WorldWideScience

Sample records for californium 253

  1. Californium-252 progress, report No. 7, April 1971

    Energy Technology Data Exchange (ETDEWEB)

    1971-12-31

    This report contains discusses of the following topics on Californium-252: First sales of californium-252; encapsulation services discussed; three new participants in market evaluation program; summer training programs to use californium; Californium-252 shipping casks available; Californium-252 questions and answers, radiotherapy; neutron radiography; natural resources exploration; nuclear safeguards; process control; dosimetry; neutron radiography; neutron shielding; and nuclear safeguards.

  2. Historical review of californium-252 discovery and development

    Science.gov (United States)

    Stoddard, D. H.

    This paper discusses the discovery and history of californium 252. This isotope may be synthesized by irradiating plutonium 239, plutonium 242, americium 243, or curium 244 with neutrons in a nuclear reactor. Various experiments and inventions involving (252)Cf conducted at the Savannah River Plant are discussed. The evolution of radiotherapy using californium 252 is reviewed.

  3. Californium-252: a remarkable versatile radioisotope

    Energy Technology Data Exchange (ETDEWEB)

    Osborne-Lee, I.W.; Alexander, C.W.

    1995-10-10

    A product of the nuclear age, Californium-252 ({sup 252}Cf) has found many applications in medicine, scientific research, industry, and nuclear science education. Californium-252 is unique as a neutron source in that it provides a highly concentrated flux and extremely reliable neutron spectrum from a very small assembly. During the past 40 years, {sup 252}Cf has been applied with great success to cancer therapy, neutron radiography of objects ranging from flowers to entire aircraft, startup sources for nuclear reactors, fission activation for quality analysis of all commercial nuclear fuel, and many other beneficial uses, some of which are now ready for further growth. Californium-252 is produced in the High Flux Isotope Reactor (HFIR) and processed in the Radiochemical Engineering Development Center (REDC), both of which are located at the Oak Ridge National Laboratory (ORNL) in Oak Ridge, Tennessee. The REDC/HFIR facility is virtually the sole supplier of {sup 252}Cf in the western world and is the major supplier worldwide. Extensive exploitation of this product was made possible through the {sup 252}Cf Market Evaluation Program, sponsored by the United States Department of Energy (DOE) [then the Atomic Energy Commission (AEC) and later the Energy Research and Development Administration (ERDA)]. This program included training series, demonstration centers, seminars, and a liberal loan policy for fabricated sources. The Market Evaluation Program was instituted, in part, to determine if large-quantity production capability was required at the Savannah River Laboratory (SRL). Because of the nature of the product and the means by which it is produced, {sup 252}Cf can be produced only in government-owned facilities. It is evident at this time that the Oak Ridge research facility can meet present and projected near-term requirements. The production, shipment, and sales history of {sup 252}Cf from ORNL is summarized herein.

  4. Production, Distribution, and Applications of Californium-252 Neutron Sources

    Energy Technology Data Exchange (ETDEWEB)

    Balo, P.A.; Knauer, J.B.; Martin, R.C.

    1999-10-03

    The radioisotope {sup 252}Cf is routinely encapsulated into compact, portable, intense neutron sources with a 2.6-year half-life. A source the size of a person's little finger can emit up to 10{sup 11} neutrons/s. Californium-252 is used commercially as a reliable, cost-effective neutron source for prompt gamma neutron activation analysis (PGNAA) of coal, cement, and minerals, as well as for detection and identification of explosives, laud mines, and unexploded military ordnance. Other uses are neutron radiography, nuclear waste assays, reactor start-up sources, calibration standards, and cancer therapy. The inherent safety of source encapsulations is demonstrated by 30 years of experience and by U.S. Bureau of Mines tests of source survivability during explosions. The production and distribution center for the U. S Department of Energy (DOE) Californium Program is the Radiochemical Engineering Development Center (REDC) at Oak Ridge National Laboratory (ORNL). DOE sells The radioisotope {sup 252}Cf is routinely encapsulated into compact, portable, intense neutron sources with a 2.6- year half-life. A source the size of a person's little finger can emit up to 10 neutrons/s. Californium-252 is used commercially as a reliable, cost-effective neutron source for prompt gamma neutron activation analysis (PGNAA) of coal, cement, and minerals, as well as for detection and identification of explosives, laud mines, and unexploded military ordnance. Other uses are neutron radiography, nuclear waste assays, reactor start-up sources, calibration standards, and cancer therapy. The inherent safety of source encapsulations is demonstrated by 30 years of experience and by U.S. Bureau of Mines tests of source survivability during explosions. The production and distribution center for the U. S Department of Energy (DOE) Californium Program is the Radiochemical Engineering Development Center (REDC) at Oak Ridge National Laboratory(ORNL). DOE sells {sup 252}Cf to commercial

  5. Unusual structure, bonding and properties in a californium borate

    Energy Technology Data Exchange (ETDEWEB)

    Polinski, Matthew J.; Garner, Edward B.; Maurice, Rémi; Planas, Nora; Stritzinger, Jared T.; Parker, T. Gannon; Cross, Justin N.; Green, Thomas D.; Alekseev, Evgeny V.; Van Cleve, Shelley M.; Depmeier, Wulf; Gagliardi, Laura; Shatruk, Michael; Knappenberger, Kenneth L.; Liu, Guokui; Skanthakumar, S.; Soderholm, Lynda; Dixon, David A.; Albrecht-Schmitt, Thomas E.

    2014-03-23

    The participation of the valence orbitals of actinides in bonding has been debated for decades. Recent experimental and computational investigations demonstrated the involvement of 6p, 6d and/or 5f orbitals in bonding. However, structural and spectroscopic data, as well as theory, indicate a decrease in covalency across the actinide series, and the evidence points to highly ionic, lanthanide-like bonding for late actinides. Here we show that chemical differentiation between californium and lanthanides can be achieved by using ligands that are both highly polarizable and substantially rearrange on complexation. A ligand that suits both of these desired properties is polyborate. We demonstrate that the 5f, 6d and 7p orbitals are all involved in bonding in a Cf(III) borate, and that large crystal-field effects are present. Synthetic, structural and spectroscopic data are complemented by quantum mechanical calculations to support these observations.

  6. Biomedical neutron research at the Californium User Facility for neutron science

    Energy Technology Data Exchange (ETDEWEB)

    Martin, R.C. [Oak Ridge National Lab., TN (United States); Byrne, T.E. [Roane State Community College, Harriman, TN (United States); Miller, L.F. [Univ. of Tennessee, Knoxville, TN (United States)

    1997-04-01

    The Californium User Facility for Neutron Science has been established at Oak Ridge National Laboratory (ORNL). The Californium User Facility (CUF) is a part of the larger Californium Facility, which fabricates and stores compact {sup 252}Cf neutron sources for worldwide distribution. The CUF can provide a cost-effective option for research with {sup 252}Cf sources. Three projects at the CUF that demonstrate the versatility of {sup 252}Cf for biological and biomedical neutron-based research are described: future establishment of a {sup 252}Cf-based neutron activation analysis system, ongoing work to produce miniature high-intensity, remotely afterloaded {sup 252}Cf sources for tumor therapy, and a recent experiment that irradiated living human lung cancer cells impregnated with experimental boron compounds to test their effectiveness for boron neutron capture therapy.

  7. 43 CFR 2.53 - Government contracts.

    Science.gov (United States)

    2010-10-01

    ... 43 Public Lands: Interior 1 2010-10-01 2010-10-01 false Government contracts. 2.53 Section 2.53 Public Lands: Interior Office of the Secretary of the Interior RECORDS AND TESTIMONY; FREEDOM OF INFORMATION ACT Privacy Act § 2.53 Government contracts. (a) Required contract provisions. When a contract...

  8. 28 CFR 25.3 - System information.

    Science.gov (United States)

    2010-07-01

    ... 28 Judicial Administration 1 2010-07-01 2010-07-01 false System information. 25.3 Section 25.3 Judicial Administration DEPARTMENT OF JUSTICE DEPARTMENT OF JUSTICE INFORMATION SYSTEMS The National Instant Criminal Background Check System § 25.3 System information. (a) There is established at the FBI a...

  9. 7 CFR 953.253 - Assessment rate.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 8 2010-01-01 2010-01-01 false Assessment rate. 953.253 Section 953.253 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Marketing Agreements and Orders; Fruits, Vegetables, Nuts), DEPARTMENT OF AGRICULTURE IRISH POTATOES GROWN IN SOUTHEASTERN STATES Assessment Rates § 953.253...

  10. 7 CFR 253.4 - Administration.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Administration. 253.4 Section 253.4 Agriculture... GENERAL REGULATIONS AND POLICIES-FOOD DISTRIBUTION ADMINISTRATION OF THE FOOD DISTRIBUTION PROGRAM FOR HOUSEHOLDS ON INDIAN RESERVATIONS § 253.4 Administration. (a) Federal administration. Within the Department...

  11. 32 CFR 253.5 - Responsibilities.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false Responsibilities. 253.5 Section 253.5 National Defense Department of Defense (Continued) OFFICE OF THE SECRETARY OF DEFENSE (CONTINUED) MISCELLANEOUS... MILITARY SERVICES § 253.5 Responsibilities. (a) The Deputy Under Secretary of Defense for Policy, or...

  12. 10 CFR 25.3 - Scope.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 1 2010-01-01 2010-01-01 false Scope. 25.3 Section 25.3 Energy NUCLEAR REGULATORY... licensees, certificate holders, and others who may require access to classified information related to a license, certificate, an application for a license or certificate, or other activities as the Commission...

  13. 24 CFR 220.253 - Substitute mortgagors.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Substitute mortgagors. 220.253... Contract Rights and Obligations-Homes § 220.253 Substitute mortgagors. (a) Selling mortgagor. The mortgagee... the Commissioner's approval of a substitute mortgagor, as provided by this section. (b) Purchasing...

  14. 7 CFR 983.253 - Assessment rate.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 8 2010-01-01 2010-01-01 false Assessment rate. 983.253 Section 983.253 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Marketing Agreements and Orders; Fruits, Vegetables, Nuts), DEPARTMENT OF AGRICULTURE PISTACHIOS GROWN IN CALIFORNIA, ARIZONA, AND NEW MEXICO Assessment Rate §...

  15. 50 CFR 253.22 - State projects.

    Science.gov (United States)

    2010-10-01

    ... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false State projects. 253.22 Section 253.22... State projects. (a) General—(1) Designation of state agency. The Governor of each state shall notify the... participation under the Act, to sign project documents, and to receive payments. (2) States that choose to...

  16. 40 CFR 761.253 - Chemical analysis.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 30 2010-07-01 2010-07-01 false Chemical analysis. 761.253 Section 761.253 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) TOXIC SUBSTANCES CONTROL ACT... analysis. (a) Extract PCBs from the standard wipe sample collection medium and clean-up the extracted PCBs...

  17. Apparatus for the measurement of total body nitrogen using prompt neutron activation analysis with californium-252.

    Science.gov (United States)

    Mackie, A; Hannan, W J; Smith, M A; Tothill, P

    1988-01-01

    Details of clinical apparatus designed for the measurement of total body nitrogen (as an indicator of body protein), suitable for the critically ill, intensive-care patient are presented. Californium-252 radio-isotopic neutron sources are used, enabling a nitrogen measurement by prompt neutron activation analysis to be made in 40 min with a precision of +/- 3.2% for a whole body dose equivalent of 0.145 mSv. The advantages of Californium-252 over alternative neutron sources are discussed. A comparison between two irradiation/detection geometries is made, leading to an explanation of the geometry adopted for the apparatus. The choice of construction and shielding materials to reduce the count rate at the detectors and consequently to reduce the pile-up contribution to the nitrogen background is discussed. Salient features of the gamma ray spectroscopy system to reduce spectral distortion from pulse pile-up are presented.

  18. Safety Analysis Report for Packaging (SARP) of the Oak Ridge National Laboratory TRU Californium Shipping Container

    Energy Technology Data Exchange (ETDEWEB)

    Box, W.D.; Shappert, L.B.; Seagren, R.D.; Klima, B.B.; Jurgensen, M.C.; Hammond, C.R.; Watson, C.D.

    1980-01-01

    An analytical evaluation of the Oak Ridge National Laboratory TRU Californium Shipping Container was made in order to demonstrate its compliance with the regulations governing off-site shipment of packages that contain radioactive material. The evaluation encompassed five primary categories: structural integrity, thermal resistance, radiation shielding, nuclear criticality safety, and quality assurance. The results of this evaluation demonstrate that the container complies with the applicable regulations.

  19. 28 CFR 2.53 - Mandatory parole.

    Science.gov (United States)

    2010-07-01

    ... Judicial Administration DEPARTMENT OF JUSTICE PAROLE, RELEASE, SUPERVISION AND RECOMMITMENT OF PRISONERS, YOUTH OFFENDERS, AND JUVENILE DELINQUENTS United States Code Prisoners and Parolees § 2.53 Mandatory parole. (a) A prisoner (including a prisoner sentenced under the Narcotic Addict Rehabilitation Act...

  20. 27 CFR 41.253 - Change in location or address.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 2 2010-04-01 2010-04-01 false Change in location or address. 41.253 Section 41.253 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE... § 41.253 Change in location or address. Whenever an importer of processed tobacco intends to relocate...

  1. 48 CFR 253.215 - Contracting by negotiation.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Contracting by negotiation. 253.215 Section 253.215 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS SYSTEM, DEPARTMENT OF DEFENSE CLAUSES AND FORMS FORMS Prescription of Forms 253.215 Contracting by negotiation. ...

  2. 4 CFR 25.3 - Admission to the GAO building.

    Science.gov (United States)

    2010-01-01

    ... 4 Accounts 1 2010-01-01 2010-01-01 false Admission to the GAO building. 25.3 Section 25.3 Accounts GOVERNMENT ACCOUNTABILITY OFFICE GENERAL PROCEDURES CONDUCT IN THE GOVERNMENT ACCOUNTABILITY OFFICE BUILDING AND ON ITS GROUNDS § 25.3 Admission to the GAO building. A person may be admitted to the GAO Building...

  3. 37 CFR 253.9 - Unknown copyright owners.

    Science.gov (United States)

    2010-07-01

    ... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Unknown copyright owners. 253.9 Section 253.9 Patents, Trademarks, and Copyrights COPYRIGHT OFFICE, LIBRARY OF CONGRESS COPYRIGHT... NONCOMMERCIAL EDUCATIONAL BROADCASTING § 253.9 Unknown copyright owners. If PBS and its stations, NPR and its...

  4. 38 CFR 17.253 - Applicants for grants.

    Science.gov (United States)

    2010-07-01

    ... 38 Pensions, Bonuses, and Veterans' Relief 1 2010-07-01 2010-07-01 false Applicants for grants. 17.253 Section 17.253 Pensions, Bonuses, and Veterans' Relief DEPARTMENT OF VETERANS AFFAIRS MEDICAL Grants for Exchange of Information § 17.253 Applicants for grants. Applicants for grants generally will...

  5. 30 CFR 253.11 - Who must demonstrate OSFR?

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Who must demonstrate OSFR? 253.11 Section 253... FINANCIAL RESPONSIBILITY FOR OFFSHORE FACILITIES Applicability and Amount of OSFR § 253.11 Who must demonstrate OSFR? (a) A designated applicant must demonstrate OSFR. A designated applicant may be a...

  6. 8 CFR 253.2 - Termination of parole.

    Science.gov (United States)

    2010-01-01

    ... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Termination of parole. 253.2 Section 253.2 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS PAROLE OF ALIEN CREWMEN § 253.2 Termination of parole. (a) General. At the expiration of the period of parole authorized by the district director, or when the purpose of...

  7. UNCOVERING THE NUCLEUS CANDIDATE FOR NGC 253

    Energy Technology Data Exchange (ETDEWEB)

    Günthardt, G. I.; Camperi, J. A. [Observatorio Astronómico, Universidad Nacional de Córdoba (Argentina); Agüero, M. P. [Observatorio Astronómico, Universidad Nacional de Córdoba, and CONICET (Argentina); Díaz, R. J.; Gomez, P. L.; Schirmer, M. [Gemini Observatory, AURA (United States); Bosch, G., E-mail: gunth@oac.uncor.edu, E-mail: camperi@oac.uncor.edu, E-mail: mpaguero@oac.uncor.edu, E-mail: rdiaz@gemini.edu, E-mail: pgomez@gemini.edu, E-mail: mschirmer@gemini.edu, E-mail: guille@fcaglp.unlp.edu.ar [Instituto de Astrofísica de La Plata (CONICET-UNLP) (Argentina)

    2015-11-15

    NGC 253 is the nearest spiral galaxy with a nuclear starburst that becomes the best candidate for studying the relationship between starburst and active galactic nucleus activity. However, this central region is veiled by large amounts of dust, and it has been so far unclear which is the true dynamical nucleus to the point that there is no strong evidence that the galaxy harbors a supermassive black hole co-evolving with the starburst as was supposed earlier. Near-infrared (NIR) spectroscopy, especially NIR emission line analysis, could be advantageous in shedding light on the true nucleus identity. Using Flamingos-2 at Gemini South we have taken deep K-band spectra along the major axis of the central structure and through the brightest infrared source. In this work, we present evidence showing that the brightest NIR and mid-infrared source in the central region, already known as radio source TH7 and so far considered just a large stellar supercluster, in fact presents various symptoms of a genuine galactic nucleus. Therefore, it should be considered a valid nucleus candidate. Mentioning some distinctive aspects, it is the most massive compact infrared object in the central region, located at 2.″0 of the symmetry center of the galactic bar, as measured in the K-band emission. Moreover, our data indicate that this object is surrounded by a large circumnuclear stellar disk and it is also located at the rotation center of the large molecular gas disk of NGC 253. Furthermore, a kinematic residual appears in the H{sub 2} rotation curve with a sinusoidal shape consistent with an outflow centered in the candidate nucleus position. The maximum outflow velocity is located about 14 pc from TH7, which is consistent with the radius of a shell detected around the nucleus candidate, observed at 18.3 μm (Qa) and 12.8 μm ([Ne ii]) with T-ReCS. Also, the Brγ emission line profile shows a pronounced blueshift and this emission line also has the highest equivalent width at this

  8. 24 CFR 960.253 - Choice of rent.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 4 2010-04-01 2010-04-01 false Choice of rent. 960.253 Section 960... ADMISSION TO, AND OCCUPANCY OF, PUBLIC HOUSING Rent and Reexamination § 960.253 Choice of rent. (a) Rent... between the two methods for determining the amount of tenant rent payable monthly by the family. The...

  9. 24 CFR 983.253 - Leasing of contract units.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 4 2010-04-01 2010-04-01 false Leasing of contract units. 983.253... DEVELOPMENT PROJECT-BASED VOUCHER (PBV) PROGRAM Occupancy § 983.253 Leasing of contract units. (a) Owner selection of tenants. (1) During the term of the HAP contract, the owner must lease contract units only to...

  10. 50 CFR 253.14 - Economic and financial requirements.

    Science.gov (United States)

    2010-10-01

    ... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Economic and financial requirements. 253... Obligation Guarantee Program § 253.14 Economic and financial requirements. (a) Income and expense projections... protect the U.S. against the industry's cyclical economics and other risks of loss. (b) Working capital...

  11. 14 CFR 23.253 - High speed characteristics.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false High speed characteristics. 23.253 Section... Requirements § 23.253 High speed characteristics. If a maximum operating speed VMO/MMO is established under § 23.1505(c), the following speed increase and recovery characteristics must be met: (a) Operating...

  12. Application of TSH bioindicator for studying the biological efficiency of neutrons from californium-252 source

    Energy Technology Data Exchange (ETDEWEB)

    Cebulska-Wasilewska, A.; Rekas, K. [Institute of Nuclear Physics, Cracow (Poland); Kim, J.K. [Korea Atomic Energy Research Inst., Taejon (Korea, Republic of)

    1997-12-31

    The effectiveness of neutrons from a Californium-252 source in the induction of various abnormalities in the Tradescantia clone 4430 stamen hair cells (TSH-assay) was studied. The special attention was paid to check whether any enhancement in effects caused by process of boron neutron capture is visible in the cells enriched with boron ions. Two chemicals (borax and BSH) were applied to introduce boron-10 ions into cells. Inflorescence, normal or pretreated with chemicals containing boron, were irradiated in the air with neutrons from a Cf-252 source at KAERI, Taejon, Korea. To estimate the relative biological effectiveness (RBE) in the induction of gene mutations of the neutron beam under the study, Tradescantia inflorescences, without any chemical pretreatment, were irradiated with various doses of X-rays. The ranges of radiation doses used were 0-0.1 Gy in neutrons and 0-0.5 Gy in X-rays. After the time needed to complete the postirradiation repair Tradescantia cuttings were transferred to Cracow, where screening of gene and lethal; mutations, cell cycle alterations in somatic cells have been done, and dose response relationships were figured. The maximal RBE values were estimated in the range of 4.6-6.8. Alterations of RBE value were observed; from 6.8 to 7.8 in the case of plants pretreated with 240 ppm of B-10 from borax, and 4.6 to 6.1 in the case of 400 ppm of B-10 from BSH. Results showed a slight, although statistically insignificant increase in biological efficacy of radiation from the Cf-252 source in samples pretreated with boron containing chemicals. (author)

  13. Study of the shielding for spontaneous fission sources of Californium-252; Estudio de blindaje para fuentes de fision espontanea de Californio-252

    Energy Technology Data Exchange (ETDEWEB)

    Davila R, I

    1991-06-15

    A shielding study is made to attenuate, until maximum permissible levels, the neutrons radiation and photons emitted by spontaneous fission coming from a source of Californium-252. The compound package by a database (Library DLC-23) and the ANISNW code is used, in it version for personal computer. (Author)

  14. Simulation and design of an electron beam ion source charge breeder for the californium rare isotope breeder upgrade

    Directory of Open Access Journals (Sweden)

    Clayton Dickerson

    2013-02-01

    Full Text Available An electron beam ion source (EBIS will be constructed and used to charge breed ions from the californium rare isotope breeder upgrade (CARIBU for postacceleration into the Argonne tandem linear accelerator system (ATLAS. Simulations of the EBIS charge breeder performance and the related ion transport systems are reported. Propagation of the electron beam through the EBIS was verified, and the anticipated incident power density within the electron collector was identified. The full normalized acceptance of the charge breeder with a 2 A electron beam, 0.024π  mm mrad for nominal operating parameters, was determined by simulating ion injection into the EBIS. The optics of the ion transport lines were carefully optimized to achieve well-matched ion injection, to minimize emittance growth of the injected and extracted ion beams, and to enable adequate testing of the charge bred ions prior to installation in ATLAS.

  15. Extraction of Trivalent Actinides and Lanthanides from Californium Campaign Rework Solution Using TODGA-based Solvent Extraction System

    Energy Technology Data Exchange (ETDEWEB)

    Benker, Dennis [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Delmau, Laetitia Helene [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Dryman, Joshua Cory [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States)

    2017-07-01

    This report presents the studies carried out to demonstrate the possibility of quantitatively extracting trivalent actinides and lanthanides from highly acidic solutions using a neutral ligand-based solvent extraction system. These studies stemmed from the perceived advantage of such systems over cationexchange- based solvent extraction systems that require an extensive feed adjustment to make a low-acid feed. The targeted feed solutions are highly acidic aqueous phases obtained after the dissolution of curium targets during a californium (Cf) campaign. Results obtained with actual Cf campaign solutions, but highly diluted to be manageable in a glove box, are presented, followed by results of tests run in the hot cells with Cf campaign rework solutions. It was demonstrated that a solvent extraction system based on the tetraoctyl diglycolamide molecule is capable of quantitatively extracting trivalent actinides from highly acidic solutions. This system was validated using actual feeds from a Cf campaign.

