequence exists in the relative predominance of these dimensions; to examine the relation between the salience of these dimensions and cognitive developmental…

  12. Describing Elementary Certification Methods across the Elementary Music Career Cycle

    Science.gov (United States)

    Svec, Christina L.

    2017-01-01

    The purpose of the study was to describe elementary music method choice and certification method choice overall and across the elementary music career cycle. Participants (N = 254) were categorized as Level I or Elementary Division in a southwestern music education association database. The questionnaire included 25 four-point Likert-type items…

  13. Gclust Server: 84441 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available 84441 NCR_NCU01389 Cluster Sequences Related Sequences(254) 401 conserved hypothetical protein (translation)...1.00e-12 0.0 0.0 0.0 0.0 0.0 12.5 Show 84441 Cluster ID 84441 Sequence ID NCR_NCU01389 Link to cluster

  14. East African Medical Journal - Vol 81, No 5 (2004)

    African Journals Online (AJOL)

    Retinitis pigmentosa in Benin, Nigeria · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. CU Ukponmwan, A Atamah, 254-257. http://dx.doi.org/10.4314/eamj.v81i5.9169 ...

  15. 78 FR 33705 - Postdecisional Administrative Review Process for Occupancy or Use of National Forest System Lands...

    Science.gov (United States)

    2013-06-05

    ..., 222, 228, 241, 251, 254, and 292 RIN 0596-AB45 Postdecisional Administrative Review Process for... encourages informal dispute resolution. Section 214.6(b) in the final rule requires the Responsible Official... informal resolution and appeal rights in an appealable decision. This respondent believed that Responsible...

  16. 76 FR 65965 - Contributions to the Telecommunications Relay Services Fund

    Science.gov (United States)

    2011-10-25

    ... provider shall file such information with the Chief of the Enforcement Bureau's Market Disputes Resolution... Enforcement Bureau's Market Disputes Resolution Division. A paper copy of this designation list shall be...-104, 110 Stat. 56. Interpret or apply 47 U.S.C. 201, 218, 222, 225, 226, 227, 228, 254(k), 616, and...

  17. Data of evolutionary structure change: 1CERA-1VSVC [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1CERA-1VSVC 1CER 1VSV A C -MKVGINGFGRIGRQVFRILHSRG-VEVALINDL-TDNK...GRCAGNNIIPASTGAAKAVGKVIPALNGKLTGMAIRVPTPDVSVVDLTCKLAKPASIEEIYQAVKEASNGPMKGIMGYTSD...ine> VAL CA 434 ALA CA 375 LEU CA 455 1VSV... C 1VSVC ...SP CA 251 ASN CA 309 LYS CA 254 THR CA 266

  18. Data of evolutionary structure change: 1CERA-1VSVA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1CERA-1VSVA 1CER 1VSV A A -MKVGINGFGRIGRQVFRILHSRG-VEVALINDLT-DNK...GRCAGNNIIPASTGAAKAVGKVIPALNGKLTGMAIRVPTPDVSVVDLTCKLAKPASIEEIYQAVKEASNGPMKGIMGYTSD.../line> VAL CA 434 ALA CA 375 LEU CA 455 1VSV... A 1VSVA LYS CA 254 THR CA 266 LEU CA 389 1VSV

  19. Triterpenoids From the Leaves of Olax mannii Oliv. * MISule, HS

    African Journals Online (AJOL)

    was performed with a Hewlett Packard HP 5890 gas chromatography that was equipped with a. 25m fused silica capillary column with dimethylsiloxane CPsil 5CB coupled to a VG analytical 70-250S mass spectrometer. Thin-layer chromatography (TLC) was performed on precoated silica gel 60F254 and spots were.

  20. Does Lecture Capturing Impact Student Performance and Attendance in an Introductory Accounting Course?

    Science.gov (United States)

    Aldamen, Husam; Al-Esmail, Rajab; Hollindale, Janice

    2015-01-01

    The study empirically examines the interplay between lecture capturing viewership, performance and attendance for students in the Middle Eastern country of Qatar. The sample consists of 254 students enrolled in an introductory accounting class either in the Fall semester or in the Spring semester. We show a weak positive relationship between…

  1. M-Rated Video Games and Aggressive or Problem Behavior among Young Adolescents

    Science.gov (United States)

    Olson, Cheryl K.; Kutner, Lawrence A.; Baer, Lee; Beresin, Eugene V.; Warner, Dorothy E.; Nicholi, Armand M., II

    2009-01-01

    This research examined the potential relationship between adolescent problem behaviors and amount of time spent with violent electronic games. Survey data were collected from 1,254 7th and 8th grade students in two states. A "dose" of exposure to Mature-rated games was calculated using Entertainment Software Rating Board ratings of…

  2. Knowledge and Previous Contraceptive Use by Pregnant ...

    African Journals Online (AJOL)

    Information obtained included demographic characteristics, knowledge of and previous use of contraception. Results: Respondents displayed a high level of contraceptive knowledge, as 277 (91.7%) were aware of it. The condom and the combined oral pill were the two contraceptive methods most commonly known, by 254 ...

  3. Sequence Classification: 773280 [

    Lifescience Database Archive (English)

    Full Text Available cted CDS, cell Division Cycle related (cdc-25.4) || http://www.ncbi.nlm.nih.gov/protein/17532605 ... ...Non-TMB Non-TMH Non-TMB Non-TMB Non-TMB Non-TMB >gi|17532605|ref|NP_496197.1| predi

  4. The influence of roughage on the digestibility of whole maize grain ...

    African Journals Online (AJOL)

    as determined during the previous phase (44-day feeding period). The daily feed allowance was divided into two equal. Table 1 Composition of the high protein concentrate. Urea. 28,8. Limestone. 25,4. Dicalcium phosphate. 15,2. Salt. 17,8. Sodium bicarbonate. 5,1. Potassium sulphate. 5,1. Vitamin and mineral premix".

  5. AcEST: DK963372 [AcEST

    Lifescience Database Archive (English)

    Full Text Available nt phospho... 31 4.9 sp|Q4KJX9|AGUA_PSEF5 Agmatine deiminase OS=Pseudomonas fluoresce... 31 4.9 sp|O29443|TR...75%) Frame = +2 Query: 161 SGVVNEDDTPTETANQDDAV 220 S +VNED+TP T N DDAV Sbjct: 235 SVIVNEDETPVATINDDDAV 254 >sp|Q4KJX9|AGUA

  6. The isospin mixing and the superallowed Fermi beta decay

    Indian Academy of Sciences (India)

    Holland,. Amsterdam, 1969) pp. 115–172. [2] I S Towner and J C Hardy, Nucl. Phys. A205, 33 (1973). [3] D H Wilkinson, Phys. Lett. 65B, 9 (1976). [4] J C Hardy and I S Towner, Nucl. Phys. A254, 221 (1975). [5] I S Towner, J C Hardy and M Harvey, ...

  7. The Effect of Academic Advising on Academic Performance of ...

    African Journals Online (AJOL)

    User

    ISSN 2070--0083 (Online). DOI: http://dx.doi.org/10.4314/afrrev.v5i5.26. The Effect of Academic Advising on Academic Performance of University Students in Kenyan Universities. (Pp. 332-345). Muola, J. M. - South Eastern University College, School of Education. P.O. BOX 170 – 90200, KITUI, Kenya. Tel. +254 721 228 621.

  8. Synthesis and antibacterial study of some s-substituted aliphatic ...

    African Journals Online (AJOL)

    biological activities including anticonvulsant, anti- depressant, anti-inflammatory, antifungal, hypoglycemic, antimitotic, ... were developed in solvent system of ethyl acetate and n-hexane and observed under 254 nm UV lamps. ...... considered for drug discovery program by the pharmacological industries. CONCLUSION.

  9. Ontwikkelingsplannen

    NARCIS (Netherlands)

    J. Tinbergen (Jan)

    1967-01-01

    textabstractSeries ‘Wereldakademie’ No. 18. In English: Development Planning, Series World University Library No. 18, Weidenfeld and Nicolson, London, 1967, 256 p. In Spanish: Planificacion del Desarrollo, Series ‘Biblioteca para el Hombre Actual’, Ediciones Guadarrama, Madrid, 1967, 254 p. In

  10. Hollow-Core Fiber Lamp

    Science.gov (United States)

    Yi, Lin (Inventor); Tjoelker, Robert L. (Inventor); Burt, Eric A. (Inventor); Huang, Shouhua (Inventor)

    2016-01-01

    Hollow-core capillary discharge lamps on the millimeter or sub-millimeter scale are provided. The hollow-core capillary discharge lamps achieve an increased light intensity ratio between 194 millimeters (useful) and 254 millimeters (useless) light than conventional lamps. The capillary discharge lamps may include a cone to increase light output. Hollow-core photonic crystal fiber (HCPCF) may also be used.

  11. CATALYTIC STEAM REFORMING OF CHLOROCARBONS: CATALYST COMPARISONS. (R822721C633)

    Science.gov (United States)

    Catalyst candidates for steam reforming chlorocarbons have been screened for activity using methyl chloride as a model reactant. At 500°C, a H2O/C ratio of about 10 and a GHSV of 254 000 h-1, catalysts comprising 0.5% loading of the metals o...

  12. CATALYTIC STEAM REFORMING OF CHLOROCARBONS: CATALYST COMPARISONS. (R826694C633)

    Science.gov (United States)

    Catalyst candidates for steam reforming chlorocarbons have been screened for activity using methyl chloride as a model reactant. At 500°C, a H2O/C ratio of about 10 and a GHSV of 254 000 h-1, catalysts comprising 0.5% loading of the metals ...

  13. Journalists\\' Knowledge of AIDS and Attitude to Persons Living with ...

    African Journals Online (AJOL)

    This study surveyed 254 journalists from the seven media organisations in Ibadan, Nigeria, to assess their knowledge of acquired immune deficiency syndrome (AIDS), attitude to persons living with HIV/AIDS (PLWA) and reports of AIDS-related issues. The journalists\\' overall mean AIDS knowledge score was 10.6 out of 14 ...

  14. Array-CGH detection of three cryptic submicroscopic imbalances in ...

    Indian Academy of Sciences (India)

    patient with a language disorder and mild mental retardation by array-CGH. Am. J. Med. Genet. Part A 129A, 254–260. Zwaigenbaum L., Sonnenberg L. K., Heshka T., Eastwood S. and. Xu J. 2005 A girl with pervasive developmental disorder and complex chromosome rearrangement involving 8p and 10p. J. Autism. Dev.

  15. N-terminal PDZ-like domain of chromatin organizer SATB1 ...

    Indian Academy of Sciences (India)

    and high affinity binding of MARs (Dickinson et al. 1997;. Purbey et al. 2008). Cleavage of SATB1 during T cell apoptosis at position 254 by caspase 6 causes detachment of. SATB1 from the chromatin (Galande et al. 2001). This observation resulted in the identification of an oligomerization domain in the N-terminal of ...

  16. Impact-pressure controlled orientation of shatter cone magnetizations in Sierra Madera, Texas, USA

    Czech Academy of Sciences Publication Activity Database

    Adachi, T.; Kletetschka, Günther

    2008-01-01

    Roč. 52, č. 2 (2008), s. 237-254 ISSN 0039-3169 Institutional research plan: CEZ:AV0Z30130516 Keywords : shatter cones * impact crater * shock fractures * magnetism * Mars Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.770, year: 2008

  17. Photoluminescence properties of Er-doped Ge–In(Ga)–S glasses modified by caesium halides

    Czech Academy of Sciences Publication Activity Database

    Ivanova, Z.G.; Zavadil, Jiří; Kostka, P.; Djouama, T.; Reinfelde, M.

    2017-01-01

    Roč. 254, č. 6 (2017), č. článku 1600662. ISSN 0370-1972 Institutional support: RVO:67985882 Keywords : caesium halides * chalcohalide glass es * erbium doping * transmission spectroscopy * photoluminiscence Subject RIV: JH - Ceramics, Fire-Resistant Materials and Glass Impact factor: 1.674, year: 2016

  18. Photoluminescence properties of Er-doped Ge–In(Ga)–S glasses modified by caesium halides

    Czech Academy of Sciences Publication Activity Database

    Ivanova, Z.G.; Zavadil, Jiří; Kostka, Petr; Djouama, T.; Reinfelde, M.