  16. Beyond Californium-A Neutron Generator Alternative for Dosimetry and Instrument Calibration in the U.S.

    Science.gov (United States)

    Piper, Roman K; Mozhayev, Andrey V; Murphy, Mark K; Thompson, Alan K

    2017-09-01

    Evaluations of neutron survey instruments, area monitors, and personal dosimeters rely on reference neutron radiations, which have evolved from the heavy reliance on (α,n) sources to a shared reliance on (α,n) and the spontaneous fission neutrons of californium-252 (Cf). Capable of producing high dose equivalent rates from an almost point source geometry, the characteristics of Cf are generally more favorable when compared to the use of (α,n) and (γ,n) sources or reactor-produced reference neutron radiations. Californium-252 is typically used in two standardized configurations: unmoderated, to yield a fission energy spectrum; or with the capsule placed within a heavy-water moderating sphere to produce a softened spectrum that is generally considered more appropriate for evaluating devices used in nuclear power plant work environments. The U.S. Department of Energy Cf Loan/Lease Program, a longtime origin of affordable Cf sources for research, testing and calibration, was terminated in 2009. Since then, high-activity sources have become increasingly cost-prohibitive for laboratories that formerly benefited from that program. Neutron generators, based on the D-T and D-D fusion reactions, have become economically competitive with Cf and are recognized internationally as important calibration and test standards. Researchers from the National Institute of Standards and Technology and the Pacific Northwest National Laboratory are jointly considering the practicality and technical challenges of implementing neutron generators as calibration standards in the U.S. This article reviews the characteristics of isotope-based neutron sources, possible isotope alternatives to Cf, and the rationale behind the increasing favor of electronically generated neutron options. The evaluation of a D-T system at PNNL has revealed characteristics that must be considered in adapting generators to the task of calibration and testing where accurate determination of a dosimetric quantity is

  17. Californium-252 Brachytherapy Combined With External-Beam Radiotherapy for Cervical Cancer: Long-Term Treatment Results

    Energy Technology Data Exchange (ETDEWEB)

    Lei Xin; Qian Chengyuan; Qing Yi; Zhao Kewei; Yang Zhengzhou; Dai Nan; Zhong Zhaoyang; Tang Cheng; Li Zheng; Gu Xianqing; Zhou Qian; Feng Yan; Xiong Yanli; Shan Jinlu [Cancer Center, Research Institute of Surgery and Daping Hospital, Third Military Medical University, Chongqing (China); Wang Dong, E-mail: dongwang64@hotmail.com [Cancer Center, Research Institute of Surgery and Daping Hospital, Third Military Medical University, Chongqing (China)

    2011-12-01

    Purpose: To observe, by retrospective analysis, the curative effects and complications due to californium-252 ({sup 252}Cf) neutron intracavitary brachytherapy (ICBT) combined with external-beam radiotherapy (EBRT) in the treatment of cervical cancer. Methods and Materials: From February 1999 to December 2007, 696 patients with cervical cancer (Stages IB to IIIB) were treated with {sup 252}Cf-ICBT in combination of EBRT. Of all, 31 patients were at Stage IB, 104 at IIA, 363 at IIB, 64 at IIIA, and 134 at IIIB. Californium-252 ICBT was delivered at 7-12 Gy per insertion per week, with a total dose of 29-45 Gy to reference point A in three to five insertions. The whole pelvic cavity was treated with 8-MV X-ray external irradiation at 2 Gy per fraction, four times per week. After 16-38 Gy of external irradiation, the center of the whole pelvic field was blocked with a 4-cm-wide lead shield, with a total external irradiation dose of 44-56 Gy. The total treatment course was 5 to 6 weeks. Results: Overall survival rate at 3 and 5 years for all patients was 76.0% and 64.9%, respectively. Disease-free 3- and 5-year survival rates of patients were 71.2% and 58.4%, respectively. Late complications included vaginal contracture and adhesion, radiation proctitis, radiation cystitis, and inflammatory bowel, which accounted for 5.8%, 7.1%, 6.2%, and 4.9%, respectively. Univariate analysis results showed significant correlation of stage, age, histopathologic grade, and lymph node status with overall survival. Cox multiple regression analysis showed that the independent variables were stage, histopathologic grade, tumor size, and lymphatic metastasis in all patients. Conclusion: Results of this series suggest that the combined use of {sup 252}Cf-ICBT with EBRT is an effective method for treatment of cervical cancer.

  18. Phenotype-gene: 253 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 253 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u3ria224u1251i delayed in org... Apr. Plant J. 54(2):205-19. http://metadb.riken.jp/db/SciNetS_ria224i/cria224u4ria224u18182030i delayed in

  19. 14 CFR 25.253 - High-speed characteristics.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false High-speed characteristics. 25.253 Section...-speed characteristics. (a) Speed increase and recovery characteristics. The following speed increase and recovery characteristics must be met: (1) Operating conditions and characteristics likely to cause...

  20. 37 CFR 253.7 - Recording rights, rates and terms.

    Science.gov (United States)

    2010-07-01

    ... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Recording rights, rates and... NONCOMMERCIAL EDUCATIONAL BROADCASTING § 253.7 Recording rights, rates and terms. (a) Scope. This section... include: (i) The title, composer and author to the extent such information is reasonably obtainable. (ii...

  1. Phenotype abnormality: 253 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 253 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u1ria224u759i delayed whole p...lant flowering stage in environment of vernalization ... delayed ... whole plant flowering stage ...

  2. Structure of rotational bands in {sup 253}No

    Energy Technology Data Exchange (ETDEWEB)

    Herzberg, R.D.; Moon, S.; Butler, P.A.; Page, T.; Amzal, N.; Bastin, J.E.; Cocks, J.F.C.; Darby, I.G.; Gray-Jones, C.; Hammond, N.J.; Herzberg, A.; Humphreys, R.D.; Jones, G.D.; Page, R.D.; Page, T.; Pritchard, A. [University of Liverpool, Oliver Lodge Laboratory, Liverpool (United Kingdom); Eeckhaudt, S.; Greenlees, P.T.; Dorvaux, O.; Jones, P.M.; Julin, R.; Juutinen, S.; Kankaanpaeae, H.; Kettunen, H.; Kuusiniemi, P.; LeCoz, Y.; Leino, M.; Leppaenen, A.P.; Muikku, M.; Nieminen, P.; Nyman, M.; Rahkila, P.; Sandzelius, M.; Saren, J.; Scholey, C.; Trzaska, W.H.; Uusitalo, J. [University of Jyvaeskylae, Department of Physics, Jyvaeskylae (Finland); Afanasjev, A.V. [Mississippi State University, Department of Physics and Astronomy, Mississippi, MS (United States); Becker, F.; Houry, M.; Huerstel, A.; Korten, W.; Lucas, R.; Theisen, C. [DAPNIA/SPhN CEA-Saclay, Saclay (France); Bender, M. [Universite Bordeaux and CNRS/IN2P3, Centre d' Etudes Nucleaires de Bordeaux Gradignan, Bordeaux (France); Bruyneel, B.; Reiter, P.; Wiens, A. [Universitaet zu Koeln, Institut fuer Kernphysik, Koeln (Germany); Eskola, K. [University of Helsinki, Department of Physics, Helsinki (Finland); Gerl, J.; Hessberger, F.; Schlegel, C.; Wollersheim, H.J. [GSI Helmholtzzentrum fuer Schwerionenforschung, Darmstadt (Germany); Grahn, T.; Pakarinen, J. [University of Liverpool, Oliver Lodge Laboratory, Liverpool (United Kingdom); University of Jyvaeskylae, Department of Physics, Jyvaeskylae (Finland); Hauschild, K. [IN2P3-CNRS, CSNSM, Orsay Campus (France); Heenen, P.H. [Universite Libre de Bruxelles, Service de Physique Nucleaire Theorique, Bruxelles (Belgium); Helariutta, K. [University of Jyvaeskylae, Department of Physics, Jyvaeskylae (Finland); University of Helsinki, Department of Physics, Helsinki (Finland); Khoo, T.L.; Lister, C.J. [Argonne National Laboratory, Argonne, IL (United States)

    2009-12-15

    In-beam gamma-ray and conversion electron spectroscopic studies have been performed on the {sup 253} No nucleus. A strongly coupled rotational band has been identified and the improved statistics allows an assignment of the band structure as built on the 9/2{sup -}[734]{sub {nu}} ground state. The results agree with previously known transition energies but disagree with the tentative structural assignments made in earlier work. (orig.)

  3. 37 CFR 2.53 - Requirements for drawings filed through the TEAS.

    Science.gov (United States)

    2010-07-01

    ... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Requirements for drawings filed through the TEAS. 2.53 Section 2.53 Patents, Trademarks, and Copyrights UNITED STATES PATENT AND TRADEMARK OFFICE, DEPARTMENT OF COMMERCE RULES OF PRACTICE IN TRADEMARK CASES Drawing § 2.53 Requirements...

  4. Long-term effects of an intracavitary treatment with californium-252 on normal tissue. [Swine, /sup 226/Ra

    Energy Technology Data Exchange (ETDEWEB)

    Sullivan, M.F.; Beamer, J.L.; Mahony, T.D.; Cross, F.T.; Lund, J.E.; Endres, G.W.R.

    1976-01-01

    About one hundred fifty swine were exposed to either radium-226 or californium-252 sources in the uterine cervix to determine an RBE for both acute and long-term effects. That value for early changes in the tissues at risk in the treatment of cervical cancer was between 6.2 and 6.8. The incidence of complications increased with time after exposure, especially among animals treated with /sup 252/Cf. Analysis of rectal injury showed that ulceration occurred frequently within a year postexposure at doses between 1600 and 2400 rad calculated at 2 cm lateral to the source midline. Fat necrosis and smooth muscle atrophy, resulting in a local rectal stricture, were delayed changes observed in some animals. The lower ureter was the site for a greater frequency of complications than the GI tract. Ureteral stricture often occurred at doses of 1200 rad from /sup 252/Cf and 7000 rad from /sup 226/Ra. Observation of delayed effects in the uterine-cervix in animals held up to 4 years postexposure indicate that the RBE for /sup 252/Cf may be increased to a value as high as 18, while repair may have even decreased it to about 5.6 in the rectum. Fifty swine are still being observed for long-term effects after doses above 800 rad from /sup 252/Cf and 5000 rad from /sup 226/Ra.

  5. SWAN: NGC 253’s Nucleated Star Bursting Environment

    Science.gov (United States)

    Gorski, Mark; Ott, Juergen; Meier, David; Momjian, Emmanuel; Walter, Fabian; Rand, Richard

    2015-08-01

    We present the first results from SWAN: Survey of Water and Ammonia in Nearby galaxies. Nearby galaxies are conveniently located to probe molecular gas properties on scales of 10 to 200 pc, which are appropriate for Giant Molecular Clouds (GMCs). The resolution of the VLA in D and C configurations maps to a few 10’s of parsecs in these galaxies. To advance studies of galaxy evolution it is paramount to understand how processes in the molecular ISM and star formation are linked on these scales. We have observed the metastable transitions of ammonia and the 22GHz water maser line in four nearby galaxies: NGC 253, IC 342, NGC 2146, and NGC 6946. These galaxies were chosen to span an order of magnitude in star formation rate, and a range of galactic ecosystems. We use the ammonia transitions to derive kinetic temperatures, which exposes the heating and cooling balance of the ISM. We then aim to relate these conditions to energetic feedback from star formation indicated by water masers. Currently our analysis is focused on NGC 253. NGC 253 is a barred spiral galaxy with a nucleated starburst of ≈3M⊙ per year. We have observed ammonia transitions (1,1) to (5,5) and the 22GHz water maser line with a resolution of ≈63pc. We have identified nine regions across the nucleated starburst for study. The ammonia (3,3) line appears to be masing in the centermost 200pc. In combination with Large Velocity Gradient models (LVG) we find that the properties of the molecular gas is warm, ranging from 100K to 160K, with molecular hydrogen densities from 2.2e3 cm-3 to 4.8e3 cm-3. We have identified two regions of water maser emission. The first region is a north south extension, about the center of the galaxy, with a major axis of ≈7”(150pc) and a minor axis of ≈3”(90pc), and the second is a nearby region ≈6”(100pc) to the southeast of the galaxy center. By means of these measurements, we gain an understanding of the molecular ISM associated with the nucleated

  6. Ab initio full-potential study of mechanical properties and magnetic phase stability of californium monopnictides (CfN and CfP)

    Energy Technology Data Exchange (ETDEWEB)

    Amari, S., E-mail: siham_amari@yahoo.fr [Faculté des Sciences de la Nature et de la Vie, Université Hassiba Benbouali, Chlef, 02000 (Algeria); Bouhafs, B. [Laboratoire de Modélisation et Simulation en Sciences des Matériaux, Université Djillali Liabès de Sidi Bel-Abbés, Sidi Bel-Abbés, 22000 (Algeria)

    2016-09-15

    Based on the first-principles methods, the structural, elastic, electronic, properties and magnetic ordering of californium monopnictides CfX (X = P) have been studied using the full-potential augmented plane wave plus local orbitals (FP-L/APW + lo) method within the framework of density functional theory (DFT). The electronic exchange correlation energy is described by generalized gradient approximation GGA and GGA+U (U is the Hubbard correction). The GGA+U method is applied to the rare-earth 5f states. We have calculated the lattice parameters, bulk modulii and the first pressure derivatives of the bulk modulii. The elastic properties of the studied compounds are only investigated in the most stable calculated phase. In order to gain further information, we have calculated Young’s modulus, shear modulus, anisotropy factor and Kleinman parameter by the aid of the calculated elastic constants. The results mainly show that californium monopnictides CfX (X = P) have an antiferromagnetic spin ordering. Density of states (DOS) and charge densities for both compounds are also computed in the NaCl (B1) structure.

  7. Low-Dose-Rate Californium-252 Neutron Intracavitary Afterloading Radiotherapy Combined With Conformal Radiotherapy for Treatment of Cervical Cancer

    Energy Technology Data Exchange (ETDEWEB)

    Zhang Min [Department of Oncology, Armed Police Hospital of Hangzhou, Hangzhou, Zhejiang Province (China); Xu Hongde [Cancer Center, Armed Police Hospital of Hangzhou, Hangzhou, Zhejiang Province (China); Pan Songdan; Lin Shan; Yue Jianhua [Department of Oncology, Armed Police Hospital of Hangzhou, Hangzhou, Zhejiang Province (China); Liu Jianren, E-mail: liujianren0571@hotmail.com [Second Affiliated Hospital, School of Medicine, Zhejiang University, Hangzhou, Zhejiang Province (China)

    2012-07-01

    Purpose: To study the efficacy of low-dose-rate californium-252 ({sup 252}Cf) neutron intracavitary afterloading radiotherapy (RT) combined with external pelvic RT for treatment of cervical cancer. Methods and Materials: The records of 96 patients treated for cervical cancer from 2006 to 2010 were retrospectively reviewed. For patients with tumors {<=}4 cm in diameter, external beam radiation was performed (1.8 Gy/day, five times/week) until the dose reached 20 Gy, and then {sup 252}Cf neutron intracavitary afterloading RT (once/week) was begun, and the frequency of external beam radiation was changed to four times/week. For patients with tumors >4 cm, {sup 252}Cf RT was performed one to two times before whole-pelvis external beam radiation. The tumor-eliminating dose was determined by using the depth limit of 5 mm below the mucosa as the reference point. In all patients, the total dose of the external beam radiation ranged from 46.8 to 50 Gy. For {sup 252}Cf RT, the dose delivered to point A was 6 Gy/fraction, once per week, for a total of seven times, and the total dose was 42 Gy. Results: The mean {+-} SD patient age was 54.7 {+-} 13.7 years. Six patients had disease assessed at stage IB, 13 patients had stage IIA, 49 patients had stage IIB, 3 patients had stage IIIA, 24 patients had stage IIIB, and 1 patient had stage IVA. All patients obtained complete tumor regression (CR). The mean {+-} SD time to CR was 23.5 {+-} 3.4 days. Vaginal bleeding was fully controlled in 80 patients within 1 to 8 days. The mean {+-} SD follow-up period was 27.6 {+-} 12.7 months (range, 6-48 months). Five patients died due to recurrence or metastasis. The 3-year survival and disease-free recurrence rates were 89.6% and 87.5 %, respectively. Nine patients experienced mild radiation proctitis, and 4 patients developed radiocystitis. Conclusions: Low-dose-rate {sup 252}Cf neutron RT combined with external pelvic RT is effective for treating cervical cancer, with a low incidence of

  8. 50 CFR 14.253 - What are the restrictions contained in these regulations?

    Science.gov (United States)

    2010-10-01

    ... 50 Wildlife and Fisheries 1 2010-10-01 2010-10-01 false What are the restrictions contained in these regulations? 14.253 Section 14.253 Wildlife and Fisheries UNITED STATES FISH AND WILDLIFE SERVICE....255, it is unlawful for any person to import, export, transport, sell, receive, acquire, or purchase...

  9. 15 CFR 25.3 - Basis for civil penalties and assessments.

    Science.gov (United States)

    2010-01-01

    ... assessments. 25.3 Section 25.3 Commerce and Foreign Trade Office of the Secretary of Commerce PROGRAM Fraud... considered made to the authority, recipient, or party when such claim is actually made to an agent, fiscal... considered made to the authority when such statement is actually made to an agent, fiscal intermediary, or...

  10. 44 CFR 206.253 - Insurance requirements for facilities damaged by disasters other than flood.

    Science.gov (United States)

    2010-10-01

    ... facilities damaged by disasters other than flood. 206.253 Section 206.253 Emergency Management and Assistance... by disasters other than flood. (a) Prior to approval of a Federal grant for the restoration of a facility and its contents which were damaged by a disaster other than flood, the Grantee shall notify the...

  11. 48 CFR 253.213-70 - Completion of DD Form 1155, Order for Supplies or Services.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Completion of DD Form 1155... Forms 253.213-70 Completion of DD Form 1155, Order for Supplies or Services. Follow the procedures at PGI 253.213-70 for completion of DD Form 1155. ...

  12. 48 CFR 253.208-2 - DD Form 448-2, Acceptance of MIPR.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false DD Form 448-2, Acceptance... REGULATIONS SYSTEM, DEPARTMENT OF DEFENSE CLAUSES AND FORMS FORMS Prescription of Forms 253.208-2 DD Form 448-2, Acceptance of MIPR. Follow the procedures at PGI 253.208-2 for use of DD Form 448-2. ...

  13. 48 CFR 253.215-70 - DD Form 1547, Record of Weighted Guidelines Application.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false DD Form 1547, Record of... Forms 253.215-70 DD Form 1547, Record of Weighted Guidelines Application. Follow the procedures at PGI 253.215-70 for completing DD Form 1547. ...

  14. 49 CFR 234.253 - Flashing light units and lamp voltage.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Flashing light units and lamp voltage. 234.253... Maintenance, Inspection, and Testing Inspections and Tests § 234.253 Flashing light units and lamp voltage. (a... voltage shall be tested when installed and at least once every 12 months thereafter. (c) Each flashing...

  15. 48 CFR 253.213 - Simplified acquisition procedures (SF's 18, 30, 44, 1165, 1449, and OF's 336, 347, and 348).

    Science.gov (United States)

    2010-10-01

    ... procedures (SF's 18, 30, 44, 1165, 1449, and OF's 336, 347, and 348). 253.213 Section 253.213 Federal... OF's 336, 347, and 348). (f) DoD uses the DD Form 1155, Order for Supplies or Services, instead of OF 347; and OF 336, Continuation Sheet, instead of OF 348. Follow the procedures at PGI 253.213(f) for...

  16. 37 CFR 253.8 - Terms and rates of royalty payments for the use of published pictorial, graphic, and sculptural...

    Science.gov (United States)

    2010-07-01

    ... payments for the use of published pictorial, graphic, and sculptural works. 253.8 Section 253.8 Patents... BROADCASTING § 253.8 Terms and rates of royalty payments for the use of published pictorial, graphic, and..., graphic, and sculptural works by public broadcasting entities for the activities described in 17 U.S.C...

  17. 5 CFR 532.253 - Special rates or rate ranges for leader, supervisory, and production facilitating positions.

    Science.gov (United States)

    2010-01-01

    ... to the same occupational series and title, that lead, supervise, or perform production facilitating..., supervisory, and production facilitating positions. 532.253 Section 532.253 Administrative Personnel OFFICE OF....253 Special rates or rate ranges for leader, supervisory, and production facilitating positions. (a...

  18. A study on the radiosensitivity and chemosensitivity of A-253 cell line in vitro

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Joo Hyun; Hwang, Eui Hwan; Lee, Sang Rae [Dept. of Oral and Maxillofacial Radiology, College of Dentistry, Kyung Hee University, Seoul (Korea, Republic of)

    1997-08-15

    The purpose of this study was to aid in the prediction of tumor cell tolerance to radiotherapy and/or chemotherapy. For this study, cell surviving curves were obtained for human epidermoid carcinoma A-253 cell line using semiautomated MTT assay. 2, 4, 6, 8, 10 Gy were irradiated at a dose rate of 210 cGy/min using {sup 60}Co Irradiator ALDORADO 8. After irradiation, A-253 cell lines(2 X 10000 cells/ml) were exposed to bleomycin or cisplatin for 1 hour. The viable cells were determined for each radiation dose with/without 2 {mu}g/ml of drug at the 3rd day. And they were compared to control values. The results were obtained as follows : 1. The surviving curve with gentle slope was obtained after irradiation of 2, 4, 6, 8, 10 Gy on A-253 cell line. 2. The cytotoxicity of bleomycin or cisplatin at the concentration of 2 {mu}g/ml was great on A-253 cell line. But, there was no significant difference between the cytotoxicity of bleomycin and that of cisplatin. 3. There were significant differences of surviving fractions after irradiation with 2 {mu}g/ml of bleomycin compared with irradiation only on A-253 cell line. 4. There were significant differences of surviving fractions after irradiation with 2 {mu}g/ml of cisplatin compared with irradiation only on A-253 cell line. 5. There were no significant differences of surviving fractions between the groups of irradiation with bleomycin and the groups of irradiation with cisplatin on A-253 cell line

  19. High energy (gamma)-ray emission from the starburst nucleus of NGC 253

    Energy Technology Data Exchange (ETDEWEB)

    Domingo-Santamaria, E; Torres, D F

    2005-06-15

    The high density medium that characterizes the central regions of starburst galaxies and its power to accelerate particles up to relativistic energies make these objects good candidates as {gamma}-rays sources. In this paper, a self-consistent model of the multifrequency emission of the starburst galaxy NGC 253, from radio to gamma-rays, is presented. The model is in agreement with all current measurements and provides predictions for the high energy behavior of the NGC 253 central region. Prospects for observations with the HESS array and GLAST satellite are especially discussed.

  20. 48 CFR 253.208-1 - DD Form 448, Military Interdepartmental Purchase Request.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false DD Form 448, Military... DD Form 448, Military Interdepartmental Purchase Request. Follow the procedures at PGI 253.208-1 for use of DD Form 448. ...

  1. 42 CFR 441.253 - Sterilization of a mentally competent individual aged 21 or older.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 4 2010-10-01 2010-10-01 false Sterilization of a mentally competent individual... LIMITS APPLICABLE TO SPECIFIC SERVICES Sterilizations § 441.253 Sterilization of a mentally competent individual aged 21 or older. FFP is available in expenditures for the sterilization of an individual only if...

  2. 40 CFR 52.253 - Metal surface coating thinner and reducer.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 3 2010-07-01 2010-07-01 false Metal surface coating thinner and... PROGRAMS (CONTINUED) APPROVAL AND PROMULGATION OF IMPLEMENTATION PLANS California § 52.253 Metal surface... Counties Air Basin portion). (iii) This section is rescinded for metal parts and products coaters which are...

  3. Californium-252 neutron intracavity brachytherapy alone for T1N0 low-lying rectal adenocarcinoma: A definitive anal sphincter-preserving radiotherapy

    Science.gov (United States)

    Xiong, Yanli; Shan, Jinlu; Liu, Jia; Zhao, Kewei; Chen, Shu; Xu, Wenjing; Zhou, Qian; Yang, Mei; Lei, Xin

    2017-01-01

    This study evaluated the 4-year results of 32 patients with T1N0 low-lying rectal adenocarcinoma treated solely with californium-252 (Cf-252) neutron intracavity brachytherapy (ICBT). Patients were solicited into the study from January 2008 to June 2011. All the patients had refused surgery or surgery was contraindicated. The patients were treated with Cf-252 neutron ICBT using a novel 3.5-cm diameter off-axis 4-channel intrarectal applicator designed by the authors. The dose reference point was defined on the mucosa surface, with a total dose of 55–62 Gy-eq/4 f (13–16 Gy-eq/f/wk). All the patients completed the radiotherapy in accordance with our protocol. The rectal lesions regressed completely, and the acute rectal toxicity was mild (≤G2). The 4-year local control, overall survival, disease-free survival, and late complication (≥G2) rates were 96.9%, 90.6%, 87.5% and 15.6%, respectively. No severe late complication (≥G3) occurred. The mean follow-up was 56.1 ± 16.0 months. At the end of last follow-up, 29 patients remained alive. The mean survival time was 82.1 ± 2.7 months. Cf-252 neutron ICBT administered as the sole treatment (without surgery) for patients with T1N0 low-lying rectal adenocarcinoma is effective with acceptable late complications. Our study and method offers a definitive anal sphincter-preserving radiotherapy for T1N0 low-lying rectal adenocarcinoma patients. PMID:28094790

  4. 30 CFR 253.24 - When I submit audited annual financial statements to verify my net worth, what standards must...