    2017-01-01

    Roč. 254, č. 6 (2017), č. článku 1600662. ISSN 0370-1972 Institutional support: RVO:67985891 Keywords : caesium halides * chalcohalide glass es * erbium doping * transmission spectroscopy * photoluminiscence Subject RIV: JH - Ceramics, Fire-Resistant Materials and Glass Impact factor: 1.674, year: 2016

  19. Impact of a Library Instruction Session on Bibliographies of Organic Chemistry Students

    Science.gov (United States)

    Kromer, John

    2015-01-01

    Students in Chemistry 254: Organic Chemistry for Majors were required to write a paper about an organic name reaction. Before turning in this assignment, students had the option of attending a one-hour library instruction session covering SciFinder, sources for spectra, ACS Style, and print resources about organic name reactions. Twenty-five…

  20. Preschool Gifted Education: Perceived Challenges Associated with Program Development

    Science.gov (United States)

    Kettler, Todd; Oveross, Mattie E.; Salman, Rania C.

    2017-01-01

    This descriptive study investigated the challenges related to implementing gifted education services in preschool centers. Participants were 254 licensed preschool center directors in a southern state. Participants completed a researcher-created survey including both selected response items and constructed response items to examine the perceived…

  1. Regional cerebral blood flow in focal cortical epilepsy

    DEFF Research Database (Denmark)

    Hougaard, Kristina Dupont; Oikawa, T; Sveinsdottir, E

    1976-01-01

    Regional cerebral blood flow (rCBF) was studied in ten patients with focal cortical epilepsy. The blood flow was measured by the intra-arterial injection of xenon 133 (133Xe), and the isotope clearance was recorded by a multidetector scintillation camera with 254 detectors. Three patients were st...

  2. Regional cerebral blood flow in various types of brain tumor. Effect of the space-occupying lesion on blood flow in brain tissue close to and remote from tumor site

    DEFF Research Database (Denmark)

    Kuroda, K; Skyhøj Olsen, T; Lassen, N A

    1982-01-01

    Regional cerebral blood flow (rCBF) was measured in 23 patients with brain tumors using the 133Xe intra-carotid injection method and a 254 channel gamma camera. The glioblastomas (4) and astrocytomas (4) all showed hyperemia in the tumor and tumor-near region. This was also seen in several...

  3. Obstructive right paraduodenal hernia: A case report

    African Journals Online (AJOL)

    surgical management of paraduodenal hernia. Ann. Surg. 1968; 168: 249-254. 8. Surgery: Scientific principles and practice – Lipincott and Raven: Second edition, Lazar J. Greenfield. 1997. 9. Sinohara T., Okugawa K. and Furuta C. Volvulus of the small intestine caused by right paraduodenal hernia. J. Pediat. Surg. 2004 ...

  4. Gclust Server: 202095 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available 202095 Bja_blr4840 Cluster Sequences - 254 hypothetical protein 1 1.00e-99 0.0 0.0 0.0 0.0 3.23 0.0 Show...Show 202095 Cluster ID 202095 Sequence ID Bja_blr4840 Link to cluster sequences Cluster Sequences Link

  5. Hemopoietic stem cells in rhesus monkeys : surface antigens, radiosensitivity, and responses to GM-CSF

    NARCIS (Netherlands)

    J.J. Wielenga (Jenne)

    1990-01-01

    textabstractRhesus monkeys (Macaca mulatta) were bred at the Primate Center TNO, Rijswijk, The Netherlands!. Both male and female animals were used for the experiments. The monkeys weighed 2.5-4 kg and were 2-4 years old at the time of the experiment. They were all typed for RhLA-A, -B and -DR

  6. Marang: Journal of Language and Literature: Submissions

    African Journals Online (AJOL)

    2006-10-25

    Literacy, ethnolinguistic diversity, and transitional bilingual education in Malawi. International Journal of Bilingual Education and Bilingualism, 9 (2), 239-254. Brians, P. (n.d.). Chinua Achebe: Things Fall Apart study guide. RetrievedOctober 25, 2006, from http://www.wsu.edu:8000/~brians/anglophone/achebe.html. TABLES.

  7. Long-Term Effects of Bereavement and Caregiver Intervention on Dementia Caregiver Depressive Symptoms

    Science.gov (United States)

    Haley, William E.; Bergman, Elizabeth J.; Roth, David L.; McVie, Theresa; Gaugler, Joseph E.; Mittelman, Mary S.

    2008-01-01

    Purpose: The purpose of this study was to examine the joint effects of bereavement and caregiver intervention on caregiver depressive symptoms. Design and Methods: Alzheimer's caregivers from a randomized trial of an enhanced caregiver support intervention versus usual care who had experienced the death of their spouse (n = 254) were repeatedly…

  8. State Education Finance and Governance Profile: Arkansas

    Science.gov (United States)

    Zhang, Chi

    2010-01-01

    This article presents the state education finance and governance profile of Arkansas. Arkansas has 254 school districts, which operate 1,114 schools. More than two thirds (68.4%) of all schools are Title I schools. All school districts in Arkansas receive foundation funding--a set amount of money per student. In addition to the foundation funding…

  9. Charge densities and charge noise in mesoscopic conductors

    Indian Academy of Sciences (India)

    February 2002 physics pp. 241–257. Charge densities and charge noise in mesoscopic conductors ... the charge noise [6] based on the scattering approach. Similar to the discussion of linear ...... a novel resistance which determines the dissipative effects in charging and decharging a. 254. Pramana – J. Phys., Vol. 58, No.

  10. Adlai E. Stevenson High School Bilingual Education and Career Awareness Program 1984-1985. OEA Evaluation Report.

    Science.gov (United States)

    New York City Board of Education, Brooklyn. Office of Educational Assessment.

    The Bilingual Education and Career Awareness Program (BECA) at Adlai E. Stevenson High School, The Bronx, completed the second of its 3-year funding cycle in June 1985. BECA offered a bilingual academic program with a business-technology (industrial arts) emphasis to 254 Hispanic ninth through twelfth graders of limited English proficiency (LEP)…

  11. The use of Pin-In-Plaster Technique in The Management of ...

    African Journals Online (AJOL)

    RESULT: A total of 565 patients were treated for complex open tibial fractures within this period. Eighty-five (15%) of this were treated using Pin-in-plaster method while 25(4%) had conventional External fixation. Others were treated with Traction and or POP application. One hundred patients (18%) left against Medical ...

  12. Integrating Moral and Social Development within Middle School Social Studies: A Social Cognitive Domain Approach

    Science.gov (United States)

    Nucci, Larry; Creane, Michael W.; Powers, Deborah W.

    2015-01-01

    Eleven teachers and 254 urban middle-school students comprised the sample of this study examining the social and moral development outcomes of the integration of social cognitive domain theory within regular classroom instruction. Participating teachers were trained to construct and implement history lessons that stimulated students' moral…

  13. Dissolved organic matter removal using magnetic anion exchange resin treatment on biological effluent of textile dyeing wastewater.

    Science.gov (United States)

    Fan, Jun; Li, Haibo; Shuang, Chendong; Li, Wentao; Li, Aimin

    2014-08-01

    This study investigated the removal of dissolved organic matter (DOM) from real dyeing bio-treatment effluents (DBEs) with the use of a novel magnetic anion exchange resin (NDMP). DOMs in two typical DBEs were fractionized using DAX-8/XAD-4 resin and ultrafiltration membranes. The hydrophilic fractions and the low molecular weight (MW) (50%) of DOMs for the two effluents. The hydrophilic and low MW fractions of both effluents were the greatest contributors of specific UV254 absorbance (SUVA254), and the SUVA254 of DOM fractions decreased with hydrophobicity and MW. Two DBEs exhibited acute and chronic biotoxicities. Both acute and chronic toxicities of DOM fractions increased linearly with the increase of SUVA254 value. Kinetics of dissolved organic carbon (DOC) removal via NDMP treatment was performed by comparing it with that of particle active carbon (PAC). Results indicated that the removal of DOC from DBEs via NDMP was 60%, whereas DOC removals by PAC were lower than 15%. Acidic organics could be significantly removed with the use of NDMP. DOM with large MW in DBE could be removed significantly by using the same means. Removal efficiency of NDMP for DOM decreased with the decrease of MW. Compared with PAC, NDMP could significantly reduce the acute and chronic bio-toxicities of DBEs. NaCl/NaOH mixture regenerants, with selected concentrations of 10% NaCl (m/m)/1% NaOH (m/m), could improve desorption efficiency. Copyright © 2014. Published by Elsevier B.V.

  14. Social Constructivism and the "Believing Game": A Mathematics Teacher's Practice and Its Implications

    Science.gov (United States)

    Harkness, Shelly Sheats

    2009-01-01

    The study reported here is the third in a series of research articles (Harkness, S. S., D'Ambrosio, B., & Morrone, A. S., in "Educational Studies in Mathematics" 65:235-254, 2007; Morrone, A. S., Harkness, S. S., D'Ambrosio, B., & Caulfield, R. in "Educational Studies in Mathematics" 56:19-38, 2004) about the teaching practices of the same…

  15. Cyberbullying and Victimisation among Turkish University Students

    Science.gov (United States)

    Akbulut, Yavuz; Eristi, Bahadir

    2011-01-01

    This study investigated the extent of cyberbullying and victimisation among Turkish university students at a state college of education. A personal information form and 56 scaled items were administered to 254 students. Items addressing cyberbullying victimisation were adopted from a recent study, whereas parallel cyberbullying items were…

  16. 22 CFR 145.16 - Resource Conservation and Recovery Act.

    Science.gov (United States)

    2010-04-01

    ... Section 145.16 Foreign Relations DEPARTMENT OF STATE CIVIL RIGHTS GRANTS AND AGREEMENTS WITH INSTITUTIONS...-580 codified at 42 U.S.C. 6962), any State agency or agency of a political subdivision of a State...-254). Accordingly, State and local institutions of higher education, hospitals, and non-profit...

  17. 32 CFR 32.49 - Resource Conservation and Recovery Act.

    Science.gov (United States)

    2010-07-01

    ... AGREEMENT REGULATIONS ADMINISTRATIVE REQUIREMENTS FOR GRANTS AND AGREEMENTS WITH INSTITUTIONS OF HIGHER...) (section 6002, Pub. L. 94-580, 42 U.S.C. 6962), any State agency or agency of a political subdivision of a... parts 247-254). Accordingly, State and local institutions of higher education, hospitals, and non-profit...

  18. 38 CFR 49.16 - Resource Conservation and Recovery Act (RCRA).

    Science.gov (United States)

    2010-07-01

    ... AFFAIRS (CONTINUED) UNIFORM ADMINISTRATIVE REQUIREMENTS FOR GRANTS AND AGREEMENTS WITH INSTITUTIONS OF... agency or agency of a political subdivision of a State which is using appropriated Federal funds must... Environmental Protection Agency (EPA) (40 CFR parts 247-254). Accordingly, State and local institutions of...

  19. 15 CFR 14.16 - Resource Conservation and Recovery Act (RCRA).

    Science.gov (United States)

    2010-01-01

    ... ADMINISTRATIVE REQUIREMENTS FOR GRANTS AND AGREEMENTS WITH INSTITUTIONS OF HIGHER EDUCATION, HOSPITALS, OTHER NON... Act (RCRA). Under RCRA (Pub. L. 94-580, 42 U.S.C. 6962), any State agency or agency of a political... parts 247-254). Accordingly, State and local institutions of higher education, hospitals, non-profit...

  20. 14 CFR 1260.116 - Resource Conservation and Recovery Act (RCRA).

    Science.gov (United States)

    2010-01-01

    ... Agreements With Institutions of Higher Education, Hospitals, and Other Non-Profit Organizations Pre-Award... at 42 U.S.C. 6962), any State agency or agency of a political subdivision of a State which is using... parts 247 through 254). Accordingly, State and local institutions of higher education, hospitals, and...

  1. 45 CFR 74.16 - Resource Conservation and Recovery Act (RCRA, Section 6002 of Pub. L. No. 94-580 (Codified at 42...

    Science.gov (United States)

    2010-10-01

    ... AND SUBAWARDS TO INSTITUTIONS OF HIGHER EDUCATION, HOSPITALS, OTHER NONPROFIT ORGANIZATIONS, AND... a political subdivision of a State which is using appropriated Federal funds must comply with... Environmental Protection Agency (EPA) (40 CFR parts 247-254). Accordingly, State and local institutions of...

  2. CPAP Tips

    Medline Plus

    Full Text Available ... my first night using a CPAP machine - Duration: 9:28. Heidi Willbanks 362,656 views 9:28 How CPAP works 5_23_11.wmv - ... 802 views 20:58 CPAP Machine Review - Duration: 9:35. Ali Thompson 34,254 views 9:35 ...