    Science.gov (United States)

    2010-07-01

    ... misstatement, and (2) The audit was conducted in accordance with the generally accepted auditing standards (GAAS) of the United States, or other international auditing standards that MMS determines to be... statements to verify my net worth, what standards must they meet? 253.24 Section 253.24 Mineral Resources...

  5. Active galactic nuclei, neutrinos, and interacting cosmic rays in NGC 253 and NGC 1068

    Energy Technology Data Exchange (ETDEWEB)

    Yoast-Hull, Tova M.; Zweibel, Ellen G. [Department of Physics, University of Wisconsin-Madison, WI 53706 (United States); Gallagher III, J. S. [Department of Astronomy, University of Wisconsin-Madison, WI 53706 (United States); Everett, John E., E-mail: yoasthull@wisc.edu [Center for Interdisciplinary Exploration and Research in Astrophysics, Northwestern University, IL 60208 (United States)

    2014-01-10

    The galaxies M82, NGC 253, NGC 1068, and NGC 4945 have been detected in γ-rays by Fermi. Previously, we developed and tested a model for cosmic-ray interactions in the starburst galaxy M82. Now, we aim to explore the differences between starburst and active galactic nucleus (AGN) environments by applying our self-consistent model to the starburst galaxy NGC 253 and the Seyfert galaxy NGC 1068. Assuming a constant cosmic-ray acceleration efficiency by supernova remnants with Milky Way parameters, we calculate the cosmic-ray proton and primary and secondary electron/positron populations, predict the radio and γ-ray spectra, and compare with published measurements. We find that our models easily fit the observed γ-ray spectrum for NGC 253 while constraining the cosmic-ray source spectral index and acceleration efficiency. However, we encountered difficultly modeling the observed radio data and constraining the speed of the galactic wind and the magnetic field strength, unless the gas mass is less than currently preferred values. Additionally, our starburst model consistently underestimates the observed γ-ray flux and overestimates the radio flux for NGC 1068; these issues would be resolved if the AGN is the primary source of γ-rays. We discuss the implications of these results and make predictions for the neutrino fluxes for both galaxies.

  6. Class I methanol masers in NGC 253: Alcohol at the end of the bar

    Science.gov (United States)

    Ellingsen, S. P.; Chen, X.; Breen, S. L.; Qiao, H.-H.

    2017-11-01

    We have used the Australia Telescope Compact Array to observe the 36.2-GHz class I methanol maser emission towards NGC 253 and find that it is located at the interface between the nuclear ring and both ends of the galactic bar. This is thought to be the location of the inner Linblad resonance and we suggest that the maser emission in this region is likely due to large-scale cloud-cloud collisions. We have detected the first extragalactic 44.1-GHz class I methanol maser and find that it is associated with the 36.2-GHz maser emission. In contrast to the class I methanol masers found in Galactic star formation regions, the 44.1-GHz emission in NGC 253 is two orders of magnitude weaker than the 36.2-GHz masers. Both the 36.2- and 44.1-GHz emission is orders of magnitude stronger than expected from typical high-mass star formation regions. This demonstrates that the luminous class I methanol masers observed in NGC 253 are significantly different from those associated with Galactic star formation.

  7. Depletion of cdc-25.3, a Caenorhabditis elegans orthologue of cdc25, increases physiological germline apoptosis.

    Science.gov (United States)

    Sung, Minhee; Kawasaki, Ichiro; Shim, Yhong-Hee

    2017-07-01

    In Caenorhabditis elegans hermaphrodites, physiological germline apoptosis is higher in cdc-25.3 mutants than in wild-type. The elevated germline apoptosis in cdc-25.3 mutants seems to be induced by accumulation of double-stranded DNA breaks (DSBs). Both DNA damage and synapsis checkpoint genes are required to increase the germline apoptosis. Notably, the number of germ cells that lose P-granule components, PGL-1 and PGL-3, increase in cdc-25.3 mutants, and the increase in germline apoptosis requires the activity of SIR-2.1, a Sirtuin orthologue. These results suggest that elevation of germline apoptosis in cdc-25.3 mutants is induced by accumulation of DSBs, leading to a loss of PGL-1 and PGL-3 in germ cells, which promotes cytoplasmic translocation of SIR-2.1, and finally activates the core apoptotic machinery. © 2017 Federation of European Biochemical Societies.

  8. Californium-252 Program Equipment Evaluation

    Energy Technology Data Exchange (ETDEWEB)

    Chattin, Fred Rhea [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Wilson, Kenton [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Ezold, Julie G. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States)

    2017-12-01

    To successfully continue the 252Cf production and meet the needs of the customers, a comprehensive evaluation of the Building 7920 processing equipment was requested to identify equipment critical to the operational continuity of the program.

  9. Development and capabilities of the new 253 Ultra high resolution, gas source mass spectrometer

    Science.gov (United States)

    Clog, M. D.; Ellam, R. M.; Hilkert, A.; Schwieters, J. B.; Deerberg, M.

    2016-12-01

    The growing interest in clumped and position-specific isotope geochemistry drives the development of gas source mass spectrometers capable of overcoming the technical challenges that limits our capabilities. The main challenges is reaching a mass resolving power high enough to be able to resolve the species of interest from isobars (contaminants, isotopologues with different isotopes and products of ion source chemistry). Applications to natural samples also requires the ability to make measurements at the sub-permil level for low-intensity ion beams. It is thus also necessary for those instruments to have a high abundance sensitivity, high resolution to avoid the need for peak stripping schemes and a high stability of the signal intensities and peak positions in the image plane of the mass spectrometer. We present here the capabilities of the production series version of the ThermoFisher Scientific 253 Ultra, whose design is an iteration of the Caltech 253 Ultra prototype. It is a double-focusing, multi-collection instrument able to reach a mass resolving power of up to 48,000. Over 30 minutes, the standard deviation of the peak position at mass 44 was 20 micro a.m.u. (0.5 ppm). It is equipped with 9 Faraday cups (8 movable) and 4 ion counters (3 movable, the last one located behind a retardation lens). Without using the retardation lens, around mass 40, the abundance sensitivity at .5 a.m.u. is 1ppm, and at 3 a.m.u. drops to 100 ppb. One of movable Faraday cup and one of the movable ion counters have a narrow entrance slit, to allow for peak separation (for example, to measure separately 13CH3D and 12CD2H2). After integration on ion counters of beams ranging from 100 to 10⁵ cps for several hours, the standard error on the ratio of these peaks to ion beams measured on a Faraday cup was within 10% of the counting statistics error. Overall, the 253 Ultra is showing great potential for the development of clumped and position-specific isotope geochemistry.

  10. [Influence of indium net position on 253.7 nm resonance spectra line of electrodeless discharge lamps].

    Science.gov (United States)

    Dong, Jin-Yang; Zhang, Gui-Xin; Wang, Chang-Quan; Zou, Jun; Zhao, Ting

    2012-09-01

    As a kind of new electric light source, electrodeless discharge lamps (EDL) are based on high-frequency electromagnetic induction and nonpolar gas discharge. Visible light is emitted as a result of Hg 253.7 nm resonance spectrum line inspiring phosphor. The influence of indium net position on the Hg 253. 7 nm resonance spectral line was studied experimentally by atomic emission spectral analysis. It was found that the relative intensity of Hg 253.7 nm resonance spectral line is strongest when the indium net is located at both ends of coupling coil, weaker at middle and weakest when far away from coupling coil. It was inferred that there is an optimum indium net position for EDL, and the corresponding lighting effect is maximal. The results were qualitatively analyzed from the standpoint of gas discharge theory, combined with the finite element simulation of Maxwell 3D, which has instructive value for pattern design and parametric optimization of EDL.

  11. [Influence of cold spot temperature on 253.7 nm resonance spectra line of electrodeless discharge lamps].

    Science.gov (United States)

    Dong, Jin-yang; Zhang, Gui-xin; Wang, Chang-quan

    2012-01-01

    As a kind of new electric light source, electrodeless discharge lamps are of long life, low mercury and non-stroboscopic light. The lighting effect of electrodeless discharge lamps depends on the radiation efficiency of 253.7 nm resonance spectra line to a large extent. The influence of cold temperature on 253.7 nm resonance spectra line has been studied experimentally by atomic emission spectral analysis. It was found that the radiation efficiency of 253.7 nm resonance spectra line is distributed in a nearly normal fashion with the variation of cold spot temperature, in other words, there is an optimum cold spot temperature for an electrodeless discharge lamp. At last, the results of experiments were analyzed through gas discharge theory, which offers guidance to the improvement of lighting effect for electrodeless discharge lamps.

  12. In-beam study of 253No using the SAGE spectrometer

    Science.gov (United States)

    Mistry, A. K.; Herzberg, R.-D.; Greenlees, P. T.; Papadakis, P.; Auranen, K.; Butler, P. A.; Cox, D. M.; Garnsworthy, A. B.; Grahn, T.; Hauschild, K.; Jakobsson, U.; Joss, D. T.; Julin, R.; Ketelhut, S.; Konki, J.; Leino, M.; Lopez-Martens, A.; Page, R. D.; Pakarinen, J.; Peura, P.; Rahkila, P.; Sandzelius, M.; Scholey, C.; Simpson, J.; Seddon, D.; Sorri, J.; Stolze, S.; Thornhill, J.; Uusitalo, J.; Wells, D.

    2017-02-01

    The heavy actinide nucleus 253No ( Z = 102) was studied using the (S)ilicon (A)nd (Ge)rmanium (SAGE) spectrometer allowing simultaneous in-beam γ-ray and conversion electron spectroscopy at the accelerator laboratory of the University of Jyväskylä. Using the recoil-tagging technique, γ-electron coincidences have allowed for the extension of the level scheme in the lower-spin region of the yrast band. In addition, internal conversion coefficient (ICC) measurements to establish the multipolarity of transitions have been performed. Measurement of the interband-intraband branching ratios supports the assignment of the Nilsson band-head configuration 9/2-[734] assigned in previous studies. The study shows the viability of combined in-beam electron and γ-ray spectroscopy down to μb cross sections.

  13. In-beam study of {sup 253}No using the SAGE spectrometer

    Energy Technology Data Exchange (ETDEWEB)

    Mistry, A.K.; Herzberg, R.D.; Butler, P.A.; Cox, D.M.; Joss, D.T.; Page, R.D.; Seddon, D.; Thornhill, J.; Wells, D. [University of Liverpool, Oliver Lodge Laboratory, Liverpool (United Kingdom); Greenlees, P.T.; Papadakis, P.; Auranen, K.; Grahn, T.; Jakobsson, U.; Julin, R.; Konki, J.; Leino, M.; Pakarinen, J.; Peura, P.; Rahkila, P.; Sandzelius, M.; Scholey, C.; Sorri, J.; Stolze, S.; Uusitalo, J. [University of Jyvaskyla, Department of Physics, Jyvaskyla (Finland); Garnsworthy, A.B.; Ketelhut, S. [University of British Columbia, TRIUMF, Vancouver, British Columbia (Canada); Hauschild, K.; Lopez-Martens, A. [Universite Paris-Sud, CSNSM, CNRS, IN2P3, Orsay (France); Simpson, J. [STFC, Daresbury Laboratory, Daresbury, Warrington (United Kingdom)

    2017-02-15

    The heavy actinide nucleus {sup 253}No (Z = 102) was studied using the (S)ilicon (A)nd (Ge)rmanium (SAGE) spectrometer allowing simultaneous in-beam γ-ray and conversion electron spectroscopy at the accelerator laboratory of the University of Jyvaeskylae. Using the recoil-tagging technique, γ-electron coincidences have allowed for the extension of the level scheme in the lower-spin region of the yrast band. In addition, internal conversion coefficient (ICC) measurements to establish the multipolarity of transitions have been performed. Measurement of the interband-intraband branching ratios supports the assignment of the Nilsson band-head configuration 9/2{sup -}[734] assigned in previous studies. The study shows the viability of combined in-beam electron and γ-ray spectroscopy down to μb cross sections. (orig.)

  14. Postoperative irradiation for pterygium. Retrospective analysis of 1,253 patients from the Osaka University Hospital

    Energy Technology Data Exchange (ETDEWEB)

    Isohashi, F.; Inoue, T.; Xing, S.; Eren, C.B.; Inoue, T. [Dept. of Radiation Oncology, Osaka Univ. Graduate School of Medicine (Japan); Ozeki, S. [Genome Information Research Center, Osaka Univ. (Japan)

    2006-08-15

    Background and Purpose: Irradiation of ocular pterygium is considered a valuable treatment supplementation after surgical therapy. Since prospective randomized trials are scare and only limited patient data are available, the aim of this study was to evaluate the patient population treated with fractioned {sup 90}Sr irradiation after surgical pterygium resection. Patients and Methods: Between September 1993 and March 2001, 1,147 patients with pterygium lesions (1,320 lesions) were treated surgically and with {sup 90}Sr postoperative {beta}-irradiation. A total dose of 30 Gy was used for patients treated within 48 h after surgery, while those treated > 48 h postoperatively received a total dose of 35 Gy. A minimum follow-up period of 3 months was required for inclusion in the analysis, and 1,253 lesions were ultimately analyzed. Results: Recurrence of the pterygium after postoperative {sup 90}Sr irradiation was observed in 97 of 1,253 cases (7.7%). Statistical analysis (uni- and multivariate) revealed, that male gender, younger age (< 40 years), prior treatment (surgery and radiotherapy) and immediate irradiation (< 2 h after surgery) were negative predictors for local recurrence. Temporary radiotherapy-induced side effects were observed in 15.2% of patients, including moderate conjunctivitis, local pain, visual disturbance and photophobia or an increase in tear flow. However, no long-term serious side effects were documented. Conclusion: {sup 90}Sr irradiation of pterygium after surgery represents a safe and effective treatment option to prevent disease recurrence. The data obtained in this study indicate that a certain interval after surgery might improve therapy outcome. (orig.)

  15. En undersøgelse af de 253 første nyrestensbehandlinger med 3. generations Siemens Lithoskop™

    DEFF Research Database (Denmark)

    Kruckow, Line; Eldrup, Jesper

    Introduktion: Kandidatspecialets formål er at undersøge et års behandlinger af nyresten ved ny stenknuser, Siemens Lithoskop. Undersøgelsen fokuserer på hvorvidt stenstørrelse, BMI og stenplacering har indflydelse på stenfrihedsraten. Metode: Mellem 6/12-11 og 11/12-12 blev 253 behandlinger og be...

  16. G0.253 + 0.016: A Molecular Cloud Progenitor of an Arches-like Cluster

    Science.gov (United States)

    Longmore, Steven N.; Rathborne, Jill; Bastian, Nate; Alves, Joao; Ascenso, Joana; Bally, John; Testi, Leonardo; Longmore, Andy; Battersby, Cara; Bressert, Eli; Purcell, Cormac; Walsh, Andrew; Jackson, James; Foster, Jonathan; Molinari, Sergio; Meingast, Stefan; Amorim, A.; Lima, J.; Marques, R.; Moitinho, A.; Pinhao, J.; Rebordao, J.; Santos, F. D.

    2012-02-01

    Young massive clusters (YMCs) with stellar masses of 104-105 M ⊙ and core stellar densities of 104-105 stars per cubic pc are thought to be the "missing link" between open clusters and extreme extragalactic super star clusters and globular clusters. As such, studying the initial conditions of YMCs offers an opportunity to test cluster formation models across the full cluster mass range. G0.253 + 0.016 is an excellent candidate YMC progenitor. We make use of existing multi-wavelength data including recently available far-IR continuum (Herschel/Herschel Infrared Galactic Plane Survey) and mm spectral line (H2O Southern Galactic Plane Survey and Millimetre Astronomy Legacy Team 90 GHz Survey) data and present new, deep, multiple-filter, near-IR (Very Large Telescope/NACO) observations to study G0.253 + 0.016. These data show that G0.253 + 0.016 is a high-mass (1.3 × 105 M ⊙), low-temperature (T dust ~ 20 K), high-volume, and column density (n ~ 8 × 104 cm-3 N_{H_2} \\sim 4\\times 10^{23} cm-2) molecular clump which is close to virial equilibrium (M dust ~ M virial) so is likely to be gravitationally bound. It is almost devoid of star formation and, thus, has exactly the properties expected for the initial conditions of a clump that may form an Arches-like massive cluster. We compare the properties of G0.253 + 0.016 to typical Galactic cluster-forming molecular clumps and find it is extreme, and possibly unique in the Galaxy. This uniqueness makes detailed studies of G0.253 + 0.016 extremely important for testing massive cluster formation models.

  17. Manganese determination om minerals by activation analysis, using the californium-252 as a neutron source; Determinacao de manganes em minerios, por analise por ativacao, usando californio-252 como fonte de neutrons

    Energy Technology Data Exchange (ETDEWEB)

    Cardoso, Antonio

    1976-07-01

    Neutron Activation Analysis, using a Californium-252 neutron source, has been applied for the determination of manganese in ores such as pyrolusite, rodonite (manganese silicate)' and blending used in dry-batteries The favorable nuclear properties of manganese, such as high thermal neutron cross-section for the reaction {sup 55}Mn (n.gamma){sup 56} Mn, high concentration of manganese in the matrix and short half - life of {sup 56}Mn, are an ideal combination for non-destructive analysis of manganese in ores. Samples and standards of manganese dioxide were irradiated for about 20 minutes, followed by a 4 to 15 minutes decay and counted in a single channel pulse-height discrimination using a NaI(Tl) scintillation detector. Counting time was equal to 10 minutes. The interference of nuclear reactions {sup 56}Fe(n,p){sup 56}Mn and {sup 59} Co (n, {alpha}){sup 56} were studied, as well as problems in connection with neutron shadowing during irradiation, gamma-rays attenuation during counting and influence of granulometry of samples. One sample,was also analysed by wet-chemical method (sodium bismuthate) in order to compare results. As a whole, i t was shown that the analytical method of neutron activation for manganese in ores and blending, is a method simple, rapid and with good precision and accuracy. (author)

  18. Design of a homogeneous subcritical nuclear reactor based on thorium with a source of californium 252; Diseno de un reactor nuclear subcritico homogeneo a base de Torio con una fuente de Californio 252

    Energy Technology Data Exchange (ETDEWEB)

    Delgado H, C. E.; Vega C, H. R. [Universidad Autonoma de Zacatecas, Unidad Academica de Estudios Nucleares, Cipres No. 10, Fracc. La Penuela, 98068 Zacatecas, Zac. (Mexico); Sajo B, L., E-mail: ce_delgado89@hotmail.com [Universidad Simon Bolivar, Laboratorio de Fisica Nuclear, Apdo. 89000, 1080A Caracas (Venezuela, Bolivarian Republic of)

    2015-10-15

    Full text: One of the energy alternatives to fossil fuels which do not produce greenhouse gases is the nuclear energy. One of the drawbacks of this alternative is the generation of radioactive wastes of long half-life and its relation to the generation of nuclear materials to produce weapons of mass destruction. An option to these drawbacks of nuclear energy is to use Thorium as part of the nuclear fuel which it becomes in U{sup 233} when capturing neutrons, that is a fissile material. In this paper Monte Carlo methods were used to design a homogeneous subcritical reactor based on thorium. As neutron reflector graphite was used. The reactor core is homogeneous and is formed of 70% light water as moderator, 12% of enriched uranium UO{sub 2}(NO{sub 3}){sub 4} and 18% of thorium Th(NO{sub 3}){sub 4} as fuel. To start the nuclear fission chain reaction an isotopic source of californium 252 was used with an intensity of 4.6 x 10{sup 7} s{sup -1}. In the design the value of the effective multiplication factor, whose value turned out k{sub eff} <1 was calculated. Also, the neutron spectra at different distances from the source and the total fluence were calculated, as well as the values of the ambient dose equivalent in the periphery of the reactor. (Author)

  19. On the paleoenvironmental potential of 253 newly discovered pine stumps from Zurich, Switzerland

    Science.gov (United States)

    Reinig, Frederick; Nievergelt, Daniel; Esper, Jan; Friedrich, Michael; Helle, Gerhard; Hellmann, Lena; Kromer, Bernd; Morganti, Sandro; Pauly, Maren; Sookdeo, Adam; Tegel, Willy; Treydte, Kerstin; Wacker, Lukas; Büntgen, Ulf

    2017-04-01

    The transition from the last Ice Age to the early Holocene 15'000-10'000 BP represents a close natural analog to the ongoing and predicted rates of anthropogenic climate change. A reduced quality and quantity of high-resolution proxy archives during this period, however, limits our understanding of the magnitude and pace of Late Glacial (LG) environmental variability. Here, we present the world's best preserved, most replicated and oldest forest remains: A total of 253 subfossil pine stumps were recently discovered in Zurich. The combined approach of tree-ring and radiocarbon (14C) measurements results in an absolutely dated Preboreal Swiss tree-ring width chronology and eight floating chronologies. With tree ages ranging between 41 and 506 years, often including pith and bark, and a mean segment length of 163 years, this exceptional find is distributed over nearly 2'000 years between the Allerød and the Preboreal. Together with 200 previously collected LG pines from the greater Zurich region, this study sets a benchmark in terms of sample replication and dating precision for stable more dynamic climatic periods such as the Laacher See eruption, the Older and Younger Dryas. The paleoenvironmental significance would even increase when annually resolved 14C-measurements help fixing a major, Northern Hemispheric gap in the absolutely dated dendro time series during the Younger Dryas. While overcoming this interlude, our results further emphasize the importance of interdisciplinary research on these striking LG climatic shifts to better understand and assess their ecological and environmental impact.

  20. STAR FORMATION IN THE MASSIVE ''STARLESS'' INFRARED DARK CLOUD G0.253+0.016

    Energy Technology Data Exchange (ETDEWEB)

    Rodriguez, Luis F.; Zapata, Luis A., E-mail: lrodriguez@crya.unam.mx, E-mail: lzapata@crya.unam.mx [Centro de Radioastronomia y Astrofisica, UNAM, Apdo. Postal 3-72 (Xangari), 58089 Morelia, Michoacan (Mexico)

    2013-04-10

    G0.253+0.016 is a remarkable massive infrared dark cloud located within {approx}100 pc of the galactic center. With a high mass of 1.3 Multiplication-Sign 10{sup 5} M{sub Sun }, a compact average radius of {approx}2.8 pc, and a low dust temperature of 23 K, it has been believed to be a yet starless precursor to a massive Arches-like stellar cluster. We present sensitive JVLA 1.3 and 5.6 cm radio continuum observations that reveal the presence of three compact thermal radio sources projected against this cloud. These radio sources are interpreted as H II regions powered by {approx}B0.5 zero-age main sequence stars. We conclude that although G0.253+0.016 does not show evidence of O-type star formation, there are certainly early B-type stars embedded in it. We detect three more sources in the periphery of G0.253+0.016 with non-thermal spectral indices. We suggest that these sources may be related to the galactic center region and deserve further study.