  3. Composing Effective Environments for Concept Exploration in a Multi-Agency Context

    Science.gov (United States)

    2011-01-01

    Danish Defence College Sandeep Mulgund (USA), The MITRE Corporation Mark Nissen (USA), Naval Postgraduate School Mink Spaans (NLD), TNO Defence...Greenwood, J. D. 1983. Role Playing as an Experimental Strategy in Social Psychology. European Journal of Social Psychology 13(3): 235-254. Henrich, J

  4. ClEST cluster :Cl_singleton1840 [ClEST

    Lifescience Database Archive (English)

    Full Text Available Cl_singleton1840 signal recognition particle 9 kda Cimex lectularius nuclear gene 254 GAGTTGATTTCTCT...TTGC mb02088 1 PREDICTED: signal recognition particle 9 kDa protein [Apis mellifera] XP_001120520 2.7055E-10

  5. All projects related to south africa | Page 7 | IDRC - International ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Topic: SOCIAL WELFARE, SOCIAL SECURITY, HOUSEHOLD INCOME, YOUTH UNEMPLOYMENT. Region: South Africa, South of Sahara. Program: Employment and Growth. Total Funding: CA$ 254,300.00. Ecology of Access to Educational Material in Developing World Universities. Project. The longstanding crisis of the ...

  6. Pramana – Journal of Physics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Pramana – Journal of Physics. Neeraj Sinha. Articles written in Pramana – Journal of Physics. Volume 59 Issue 2 August 2002 pp 243-254. Developments in quantum information processing by nuclear magnetic resonance: Use of quadrupolar and dipolar couplings · Anil Kumar K V Ramanathan T S ...

  7. Pramana – Journal of Physics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Pramana – Journal of Physics. T S Mahesh. Articles written in Pramana – Journal of Physics. Volume 59 Issue 2 August 2002 pp 243-254. Developments in quantum information processing by nuclear magnetic resonance: Use of quadrupolar and dipolar couplings · Anil Kumar K V Ramanathan T S Mahesh ...

  8. 77 FR 74193 - Request for Information on Edel-Kindwall Caisson Tables for Preventing Decompression Illness in...

    Science.gov (United States)

    2012-12-13

    ... submitting comments can be found at: http://www.regulations.gov . NIOSH includes all comments received... be formatted as Microsoft Word. Please make reference to CDC 2012-0012 and docket number NIOSH-254... projects. Compressed air is used to prevent seepage of water or to stabilize unstable soil conditions...

  9. Assessment of Body Weight Standards in Male and Female Army Recruits

    Science.gov (United States)

    1989-12-29

    217-225. 41. Malcom GT, AK Bhattacharyya, M Velez -Duran, MA Guzman, MC Oalmann, JP Strong (1989). Fatty acid composition of adipose tissue In humans...77 ----------------- 151 254 267 267 2C4 256 2488 . . ------- -153 260 275 273 271 4 Tnble 11. Ta~o!e o ita -ity Arreptable Weight (in Potinds) as

  10. Prédétermination des débits de crue par différentes méthodes. Cas ...

    African Journals Online (AJOL)

    [4] Toutain C., 2001. Prévenir les catastrophes naturelles ? Ed. Milan : les Essentiels. 64 p. [5] Veyret Y., Meschinet de Richemond N., Garry G., 2004. Risques naturels et aménagement en Europe. Ed. Armand Colin,. 254 p. [6] Veyret-Mekdjian Y., 2001. Géographie des risques naturels. Ed. La Documentation Française.

  11. Okonji et al (6).cdr

    African Journals Online (AJOL)

    Timothy Ademakinwa

    Purification of tapioca leaf rhodanese. Phytochemistry15: 1343-1344. Bradford, K. M. 1976. A rapid and sensitive method for the quantitation of micrograme quantities of protein utilizing the principle of protein-dye binding. Analytical Biochemistry 72: 248-254. Broderick, K., Potluri, P., Zhuang, S., Scheffer,. I., Sharma, V., Pilz, ...

  12. Trajectory Control and Optimization for Responsive Spacecraft

    Science.gov (United States)

    2012-03-22

    ν = L− tan−1 ( h k ) (2.53) Kepler’s equation in terms of equinoctial elements is derived directly from the classical Kepler equation (2.54) using the...dospectral Methods . 35. Escobal, P. R., Methods of Orbit Determination, John Wiley & Sons, Inc, 1965. 36. Larson, W. J. and Wertz, J. R., editors, Space

  13. 7 CFR 51.1164 - Fairly well colored.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 2 2010-01-01 2010-01-01 false Fairly well colored. 51.1164 Section 51.1164... STANDARDS) United States Standards for Grades of Florida Oranges and Tangelos Definitions § 51.1164 Fairly... aggregate area of green color which does not exceed the area of a circle 1 inch (25.4 mm) in diameter, the...

  14. File list: ALL.Neu.50.AllAg.Hypothalamus [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available ALL.Neu.50.AllAg.Hypothalamus mm9 All antigens Neural Hypothalamus SRX956253,SRX956...254 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/ALL.Neu.50.AllAg.Hypothalamus.bed ...

  15. File list: ALL.Neu.20.AllAg.Hypothalamus [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available ALL.Neu.20.AllAg.Hypothalamus mm9 All antigens Neural Hypothalamus SRX956253,SRX956...254 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/ALL.Neu.20.AllAg.Hypothalamus.bed ...

  16. File list: Unc.Neu.20.AllAg.Hypothalamus [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Unc.Neu.20.AllAg.Hypothalamus mm9 Unclassified Neural Hypothalamus SRX956253,SRX956...254 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/Unc.Neu.20.AllAg.Hypothalamus.bed ...

  17. File list: ALL.Neu.10.AllAg.Hypothalamus [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available ALL.Neu.10.AllAg.Hypothalamus mm9 All antigens Neural Hypothalamus SRX956253,SRX956...254 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/ALL.Neu.10.AllAg.Hypothalamus.bed ...

  18. File list: Unc.Neu.10.AllAg.Hypothalamus [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Unc.Neu.10.AllAg.Hypothalamus mm9 Unclassified Neural Hypothalamus SRX956253,SRX956...254 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/Unc.Neu.10.AllAg.Hypothalamus.bed ...

  19. File list: Unc.Neu.50.AllAg.Hypothalamus [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Unc.Neu.50.AllAg.Hypothalamus mm9 Unclassified Neural Hypothalamus SRX956253,SRX956...254 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/Unc.Neu.50.AllAg.Hypothalamus.bed ...