  1. SPECTRAL ANALYSIS AND INTERPRETATION OF THE {gamma}-RAY EMISSION FROM THE STARBURST GALAXY NGC 253

    Energy Technology Data Exchange (ETDEWEB)

    Abramowski, A. [Institut fuer Experimentalphysik, Universitaet Hamburg, Luruper Chaussee 149, D-22761 Hamburg (Germany); Acero, F. [Laboratoire Univers et Particules de Montpellier, Universite Montpellier 2, CNRS/IN2P3, CC 72, Place Eugene Bataillon, F-34095 Montpellier Cedex 5 (France); Aharonian, F.; Bernloehr, K.; Bochow, A. [Max-Planck-Institut fuer Kernphysik, P.O. Box 103980, D-69029 Heidelberg (Germany); Akhperjanian, A. G. [National Academy of Sciences of the Republic of Armenia, Yerevan (Armenia); Anton, G.; Balzer, A.; Brucker, J. [Physikalisches Institut, Universitaet Erlangen-Nuernberg, Erwin-Rommel-Str. 1, D-91058 Erlangen (Germany); Barnacka, A. [Nicolaus Copernicus Astronomical Center, ul. Bartycka 18, 00-716 Warsaw (Poland); Becherini, Y. [APC, AstroParticule et Cosmologie, Universite Paris Diderot, CNRS/IN2P3, CEA/lrfu, Observatoire de Paris, Sorbonne Paris Cite, 10, rue Alice Domon et Leonie Duquet, F-75205 Paris Cedex 13 (France); Becker, J. [Institut fuer Theoretische Physik, Lehrstuhl IV: Weltraum und Astrophysik, Ruhr-Universitaet Bochum, D-44780 Bochum (Germany); Birsin, E. [Institut fuer Physik, Humboldt-Universitaet zu Berlin, Newtonstr. 15, D-12489 Berlin (Germany); Biteau, J.; Brun, F. [Laboratoire Leprince-Ringuet, Ecole Polytechnique, CNRS/IN2P3, F-91128 Palaiseau (France); Boisson, C. [LUTH, Observatoire de Paris, CNRS, Universite Paris Diderot, 5 Place Jules Janssen, F-92190 Meudon (France); Bolmont, J. [LPNHE, Universite Pierre et Marie Curie Paris 6, Universite Denis Diderot Paris 7, CNRS/IN2P3, 4 Place Jussieu, F-75252, Paris Cedex 5 (France); Bordas, P. [Institut fuer Astronomie und Astrophysik, Universitaet Tuebingen, Sand 1, D-72076 Tuebingen (Germany); Brun, P. [CEA Saclay, DSM/IRFU, F-91191 Gif-Sur-Yvette Cedex (France); Bulik, T., E-mail: stefan.ohm@le.ac.uk [Astronomical Observatory, The University of Warsaw, Al. Ujazdowskie 4, 00-478 Warsaw (Poland); Collaboration: H.E.S.S. Collaboration; and others

    2012-10-01

    Very high energy (VHE; E {>=} 100 GeV) and high-energy (HE; 100 MeV {<=} E {<=} 100 GeV) data from {gamma}-ray observations performed with the H.E.S.S. telescope array and the Fermi-LAT instrument, respectively, are analyzed in order to investigate the non-thermal processes in the starburst galaxy NGC 253. The VHE {gamma}-ray data can be described by a power law in energy with differential photon index {Gamma} = 2.14 {+-} 0.18{sub stat} {+-} 0.30{sub sys} and differential flux normalization at 1 TeV of F{sub 0} = (9.6 {+-} 1.5{sub stat}(+ 5.7, -2.9){sub sys}) Multiplication-Sign 10{sup -14} TeV{sup -1} cm{sup -2} s{sup -1}. A power-law fit to the differential HE {gamma}-ray spectrum reveals a photon index of {Gamma} 2.24 {+-} 0.14{sub stat} {+-} 0.03{sub sys} and an integral flux between 200 MeV and 200 GeV of F(0.2-200 GeV) = (4.9 {+-} 1.0{sub stat} {+-} 0.3{sub sys}) Multiplication-Sign 10{sup -9} cm{sup -2} s{sup -1}. No evidence for a spectral break or turnover is found over the dynamic range of both the LAT instrument and the H.E.S.S. experiment: a combined fit of a power law to the HE and VHE {gamma}-ray data results in a differential photon index {Gamma} = 2.34 {+-} 0.03 with a p-value of 30%. The {gamma}-ray observations indicate that at least about 20% of the energy of the cosmic rays (CRs) capable of producing hadronic interactions is channeled into pion production. The smooth alignment between the spectra in the HE and VHE {gamma}-ray domain suggests that the same transport processes dominate in the entire energy range. Advection is most likely responsible for charged particle removal from the starburst nucleus from GeV to multiple TeV energies. In a hadronic scenario for the {gamma}-ray production, the single overall power-law spectrum observed would therefore correspond to the mean energy spectrum produced by the ensemble of CR sources in the starburst region.

  2. Physicochemical properties of binary solutions of propylene carbonate-acetonitrile in the range of 253.15-313.15 K

    Science.gov (United States)

    Tyunina, E. Yu.; Chekunova, M. D.

    2017-05-01

    The density, dynamic viscosity, and dielectric constant of propylene carbonate solutions with acetonitrile are measured over the composition of a mixed solvent at temperatures of 253.15, 273.15, 293.15, and 313.15 K. The molar volume, molar viscosity, and molar capacity of a mixture of propylene carbonate-acetonitrile and an excess amount of it are calculated. The effect the temperature and composition of the mixture have on the excess molar properties is discussed. A linear correlation is observed between the values of the molar fluidity, capacity, polarization, and molar volume of the studied system.

  3. Analysis alloy quasicrystalline Al62,2 Cu25,3 Fe12,5 for steam reforming of methanol

    Directory of Open Access Journals (Sweden)

    Lourdes Cristina Lucena Agostinho Jamshidi

    2015-10-01

    Full Text Available This study shows a good performance of quasicrystal Al62,2Cu25,3Fe12,5 as catalyst in catalytic reactions. This metal catalyst, without being leached with acid or base, with dry stoichiometric composition, Al62,2Cu25,3Fe12,5 is revealed among the reactions which occurred to be a partial oxidation; and promoted the formation of products: methanol, methanal + methanoic acid, water and dimethyl ether. For this research were used such experimental techniques as X-ray Diffraction (XRD to follow the evolution of the alloy phase, the Scanning Electron Microscopy (SEM that provides the study of surface microstructure, and Transmission Electron Microscopy (MET. All these techniques study the morphology of the internal phase, and defect a quasicrystalline nucleus. Catalytic tests of methanol conversion and selectivity intermediate products were obtained using this catalyst quasicrystal. The activity and stability of quasicrystal catalyst for reforming of methanol vapor show sufficient growth compared to the other catalysts. Fe and Cu species are highly dispersed in the homogeneous layer of quasicrystal catalyst which increase the catalytic activity and suppress the aggregation of Cu particles. We suppose that the quasicrystal can be a good catalyst used in a catalytic steam reforming, with high catalytic activity and excellent thermal stability.

  4. Hypofibrinogenaemia caused by a novel FGG missense mutation (W253C) in the gamma chain globular domain impairing fibrinogen secretion.

    Science.gov (United States)

    Vu, D; de Moerloose, P; Batorova, A; Lazur, J; Palumbo, L; Neerman-Arbez, M

    2005-09-01

    Inherited disorders of fibrinogen are rare and affect either the quantity (hypofibrinogenaemia and afibrinogenaemia) or the quality of the circulating fibrinogen (dysfibrinogenaemia). Extensive allelic heterogeneity has been found for all three disorders: in congenital afibrinogenaemia >30 mutations, the majority in FGA, have been identified in homozygosity or in compound heterozygosity. Several mutations have also been identified in patients with hypofibrinogenaemia; many of these are heterozygous carriers of afibrinogenaemia null mutations. To report the case of a patient from Slovakia diagnosed with hypofibrinogenaemia characterised by fibrinogen concentrations of around 0.7 g/l. The patient was found to be heterozygous for a novel missense mutation W253C (W227C in the mature protein) in the C-terminal globular domain of the fibrinogen gamma chain. Co-expression of the W253C FGG mutant cDNA (fibrinogen Bratislava) in combination with wild-type FGA and FGB cDNAs showed that fibrinogen molecules containing the mutant gamma chain can assemble intracellularly but are not secreted into the media, confirming the causative nature of the identified mutation. Current analysis of fibrinogen Bratislava indicates that the domains important for the processes of hexamer assembly and hexamer secretion should not be considered as strictly restricted to one or other fibrinogen chain.

  5. The N253F mutant structure of trehalose synthase from Deinococcus radiodurans reveals an open active-site topology.

    Science.gov (United States)

    Chow, Sih Yao; Wang, Yung Lin; Hsieh, Yu Chiao; Lee, Guan Chiun; Liaw, Shwu Huey

    2017-11-01

    Trehalose synthase (TS) catalyzes the reversible conversion of maltose to trehalose and belongs to glycoside hydrolase family 13 (GH13). Previous mechanistic analysis suggested a rate-limiting protein conformational change, which is probably the opening and closing of the active site. Consistently, crystal structures of Deinococcus radiodurans TS (DrTS) in complex with the inhibitor Tris displayed an enclosed active site for catalysis of the intramoleular isomerization. In this study, the apo structure of the DrTS N253F mutant displays a new open conformation with an empty active site. Analysis of these structures suggests that substrate binding induces a domain rotation to close the active site. Such a substrate-induced domain rotation has also been observed in some other GH13 enzymes.

  6. Apert Syndrome: Molecularly Confirmed C.758C>G (P.Pro253Arg) in FGFR2

    Energy Technology Data Exchange (ETDEWEB)

    Cha Gon, Lee, E-mail: leechagon@eulji.ac.kr [Department of Pediatrics, Eulji General Hospital, College of Medicine, Eulji University, 68 Hangeulbiseok-ro, Nowon-gu, Seoul 139-711 (Korea, Republic of)

    2016-03-21

    A 5-day-old girl was referred to our clinic for evaluation of congenital malformations. She was identified with a pathogenic mutation c.758C>G (p.Pro253Arg) in FGFR2 gene using targeted exome sequencing. The de novo mutation was confirmed with Sanger sequencing in the patient and her parents. She showed occipital plagiocephaly with frontal bossing (Figure A and B). Skull frontal and lateral radiography revealed fusion of most of the sutures except coronal suture, with convolutional markings (Figure D and E). She had complete cleft palate (Figure C). Her fused bilateral hands showed type II syndactyly with complete syndactyly between the ring and the little fingers (Figure F1-F3). Both toes were simple syndactyly with side-to-side fusion of skin (Figure G1-)

  7. Assessment of the clinical relevance of 17q25.3 copy number and three-dimensional telomere organization in non-small lung cancer patients.

    Science.gov (United States)

    Sunpaweravong, Patrapim; Thu, Kelsie L; Lam, Wan L; Mai, Sabine

    2016-04-01

    To identify potential biomarkers that may provide new therapeutic targets or prognostic indicators for non-small cell lung cancer (NSCLC), we investigated the three-dimensional (3D) organization of telomeres and cytoband 17q25.3 copy number in NSCLC tissues. NSCLC paraffin-embedded tissue specimens from 18 patients were assessed for 3D telomere organization by 3D nuclear telomere imaging followed by quantitative analysis. Patients were stratified by smoking, histology, and EGFR status. Cytoband 17q25.3 was examined by fluorescent in situ hybridization. Data from comparative genomic hybridization and/or single nucleotide polymorphism arrays for cytoband 17q25.3 were obtained and correlated with Q-FISH and 3D telomere results. 3D telomeric profiling demonstrated that the smokers, EGFR-negative, and squamous cell carcinoma subgroups tended to have higher numbers of lower-intensity telomeres, indicative of shorter telomeres, as well as higher numbers of telomeric aggregations compared to non-smokers, EGFR-positive, and adenocarcinomas, respectively. Gains of cytoband 17q25.3 in conjunction with an increase in the control region 17p11.2 were observed in 7 of 18 (38.9 %) patients, reflecting a gain of chromosome 17. Clonal gains of cytoband 17q25.3 were observed in 11 of 18 (61 %) patients, highlighting a potential biological significance for the genes in this region in NSCLC tumourigenesis. The 3D telomere profiles may differentiate NSCLC patients with different histologies, EGFR, and smoking statuses, rendering them a potential biomarker for distinguishing these clinically relevant histological and molecular subtypes of lung cancer. Highly frequent clonal gain of cytoband 17q25.3 was also demonstrated, suggesting an important biological role for the genes in this region.

  8. Diverse Nuclear Star-forming Activities in the Heart of NGC 253 Resolved with 10-pc-scale ALMA Images

    Science.gov (United States)

    Ando, Ryo; Nakanishi, Kouichiro; Kohno, Kotaro; Izumi, Takuma; Martín, Sergio; Harada, Nanase; Takano, Shuro; Kuno, Nario; Nakai, Naomasa; Sugai, Hajime; Sorai, Kazuo; Tosaki, Tomoka; Matsubayashi, Kazuya; Nakajima, Taku; Nishimura, Yuri; Tamura, Yoichi

    2017-11-01

    We present an 8 pc × 5 pc resolution view of the central ˜200 pc region of the nearby starburst galaxy NGC 253, based on ALMA Band 7 (λ ≃ 0.85 {mm} or ν ˜ 350 GHz) observations covering 11 GHz. We resolve the nuclear starburst of NGC 253 into eight dusty star-forming clumps, 10 pc in scale, for the first time. These clumps, each of which contains (4-10) × {10}4 {M}⊙ of dust (assuming that the dust temperature is 25 K) and up to 6× {10}2 massive (O5V) stars, appear to be aligned in two parallel ridges, while they have been blended in previous studies. Despite the similarities in sizes and dust masses of these clumps, their line spectra vary drastically from clump to clump, although they are separated by only ˜10 pc. Specifically, one of the clumps, Clump 1, exhibits line-confusion-limited spectra with at least 36 emission lines from 19 molecules (including CH3OH, HNCO, H2CO, CH3CCH, H2CS, and H3O+) and a hydrogen recombination line (H26α), while far fewer kinds of molecular lines are detected in some other clumps where fragile species, such as complex organic molecules and HNCO, completely disappear from their spectra. We demonstrate the existence of hot molecular gas ({T}{rot}({{SO}}2)=90+/- 11 K) in the former clump, which suggests that the hot and chemically rich environments are localized within a 10-pc-scale star-forming clump.

  9. Two unrelated children with overlapping 6q25.3 deletions, motor speech disorders, and language delays.

    Science.gov (United States)

    Peter, Beate; Lancaster, Hope; Vose, Caitlin; Fares, Amna; Schrauwen, Isabelle; Huentelman, Matthew

    2017-10-01

    Interstitial and terminal 6q25 deletions are associated with developmental delays, hypotonia, eye pathologies, craniofacial dysmorphologies, and structural brain anomalies. In most cases, speech and language deficits are not described in detail. We report on a case (Patient 1, age 7 years) with a de novo 6q25.3-qter deletion, 11.1 Mb long and encompassing 108 genes, and a case (Patient 2, age 5 years) with an inherited interstitial 6q25.3 deletion, located within Patient 1's deletion region and 403 kb long, the smallest 6q25 deletion reported to date. Both children have hypotonia, motor speech disorders, and expressive language delays. Patient 1's speech was characterized by childhood apraxia of speech (CAS) and dysarthria. Other findings include developmental delay, ataxic cerebral palsy, optic nerve dysplagia, and atypical brain morphologies regarding the corpus callosum and gyration patterns, a clinical profile that closely matches a previously reported case with a nearly identical deletion. Patient 2 had speech characterized by CAS and typical nonverbal processing abilities. His father, a carrier, had typical speech and language but showed difficulties with complex motor speech and hand motor tasks, similar to other adults with residual signs of CAS. The small deletion in this family contains the IGF2R-AIRN-SLC22A2-SLC22A3 gene cluster, which is associated with imprinting and maternal-specific expression of Igf2R, Slc22a2, and Slc22a3 in mice, whereas imprinting in humans is a polymorphic trait. The shared phenotypes in the two patients might be associated with the deletion of the gene cluster. © 2017 Wiley Periodicals, Inc.

  10. Spatially resolving a starburst galaxy at hard X-ray energies: NuSTAR, CHANDRA, AND VLBA observations of NGC 253

    DEFF Research Database (Denmark)

    Wik, D. R.; Lehmer, B. D.; Hornschemeier, A. E.

    2014-01-01

    Prior to the launch of NuSTAR, it was not feasible to spatially resolve the hard (E > 10 keV) emission from galaxies beyond the Local Group. The combined NuSTAR data set, comprised of three ~165 ks observations, allows spatial characterization of the hard X-ray emission in the galaxy NGC 253 for ...

  11. Study of cyclic oxidation for stainless steels AISI 309 T 253 M A, with low additions of cerium; Estudio de la oxidacion ciclica de los aceros inoxidables AISI 309 T 253 MA, con pequenas adiciones de Cerio

    Energy Technology Data Exchange (ETDEWEB)

    Velazquez F, G.L.; Martinez, M.; Ruiz, A. [Universidad Nacional Experimental Politecnica (UNEXPO) - Vicerrectorado de Puerto Ordaz, Centro de Estudios de Corrosion. Puerto Ordaz. venezuela (Venezuela)

    1998-12-31

    It has been detected that the addition of small amounts (<1%) of the so called `reactive elements` such as Cerium to Fe-Cr alloys that was utilized in oxidating environment at high temperatures improving its resistance to oxidation under isothermal and cyclic conditions. In this work, it was evaluated the behavior under cyclic oxidation conditions for an austenitic stainless steel at chromium-nickel (253MA) with cerium addition, and comparing it with the AISI 310S austenitic stainless steel. The cyclic oxidation essays consist of five cycles by 24 hours each one, following of a cooling in air until ambient temperature from the temperatures of 850, 900 and 950 Centigrade, registering the gain mass of the specimen at end of each cycle. In order to this were prepared samples with dimensions of 20 mm. x 10 mm. x 1 mm. Later to the oxidation essays was evaluated the morphology of the corrosion products layer by scanning electron microscopy. The present phases were identified by X-ray diffraction and by chemical microanalysis by Dispersive energy (EDAX). The results obtained show that the steel with cerium addition, presents a higher adherence and resistance to the spalling noting that the cerium promotes the casting anchor of the oxides layer to matrix and by reducing the grain size of the layer improving its plasticity. Additionally the cerium promotes the preferential oxidation of the forming elements of protective layers like the chromium. (Author)

  12. Creep rupture of the 21Cr 11Ni Si N REM stainless steel 253MA - Data collation and assessment

    Energy Technology Data Exchange (ETDEWEB)

    Linde, Lars; Sandstroem, R.

    1998-02-01

    Creep data for the heat resistant austenitic stainless steel 253MA (21Cr 11Ni 1.7Si 0.17N REM) have been collated and assessed as part of the work in the European Creep Collaborative Committee (ECCC) Working Group (WG) 3.3. The data were assessed using the guidelines provided by ECCC WG 1. In the present assessment, two methods using different types of time-temperature parameters (TTP) have been utilised. One of the methods, the Free Temperature Method (FTM) represents a new approach, which takes into account the slope changes in the stress-time relationships with temperature. The other method, the Averaging Method (AM), was based on conventional TTPs. Post-assessment tests, also proposed by ECCC, were applied to the results of both methods. The requirements in the post-assessment tests were all met by the AM and, except in one case, by the FTM. However, creep rupture values from the FTM for this steel were found to provide and accurate description of the material behaviour and were recommended for use in the European Standard 3 refs, 15 figs, 3 tabs

  13. Effect of UV irradiation (253.7 nm) on free Legionella and Legionella associated with its amoebae hosts.

    Science.gov (United States)

    Cervero-Aragó, Sílvia; Sommer, Regina; Araujo, Rosa M

    2014-12-15

    Water systems are the primary reservoir for Legionella spp., where the bacteria live in association with other microorganisms, such as free-living amoebae. A wide range of disinfection treatments have been studied to control and prevent Legionella colonization but few of them were performed considering its relation with protozoa. In this study, the effectiveness of UV irradiation (253.7 nm) using low-pressure lamps was investigated as a disinfection method for Legionella and amoebae under controlled laboratory conditions. UV treatments were applied to 5 strains of Legionella spp., 4 strains of free-living amoeba of the genera Acanthamoeba and Vermamoeba, treating separately trophozoites and cysts, and to two different co-cultures of Legionella pneumophila with the Acanthamoeba strains. No significant differences in the UV inactivation behavior were observed among Legionella strains tested which were 3 logs reduced for fluences around 45 J/m(2). UV irradiation was less effective against free-living amoebae; which in some cases required up to 990 J/m(2) to obtain the same population reduction. UV treatment was more effective against trophozoites compared to cysts; moreover, inactivation patterns were clearly different between the genus Acanthamoeba and Vermamoeba. For the first time data about Vermamoeba vermiformis UV inactivation has been reported in a study. Finally, the results showed that the association of L. pneumophila with free-living amoebae decreases the effectiveness of UV irradiation against the bacteria in a range of 1.5-2 fold. That fact demonstrates that the relations established between different microorganisms in the water systems can modify the effectiveness of the UV treatments applied. Copyright © 2014 Elsevier Ltd. All rights reserved.

  14. Severe intellectual disability, West syndrome, Dandy-Walker malformation, and syndactyly in a patient with partial tetrasomy 17q25.3.

    Science.gov (United States)

    Hackmann, Karl; Stadler, Anja; Schallner, Jens; Franke, Kathlen; Gerlach, Eva-Maria; Schrock, Evelin; Rump, Andreas; Fauth, Christine; Tinschert, Sigrid; Oexle, Konrad

    2013-12-01

    We report on a de novo 0.5 Mb triplication (partial tetrasomy) of chromosome 17q25.3 in a 10-year-old girl with severe intellectual disability, infantile seizures (West syndrome), moderate hearing loss, Dandy-Walker malformation, microcephaly, craniofacial dysmorphism, striking cutaneous syndactyly (hands 3-4, feet 2-3), joint laxity, and short stature. The triplication resulted from the unusual combination of a terminal duplication at 17qter and a cryptic translocation of an extra copy of the same segment onto chromosome 10qter. The breakpoint at 17q25.3 was located within the FOXK2 gene. SNP chip analysis suggested that the rearrangement occurred during paternal meiosis involving both paternal chromosomes 17. © 2013 Wiley Periodicals, Inc.

  15. Substrate binds in the S1 site of the F253A mutant of LeuT, a neurotransmitter sodium symporter homologue

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Hui; Gouaux, Eric (Oregon HSU)

    2012-10-10

    LeuT serves as the model protein for understanding the relationships between structure, mechanism and pharmacology in neurotransmitter sodium symporters (NSSs). At the present time, however, there is a vigorous debate over whether there is a single high-affinity substrate site (S1) located at the original, crystallographically determined substrate site or whether there are two high-affinity substrates sites, one at the primary or S1 site and the other at a second site (S2) located at the base of the extracellular vestibule. In an effort to address the controversy over the number of high-affinity substrate sites in LeuT, one group studied the F253A mutant of LeuT and asserted that in this mutant substrate binds exclusively to the S2 site and that 1 mM clomipramine entirely ablates substrate binding to the S2 site. Here we study the binding of substrate to the F253A mutant of LeuT using ligand binding and X-ray crystallographic methods. Both experimental methods unambiguously show that substrate binds to the S1 site of the F253A mutant and that binding is retained in the presence of 1 mM clomipramine. These studies, in combination with previous work, are consistent with a mechanism ofr LeuT that involves a single high-affinity substrate binding site.

  16. Nustar and Chandra Insight into the Nature of the 3-40 Kev Nuclear Emission in Ngc 253

    Science.gov (United States)

    Lehmer, Bret D.; Wik, Daniel R.; Hornschemeier, Ann E.; Ptak, Andrew; Antoniu, V.; Argo, M.K.; Bechtol, K.; Boggs, S.; Christensen, F.E.; Craig, W.W.; hide

    2013-01-01

    We present results from three nearly simultaneous Nuclear Spectroscopic Telescope Array (NuSTAR) and Chandra monitoring observations between 2012 September 2 and 2012 November 16 of the local star-forming galaxy NGC 253. The 3-40 kiloelectron volt intensity of the inner approximately 20 arcsec (approximately 400 parsec) nuclear region, as measured by NuSTAR, varied by a factor of approximately 2 across the three monitoring observations. The Chandra data reveal that the nuclear region contains three bright X-ray sources, including a luminous (L (sub 2-10 kiloelectron volt) approximately few × 10 (exp 39) erg per s) point source located approximately 1 arcsec from the dynamical center of the galaxy (within the sigma 3 positional uncertainty of the dynamical center); this source drives the overall variability of the nuclear region at energies greater than or approximately equal to 3 kiloelectron volts. We make use of the variability to measure the spectra of this single hard X-ray source when it was in bright states. The spectra are well described by an absorbed (power-law model spectral fit value, N(sub H), approximately equal to 1.6 x 10 (exp 23) per square centimeter) broken power-law model with spectral slopes and break energies that are typical of ultraluminous X-ray sources (ULXs), but not active galactic nuclei (AGNs). A previous Chandra observation in 2003 showed a hard X-ray point source of similar luminosity to the 2012 source that was also near the dynamical center (Phi is approximately equal to 0.4 arcsec); however, this source was offset from the 2012 source position by approximately 1 arcsec. We show that the probability of the 2003 and 2012 hard X-ray sources being unrelated is much greater than 99.99% based on the Chandra spatial localizations. Interestingly, the Chandra spectrum of the 2003 source (3-8 kiloelectron volts) is shallower in slope than that of the 2012 hard X-ray source. Its proximity to the dynamical center and harder Chandra spectrum

  17. Biological, chemical and other data collected aboard the THOMAS G. THOMPSON during cruise TN253 in the North Pacific Ocean from 2010-08-26 to 2010-09-07 (NODC Accession 0104358)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NODC accession 0104358 includes biological, chemical, optical, physical and underway data collected aboard the THOMAS G. THOMPSON during cruise TN253 in the North...

  18. Safety assessment of the butyrate-producing Butyricicoccus pullicaecorum strain 25-3(T), a potential probiotic for patients with inflammatory bowel disease, based on oral toxicity tests and whole genome sequencing.

    Science.gov (United States)

    Steppe, Marjan; Van Nieuwerburgh, Filip; Vercauteren, Griet; Boyen, Filip; Eeckhaut, Venessa; Deforce, Dieter; Haesebrouck, Freddy; Ducatelle, Richard; Van Immerseel, Filip

    2014-10-01

    Inflammatory bowel disease (IBD) is a chronic inflammation of the digestive tract, characterized by dysbiosis of the intestinal microbiota. Probiotics have been suggested as a strategy to reduce active disease or extend remission. We isolated and characterized the butyrate-producing strain Butyricicoccus pullicaecorum 25-3(T) and identified it as a potential probiotic for patients with IBD. To evaluate the safety of 25-3(T) for use in humans, we conducted a standard acute oral toxicity test and a 28-day repeated oral dose toxicity test. The complete genome of B. pullicaecorum 25-3(T) was sequenced to search for virulence factors and antibiotic resistance determinants. The minimum inhibitory concentration (MIC) of 21 antimicrobials was determined. Results showed no adverse effects in the oral toxicity tests. B. pullicaecorum 25-3(T) is resistant against aminoglycosides and trimethoprim. The genome of 25-3(T) contains no virulence factors, one gene related to harmful metabolites and 52 sequences with high similarity to antimicrobial and toxic compound resistance genes, that did not correspond with a resistant phenotype. This first report of a safety assessment of a butyrate-producing strain from Clostridium cluster IV shows that B. pullicaecorum 25-3(T) is a non-pathogenic strain, but carries antibiotic resistance genes with the risk of transfer, that need further investigation. Copyright © 2014 Elsevier Ltd. All rights reserved.

  19. Survey of Water and Ammonia in Nearby Galaxies (SWAN): Resolved Ammonia Thermometry, and Water and Methanol Masers in the Nuclear Starburst of NGC 253

    Science.gov (United States)

    Gorski, Mark; Ott, Jürgen; Rand, Richard; Meier, David S.; Momjian, Emmanuel; Schinnerer, Eva

    2017-06-01

    We present Karl G. Jansky Very Large Array molecular line observations of the nearby starburst galaxy NGC 253, from SWAN, the Survey of Water and Ammonia in Nearby galaxies. SWAN is a molecular line survey at centimeter wavelengths designed to reveal the physical conditions of star-forming gas over a range of star-forming galaxies. NGC 253 has been observed in four 1 GHz bands from 21 to 36 GHz at 6″ ˜ 100 pc) spatial and 3.5 km s-1 spectral resolution. In total we detect 19 transitions from 7 molecular and atomic species. We have targeted the metastable inversion transitions of ammonia (NH3) from (1, 1) to (5, 5) and the (9, 9) line, the 22.2 GHz water (H2O) ({6}16{--}{5}23) maser, and the 36.1 GHz methanol (CH3OH) ({4}-1{--}{3}0) maser. Using NH3 as a thermometer, we present evidence for uniform heating over the central kpc of NGC 253. The molecular gas is best described by a two kinetic temperature model with a warm 130 K and a cooler 57 K component. A comparison of these observations with previous ALMA results suggests that the molecular gas is not heated in photon-dominated regions or shocks. It is possible that the gas is heated by turbulence or cosmic rays. In the galaxy center we find evidence for NH3(3, 3) masers. Furthermore, we present velocities and luminosities of three water maser features related to the nuclear starburst. We partially resolve CH3OH masers seen at the edges of the bright molecular emission, which coincides with expanding molecular superbubbles. This suggests that the masers are pumped by weak shocks in the bubble surfaces.

  20. The 253-kb inversion and deep intronic mutations in UNC13D are present in North American patients with familial hemophagocytic lymphohistiocytosis 3.

    Science.gov (United States)

    Qian, Yaping; Johnson, Judith A; Connor, Jessica A; Valencia, C Alexander; Barasa, Nathaniel; Schubert, Jeffery; Husami, Ammar; Kissell, Diane; Zhang, Ge; Weirauch, Matthew T; Filipovich, Alexandra H; Zhang, Kejian

    2014-06-01

    The mutations in UNC13D are responsible for familial hemophagocytic lymphohistiocytosis (FHL) type 3. A 253-kb inversion and two deep intronic mutations, c.118-308C > T and c.118-307G > A, in UNC13D were recently reported in European and Asian FHL3 patients. We sought to determine the prevalence of these three non-coding mutations in North American FHL patients and evaluate the significance of examining these new mutations in genetic testing. We performed DNA sequencing of UNC13D and targeted analysis of these three mutations in 1,709 North American patients with a suspected clinical diagnosis of hemophagocytic lymphohistiocytosis (HLH). The 253-kb inversion, intronic mutations c.118-308C > T and c.118-307G > A were found in 11, 15, and 4 patients, respectively, in which the genetic basis (bi-allelic mutations) explained 25 additional patients. Taken together with previously diagnosed FHL3 patients in our HLH patient registry, these three non-coding mutations were found in 31.6% (25/79) of the FHL3 patients. The 253-kb inversion, c.118-308C > T and c.118-307G > A accounted for 7.0%, 8.9%, and 1.3% of mutant alleles, respectively. Significantly, eight novel mutations in UNC13D are being reported in this study. To further evaluate the expression level of the newly reported intronic mutation c.118-307G > A, reverse transcription PCR and Western blot analysis revealed a significant reduction of both RNA and protein levels suggesting that the c.118-307G > A mutation affects transcription. These specified non-coding mutations were found in a significant number of North American patients and inclusion of them in mutation analysis will improve the molecular diagnosis of FHL3. © 2014 Wiley Periodicals, Inc.

  1. Patients with high-bone-mass phenotype owing to Lrp5-T253I mutation have low plasma levels of serotonin

    DEFF Research Database (Denmark)

    Frost, Morten; Andersen, Tom E.; Yadav, Vijay

    2010-01-01

    The Lrp5 gene is a major determinant of bone mass accrual. It has been demonstrated recently to achieve this function by hampering the synthesis of gut-derived serotonin, which is a powerful inhibitor of bone formation. In this study we analyzed plasma serotonin levels in patients with a high......-bone-mass (HBM) phenotype owing to gain-of-function mutation of Lrp5 (T253I). A total of 9 HBM patients were compared with 18 sex- and age-matched controls. In HBM patients, the serotonin concentrations in platelet-poor plasma were significantly lower than in the controls (mean +/- SEM: 2.16 +/- 0.28 ng....../mL versus 3.51 +/- 0.49 ng/mL, respectively, p Lrp5 in humans. (c) 2010 American Society for Bone and Mineral Research....

  2. Rapid detection of de novo P253R mutation in FGFR2 using uncultured amniocytes in a pregnancy affected by polyhydramnios, Blake's pouch cyst, and Apert syndrome.

    Science.gov (United States)

    Chen, Chih-Ping; Su, Yi-Ning; Chang, Tung-Yao; Chern, Schu-Rern; Chen, Chen-Yu; Su, Jun-Wei; Wang, Wayseen

    2013-06-01

    To present prenatal ultrasound and molecular genetic diagnosis of Apert syndrome. A 30-year-old, gravida 3, para 2 woman was referred for genetic counseling at 32 weeks of gestation because of polyhydramnios and craniofacial and digital abnormalities in the fetus. She had undergone amniocentesis at 18 weeks of gestation because of maternal anxiety. Results of amniocentesis revealed a karyotype of 46,XX. A prenatal ultrasound at 32 weeks of gestation revealed a female fetus with a fetal biometry equivalent to 32 weeks, polyhydramnios with an increased amniotic fluid index of 26.1 cm, frontal bossing, midface hypoplasia, hypertelorism, Blake's pouch cyst with an apparent posterior fossa cyst in communication with the fourth ventricle on axial images, digital fusion, and bilateral syndactyly of the hands and feet. A DNA testing for the FGFR2 gene was immediately performed using uncultured amniocytes obtained by repeated amniocentesis, which revealed a heterozygous c.758C>G, CCT>CGT transversion leading to a p.Pro253Arg (P253R) mutation in the FGFR2 gene. Subsequently, a diagnosis of Apert syndrome was made. Molecular analysis of the FGFR2 gene in the parents did not reveal such a mutation. The fetus postnatally manifested frontal bossing, midface hypoplasia, and bilateral syndactyly of the hands (mitten hands) and feet. Prenatal diagnosis of polyhydramnios, frontal bossing, and midface hypoplasia associated with brain and digital abnormalities should include a differential diagnosis of Apert syndrome. A molecular analysis of FGFR2 using uncultured amniocytes is useful for rapid confirmation of Apert syndrome at prenatal diagnosis. Copyright © 2013. Published by Elsevier B.V.

  3. Novel metal-organic and supramolecular 3D frameworks constructed from flexible biphenyl-2,5,3‧-tricarboxylate blocks: Synthesis, structural features and properties

    Science.gov (United States)

    You, Ao; Li, Yu; Zhang, Ze-Min; Zou, Xun-Zhong; Gu, Jin-Zhong; Kirillov, Alexander M.; Chen, Jin-Wei; Chen, Yun-Bo

    2017-10-01

    Biphenyl-2,5,3‧-tricarboxylic acid (H3L) was selected as an unexplored tricarboxylate building block and applied for the hydrothermal synthesis of three novel coordination compounds, namely a 0D tetramer [Co4(HL)2(μ3-HL)2(phen)6(H2O)2]·3H2O (1) and two 3D metal-organic frameworks (MOFs) [Cd3(μ5-L)(μ6-L)(py)(μ-H2O)2(H2O)]n·H2O (2) and [Zn3(μ4-L)2(2,2‧-bpy)(μ-4,4‧-bpy)]n·2H2O (3). These products were easily generated in aqueous medium from the corresponding metal(II) chlorides, H3L, and various N-donor ancillary ligands, selected from 1,10-phenanthroline (phen), pyridine (py), 2,2‧-bipyridine (2,2‧-bpy), and 4,4‧-bipyridine (4,4‧-bpy). Compounds 1-3 were isolated as stable crystalline solids and were fully characterized by IR and UV-vis spectroscopy, elemental, thermogravimetric (TGA), powder (PXRD) and single-crystal X-ray diffraction analyses. Compound 1 possesses a discrete tetracobalt(II) structure, which is extended into a 3D H-bonded network with the pcu topology. In contrast, MOF 2 discloses a very complex trinodal 4,5,12-connected net with an undocumented topology, while MOF 3 features the nce/I topological framework. The magnetic (for 1) and luminescence (for 2 and 3) properties were also studied and discussed. The present study thus widens a still very limited family of metal-organic and supramolecular frameworks driven by flexible biphenyl-2,5,3‧-tricarboxylate building blocks.

  4. Familial insertion (3;5)(q25.3;q22.1q31.3) with deletion or duplication of chromosome region 5q22.1-5q31.3 in ten unbalanced carriers.

    NARCIS (Netherlands)

    Arens, Y.H.; Engelen, J.J.M.; Govaerts, L.C.P.; Ravenswaaij-Arts, C.M.A. van; Loneus, W.H.; Lent-Albrechts, J.C. van; Blij-Philipsen, M. van der; Hamers, A.J.H.; Schrander-Stumpel, C.T.R.M.

    2004-01-01

    We report on the clinical and cytogenetic data of a large family with an unbalanced insertion translocation (3;5)(q25.3;q22.1q31.3). Analysis of GTG-banded chromosomes demonstrated that unbalanced inheritance of a parental insertion translocation caused either a partial deletion or duplication 5q in

  5. FOXC1 is required for normal cerebellar development and is a major contributor to chromosome 6p25.3 Dandy-Walker malformation

    Science.gov (United States)

    Aldinger, Kimberly A; Lehmann, Ordan J; Hudgins, Louanne; Chizhikov, Victor V; Bassuk, Alexander G; Ades, Lesley C; Krantz, Ian D; Dobyns, William B; Millen, Kathleen J

    2010-01-01

    Dandy-Walker malformation (DWM), the most common human cerebellar malformation, has only one characterized associated locus1,2. Here we characterize a second DWM-linked locus on 6p25.3, showing that deletions or duplications encompassing FOXC1 are associated with cerebellar and posterior fossa malformations including cerebellar vermis hypoplasia (CVH), mega-cisterna magna (MCM) and DWM. Foxc1-null mice have embryonic abnormalities of the rhombic lip due to loss of mesenchyme-secreted signaling molecules with subsequent loss of Atoh1 expression in vermis. Foxc1 homozygous hypomorphs have CVH with medial fusion and foliation defects. Human FOXC1 heterozygous mutations are known to affect eye development, causing a spectrum of glaucoma-associated anomalies (Axenfeld-Rieger syndrome, ARS; MIM no. 601631). We report the first brain imaging data from humans with FOXC1 mutations and show that these individuals also have CVH. We conclude that alteration of FOXC1 function alone causes CVH and contributes to MCM and DWM. Our results highlight a previously unrecognized role for mesenchyme-neuroepithelium interactions in the mid-hindbrain during early embryogenesis. PMID:19668217

  6. The receptor tyrosine kinase inhibitor vandetanib activates Akt and increases side population in a salivary gland tumor cell line (A253).

    Science.gov (United States)

    Fujishiro, Yuka; Tonogi, Morio; Ochiai, Hiromi; Matsuzaka, Kenichi; Yamane, Gen-Yuki; Azuma, Toshifumi

    2012-07-01

    We and others have reported that cancer side population (SP) cells have self-renewal and multidrug resistance capabilities. These phenotypes are similar to those of cancer stem cells (CSCs), cancer stem-like cells and tumor-initiating cells (TICs). It has also been reported that upregulation of the epidermal growth factor receptor (EGFR) significantly increases the number of cancer SP cells, conversely, molecular targeting of EGFR tyrosine kinases using specific kinase inhibitors downregulates CSCs. Thus, we used flow cytometric analysis and cell sorting to examine cancer SP cells in the SCA9.cl-15, WR21 and A253 cell lines that originate from a salivary gland tumor (SGT). We successfully isolated cancer SP cells from all of these cell lines. SP cells were detected following treatment of these cell lines with the receptor tyrosine kinase inhibitors (RTKIs) lapatinib, erlotinib and vandetanib. Several studies reported that RTKIs mostly reduced the SP population in cancer cells. We did not observe any detectable morphological differences between SP cells and non-SP cells. We found that the EGF RTKI lapatinib decreased the number of cancer SP cells in all cell lines investigated; however, the EGF RTKI erlotinib did not cause significant differences in the frequency of cancer SP cells in these cell lines. Addition of vandetanib significantly increased the number of cancer SP cells and upregulated the phosphorylated Akt. As far as we know, this is the first report to show that one of the RTKIs, vandetanib, can activate Akt and increase the number of cancer SP cells. It has been reported that RTKIs could competitively inhibit ABC transporters and subsequently reduced the number of SP cells. However, our observation indicated that signaling changes induced by RTKIs could even activate Akt and induce the SP population. Investigation of the SP phenotype of SGTs is important for the establishment of optimal cancer therapy.

  7. Osteoclasts from patients with autosomal dominant osteopetrosis type I caused by a T253I mutation in low-density lipoprotein receptor-related protein 5 are normal in vitro, but have decreased resorption capacity in vivo

    DEFF Research Database (Denmark)

    Henriksen, Kim; Gram, Jeppe; Høegh-Andersen, Pernille

    2005-01-01

    Autosomal dominant osteopetrosis type I (ADOI) is presumably caused by gain-of-function mutations in the LRP5 gene. Patients with a T253I mutation in LRP5 have a high bone mass phenotype, characterized by increased mineralizing surface index but abnormally low numbers of small osteoclasts....... To investigate the effect of the T253I mutation in LRP5 on osteoclasts, we isolated CD14+ monocytes from ADOI patients and assessed their ability to generate osteoclasts when treated with RANKL and M-CSF compared to that of age- and sex-matched control osteoclasts. We found normal osteoclastogenesis, expression...... of osteoclast markers, morphology, and localization of proteins involved in bone resorption, such as ClC-7 and cathepsin K. The ability to resorb bone was also normal. In vivo, we compared the bone resorption and bone formation response to T3 in ADOI patients and age- and sex-matched controls. We found...

  8. Erratum to "Solar Sources and Geospace Consequences of Interplanetary Magnetic Clouds Observed During Solar Cycle 23-Paper 1" [J. Atmos. Sol.-Terr. Phys. 70(2-4) (2008) 245-253

    Science.gov (United States)

    Gopalswamy, N.; Akiyama, S.; Yashiro, S.; Michalek, G.; Lepping, R. P.

    2009-01-01

    One of the figures (Fig. 4) in "Solar sources and geospace consequences of interplanetary magnetic Clouds observed during solar cycle 23 -- Paper 1" by Gopalswamy et al. (2008, JASTP, Vol. 70, Issues 2-4, February 2008, pp. 245-253) is incorrect because of a software error in t he routine that was used to make the plot. The source positions of various magnetic cloud (MC) types are therefore not plotted correctly.

  9. Kinetics of the gas-phase reactions of chlorine atoms with CH2F2, CH3CCl3 and CF3CFH2 over the temperature range 253 – 551 K

    DEFF Research Database (Denmark)

    Nilsson, Elna Johanna Kristina; Johnson, Matthew Stanley; Nielsen, Ole John

    2009-01-01

    Relative rate techniques were used to study the title reactions in 930–1200 mbar of N2 diluent. The reaction rate coefficients measured in the present work are summarized by the expressions k(Cl+CH2F2) = 1.19×10-17 T 2 exp(-1023/T ) cm3 molecule-1 s-1 (253– 553 K), k(Cl+CH3CCl3) = 2.41×10-12 exp(...

  10. Patients with Philadelphia-positive leukemia with Y253H or F359V mutation have a high risk of developing new mutations in the setting of dasatinib resistance.

    Science.gov (United States)

    Jiang, Qian; Qin, Ya-Zhen; Lai, Yue-Yun; Jiang, Hao; Wang, Jing; Huang, Xiao-Jun

    2015-07-01

    The treatment outcome and development of new mutations in patients with imatinib- and/or nilotinib-failure Philadelphia chromosome positive (Ph+) leukemia with highly nilotinib-resistant mutations (Y253H, E255K/V and F359V/C) were assessed on dasatinib therapy. A total of 111 patients with Ph+ leukemia were grouped into three cohorts by baseline BCR-ABL kinase domain mutation status: no mutation (n = 44), non-nilotinib-resistant mutations (n = 26) or nilotinib-resistant mutations (n = 41). The frequencies of hematological, cytogenetic and molecular responses and clinical resistance to dasatinib were similar among the three cohorts during dasatinib therapy. In dasatinib-resistant patients, new mutations were most frequently observed in the cohort with nilotinib-resistant mutations (p = 0.001). Multivariate analysis revealed that advanced disease and harboring Y253H or F359V mutation before dasatinib were independent predictors of developing new mutations. We conclude that patients with Ph+ leukemia with Y253H or F359V mutation have a high likelihood of developing new mutations in the setting of dasatinib resistance.

  11. Automated absolute activation analysis with californium-252 sources

    Energy Technology Data Exchange (ETDEWEB)

    MacMurdo, K.W.; Bowman, W.W.

    1978-09-01

    A 100-mg /sup 252/Cf neutron activation analysis facility is used routinely at the Savannah River Laboratory for multielement analysis of many solid and liquid samples. An absolute analysis technique converts counting data directly to elemental concentration without the use of classical comparative standards and flux monitors. With the totally automated pneumatic sample transfer system, cyclic irradiation-decay-count regimes can be pre-selected for up to 40 samples, and samples can be analyzed with the facility unattended. An automatic data control system starts and stops a high-resolution gamma-ray spectrometer and/or a delayed-neutron detector; the system also stores data and controls output modes. Gamma ray data are reduced by three main programs in the IBM 360/195 computer: the 4096-channel spectrum and pertinent experimental timing, counting, and sample data are stored on magnetic tape; the spectrum is then reduced to a list of significant photopeak energies, integrated areas, and their associated statistical errors; and the third program assigns gamma ray photopeaks to the appropriate neutron activation product(s) by comparing photopeak energies to tabulated gamma ray energies. Photopeak areas are then converted to elemental concentration by using experimental timing and sample data, calculated elemental neutron capture rates, absolute detector efficiencies, and absolute spectroscopic decay data. Calculational procedures have been developed so that fissile material can be analyzed by cyclic neutron activation and delayed-neutron counting procedures. These calculations are based on a 6 half-life group model of delayed neutron emission; calculations include corrections for delayed neutron interference from /sup 17/O. Detection sensitivities of < or = 400 ppB for natural uranium and 8 ppB (< or = 0.5 (nCi/g)) for /sup 239/Pu were demonstrated with 15-g samples at a throughput of up to 140 per day. Over 40 elements can be detected at the sub-ppM level.

  12. Metastable charge-transfer state of californium(iii) compounds.

    Science.gov (United States)

    Liu, Guokui; Cary, Samantha K; Albrecht-Schmitt, Thomas E

    2015-06-28

    Among a series of anomalous physical and chemical properties of Cf(iii) compounds revealed by recent investigations, the present work addresses the characteristics of the optical spectra of An(HDPA)3·H2O (An = Am, Cm, and Cf), especially the broadband photoluminescence from Cf(HDPA)3·H2O induced by ligand-to-metal charge transfer (CT). As a result of strong ion-ligand interactions and the relative ease of reducing Cf(iii) to Cf(ii), a CT transition occurs at low energy (transfer state undergoes radiative and non-radiative relaxations. Broadening of the CT transition arises from strong vibronic coupling and hole-charge interactions in the valence band. The non-radiative relaxation of the metastable CT state results from a competition between phonon-relaxation and thermal tunneling that populates the excited states of Cf(iii).

  13. Cosmic rays and the magnetic field in the nearby starburst galaxy NGC 253 III. Helical magnetic fields in the nuclear outflow

    Science.gov (United States)

    Heesen, V.; Beck, R.; Krause, M.; Dettmar, R.-J.

    2011-11-01

    Context. Magnetic fields are good tracers of gas compression by shock waves in the interstellar medium. These can be caused by the interaction of star-formation driven outflows from individual star formation sites as described in the chimney model. Integration along the line-of-sight and cosmic-ray diffusion may hamper detection of compressed magnetic fields in many cases. Aims. We study the magnetic field structure in the central part of the nuclear starburst galaxy NGC 253 with spatial resolutions between 40 and 150 pc to detect any filamentary emission associated with the nuclear outflow. As the nuclear region is much brighter than the rest of the disc we can distinguish this emission from that of the disc. Methods. We used radio polarimetric observations with the VLA. New observations at λ3 cm with 7.5 arcsec resolution were combined with archive data at λλ 20 and 6 cm. We created a map of the rotation measure distribution between λλ 6 and 3 cm and compared it with a synthetic polarization map. Results. We find filamentary radio continuum emission in a geometrical distribution, which we interpret as the boundary of the NW nuclear outflow cone seen in projection. The scaleheight of the continuum emission is 150 ± 20 pc, regardless of the observing frequency. The equipartition magnetic field strength is 46 ± 10 μG for the total field and 21 ± 5 μG for the regular field in the filaments. We find that the ordered magnetic field is aligned along the filaments, in agreement with amplification due to compression. The perpendicular diffusion coefficient across the filaments is κ⊥= 1.5-1028 cm2 s-1 E(GeV)0.5±0.7. In the SE part of the nuclear outflow cone the magnetic field is pointing away from the disc in form of a helix, with an azimuthal component increasing up to at least 1200 pc height, where it is about equal to the total component. The ordered magnetic field in the disc is anisotropic within a radius of 2.2 kpc. At larger radii, the large

  14. Assessment of the olfactory function in Italian patients with type 3 von Willebrand disease caused by a homozygous 253 Kb deletion involving VWF and TMEM16B/ANO2.