  20. Improved detectability of barbiturates in high-performance liquid chromatography by pre-column labelling and ultraviolet detection

    NARCIS (Netherlands)

    Hulshoff, A.; Roseboom, H.; Renema, J.

    1979-01-01

    2-Naphthacyl derivatives of barbiturates are formed in acetone at 30° within 30 min, in an essentially quantitative manner, using caesium carbonate as a catalyst. These derivatives absorb UV radiation strongly at 254 nm. Using a variable-wavelength detector set at 249 nm, 1 ng of

  1. 77 FR 11600 - Agency Forms Submitted for OMB Review, Request for Comments

    Science.gov (United States)

    2012-02-27

    ... Management and Budget (OMB). Our ICR describes the information we seek to collect from the public. Review and... work activity and/or recent medical history warrants completion of Form G-254 for a more extensive... . Charles Mierzwa, Chief of Information Resources Management. BILLING CODE 7905-01-P ...

  2. Patterns of regional cerebral blood flow in acute stroke

    DEFF Research Database (Denmark)

    Olsen, T S; Skriver, E B

    1981-01-01

    In a consecutive group of 56 stroke patients the regional cerebral blood flow was measured within 84 hours after stroke. A 254 multidetector scintillation camera and the intracarotid Xenon-133 injection method was used to study rCBF. Typical rCBF-patterns are described and compared to the findings...

  3. Data of evolutionary structure change: 1OZHA-1UPCB [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1OZHA-1UPCB 1OZH 1UPC A B VRQWAHGADLVVSQLEAQGVRQVFGIPGAKIDKVFDSLL...>B 1UPCB LLGSSEGIDTPNPP HH... ASP CA 254 1UPC B 1UPCB...MET CA 330 1UPC B 1UPCB.../pdbID> B 1UPCB WQKGIEKKTVR

  4. Evaluation of Capsicum as a Source of Natural Antioxidant in ...

    African Journals Online (AJOL)

    These residues were tested on sunflower oil to evaluate their antioxidant effects. The accelerated methods used for oxidation were the Automated Rancimat, Oven heating and UV light at 254 nm. The oxidation of sunflower oil was measured using changes in peroxide values and the UV absorbances (Conjugated diene) at ...

  5. An Investigation of Social Skills in Children with Different Perfectionism Levels

    Science.gov (United States)

    Arslan, Emel

    2011-01-01

    The purpose of this study is to analyze social skills in children with different perfectionism. The participants were 514 (254 females and 260 males) elementary school students. Data were collected from "multidimensional perfectionism scale" and "Matson evaluation of social skills with youngsters". In order to analyze data, t…

  6. Burnout and health of primary school educators in the North West ...

    African Journals Online (AJOL)

    Burnout and health of primary school educators in the North West Province. Amanda Montgomery, Karina Mostert, Leon Jackson. Abstract. No Abstract. South African journal of Education Vol. 25(4) 2005: 266-272. Full Text: EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL ...

  7. hypertension among dental patients attending tertiary

    African Journals Online (AJOL)

    Introduction: Hypertension is one of the cardiovascular diseases which has been reported as one of the ... Acute periapical periodontitis and chronic .... disease in Sweden. J clin Periodontal. 2002 ;. 29(3): 254-9. Ogawa Y. Imaki M, Yoshida Y, Matsumoto. M, Tanada S. Epidemidogical study on the relationship between ...

  8. Association between Cigarette Smoking and Metabolic Syndrome in ...

    African Journals Online (AJOL)

    Purpose: To investigate the relationship between metabolic syndrome as defined by using the modified NCEP/ATP III criteria [modified the National Cholesterol Education Program (NCEP)/Adult Treatment Panel III (ATP III) criteria] and cigarette smoking in Thai subjects. Methods: This study was carried out among 254 ...

  9. 88 Rama Mohana Rao Chilumuru1*, Cyril Arun Kumar Lakkineni2 ...

    African Journals Online (AJOL)

    2013-06-06

    Jun 6, 2013 ... cyclohexane (5:95 v/v) as mobile phase. The flow rate was 1.0 ml/min and eluent was monitored at. 254 nm. The retention time of cypermethrin was. 5.35 min. Under the optimized experimental conditions ... are applied directly to the soil in powder form or sprayed over crop fields in liquid form and hence.

  10. 49 CFR 571.216a - Standard No. 216a; Roof crush resistance; Upgraded standard.

    Science.gov (United States)

    2010-10-01

    ... S7.1 through S7.6. S7.1Support the vehicle off its suspension and rigidly secure the sills and the... is parallel to the vertical plane through the vehicle's longitudinal centerline; (b) Its transverse... the lower surface of the test device is within 10 mm of the transverse vertical plane 254 mm forward...

  11. Examining the Relationship between Teacher Leadership Culture and Teacher Professionalism: Quantitative Study

    Science.gov (United States)

    Parlar, Hanifi; Cansoy, Ramazan; Kilinç, Ali Çagatay

    2017-01-01

    The aim of this study was to examine the relationships between schools' levels of having teacher leadership culture and teachers' professional behaviors. A total of 254 teachers working in primary and secondary schools located in Üsküdar district of Istanbul province participated in the study. The "Teacher Leadership Culture Scale" and…

  12. International Students' Motivation and Learning Approach: A Comparison with Local Students

    Science.gov (United States)

    Chue, Kah Loong; Nie, Youyan

    2016-01-01

    Psychological factors contribute to motivation and learning for international students as much as teaching strategies. 254 international students and 144 local students enrolled in a private education institute were surveyed regarding their perception of psychological needs support, their motivation and learning approach. The results from this…

  13. 78 FR 64237 - Information Collection: General and Oil and Gas Production Requirements in the Outer Continental...

    Science.gov (United States)

    2013-10-28

    ... time, bottomhole temperature, kelly bushing elevation; and bottomhole pressure points that consist of... royalty interest (Form BOEM-0140, Bottomhole Pressure Survey Report). Specifically, BOEM uses the... burden annual responses hours 1153 Conduct static 14 1,161 surveys.... 16,254 bottomhole pressure survey...