    Directory of Open Access Journals (Sweden)

    Valentina Cenedese

    Full Text Available Type 3 Von Willebrand disease is an autosomal recessive disease caused by the virtual absence of the von Willebrand factor (VWF. A rare 253 kb gene deletion on chromosome 12, identified only in Italian and German families, involves both the VWF gene and the N-terminus of the neighbouring TMEM16B/ANO2 gene, a member of the family named transmembrane 16 (TMEM16 or anoctamin (ANO. TMEM16B is a calcium-activated chloride channel expressed in the olfactory epithelium. As a patient homozygous for the 253 kb deletion has been reported to have an olfactory impairment possibly related to the partial deletion of TMEM16B, we assessed the olfactory function in other patients using the University of Pennsylvania Smell Identification Test (UPSIT. The average UPSIT score of 4 homozygous patients was significantly lower than that of 5 healthy subjects with similar sex, age and education. However, 4 other members of the same family, 3 heterozygous for the deletion and 1 wild type, had a slightly reduced olfactory function indicating that socio-cultural or other factors were likely to be responsible for the observed difference. These results show that the ability to identify odorants of the homozygous patients for the deletion was not significantly different from that of the other members of the family, showing that the 253 kb deletion does not affect the olfactory performance. As other genes may compensate for the lack of TMEM16B, we identified some predicted functional partners from in silico studies of the protein-protein network of TMEM16B. Calculation of diversity for the corresponding genes for individuals of the 1000 Genomes Project showed that TMEM16B has the highest level of diversity among all genes of the network, indicating that TMEM16B may not be under purifying selection and suggesting that other genes in the network could compensate for its function for olfactory ability.

  15. Hypoxia-Specific Drug Tirapazamine Does Not Abrogate Hypoxic Tumor Cells in Combination Therapy with Irinotecan and Methylselenocysteine in Well-Differentiated Human Head and Neck Squamous Cell Carcinoma A253 Xenografts

    Directory of Open Access Journals (Sweden)

    Arup Bhattacharya

    2008-08-01

    Full Text Available Well-differentiated hypoxic regions in head and neck squamous cell carcinoma like in A253 xenografts are avascular and, therefore, hinder drug delivery leading to drug resistance and tumor regrowth. Methylselenocysteine (MSC, 0.2 mg/mouse per day per oral for 35 days starting 7 days before the first irinotecan (CPT-11 has been found to increase efficacy of a wide variety of chemotherapeutic agents including CPT-11 (100 mg/kg per week x 4 intravenously. Whereas CPT-11 leads to a 10% complete response (CR in A253 xenografts, the combination of MSC and CPT-11 increased the CR to 70%. Surviving tumors were found to consist largely of avascular hypoxic regions. Here, we investigated the combination of tirapazamine (TPZ, 70 mg/kg per week intraperitoneal x 4 administered 3 or 72 hours before CPT-11, a bioreductive drug in clinical trial with selective toxicity for hypoxic cells, with MSC and CPT-11 in further enhancing the cure rates. Tumor response, change in tumor hypoxic regions, and DNA damage were monitored in vivo. Tirapazamine administered 3 hours before CPT-11 in combination with MSC + CPT-11 led to a lower tumor burden. Tirapazamine did not increase cure rate beyond that of MSC + CPT-11 combination and was instead found to decrease cures with no evidence of an increased DNA damage or a significant reduction in avascular hypoxic tumor regions. CD31 immunostaining in A253 demonstrated disruption of tumor vessels by TPZ that could lower cytotoxic drug delivery to carbonic anhydrase IX-positive hypoxic tumor cells and may explain at least partially these unexpected results.

  16. Rate constants for the gas-phase reactions of (Z)-CF3CHdbnd CHF and (E)-CF3CHdbnd CHF with OH radicals at 253-328 K

    Science.gov (United States)

    Zhang, Ni; Chen, Liang; Mizukado, Junji; Quan, Hengdao; Suda, Hiroyuki

    2015-02-01

    Rate constants for the reactions of (Z)-CF3CHdbnd CHF (k1) and (E)-CF3CHdbnd CHF (k2) with OH radicals assessed by a relative rate method were: (0.911 ± 0.234) × 10-12 exp[(114 ± 70)/T], (1.05 ± 0.02) × 10-12 exp[-(118 ± 10)/T] at 253-328 K; and (1.37 ± 0.04) × 10-12, (0.699 ± 0.043) × 10-12 at 298 K cm3 molecule-1 s-1. The atmospheric lifetimes were determined as ∼8.4 and 17 days, respectively. GWPs for the 100 year time horizon were estimated to be 3 and 7, respectively.

  17. Interstitial deletion of chromosome 1q [del(1)(q24q25.3)] identified by fluorescence in situ hybridization and gene dosage analysis of apolipoprotein A-II, coagulation factor V, and antithrombin III

    Energy Technology Data Exchange (ETDEWEB)

    Takano, Takako; Yamanouchi, Yasuko; Mori, Yosuke [Teikyo Univ. School of Medicine, Tokyo (Japan)] [and others

    1997-01-20

    We report on a 12-month-old Japanese boy with an interstitial deletion of the long-arm of chromosome 1 and meningomyelocele, hydrocephalus, anal atresia, atrial septal defect, left renal agenesis, bilateral cryptorchidism, talipes equinovarus, low birth weight, growth/developmental retardation, and many minor anomalies. By conventional GTG-banding, his karyotype was first interpreted as 46,XY,de1(1)(q23q24), but it was corrected as 46,XY.ish del(1)(q24q25.3) by fluorescence in situ hybridization using 11 known cosmid clones as probes. His serum levels of apolipoprotein A-II (gene symbol: APOA2, previously assigned to 1q21-q23) and coagulation factor V (F5, 1q21-q25) were normal, while serum concentration and activity of antithrombin III (AT3, 1q23-q25.1) was low. The results indicated that localization of APOA2 and F5 are proximal to the deleted region and AT3 is located within the deletion extent in the patient. 16 refs., 4 figs.

  18. 7 CFR 25.3 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... the Secretary of Agriculture RURAL EMPOWERMENT ZONES AND ENTERPRISE COMMUNITIES General Provisions... Empowerment Zones and Enterprise Communities pursuant to § 25.400. Applicant means the entity that is submitting the community's strategic plan for accomplishing comprehensive economic, human community, and...

  19. 8 CFR 253.1 - Parole.

    Science.gov (United States)

    2010-01-01

    ... or transferred at sea to a vessel or aircraft destined directly for the United States and who is... 235(c) alleging persecution or torture. Any alien crewman, stowaway, or alien removable under section... opinion, or because of fear of torture is eligible to apply for asylum or withholding of removal under 8...

  20. 256 253 Profitability Analysis of Groundnut

    African Journals Online (AJOL)

    2008-12-02

    Dec 2, 2008 ... ground into paste. The paste is then mashed with warm water and oil rises to the surface and is skimmed off. ... fuel for diesel engines (Duke, 1981). The groundnut cake (GNC) known as. 'Kulikuli' in Hausa ... that these age groups are the most active or energetic which, is required for the tedious nature of ...

  1. 253-IJBCS-Article-Dr Yah Clarence

    African Journals Online (AJOL)

    Dr Gatsing

    1 School of Chemical and Metallurgical Engineering, University of the Witwatersrand, .... species or genus of bacteria to another within the facility. Recent .... been subjected to much abuse and secondly .... infections: A surgeon's perspective.

  2. 27 CFR 40.253 - Destruction.

    Science.gov (United States)

    2010-04-01

    ... OF THE TREASURY (CONTINUED) TOBACCO MANUFACTURE OF TOBACCO PRODUCTS, CIGARETTE PAPERS AND TUBES, AND... completely or by rendering them unfit for consumption. Upon completion of the destruction, the manufacturer...

  3. 253-IJBCS-Article-Dr Yah Clarence

    African Journals Online (AJOL)

    Dr Gatsing

    Dilution Antimicrobial Susceptibility. Tests for Bacteria that Grow Aerobically. Approved standard M7-A6. Clinical and. Laboratory Standards Institute: Wayne,. Pa. Costerton JW, Stewart PS, Greenberg EP. 1999. Bacterial biofilms (Review). A common cause of persistent. Science,. 289: 390-394. Cowan ST, Steel KJ. 1974.

  4. 42 CFR 447.253 - Other requirements.

    Science.gov (United States)

    2010-10-01

    ..., must submit the related information required by § 447.255 of this subpart, and must comply with all... State and Federal laws, regulations, and quality and safety standards. (ii) With respect to inpatient... situation of hospitals which serve a disproportionate number of low income patients with special needs; (B...

  5. 50 CFR 253.10 - Definitions.

    Science.gov (United States)

    2010-10-01

    ... property's useful life including architectural, engineering, inspection, delivery, outfitting, and interest... exports; helping develop an underutilized fishery; or enhancing financial stability, financial performance... guarantor pay a guaranteed note's full principal and interest balance. Division means the Financial Services...

  6. 7 CFR 1901.253 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... PROGRAM-RELATED INSTRUCTIONS Procedures for the Protection of Historical and Archeological Properties..., sites, buildings, structures, and objects, significant in American history, architecture, archeology..., archeological, or cultural character of a National Register property that qualifies the property under the...

  7. Publications | Page 253 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Reducing vulnerability among pastoralists in northern Kenya. The devastating drought that gripped much of East Africa in 2009 was one of the worst in living memory. But in the arid and semi-arid lands of Northern Kenya, drought is no stranger. Since 1993, Kenya has declared six national disasters.

  8. Reference: 253 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available e PTC+/PTC- ratios were higher in atupf3 mutant plants than wild-type plants and that the atupf3 mutant was ...PTC-). We analyzed their PTC+/PTC- ratios in wild-type Arabidopsis and upf3 mutant plants and showed that th

  9. 33 CFR 117.253 - Anacostia River.

    Science.gov (United States)

    2010-07-01

    ... sensors, laser scanners, video cameras or marine-radio communications, In these situations, a bridge... open position for vessel traffic. During open span movement, the channel traffic lights will flash red... traffic lights will flash red, and an audio voice-warning device will announce bridge movement during...

  10. 7 CFR 1924.253 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... method, or under a conditional commitment, or, as to only work performed by a contractor or covered by a...) Improper or incomplete seeding or sodding of yard, or failure of trees, shrubs, grass and other landscaping...

  11. 7 CFR 253.2 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... Alaska Native village or regional or village corporation (established pursuant to the Alaska Native... commodities on all or part of an Indian reservation. (j) Urban place means a town or city with a population of...

  12. Publications | Page 253 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Through books, articles, research publications, and studies, we aim to widen the impact of our investment and advance development research. We share the results of our funded research, and offer free ... Measuring gender equality at home and in the marketplace. As more women participate in the workplace, inequality ...

  13. Publications | Page 253 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    In some communities they are known as 'rainmakers' as some believe they not only foretell when the rains may come but can make... Seeing climate vulnerabilities through lived experience in Madagascar. Madagascar, the world's fourth largest island, is home to an astonishing range of life forms found nowhere else on the ...

  14. 50 CFR 253.20 - Definitions.

    Science.gov (United States)

    2010-10-01

    ... management plan by State action or regulation. Commercial fishery failure means a serious disruption of a... not include either: (1) The inability to harvest or sell raw fish or manufactured and processed... resources. Federal fishery management plan means a plan developed and approved under the Magnuson Fishery...

  15. A conservative assessment of the major genetic causes of idiopathic chronic pancreatitis: data from a comprehensive analysis of PRSS1, SPINK1, CTRC and CFTR genes in 253 young French patients.

    Directory of Open Access Journals (Sweden)

    Emmanuelle Masson

    Full Text Available Idiopathic chronic pancreatitis (ICP has traditionally been defined as chronic pancreatitis in the absence of any obvious precipitating factors (e.g. alcohol abuse and family history of the disease. Studies over the past 15 years have revealed that ICP has a highly complex genetic architecture involving multiple gene loci. Here, we have attempted to provide a conservative assessment of the major genetic causes of ICP in a sample of 253 young French ICP patients. For the first time, conventional types of mutation (comprising coding sequence variants and variants at intron/exon boundaries and gross genomic rearrangements were screened for in all four major pancreatitis genes, PRSS1, SPINK1, CTRC and CFTR. For the purposes of the study, synonymous, intronic and 5'- or 3'-untranslated region variants were excluded from the analysis except where there was persuasive evidence of functional consequences. The remaining sequence variants/genotypes were classified into causative, contributory or neutral categories by consideration of (i their allele frequencies in patient and normal control populations, (ii their presumed or experimentally confirmed functional effects, (iii the relative importance of their associated genes in the pathogenesis of chronic pancreatitis and (iv gene-gene interactions wherever applicable. Adoption of this strategy allowed us to assess the pathogenic relevance of specific variants/genotypes to their respective carriers to an unprecedented degree. The genetic cause of ICP could be assigned in 23.7% of individuals in the study group. A strong genetic susceptibility factor was also present in an additional 24.5% of cases. Taken together, up to 48.2% of the studied ICP patients were found to display evidence of a genetic basis for their pancreatitis. Whereas these particular proportions may not be extrapolable to all ICP patients, the approach employed should serve as a useful framework for acquiring a better understanding of the

  16. Neutron Protection Factor Determination and Validation for a Vehicle Surrogate Using a Californium Fission Source

    Science.gov (United States)

    2017-06-01

    a 4 mm x 4 mm (0.157" x 0.157") LiI(Eu) crystal with 96% enrichment of lithium -6. The crystal is connected to a photomultiplier tube (PMT) which...32 Figure 17. Lithium -6 Iodide, Europium Doped Scintillation Detector. Source: [27...Alamos National Laboratory LiI(Eu) Lithium Iodide Europium Doped LLD Low Level Discriminator LLNL Lawrence Livermore National Laboratory MASH Monte

  17. Dicty_cDB: VFF253 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available sk49h12.y1 Gm-c1019 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1019-5952 5', mRNA sequence. 46 0...sa87c11.y1 Gm-c1004 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1004-6285 5', mRNA sequence. 46 0...sk59a02.y1 Gm-c1019 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1019-6819 5', mRNA sequence. 46 0...saf19h09.y1 Gm-c1076 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1076-1506 5', mRNA sequence. 46 0

  18. Dicty_cDB: AFL253 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available red pieces. 36 0.22 7 BI435853 |BI435853.1 EST538614 P. infestans-challenged potato leaf, compatible reactio...1390 |BG591390.1 EST499232 P. infestans-challenged leaf Solanum tuberosum cDNA clone BPLI8D17 5' sequence, m...CF59 3' end, mRNA sequence. 48 0.31 1 BI435340 |BI435340.1 EST538101 P. infestans-challenged leaf Solanum tu

  19. 253 Education and the Paradox of Graduate Unemployment: The ...

    African Journals Online (AJOL)

    FIRST LADY

    2011-01-18

    Jan 18, 2011 ... The paper is an assessment of education, graduate unemployment and the .... areas. The reason is that in rural areas, people are usually self employed in ... are in a comatose state thereby aggravating the unemployment problem. Nigeria ranks very low in terms of energy supply and consumption globally.

  20. 7 CFR 253.3 - Availability of commodities.

    Science.gov (United States)

    2010-01-01

    ... distribution program benefits. Households eligible under this part shall receive a monthly food package based... Stamp Program benefits. The food package offered to each household by the State agency shall contain a...-Poultry-Fish-Dry Beans-Eggs-Nuts, Milk-Yogurt-Cheese, and Fats-Oils-Sweets. FNS shall periodically notify...

  1. 253 Education and the Paradox of Graduate Unemployment: The ...

    African Journals Online (AJOL)

    FIRST LADY

    2011-01-18

    Jan 18, 2011 ... The problem of graduate unemployment is attributable to corruption in governance, population explosion, expansion of university enrolment and lack of .... to regulate the admission of students into universities in Nigeria. ... depends on various factors-namely; mobility of labour, the pace of change in.

  2. H:\\PMKER 25(3)\\BRAHIM I..xps

    African Journals Online (AJOL)

    AISA

    DEUX VARIETES DE POMMIER (Malus domestica BORKH.) I. BRAHIM, N. LOMBARKIA et A. MEDJEDBA. Université de Batna, Institut des Sciences Vétérinaires et des Sciences Agronomiques, Département d'Agronomie,. 05000 Batna, Algérie. E-mail : nlombarkia@gmail.com. RESUME. Le carpocapse, Cydia pomonella ...

  3. H:\\PMKER 25(3)\\EGAH J..xps

    African Journals Online (AJOL)

    AISA

    biodiversité de l'igname (Dioscorea sp.) est menacée par la diffusion incontrôlée de certaines technologies (introduction de variétés améliorées, gestion de la fertilité des sols, octroi de crédits agricoles et contact avec certains projets de développement agricole), l'absence d'un schéma clair pour la gestion des systèmes.

  4. Dicty_cDB: CHM253 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available PXXCKTAAXVSVGVAVGXAVGGAIAL GVFIFXGXKGYDXWKASQGXXMAPSNAXXL Translated Amino Acid sequence (All Frames)...PXXCKTAAXVSVGVAVGXAVGGAIAL GVFIFXGXKGYDXWKASQGXXMAPSNAXXL Frame B: nnknnn****k***qieinkshqkkrthtkiii

  5. Dicty_cDB: SSI253 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available BH261451 |BH261451.1 CH230-90I24.TV CHORI-230 Segment 1 Rattus norvegicus genomi...QUENCING IN PROGRESS ***, 1 ordered piece. 48 0.15 1 BH339179 |BH339179.1 CH230-41C3.TV CHORI-230 Segment 1

  6. H:\\PMKER 25(3)\\ADEWOLE.xps

    African Journals Online (AJOL)

    AISA

    Ife, Nigeria. Email : badewole@oauife.edu.ng. ABSTRACT. A field experiment was conducted in south-western ..... Agronomy Monograph No. 9. Madison, WI : American Society of. Agronomy, pp 295 - 324. Cerný I. and A. Veverková. 2012.

  7. Dicty_cDB: AFK253 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available xpvgqxlixnlmlxixryxxfx*qkmkmiliqcsfvsllmexqnf*xf tvllvmxlqvkkixtkqilplhwkaqcvslvsilfqsk*titswvvitlxxx*vtxmfq...qitryrtfy*qkmkmiliqcsfvsllmehqnf*sftvllvmklqvkkiqtkqilplhwk aqcvslvsilfqsk*titswvvitlsqf*vtlmfqnatsmsq*tkltk

  8. 24 CFR 213.253 - Premiums upon initial endorsement.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Premiums upon initial endorsement... upon initial endorsement. (a) Management and Sales Types and Investor Sponsored Projects. The mortgagee, upon the initial endorsement of the mortgage for insurance, shall pay to the Commissioner a first...

  9. Gastric polyps: Retrospective analysis of 41,253 upper endoscopies.

    Science.gov (United States)

    Argüello Viúdez, Lidia; Córdova, Henry; Uchima, Hugo; Sánchez-Montes, Cristina; Ginès, Àngels; Araujo, Isis; González-Suárez, Begoña; Sendino, Oriol; Llach, Josep; Fernández-Esparrach, Gloria

    2017-10-01

    Gastric polyps are usually asymptomatic lesions incidentally discovered during endoscopy. To study the frequency of different types of gastric polyps in our population and their possible association with other factors. Retrospective study of gastroscopies performed in a tertiary hospital over a ten-year period. Demographics, medical history, indication for gastroscopy and morphological and histological characteristics of polyps were collected. Gastric polyps were found in 827 out of 41253 (2%) reviewed gastroscopies, corresponding to 709 patients. Mean age was 65.6 years, and 62% were female. 53.9% of patients had multiple polyps. The most common location was the fundus and 83.3% were smaller than 1cm. Histopathology was obtained in 607 patients: hyperplastic polyps were the most common (42.8%), followed by fundic gland polyps (37.7%). Factors independently associated with hyperplastic polyps were age and single polyp, size ≥6mm and location other than fundus. In contrast, fundic gland polyps were associated with reflux and multiple polyps, size <6mm and located in fundus. Adenomas were independently associated with single polyp. Fundic gland and hyperplastic polyps are the most common in our population and have characteristic features that can guide histological diagnosis. With single polyps it is advisable to take biopsies to rule out adenoma. Copyright © 2017 Elsevier España, S.L.U., AEEH y AEG. All rights reserved.

  10. Dicty_cDB: SSD253 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 1 Tc-EST-013 (3' read) Toxocara canis infective larva cDNA library Toxocara canis cDNA 3' similar to Tc-cpl-1...pst-cathepsin, complete cds. 44 1.6 1 U53172 |U53172.1 Toxocara canis cathepsin L-like cysteine proteinase mRNA

  11. Dicty_cDB: SSB253 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ANTGANNATNCATCTGATGNCATTTAAGTTATTAAGATTTXXXXXXXXX X sequence update 1999. 1.18 Translated Amino Acid sequence ewvmeniylirw*n*iltnsxss...uence (All Frames) Frame A: ewvmeniylirw*n*iltnsxsslfni*FYHLIKEWXXXNXYLIQFSTITKXX

  12. Underground storage tank 253-D1U1 Closure Plan

    Energy Technology Data Exchange (ETDEWEB)

    Mancieri, S.; Giuntoli, N.

    1993-09-01

    This report is a closure plan for a diesel fuel tank at the Lawrence Livermore National Laboratory. Included are maps of the site, work plans, and personnel information regarding training and qualification.

  13. H:\\PMKER 25(3)\\TIA E..xps

    African Journals Online (AJOL)

    AISA

    conditions de travail entraînent le vieillissement des paysans, l'accroissement de l'exode rural massif des ..... Cette situation accentue la rudesse du travail. En conséquence, les labours sont mal faits, ce qui favorise l'éclosion de nombreuses maladies parasitaires et cryptogamiques qui affectent le rendement. Par ailleurs ...

  14. Dicty_cDB: SLA253 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available TTTATS*i*sknifyqvslq**f****yqkmilkipf fsl*fln*i*nk*kkkknl Translated Amino Acid s...GMPLQLGYGANGKNGDNGISVWLIYGYTIVDINCNIRPIITAA TIATTTAATTTATTTATTATTTATTTATS*i*sknifyqvslq**f****yqkmilkipf fsl

  15. 7 CFR 253.5 - State agency requirements.

    Science.gov (United States)

    2010-01-01

    ... comments or recommendations offered by the ITO, for review by FNS. (c) Staffing. Personnel used in the certification process shall be employed in accordance with (1) the current standards for a Merit System of... Services, planning agencies, the ITO and school officials may be important sources of information in...

  16. H:\\PMKER 25(3)\\ZEZE A..xps

    African Journals Online (AJOL)

    AISA

    en évidence l'écologie, la diversité et la structuration des communautés de CMA endogènes associés à la culture du manioc dans les sols de la zone agroécologique d'Azaguié. Trois objectifs spécifiques découlent de cet objectif général : (1) déterminer les caractéristiques physicochimiques des sols dans les champs de ...

  17. H:\\PMKER 25(3)\\IDOWU.xps

    African Journals Online (AJOL)

    AISA

    Nairobi, Kenya. Olubanjo O., S. Akinleye and W. Soremekun. 2007. Poverty Determinants among Farmers in. Ogun State, Nigeria. Agricultural Journal. 2 (2) : 275 - 280. Oluwatayo I. B. 2009. Poverty and income diversification among households in Rural. Nigeria : A gender Analysis of livelihood patterns. Paper presented at ...

  18. H:\\PMKER 25(3)\\EGAH J..xps

    African Journals Online (AJOL)

    AISA

    et appliquées à l'échelle individuelle et collective. Malgré cela, selon l'analyse des «quatre carrés», 70 % des variétés cultivées sont devenues marginales contre 17 % seulement populaires. Ainsi, les stratégies de réponses ne favorisent que certaines variétés, laissant presqu'entière la question de la conservation de.

  19. Dicty_cDB: CFG253 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Value N AF305060 |AF305060.1 Dictyostelium discoideum Wiscott-Aldrich syndrome protein (wasA) gene, complete...ences producing significant alignments: (bits) Value AF305060_1( AF305060 |pid:none) Dictyostelium discoideum Wiscott

  20. 7 CFR 253.6 - Eligibility of households.

    Science.gov (United States)

    2010-01-01

    ... Program income eligibility limits and standard deductions. (2) Definition of income. Household income... Supplemental Security Income (SSI) or Temporary Assistance for Needy Families (TANF), General Assistance (GA...

  1. H:\\PMKER 25(3)\\HALA.xps

    African Journals Online (AJOL)

    AISA

    mangiferum Cooke, Capnodium mangiferum. Cooke, Meliola mangiferae Earle et Capnodium racemosum Cooke) qui donne un aspect noirâtre aux organes végétaux atteints (la fumagine), provoquent un étouffement de l'arbre, une réduction de la photosynthèse et par conséquent, une réduction de la productivité de.

  2. H:\\PMKER 25(3)\\TRAORE K..xps

    African Journals Online (AJOL)

    AISA

    Outre les d'adventices recensés au cours de cette étude comme réservoir de virus, ces auteurs ont identifié d'autres espèces comme : Solanum migrum,. Stellaria media, Brassica campestris et Datura stramonium. CONCLUSION. Cette étude a permis d'identifier le CMV, le. PVMV et le PVYN chez Chromolaena odorata.

  3. Dicty_cDB: VHQ253 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available uence lllkink*****ilk*li*klh*lmkmgnqq*vvkvihyqlp*yflqyivsvlsniklkv nfgtkmifk*nqvklnsaeknmillnlkahgvkmmkkttsklvyi*lyhqkkfskkifrs...*vvkvihyqlp*yflqyivsvlsniklkv nfgtkmifk*nqvklnsaeknmillnlkahgvkmmkkttsklvyi*lyhqkkfskkifrs qkqiq*ktkk*KICINL

  4. H:\\PMKER 25(3)\\ZEZE A..xps

    African Journals Online (AJOL)

    AISA

    2Laboratoire de Biotechnologie de l'Unité de Formation et de Recherche en Biosciences de l'Université Félix. Houphouet-Boigny, 22 BP 582 Abidjan 22, ... plante peut servir de culture de subsistance ou de rente (de Foresta et Schwartz 1991). Elle ... 2006) et dans la nutrition minérale des plantes. (Jakobsen et al., 2002).

  5. H:\\PMKER 25(3)\\BEUGRE F..xps

    African Journals Online (AJOL)

    AISA

    plateau, afin d'évaluer l'incidence d'un herbicide et de l'inoculation des semences avant le semis sur la croissance du soja. La variété de soja (Glycine max), Doko, ainsi qu'un inoculum fait à partir de la souche. IRAT-FA3 de Bradyrhizobium japonicum ont été utilisés. Le Glyphosate, un herbicide total et systémique.

  6. 24 CFR 92.253 - Tenant and participant protections.

    Science.gov (United States)

    2010-04-01

    ... HOME funds must be for not less than one year, unless by mutual agreement between the tenant and the... cost of legal actions regardless of outcome. Agreement by the tenant to pay attorney's fees or other... terminate the tenancy or refuse to renew the lease of a tenant of rental housing assisted with HOME funds...

  7. Dicty_cDB: SHF253 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available TAANS GAATAANSGAATAANRGNNAAATGAANGNNGAAAGANSGAATAANSGAANSGAATAANSG AAAGANSGAATXANSGAAXAASGGNGASGAANPGSIVTPND...ATGAANGNNGAAAGANSGAATAANSGAANSGAATAANSG AAAGANSGAATXANSGAAXAASGGNGASGAANPGSIVTPND

  8. 20 CFR 632.253 - Special operating provisions.

    Science.gov (United States)

    2010-04-01

    ... disadvantage youth population, especially school dropouts, youth not likely to return to school without... appropriate efforts to encourage educational agencies and post-secondary institutions to award academic credit... attesting to the accuracy of the information, including income data, provided on the application; and (h...

  9. Dicty_cDB: VSG253 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available LKNKKK--- ---TRFSKHRKSRGDVCAGYGRVGKHRKHPGGRGNAGGLTHHRINFDKYHPGYFGKLGMR HFHLLRNQYHCPTVSLEKIWTLVPESVRK...LKNKKK--- ---TRFSKHRKSRGDVCAGYGRVGKHRKHPGGRGNAGGLTHHRINFDKYHPGYFGKLGMR HFHLLRNQYHCPTVSLEKIWTLVPESVRK...k*kk Frame C: rfskhrksrgdvcagygrvgkhrkhpggrgnagglthhrinfdkyhpgyfgklgmrhfhl lrnqyhcptvslekiwtlvpesvrk

  10. Dicty_cDB: SSE253 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ihntelfisvksnfvvicdllkvndyyikyyiarflviliknrfdavqea ilscpmsmpnimsllldkrevirngkneflr Translated Amino Acid seq...sm*kyilihiyiyiyiyiyiyiyifiy*flniyktk fl*kddniieihntelfisvksnfvvicdllkvndyyikyyiarflviliknrfdavqea ilscpmsm

  11. H:\\PMKER 25(3)\\NOUATIN G..xps

    African Journals Online (AJOL)

    AISA

    Les institutions de micro finance, de part leur importance dans la réduction de la pauvreté dans les pays en développement, sont de plus en plus au centre des préoccupations aussi bien des politiques que des scientifiques. Au Bénin on compte plusieurs centaines d'institutions de micro finance, parmi lesquelles on.

  12. H:\\PMKER 25(3)\\ADEWOLE.xps

    African Journals Online (AJOL)

    AISA

    composite surface (0 - 15 cm depth) soil samples per experimental set-up were collected with hand auger ... fertilizer treatment in sites A and B for analysis. Total nitrogen in the grain samples was determined using micro ..... Radiation use efficiency and weather parameter influence during life cycle of soybean (Glycine max.

  13. 19 CFR 10.253 - Articles eligible for preferential treatment.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Articles eligible for preferential treatment. 10...; DEPARTMENT OF THE TREASURY ARTICLES CONDITIONALLY FREE, SUBJECT TO A REDUCED RATE, ETC. Andean Trade Promotion and Drug Eradication Act Extension of Atpa Benefits to Tuna and Certain Other Non-Textile Articles...

  14. All projects related to | Page 253 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    2012-02-10

    Violent conflict related to drug trafficking in Mexico has had a profound impact on the quality of life and health of affected communities. Start Date: February 10, 2012. End Date: May 10, 2014. Topic: NARCOTICS, VICTIMS, VIOLENCE, DRUG TRAFFIC, VULNERABLE GROUPS, JUDICIAL SYSTEM. Region: Mexico, North ...

  15. 40 CFR 98.253 - Calculating GHG emissions.

    Science.gov (United States)

    2010-07-01

    ... coking unit burner prior to the combustion of other fossil fuels and calculate the CO2 emissions... to the combustion of other fossil fuels (dry standard cubic feet per hour, dscfh). %CO2 = Hourly... burner prior to the combustion of other fossil fuels or calculate the volumetric flow rate of this...

  16. 40 CFR 180.253 - Methomyl; tolerances for residues.

    Science.gov (United States)

    2010-07-01

    ... million Alfalfa, forage 10 Alfalfa, hay 10 Apple 1 Asparagus 2 Avocado 2 Barley, grain 1 Barley, hay 10 Barley, straw 10 Bean, dry, seed 0.1(N) Bean, forage 10 Bean, succulent 2 Beet, garden, tops 6... Corn, sweet, kernel plus cob with husks removed 0.1(N) Corn, sweet, stover 10 Cotton, undelinted seed 0...

  17. 40 CFR 25.3 - Policy and objectives.

    Science.gov (United States)

    2010-07-01

    ... UNDER THE RESOURCE CONSERVATION AND RECOVERY ACT, THE SAFE DRINKING WATER ACT, AND THE CLEAN WATER ACT... timely decisions can be made. In the course of this process, responsible officials should make special... the government fully considers the public's concerns; (2) To assure that the government does not make...

  18. Aplicación de un problema de actividades lúdicas para el desarrollo de la noción del número y cantidad del área de matemática en los niños y niñas de 4 años de la I.E.I. Nº 253 Isabel Honorio de Lazarte de la Urbanización La Noria del distrito de Trujillo, 2012.

    OpenAIRE

    Vasquez Saldaña, Rosa.

    2015-01-01

    En el presente estudio de investigación APLICACIÓN DE UN PROGRAMA DE ACTIVIDADES LÚDICAS PARA EL DESARROLlO DE lA NOCIÓN DEL NUMERO Y CANTIDAD DEL ÁREA DE MATEMÁTICA EN LOS NIÑOS Y NIÑAS DE 4 AÑOS DE LA I.E.I. N° 253 ISABEL HONORIO DE LAZARTE DE LA URBANIZACIÓN LA NORIA DEL DISTRITO DE TRUJILLO, 2012. Tiene por finalidad dar a conocer como las actividades lúdicas permiten mejorar el aprendizaje del educando en el área de matemática, ya que durante el trabajo diario en el aula no se presenta u...

  19. Upper limiting operating temperatures of plastic jacket tubes according to EN 253 / FW 401; Obergrenze der Betriebstemperaturen fuer KMR nach EN 253 / FW 401

    Energy Technology Data Exchange (ETDEWEB)

    Besier, Rolf [AGFW - Der Energieeffizienzverband fuer Waerme, Kaelte und KWK e. V., Frankfurt am Main (Germany)

    2010-01-15

    Recent research findings show that ageing of plastic jacket tubes is influenced not only by temperature but also by oxidative processes and in some cases also by mechanical stresses. The author presents current research findings and makes recommendations for optimum temperature conditions to ensure a long service life of plastic jacket tubes. (orig.)

  20. A retrospective study of californium-252 neutron brachytherapy combined with EBRT versus 3D-CRT in the treatment of esophageal squamous cell cancer.

    Science.gov (United States)

    Wang, Qifeng; Li, Tao; Lang, Jinyi; Wang, Jie; Wang, Jian; Liu, Huiming; Jia, Xitang; Liu, Bo; Wang, C-K Chris

    2015-10-24

    We conducted a retrospective analysis on 884 patients who were diagnosed with esophageal squamous cell carcinoma (ESCC) and treated with either the neutron brachytherapy in combination with external beam radiotherapy (NBT + EBRT) or 3-dimensional conformal radiation therapy (3D-CRT) to determine the differences in efficacy and morbidity between the two treatment groups. The 884 ESCC patients treated with either NBT + EBRT or 3D-CRT between 2002 and 2012 were retrospectively reviewed and analyzed. Multivariable Cox regression was used to compare oncologic outcomes of the two groups of patients in the context of other clinically relevant variables. The acute and chronic toxicities associated with the two groups were compared using Fisher exact and log-rank tests, respectively. Among the 884 patients, 545 received NBT + EBRT and 339 received 3D-CRT (i.e. EBRT-only). The age range is 39-95 years (median 66). The follow-up time range is 3-145 months (median 32). The analysis shows that the NBT + EBRT group has higher overall survival rate and local control rate than that of the 3D-CRT group. The acute toxicity effects were acceptable for both groups of patients with the NBT + EBRT group showing higher rates of leukopenia and thrombocytopenia and the 3D-CRT group showing higher rates on fistula and massive bleeding. The patients treated with NBT + EBRT showed better oncologic outcomes than those treated with 3D-CRT. The toxicity effects were acceptable for both groups with the NBT + EBRT group showing higher rates on the acute effects and the 3D-CRT group showing higher rates on the late effects.

  1. Accurate determination of Curium and Californium isotopic ratios by inductively coupled plasma quadrupole mass spectrometry (ICP-QMS) in 248Cm samples for transmutation studies

    Energy Technology Data Exchange (ETDEWEB)

    Gourgiotis, A.; Isnard, H.; Aubert, M.; Dupont, E.; AlMahamid, I.; Cassette, P.; Panebianco, S.; Letourneau, A.; Chartier, F.; Tian, G.; Rao, L.; Lukens, W.

    2011-02-01

    The French Atomic Energy Commission has carried out several experiments including the mini-INCA (INcineration of Actinides) project for the study of minor-actinide transmutation processes in high intensity thermal neutron fluxes, in view of proposing solutions to reduce the radiotoxicity of long-lived nuclear wastes. In this context, a Cm sample enriched in {sup 248}Cm ({approx}97 %) was irradiated in thermal neutron flux at the High Flux Reactor (HFR) of the Laue-Langevin Institute (ILL). This work describes a quadrupole ICP-MS (ICP-QMS) analytical procedure for precise and accurate isotopic composition determination of Cm before sample irradiation and of Cm and Cf after sample irradiation. The factors that affect the accuracy and reproducibility of isotopic ratio measurements by ICP-QMS, such as peak centre correction, detector dead time, mass bias, abundance sensitivity and hydrides formation, instrumental background, and memory blank were carefully evaluated and corrected. Uncertainties of the isotopic ratios, taking into account internal precision of isotope ratio measurements, peak tailing, and hydrides formations ranged from 0.3% to 1.3%. This uncertainties range is quite acceptable for the nuclear data to be used in transmutation studies.

  2. Radiological Characterization Technical Report on Californium-252 Sealed Source Transuranic Debris Waste for the Off-Site Source Recovery Project at Los Alamos National Laboratory

    Energy Technology Data Exchange (ETDEWEB)

    Feldman, Alexander [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2014-04-24

    This document describes the development and approach for the radiological characterization of Cf-252 sealed sources for shipment to the Waste Isolation Pilot Plant. The report combines information on the nuclear material content of each individual source (mass or activity and date of manufacture) with information and data on the radionuclide distributions within the originating nuclear material. This approach allows for complete and accurate characterization of the waste container without the need to take additional measurements. The radionuclide uncertainties, developed from acceptable knowledge (AK) information regarding the source material, are applied to the summed activities in the drum. The AK information used in the characterization of Cf-252 sealed sources has been qualified by the peer review process, which has been reviewed and accepted by the Environmental Protection Agency.

  3. H:\\PMKER 25(3)\\VANGA A. F..xps

    African Journals Online (AJOL)

    AISA

    aux produits toxiques, les risques liés à cette pratique et les dispositions locales prises pour la circonscrire. .... L'utilisation des substances toxiques dans la capture des poissons entraîne un gain financier estimé à 15 000 .... gestion durable de la pêche lagunaire. Or, les faits montrent que ces derniers utilisent des produits ...

  4. 7 CFR 2.53 - Administrator, Food Safety and Inspection Service.

    Science.gov (United States)

    2010-01-01

    ... labor standards applicable to covered work; and emergency procurement powers; (iii) Section 104(i)(11) of the Act (42 U.S.C. 9604(i)(11)), with respect to the reduction of exposure to significant risk to..., as amended (42 U.S.C. 7401 et seq.); (v) Noise Control Act of 1972, as amended (42 U.S.C. 4901 et seq...

  5. 29 CFR 1910.253 - Oxygen-fuel gas welding and cutting.

    Science.gov (United States)

    2010-07-01

    ... shall be used. Slings or electric magnets shall not be used for this purpose. Valve-protection caps... having fixed hand wheels shall have keys, handles, or nonadjustable wrenches on valve stems while these cylinders are in service. In multiple cylinder installations only one key or handle is required for each...

  6. : tous les projets | Page 253 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    aquaculture figurent parmi les populations les plus exposées à l'insécurité alimentaire. Date de début : 1 mars 2011. End Date: 1 mai 2014. Sujet: AQUACULTURE, FISH CULTURE, FISH PRODUCTION, FISHERY PRODUCT PROCESSING, ...

  7. 37 CFR 253.6 - Performance of musical compositions by other public broadcasting entities.

    Science.gov (United States)

    2010-07-01

    ... schedule of royalty rates: (1) For all such compositions in the repertory of ASCAP, in 2003, $460; in 2004... royalty rate. The public broadcasting entity shall pay the required royalty rate to ASCAP, BMI and SESAC... this section shall furnish to ASCAP, BMI and SESAC, upon request, a music-use report during one week of...

  8. SU-E-J-253: The Radiomics Toolbox in the Computational Environment for Radiological Research (CERR)

    Energy Technology Data Exchange (ETDEWEB)

    Apte, A; Veeraraghavan, H; Oh, J; Kijewski, P; Deasy, J [Memorial Sloan Kettering Cancer Center, New York, NY (United States)

    2015-06-15

    Purpose: To present an open source and free platform to facilitate radiomics research — The “Radiomics toolbox” in CERR. Method: There is scarcity of open source tools that support end-to-end modeling of image features to predict patient outcomes. The “Radiomics toolbox” strives to fill the need for such a software platform. The platform supports (1) import of various kinds of image modalities like CT, PET, MR, SPECT, US. (2) Contouring tools to delineate structures of interest. (3) Extraction and storage of image based features like 1st order statistics, gray-scale co-occurrence and zonesize matrix based texture features and shape features and (4) Statistical Analysis. Statistical analysis of the extracted features is supported with basic functionality that includes univariate correlations, Kaplan-Meir curves and advanced functionality that includes feature reduction and multivariate modeling. The graphical user interface and the data management are performed with Matlab for the ease of development and readability of code and features for wide audience. Open-source software developed with other programming languages is integrated to enhance various components of this toolbox. For example: Java-based DCM4CHE for import of DICOM, R for statistical analysis. Results: The Radiomics toolbox will be distributed as an open source, GNU copyrighted software. The toolbox was prototyped for modeling Oropharyngeal PET dataset at MSKCC. The analysis will be presented in a separate paper. Conclusion: The Radiomics Toolbox provides an extensible platform for extracting and modeling image features. To emphasize new uses of CERR for radiomics and image-based research, we have changed the name from the “Computational Environment for Radiotherapy Research” to the “Computational Environment for Radiological Research”.

  9. SU-F-T-253: Volumetric Comparison Between 4D CT Amplitude and Phase Binning Mode

    Energy Technology Data Exchange (ETDEWEB)

    Yang, G; Ma, R; Reyngold, M [Memorial Sloan-Kettering Cancer Center, Commack, NY (United States); Li, X; Xiong, W; Gewanter, R [Memorial Sloan-Kettering Cancer Center, Rockville Center, NY (United States); Yorke, E; Mageras, G; Wu, A; Deasy, J; Hunt, M [Memorial Sloan-Kettering Cancer Center, New York, NY (United States); Tang, X [Memorial Sloan-Kettering Cancer Center, West Harrison, NY (United States); Chan, M [Memorial Sloan-Kettering Cancer Center, Basking Ridge, NJ (United States)

    2016-06-15

    Purpose: Motion artifact in 4DCT images can affect radiation treatment quality. To identify the most robust and accurate binning method, we compare the volume difference between targets delineated on amplitude and phase binned 4DCT scans. Methods: Varian RPM system and CT scanner were used to acquire 4DCTs of a Quasar phantom with embedded cubic and spherical objects having superior-inferior motion. Eight patients’ respiration waveforms were used to drive the phantom. The 4DCT scan was reconstructed into 10 phase and 10 amplitude bins (2 mm slices). A scan of the static phantom was also acquired. For each waveform, sphere and cube volumes were generated automatically on each phase using HU thresholding. Phase (amplitude) ITVs were the union of object volumes over all phase (amplitude) binned images. The sphere and cube volumes measured in the static phantom scan were V{sub sphere}=4.19cc and V{sub cube}=27.0cc. Volume difference (VD) and dice similarity coefficient (DSC) of the ITVs, and mean volume error (MVE) defined as the average target volume percentage difference between each phase image and the static image, were used to evaluate the performance of amplitude and phase binning. Results: Averaged over the eight breathing traces, the VD and DSC of the internal target volume (ITV) between amplitude and phase binning were 3.4%±3.2% (mean ± std) and 95.9%±2.1% for sphere; 2.1%±3.3% and 98.0% ±1.5% for cube, respectively.For all waveforms, the average sphere MVE of amplitude and phase binning was 6.5% ± 5.0% and 8.2%±6.3%, respectively; and the average cube MVE of amplitude and phase binning was 5.7%±3.5%and 12.9%±8.9%, respectively. Conclusion: ITV volume and spatial overlap as assessed by VD and DSC are similar between amplitude and phase binning. Compared to phase binning, amplitude binning results in lower MVE suggesting it is less susceptible to motion artifact.

  10. 30 CFR Appendix to Part 253 - List of U.S. Geological Survey Topographic Maps

    Science.gov (United States)

    2010-07-01

    ...; Tajiguas; Topanga; Torrance; Tranquillon Mountain; Triunfo Pass; Tustin; Venice; Ventura; White Ledge Peak... Comal; La Leona; La Parra Ranch NE; Laguna Vista; Lake Austin; Lake Como; Lake Stephenson; Lamar; Long...

  11. Refinement of the critical 2p25.3 deletion region

    DEFF Research Database (Denmark)

    De Rocker, Nina; Vergult, Sarah; Koolen, David

    2015-01-01

    and his three children and a 5' MYT1L overlapping duplication in a father and his two children. Expression analysis in zebrafish embryos shows specific myt1l expression in the developing brain. CONCLUSION: Our data strongly strengthen the hypothesis that MYT1L is the causal gene for the observed syndromal...

  12. H:\\PMKER 25(3)\\NGORAN K. E..xps

    African Journals Online (AJOL)

    AISA

    cause du fait des conditions d'hygiènes précaires observées dans la filière laitière (BAD, 2002 ;. Yapi-Gnaoré et al., 2009 ; N'Goran, 2010). Les conséquences sont entre autres la perte de la valeur marchande du lait local face aux importations massives du lait et produits laitiers, et secondairement la perte de la rentabilité.

  13. 253 some biochemical effects of a mainly fruit diet in man

    African Journals Online (AJOL)

    fasting glucose level. The subject in group C showed a sharp increase in her blood sugar level which returned to more or less the fasting level after 2 hours ...... acid diet which lowers the serum cholesterol level, lowers the phospholipid level even more. Plasma Proteins. The average protein intake of about 50 g per day,.

  14. Diagnosis and Management of 253 Cases with Cushing's syndrome in Imam Khomeini Hospital

    Directory of Open Access Journals (Sweden)

    Esteghamati A.R

    2007-09-01

    Full Text Available Background: Definite diagnosis and treatment of Cushing's syndrome is still a dilemma. The aim of this study was to evaluate the accuracy of diagnostic tests and follow-up of patients with Cushing's syndrome."nMethods: Two hundred and fifty three consecutive cases with Cushing's syndrome during 1370-78 were studied. The screening tests were performed in all patients. High dose dexamethasone suppression test (HDDST and ACTH measurement were carried out. MRI/CT Scan were performed and compared with laboratory data and pathologic specimens as a gold standard test."nResults: The age range was 32±11 yrs. The most frequent symptoms were weakness; hypertension, typical striae, and depression .The frequency of hypertension in ACTH-dependent case were 77% vs. 36% in adrenal tumors (P< 0.001. HDDST was positive in 99% of micro and 71% of macroadenomas. Adrenal tumors showed 3.6% suppression but none in ectopic cases. HDDST had a sensitivity of 98%, specificity of 97% and accuracy equals to 98%. The frequency of different etiologies was as following: Cushing's disease in 64.8%, adrenal tumors in 32.8% and ectopic ACTH in 2.4% of patients. Trans-sphenoidal surgery (TSS was performed in 120 patients .The patients were followed for 53±25 months whose remission periods were 46.7±23.8 months (range 4-114 months. Survival analysis showed 93% remission rate in 12mo, 82% in 2yr and only 33% after 5yr.This recurrence didn't have any platue level."nConclusion: In our study, hypertension was more prevalent in ACTH-dependent Cushing's syndrome. HDDST had acceptable sensitivity, specificity and accuracy. Lifelong follow up of pituitary adenomas is inevitable in the case of progressive and gradual nature of recurrence in these tumors.

  15. 76 FR 253 - Airworthiness Directives; ROLLADEN-SCHNEIDER Flugzeugbau GmbH Model LS6 Gliders

    Science.gov (United States)

    2011-01-04

    ... Flugzeugbau GmbH Model LS6 Gliders AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Final rule... determined that the unsafe condition does not exist in the Model LS6-c gliders. FAA's Determination We are... AD is not applicable to the Model LS6 glider, and the unsafe condition described previously is not...

  16. Radiative and mechanical feedback into the molecular gas of NGC 253

    NARCIS (Netherlands)

    Rosenberg, M. J. F.; Kazandjian, M. V.; van der Werf, P. P.; Israel, F. P.; Meijerink, R.; Weiß, A.; Requena-Torres, M. A.; Güsten, R.

    Starburst galaxies are galaxies or regions of galaxies undergoing intense periods of star formation. Understanding the heating and cooling mechanisms in these galaxies can give us insight to the driving mechanisms that fuel the starburst. Molecular emission lines play a crucial role in the cooling

  17. MobiHealth-Innovative 2.5/3G mobile services and applications for health care

    NARCIS (Netherlands)

    Konstantas, D.; Jones, Valerie M.; Bults, Richard G.A.; Herzog, Rainer

    MobiHealth aims at introducing new mobile value added services in the area of healthcare, based on 2.5 (GPRS) and 3G (UMTS) technologies, thus promoting the use and deployment of GPRS and UMTS. This will be achieved by the integration of sensors and actuators to a Wireless Body Area Network (BAN).