  14. Integrating AR services for the masses: geotagged POI transformation platform

    Czech Academy of Sciences Publication Activity Database

    Trojan, Jakub

    2016-01-01

    Roč. 7, č. 3 (2016), s. 254-265 ISSN 1757-9880 Institutional support: RVO:68145535 Keywords : augmented reality * location-based services * geotagging * points of interest Subject RIV: DE - Earth Magnetism, Geodesy, Geography http://dx.doi.org/10.1108/JHTT-07-2015-0028

  15. Making a Difference : Measuring the Impact of Information on ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Making a Difference : Measuring the Impact of Information on Development. Couverture du livre Making a Difference : Measuring the Impact of Information on Development. Directeur(s) : Paul McConnell. Maison(s) d'édition : CRDI. 1 janvier 1995. ISBN : Épuisé. 254 pages. e-ISBN : 1552502996. Téléchargez le PDF.

  16. Effects of Participation in a Martial Arts-Based Antibullying Program in Elementary Schools

    Science.gov (United States)

    Twemlow, Stuart W.; Biggs, Bridget K.; Nelson, Timothy D.; Vernberg, Eric M.; Fonagy, Peter; Twemlow, Stephen W.

    2008-01-01

    This study evaluated the Gentle Warrior Program, a traditional martial arts-based intervention to reduce aggression in children, as it was implemented in three elementary schools. The sample consisted of 254 children in grades 3, 4, and 5 who participated in the Gentle Warrior Program as part of a larger school violence intervention. Results…

  17. African Crop Science Journal - Vol 21, No 3 (2013)

    African Journals Online (AJOL)

    ... involved in a 6x6 complete diallel crossing system based on typological approach. EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. AE Issali, AE Badou Nguessan, DF Thiemele, A Amoncho, SB Ngoran Koua, HC Keassemon Kone, ZEB Koffi, A Sangare, 245-254 ...

  18. Inactivation of avirulent Yersinia pestis on food and food contact surfaces by ultraviolet light and freezing

    Science.gov (United States)

    Yersinia pestis, the causative agent of plague, can occasionally be contracted as a naso-pharangeal or gastrointestinal illness through consumption of contaminated meat. In this study, the use of 254 nm ultraviolet light (UV-C) to inactivate a multi-isolate cocktail of avirulent Y. pestis on food an...

  19. Testing a Model Linking Environmental Hope and Self-Control with Students' Positive Emotions and Environmental Behavior

    Science.gov (United States)

    Kerret, Dorit; Orkibi, Hod; Ronen, Tammie

    2016-01-01

    This study examined a moderated mediation model with 254 Israeli junior high school students, hypothesizing that students' environmental hope would simultaneously mediate the relationship between their engagement in school-based environmental activities (green engagement) and their environmental behavior as well as their positivity ratio, but that…

  20. 76 FR 80988 - Proposed Collection; Comment Request

    Science.gov (United States)

    2011-12-27

    ...) of the Railroad Unemployment Insurance Act (RUIA), the Railroad Retirement Board (RRB) is entitled to... respondent. The RRB proposes no changes to the forms in the collection. Estimate of Annual Respondent Burden... editorial and formatting changes. Form G-254a, Continuing Disability Update Report, is used to help identify...

  1. Ultraviolet-visible absorptive features of water extractable and humic fractions of animal manure and compost

    Science.gov (United States)

    UV-vis spectroscopy is a useful tool for characterizing water extractable or humic fractions of natural organic matter (WEOM). Whereas the whole UV-visible spectra of these fractions are more or less featureless, the specific UV absorptivity at 254 and 280 nm as well as spectral E2/E3 and E4/E6 rat...

  2. Recommendations from the White House Conference on Children and Youth for Home Economics Teachers on the Family Today. Part I.

    Science.gov (United States)

    Simpson, Elizabeth, Ed.; Manning, Doris, Ed.

    Many of the recommendations of the 1960 White House Conference on Children and Youth have implications for home economics education, and 14 relevant recommendations form the basis for this publication and for Part II, available as VT 005 254. This document, Part I, contains four articles on family problems which affect school-age members. Each…

  3. 1454-IJBCS-Article-Ngokam David

    African Journals Online (AJOL)

    hp

    coupling constants (J) are given in Hertz. HR-. ESI-MS experiments were performed using a. Micromass Q-TOF micro instrument. (Manchester, UK) with an electrospray source. Column chromatography was run on. Merck silica gel 60 and Sephadex LH-20 while TLC was carried out on silica gel GF254 precoated plates with ...

  4. A Molluscicidal Triterpenoid Saponin from the Fruits of Napoleonaea ...

    African Journals Online (AJOL)

    Michael Horsfall

    the isolation and structural elucidation of. Napoleonaside [1], a new molluscicidal saponin of N. imperialis is reported. EXPERIMENTAL. General: TLC was carried out on Kieselgel 60 F254 precoated glass sheets (Merck) with CHCl3-MeOH-. H2O (4:2:1). Detection was by spraying with 50% aqueous H2SO4 followed by ...

  5. Romantic Relationship Aggression and Attitudes in High School Students: The Role of Gender, Grade, and Attachment and Emotional Styles.

    Science.gov (United States)

    Feiring, Candice; Deblinger, Esther; Hoch-Espada, Amy; Haworth, Tom

    2002-01-01

    Examined use of aggressive behaviors in adolescent romantic relationships, the endorsement of attitudes that promote such behaviors, and the extent to which attachment and emotional styles are related to these behaviors and styles in 254 high school students. As expected, girls were somewhat more likely to report being the perpetrator of physical…

  6. Experiment list: SRX105458 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available ROGENITOR CELLS that have migrated to the THYMUS where they differentiate into T-LYMPHOCYTES. Thymocytes are classified into maturati...onal stages based on the expression of CELL SURFACE ANTIGENS. 9645968,97.1,72.6,254

  7. An Analysis of the National Defense Reserve Fleet, the Ready Reserve Force Component and Their Capability to Meet National Emergency.

    Science.gov (United States)

    1979-09-01

    pumps) 6. Main Engine (turbine, reduction gears, throttle) 7. Refrigeration (domestic reefer boxes, main refrigeration system) 8. Piping (salt water...F.P. 276.5’ Passengers 12 Crew 58 Grain Cubic 837,305 Cu. ft. Bale Cubic 736,723 Cu. ft. Reefer Cubic 30,254 Cu. ft. — Fuel Oil (D.B.’s+Settlers) 2,652

  8. Contribution of time of drinking onset and family history of alcohol problems in alcohol and drug use behaviors in Argentinean college students

    National Research Council Canada - National Science Library

    Pilatti, Angelina; Caneto, Florencia; Garimaldi, Javier Alejandro; Vera, Belén Del Valle; Pautassi, Ricardo Marcos

    2014-01-01

    ...-related problems and substance use. Participants were college students (60.3% females, mean age = 20.27 ± 2.54 years) from the city of Córdoba, Argentina. Several measures were used to assess alcohol, tobacco and drug use...

  9. Influence of the surface structure on the filtration performance of UV-modified PES membranes

    DEFF Research Database (Denmark)

    Kæselev, Bozena Alicja; Kingshott, P.; Jonsson, Gunnar Eigil

    2002-01-01

    Poly (ether sulfone) (PES) 50 kDa membranes were surface modified by irradiation with UV light (254 nm) in the presence of N-vinyl-2-pyrrolidine (NVP), 2-acrylamidoglycolic acid monohydrate (AAG) and 2-acrylamido-2-methyl-1-propanesulfonic acid (AAP). The surfaces of the modified membranes were c...

  10. Optimal seeding depth of five forb species from the Great Basin

    Science.gov (United States)

    Jennifer K. Rawlins; Val J. Anderson; Robert Johnson; Thomas Krebs

    2009-01-01

    Use of forbs in revegetation projects in the Great Basin is limited due to high seed cost and insufficient understanding of their germination and establishment requirements. We tested the effects of seeding depth from 0 to 25.4 mm (1 in) on emergence and survival in clay and sandy loam soils of 5 ecologically important forbs. Significantly less emergence occurred of...

  11. Examining the Relationship between Self-Esteem, Mattering, School Connectedness, and Wellness among Middle School Students

    Science.gov (United States)

    Watson, Joshua C.

    2018-01-01

    With data collected from 254 middle grade (5-8) students enrolled in a rural, southern school district, this study sought to determine the influence of self-esteem, mattering, and school connectedness on students' overall wellness. Using a two-step hierarchical multiple regression analysis, the author found that school connectedness significantly…

  12. crushed concrete as a source of aggregate for new concrete

    African Journals Online (AJOL)

    Engr. Dr. F.O. Okafor

    KEYWORDS: Waste Concrete; Recycled Aggregate; Workability, Compressive Strength. ... better methods of solid waste disposal and probably energy ... Specific gravity. Water absorption, (%). Aggregate crushing value, (%). 2.65. 0.21. 22.52. 2.49. 3.67. 29.86. Grading (% by weight passing sieve size stated). 25.4 mm.

  13. Gas and surface diffusion in modified γ-alumina systems

    NARCIS (Netherlands)

    Uhlhorn, R.J.R.; Keizer, Klaas; Burggraaf, A.J.

    1989-01-01

    The transport of pure gases through a microporous membrane is described. The alumina-based membrane (pores 2.5-4 nm) is suitable for Knudsen diffusion separation. To improve the separation factor, interaction with and mobility on the pore wall of one of the gases of a mixture is necessary. To

  14. La gestation chez le rat wistar a-t-elle un effet modérateur sur la ...

    African Journals Online (AJOL)

    mm

    Contemporary endocrinology, 233-254. [44] Toran-Allerand C.D., 1996. Mechanisms of estrogen action during neural development: mediation by interactions with the neurotrophins and their receptors? J. Steroid. Biochem. Mol. Biol., Vol. 56, 169-78. [45] De Nicola A.F., 1993. Steroid Hormones and. Neuronal Regeneration.

  15. Norma tulemuste taga on eksport Venemaale / Virge Lahe

    Index Scriptorium Estoniae

    Lahe, Virge

    2008-01-01

    Autode turvavarustuse tootja AS-i Norma teise kvartali puhaskasum oli 25,4 miljonit krooni, mis on kaks korda enam kui 2007. aasta teises kvartalis, edaspidi võib kasumit survestada terasehinna tõus. Diagramm: Norma kasum on kasvanud

  16. Scleral Autograft for Optic Nerve Head Pit Associated Chronic Maculopathy.

    Science.gov (United States)

    Shah, Parag K; Karandikar, Smita S; Narendran, Venkatapathy

    2017-03-01

    Chronic macular edema is a common finding seen in optic nerve head pits. There is no universally accepted modality present for this condition. Herein, the authors describe a novel surgical technique where a scleral autograft is used to plug the optic pit after microincision vitreous surgery. [Ophthalmic Surg Lasers Imaging Retina. 2017;48:251-254.]. Copyright 2017, SLACK Incorporated.

  17. Gclust Server: 206575 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available 206575 OSA_Os02g0740500 Cluster Sequences - 254 no annotation 1 1.00e-99 14.29 0.0 0.0 0.0 0.0 0.0 Show 2065...75 Cluster ID 206575 Sequence ID OSA_Os02g0740500 Link to cluster sequences Cluster

  18. Download this PDF file

    African Journals Online (AJOL)

    Kissebah A.H., Vydelingum N, Murray R, Evans D.J., Hartz. A.J., Kaikhoff RK, Adams PW. Relation of body fat distribution to metabolic complications of obesity. J. Clin. Endocrino!.Metab. 1982; 54:254-280. Fujioka S, Matasuzawa Y, Tokunaga K, Tarui S. Contribu- tion of intra-abdominal fat accumulation to the impairment of.

  19. An Examination of Drunkorexia, Greek Affiliation, and Alcohol Consumption

    Science.gov (United States)

    Ward, Rose Marie; Galante, Marina; Trivedi, Rudra; Kahrs, Juliana

    2015-01-01

    The purpose of this study is to examine the relation between Greek affiliation, the College Life Alcohol Salience Scale, alcohol consumption, disordered eating, and drunkorexia (i.e., using disordered eating practices as compensation for calories consumed through alcohol). A total of 349 college students (254 females, 89 males) participated in the…

  20. [ANIMAL TOXOCARIASIS IN A MEGALOPOLIS: EPIDEMIC ASPECTS].

    Science.gov (United States)

    Panova, O A; Glamazdin, I G; Spiridonov, S E

    2015-01-01

    The prevalence of toxocariasis was studied among a population of domestic and stray dogs and cats. In a megalopolis, Toxocara invasion was 31.6% in a population of cats and 82 and 25.4% in that of puppies and dogs, respectively. A method was developed for the molecular genetic identification of T. cati and T. canis.