  18. 37 CFR 253.4 - Performance of musical compositions by PBS, NPR and other public broadcasting entities engaged in...

    Science.gov (United States)

    2010-07-01

    ... background or theme music in a PBS program: 2003-2007 $56.81 (3) For performance of such a work in a feature presentation of a station of PBS: 2003-2007 $19.16 (4) For performance of such a work as background or theme music in a program of a station of PBS: 2003-2007 $4.04 (5) For the performance of such a work in a...

  19. Implementing the Extended School Day Policy in Florida's 300 Lowest Performing Elementary Schools. REL 2017-253

    Science.gov (United States)

    Folsom, Jessica Sidler; Osborne-Lampkin, La'Tara; Cooley, Stephan; Smith, Kevin

    2017-01-01

    Since the 2012/13 school year Florida law has required the 100 lowest performing elementary schools in reading to extend the school day by one hour to provide supplemental reading instruction. In 2014 the law was broadened to include the 300 elementary schools with the lowest reading performance. A previous study of the state's first two cohorts…

  20. 37 CFR 253.5 - Performance of musical compositions by public broadcasting entities licensed to colleges and...

    Science.gov (United States)

    2010-07-01

    ... rates: (1) For all such compositions in the repertory of ASCAP, $277 annually. (2) For all such.... The public broadcasting entity shall pay the required royalty rate to ASCAP, BMI and SESAC not later... shall furnish to ASCAP, BMI and SESAC, upon request, a music-use report during one week of each calendar...

  1. The TREK2 Channel Is Involved in the Proliferation of 253J Cell, a Human Bladder Carcinoma Cell

    OpenAIRE

    Park, Kyung-Sun; HAN, MIN HO; Jang, Hee Kyung; Kim, Kyung-A; Cha, Eun-Jong; Kim, Wun-Jae; Choi, Yung Hyun; Kim, Yangmi

    2013-01-01

    Bladder cancer is the seventh most common cancer in men that smoke, and the incidence of disease increases with age. The mechanism of occurrence has not yet been established. Potassium channels have been linked with cell proliferation. Some two-pore domain K+ channels (K2P), such as TASK3 and TREK1, have recently been shown to be overexpressed in cancer cells. Here we focused on the relationship between cell growth and the mechanosensitive K2P channel, TREK2, in the human bladder cancer cell ...

  2. 40 CFR 421.253 - Effluent limitations guidelines representing the degree of effluent reduction attainable by the...

    Science.gov (United States)

    2010-07-01

    ... gold refined electrolytically Lead 5.544 2.574 Mercury 2.970 1.188 Silver 5.742 2.376 Zinc 20.200 8.316... pollutant property Maximum for any 1 day Maximum for monthly average mg/troy ounce of gold and silver smelted Lead 0.364 0.169 Mercury 0.195 0.078 Silver 0.377 0.156 Zinc 1.326 0.546 Gold 0.130 (b) Silver...

  3. PARTIAL 3Q DUPLICATION SYNDROME AND ASSIGNMENT OF D3S5 TO 3Q25-3Q28

    NARCIS (Netherlands)

    VANESSEN, AJ; KOK, K; van den Berg, Anke; DEJONG, B; STELLINK, F; BOS, AF; SCHEFFER, H; BUYS, CHCM

    We report a girl with a de novo duplication of the distal part of the long arm of chromosome 3 and review the literature. Our patient had the facial characteristics and many other anomalies of the partial 3q duplication syndrome. As a hitherto undescribed symptom in partial 3q trisomy syndrome, she

  4. The importance of education in the promotion of organ donation - doi: 10.5020/18061230.2012.p253

    Directory of Open Access Journals (Sweden)

    Taise Ribeiro Morais

    2012-11-01

    Full Text Available Transplantation and human organ donation are controversial issues that have generated much interest and discussion. The lack of clarification and the sensationalist news about organ trafficking contribute to raise questions and render the myths and prejudices permanent.The donation of organs and tissues is seen by society in general, as an act of solidarity and love from the family. However, it requires decision-making at a time of extreme pain and distress, caused by the impact of breaking news of death, the feeling of loss and the unexpected interruption of a life course(1.As the criteria of death are modified, the concept of brain death arises, along with the possibility of using donor organs and tissues. When there is not a good understanding of the organ donation process, the relatives of potential donors feel apprehensive, doubtful and undecided at the time of occurrence, because it is a subject about which there hasn’t been much clarification(1.Brazil has the largest public transplants program in the world, since the government finances 92% of procedures done in the country. However, when we consider the rate of post mortem transplant into the population, Brazil’s results are little expressive(2.Family refusal is a major obstacle to the realization of transplants, and is also identified as major cause for the shortage of organs and tissues for transplantation. Families who understand well the diagnosis of brain death are more favorable to organ donation, compared to families who believe that death only occurs after the heart stops. Therefore, the poor level of information, either by the quality of information concerning brain death, either by not having exceeded the barrier of stigmatized fear of organ trading, propagated by the media, drastically reduces the number of patients who are benefited from receiving an organ(3.Although all people are responsible for disseminating information, we must also educate health professionals, since they interfere directly in the likely donor’s family decision. Perhaps, they lack the study of Thanatology. These professionals deal directly with death but do not investigate death, mourning. The family situation at the time of mourning, hardened by the difficult decision of donating the organs of their beloved one, should form a strong synergistic relationship, as it comes into question the shock of death and the decision to save other people’s lives. It has also been disclosed that religion is considered one of the reasons to refuse the donation of organs and tissues for transplantation. It is, thus, necessary to give greater attention to people’s religious beliefs and values by the time of the loss of their relatives. The literature is rich in references demonstrating that the mass media, despite their high national and global spreading power, are not best suited to provide sufficient explanation on such contentious issues as it is, among others, the organ donation. Instead, the means, the symbology and the repertoire often used by mass media cause more confusion than clarification(4.A study in Spain found that a lot of information spread in the media could be an alternative to the clarification of doubts, however, it sometimes reproduce misinformation, superficial and prejudice-based ideas, being unable to modify negative behavior related to organ donation.A research conducted with people attending health centers in Spain showed that only 7% of the respondents received information about transplantation from primary care professionals. Although the negative information has been quite absorbed, the study indicates that, even in small proportion, the positive information has generated a new way of interpreting organ donation(6We here emphasize the importance of discussing the issue “organ donation” with friends and family, because people, being well educated, are capable of promoting discussions, which that can be understood as promotion of donation.The profile of the opponent to organ donation is: man or woman over the age of 45 years, with low schooling, who does not know the concept of brain death and has a partner also against organ donation, is not conducive to blood donation and fears the manipulation of the body after death. The main reasons for not accepting the donation is the lack of knowledge of how to become a donor and the fear of misdiagnosis of death(7.Facing this reality, health professionals should act as educators, to modify public opinion regarding the misconceptions. However, unfavorable beliefs can be modified only if educators are well prepared for that, so that the population is prompted to participate in debates on organ transplants and legislation.Modifying the existing reality means developing programs planned and evaluated in an ongoing educational process, supported by theoretical background and scientifically recognized models, for all segments of the community, along with incorporating the knowledge of thanatology in the formation of health professionals, with better appreciation of religious principles, to avoid making an aggressive approach to the families of potential donors. The preparation of families should be taken into consideration, to prevent the false idea that death is being expected in order to save others’ lives, because every family wants their patient to have the opportunity to live. Therefore, the government is to be exhorted to realize that the lack of support to the practice of organ donation is a real problem, and to include educational activities regarding transplants in priority governmental programs and in public policies of health care.Since organ donation in Brazil depends exclusively on the family permission, campaigns that seek to increase the understanding of the concept of brain death among the population, and, most of all, to encourage people to express their desire to be a donor and to discuss their decision with family are important strategies to tackle this problem.With a performance based on ethics and responsibility, the relationships and public policies contribute to the interests of society and organizations being achieved and established through dialogue. On the issue of transplantation, this contribution stands out because, through information and the establishment of relations with the public segments, the activity aims to reduce the suffering of many people awaiting in queues, as well as to alleviate the suffering of donor’s relatives and friends.It is also extremely valuable to include contents related to the theme of transplants / organ donation in undergraduate courses in the health area, so that professionals can act accordingly to the needs of their clientele, safely and efficiently, improving quality of life population.

  5. SU-E-T-253: Open-Source Automatic Software for Quantifying Biological Assays of Radiation Effects

    Energy Technology Data Exchange (ETDEWEB)

    Detappe, A [University of Lyon (France); Dana-Farber Cancer Institute, Boston, MA (United States); Korideck, H [Dana-Farber Cancer Institute, Boston, MA (United States); Makrigiorgos, G; Berbeco, R [Dana-Farber Cancer Institute, Boston, MA (United States); Brigham and Women' s Hospital, Boston, MA (United States)

    2014-06-01

    Purpose: Clonogenic cell survival is a common assay for quantifying the effect of drugs and radiation. Manual counting of surviving colonies can take 30–90seconds per plate, a major limitation for large studies. Currently available automatic counting tools are not easily modified for radiation oncology research. Our goal is to provide an open-source toolkit for precise, accurate and fast analysis of biological assays in radiation oncology. Methods: As an example analysis, we used HeLa cells incubated with gadolinium nanoparticles prior to irradiation. After treatment, the cells are grown for 14days to allow for colony formation. To analyze the colony growth, we capture images of each dish for archiving and automatic computer-based analysis. A FujifilmX20 camera is placed at the top of a box setup, 20cm above the sample, which is backlit by a LED lamp placed at the bottom of the box. We use a Gaussian filter (width=1.3mm) and color threshold (19–255). The minimum size for a colony to be counted is 1mm. For this example, 20 dishes with a large range of colonies were analyzed. Each dish was counted 3 times manually by 3 different users and then compared to our counter. Results: Automatic counting of cell colonies takes an average of 7seconds, enabling the analysis process to be accelerated 4–12 times. The average precision of the automatic counter was 1.7%. The Student t-test demonstrated the non-significant differences between the two counting methods (p=0.64). The ICC demonstrated the reliability of each method with ICC>0.999 (automatic) and ICC=0.95 (manual). Conclusion: We developed an open-source automatic toolkit for the analysis of biological assays in radiation oncology and demonstrated the accuracy, precision and effort savings for clonogenic cell survival quantification. This toolkit is currently being used in two laboratories for routine experimental analysis and will be made freely available on our departmental website.

  6. Nustar and Chandra insight into the nature of the 3-40 kev nuclear emission in NGC 253

    DEFF Research Database (Denmark)

    Lehmer, B. D.; Wik, D. R.; Hornschemeier, A. E.

    2013-01-01

    by an absorbed (NH ≈ 1.6 × 1023 cm-2) broken power-law model with spectral slopes and break energies that are typical of ultraluminous X-ray sources (ULXs), but not active galactic nuclei (AGNs). A previous Chandra observation in 2003 showed a hard X-ray point source of similar luminosity to the 2012 source...

  7. Page 1 A Note on Global Dimension 253 [x;, x;] = 2. Cºxk. k-º: min (i, j ...

    Indian Academy of Sciences (India)

    with its image under this mapping. The algebra ºf is obtained as a suc- cession of extension rings such that each intermediary ring is a “non-com- mutative polynomial ring ” over the preceding with respect to a suitable derivation in the following manner. Let di be the inner derivation of &f defined by the element xi and let Ai ...

  8. 253. Experiencia en el puente al trasplante cardíaco con oxigenación de membrana extracorpórea en adultos

    Directory of Open Access Journals (Sweden)

    L. Doñate Bertolín

    2012-04-01

    Conclusiones: La asistencia tipo ECMO permite rescatar pacientes en shock cardiogénico refractario, asistiéndolos con éxito hasta el trasplante. Nuestros resultados postrasplante en pacientes en los que el puente al trasplante se hace sólo con ECMO, son suficientemente buenos como para aceptar esta estrategia, ya que la política nacional de trasplantes nos permite llevarlo a cabo en las primeras semanas de asistencia.

  9. Pure partial monosomy 3p (3p25.3 → pter: Prenatal diagnosis and array comparative genomic hybridization characterization

    Directory of Open Access Journals (Sweden)

    Chih-Ping Chen

    2012-09-01

    Conclusion: In this case, aCGH has characterized a 3p deleted region with haploinsufficiency of the neurodevelopmental genes associated with cognitive deficit and mental retardation but without involvement of the congenital heart disease susceptibility locus, and QF-PCR has determined a paternal origin of the deletion. aCGH and QF-PCR help to delineate the genomic imbalance in prenatally detected de novo chromosome aberration, and the information acquired is useful for genetic counseling.

  10. EXECUTIVE LEADERSHIP AND DEVELOPMENT (IN INDUSTRIAL PSYCHOLOGY BY B. VONHALLER GILMER AND OTHERS. NEW YORK, MCGRAW-HILL, 1966/ 228-253).

    Science.gov (United States)

    HILTON, THOMAS L.

    THIS CHAPTER FROM A LARGER WORK ON INDUSTRIAL PSYCHOLOGY DISCUSSES LEADERSHIP STEREOTYPES AND CONCEPTIONS, EMPIRICAL EVIDENCE OF ACTUAL LEADERSHIP FUNCTIONS, THE SELECTION OF POTENTIAL EXECUTIVES, AND METHODS OF EXECUTIVE DEVELOPMENT. THE MAJOR PROBLEM OF LEADERSHIP IS TO CREATE SITUATIONS IN WHICH FOLLOWERS WILLINGLY ACCEPT THE LEADER AS THEIR…

  11. 78 FR 43888 - Compliance Policy Guide Sec. 253.100-Use of Units of Plasma and Fresh Frozen Plasma Which Have...

    Science.gov (United States)

    2013-07-22

    ... and Fresh Frozen Plasma Which Have Been Thawed; Withdrawal of Compliance Policy Guide AGENCY: Food and... Units of Plasma and Fresh Frozen Plasma Which Have Been Thawed,'' issued October 1, 1980, and revised in... Plasma Which Have Been Thawed'' on October 1, 1980, and revised it in March 1995. FDA originally issued...

  12. El-AbedOroub, Unprotected: Palestinians in Egypt since 1948, Washington, DC, Institute for Palestine Studies / Ottawa: International Development Research Centre, 2009, 253 p.

    Directory of Open Access Journals (Sweden)

    Françoise de Bel-Air

    2010-06-01

    Full Text Available L’ouvrage proposé par Oroub El-Abed sur les Palestiniens d’Égypte comble un manque : cette communauté n’avait, en effet, encore jamais fait l’objet d’une étude scientifique de grande ampleur telle que celle entreprise par l’auteur sous les auspices du programme Forced Migration and Refugee Studies de l’Université américaine au Caire. L’ambition initiale de Oroub El-Abed et de son équipe était de réaliser une enquête de terrain portant sur un échantillon de 300 ménages répartis dans 15 gouvern...

  13. Care for diabetes patients using the Staged Diabetes Management protocol: an experience report - doi:10.5020/18061230.2006.p253

    Directory of Open Access Journals (Sweden)

    Maria Lúcia Zanetti

    2012-01-01

    Full Text Available The work in multi professional health team has been acknowledged as important for the diabetic patient education. This study aimed at describing the implementation of a care assistance program using the Staged Diabetes Management (SDM protocol; also, characterizing the activities performed by the multi professional health team of the Nurse Education Center for Adults and Elderly, from Ribeirão Preto, in the treatment of diabetic patients. The study was developed from April, 2004 to April, 2005 through weakly meetings, combining individual and group activities coordinated by nurses, physicians, nutritionists, psychologists and physical educators. The results showed that the use of the SDM protocol contributed to improve diabetic patient’s metabolic control and consequently, drug cover up for diabetes mellitus, arterial hypertension and dislipidemia; also, increased the adherence to the nutrition program, to physical activity and the knowledge about the disease; and yet, reduced the signs and symptoms referred by the patients. This experience, showed the viability of implanting the referred protocol. The authors believe that the disclosure of this type of study might contribute to the guides commended by World Health Organization for the care of diabetic patients, specially the disease’s self-managed care.

  14. 3-(4-{3,3,4,4,5,5-Hexafluoro-2-[5-(3-methoxyphenyl-2-methyl-3-thienyl]cyclopent-1-enyl}-5-methyl-2-thienylbenzonitrile

    Directory of Open Access Journals (Sweden)

    An-yin Chen

    2009-10-01

    Full Text Available The title compound, C29H19F6NOS2, is a new unsymmetrical photochromic diarylethene derivative with different meta-phenyl substituents. The distance between the two reactive (i.e. can be irradiated to form a new chemical bond C atoms is 3.501 (4 Å; the dihedral angles between the mean plane of the main central cyclopentene ring and the thiophene rings are 47.7 (5 and 45.1 (2°, and those between the thiophene rings and the adjacent benzene rings are 29.4 (2 and 28.4 (3°. The three C atoms and the F atoms of hexafuorocyclopentene ring are disordered over two positions, with site-occupancy factors of 0.751 (4 and 0.249 (4.

  15. Concomitant NSAID use during antipsychotic treatment and risk of 2-year relapse - a population-based study of 16,253 incident patients with schizophrenia

    DEFF Research Database (Denmark)

    Köhler, Karl Ole; Petersen, Liselotte; Benros, Michael Eriksen

    2016-01-01

    for schizophrenia. METHODS: We identified all incident patients with schizophrenia in Denmark diagnosed 1996-2012 initiating antipsychotic treatment within the year after diagnosis. We calculated concomitant treatment intervals for antipsychotic and NSAID or paracetamol use. Hazard rate ratios (HRR) were estimated......OBJECTIVE: Clinical trials have indicated antipsychotic effects of non-steroidal anti-inflammatory drugs (NSAIDs) among incident patients with schizophrenia. We aimed to study, in a population-based setting, whether concomitant use of NSAIDs or paracetamol, changed 2-year relapse risk...... using Cox regression adjusted for important covariates. MAIN OUTCOME MEASURES: 2-year relapse, i.e. (re)-hospitalizations with schizophrenia. RESULTS: Among 16,235 incident patients with schizophrenia using antipsychotics, 1480 (9.1%) used NSAIDs and 767 (4.7%) paracetamol. Concomitant use of NSAIDs...

  16. The Phase Evolution and Property of FeCoCrNiAlTix High-Entropy Alloying Coatings on Q253 via Laser Cladding

    Directory of Open Access Journals (Sweden)

    Bin He

    2017-09-01

    Full Text Available High-entropy alloys (HEAs are emerging as a hot research frontier in the metallic materials field. The study on the effect of alloying elements on the structure and properties of HEAs may contribute to the progress of the research and accelerate the application in actual production. FeCoCrNiAlTix (x = 0, 0.25, 0.5, 0.75, and 1 in at.%, respectively HEA coatings with different Ti concentrations were produced on Q235 steel via laser cladding. The constituent phases, microstructure, hardness, and wear resistance of the coatings were investigated by XRD, SEM, microhardness tester and friction-wear tester, respectively. The results show that the structure of the coating is a eutectic microstructure of FCC and BCC1 at x = 0. The structure of coatings consists of both proeutectic FCC phase and the eutectic structure of BCC1 and BCC2. With the continuous addition of Ti, the amount of eutectic structure decreases. The average hardness of the FeCoCrNiAlTix HEA coatings at x = 0, 0.25, 0.5, 0.75, and 1 are 432.73 HV, 548.81 HV, 651.03 HV, 769.20 HV, and 966.29 HV, respectively. The hardness of coatings increases with the addition of Ti, where the maximum hardness is achieved for the HEA at x = 1. The wear resistance of the HEA coatings is enhanced with the addition of Ti, and the main worn mechanism is abrasive wear.

  17. Analysis of t(9;17)(q33.2;q25.3) chromosomal breakpoint regions and genetic association reveals novel candidate genes for bipolar disorder

    DEFF Research Database (Denmark)

    Rajkumar, Anto P; Christensen, Jane H; Mattheisen, Manuel

    2015-01-01

    ,856) data. Genetic associations between these disorders and single nucleotide polymorphisms within these breakpoint regions were analysed by BioQ, FORGE, and RegulomeDB programmes. RESULTS: Four protein-coding genes [coding for (endonuclease V (ENDOV), neuronal pentraxin I (NPTX1), ring finger protein 213...

  18. Installation Restoration Program. Preliminary Assessment: 253rd Combat Communications Group and 267th Combat Communications Squadron, Wellesley Air National Guard Station, Massachusetts Air National Guard, Wellesley, Massachusetts.

    Science.gov (United States)

    1991-02-01

    portion of the Station is collected by a series of storm drains I (Figure 11L.4). Storm drains are located along the western and northwestern sides of...collected by storm drains associated with Minuteman Lane (Figure III.4). Water is routed east where it outflows the Station property and flows north along

  19. Rapid detection of de novo P253R mutation in FGFR2 using uncultured amniocytes in a pregnancy affected by polyhydramnios, Blake's pouch cyst, and Apert syndrome

    Directory of Open Access Journals (Sweden)

    Chih-Ping Chen

    2013-06-01

    Conclusion: Prenatal diagnosis of polyhydramnios, frontal bossing, and midface hypoplasia associated with brain and digital abnormalities should include a differential diagnosis of Apert syndrome. A molecular analysis of FGFR2 using uncultured amniocytes is useful for rapid confirmation of Apert syndrome at prenatal diagnosis.

  20. Multibeam collection for TN253: Multibeam data collected aboard Thomas G. Thompson from 2010-08-26 to 2010-09-07, Astoria, OR to Astoria, OR

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set is part of a larger set of data called the Multibeam Bathymetry Database (MBBDB) where other similar data can be found at...

  1. FONSECA, Luciana Carvalho. Inglês Jurídico – Tradução e Terminologia. São Paulo: Lexema, 2014. 253 p.

    Directory of Open Access Journals (Sweden)

    Juliana Steil

    2014-07-01

    Full Text Available http://dx.doi.org/10.5007/2175-7968.2014v1n33p361 O livro, escrito em linguagem elegante e objetiva, é resultado da organização de uma série de textos originalmente publicados por Luciana Carvalho Fonseca em meio eletrônico, na página da Tradjuris – law, language & culture (empresa dirigida por Fonseca e na coluna Migalaw do portal jurídico Migalhas. A obra reflete a longa experiência teórica e prática da autora, que é advogada e tradutora, além de professora de tradução jurídica, cultura e interpretação consecutiva e simultânea da PUC-SP. Um dos aspectos mais interessantes da metodologia utilizada na proposta do livro é justamente o fato de a maior parte dos tópicos abordados ter partido de dúvidas sobre tradução e terminologia apresentadas por leitores dos referidos sites, conforme explica a autora (p. 07, indicando a pertinência do perfil prioritariamente aplicado do conteúdo da obra

  2. Ethyl 2-{5-[(3-oxo-3,4-dihydro-2H-1,4-benzothiazin-4-ylmethyl]-1H-1,2,3-triazol-1-yl}acetate

    Directory of Open Access Journals (Sweden)

    Nada Kheira Sebbar

    2014-02-01

    Full Text Available In the title compound, C15H16N4O3S, the six-membered heterocycle of the benzothiazine fragment exhibits a screw boat conformation. The dihedral angle between the planes through the triazole ring and the benzene ring fused to the 1,4-thiazine ring is 62.98 (11°. The mean plane formed by the atoms belonging to the acetate group is nearly perpendicular to the triazole ring [dihedral angle = 74.65 (12°]. In the crystal, molecules are linked by pairs of C—H...O interactions, forming dimeric aggregates.

  3. Bruno Dorin, Frédéric Landy, Agriculture et alimentation de l’Inde : les vertes années (1947-2001, INRA Editions, Paris, 2002, 253 pages

    Directory of Open Access Journals (Sweden)

    Sylvain Ropital

    2004-12-01

    Full Text Available Considérée dès à présent comme l’un des premiers producteurs mondiaux de denrées alimentaires de la planète, l’Inde, outre son image moderne de géant mondial de la sous-traitance informatique, incarnera le futur « Ventre » agricole du monde en tant que premier exportateur de céréales, de lait et d’oléagineux du grand marché mondial. Parallèlement à ce visage de géant mondial de la production agricole, l’Inde apparaît aussi telle l’une des terres les plus touchées par la violence de la malnutr...

  4. A Response to Ages Past. Commentary on Harris, R. M., Michell, B.G. & Cooley. C. (1985) The Gender Gap in Library Education. (Journal of Education for Library and Information Science, 25(3), 167-176)

    Science.gov (United States)

    Wellstead, Peta

    2015-01-01

    Much has changed in the information environment since the years of Harris' review. It is important to mention the significance of the impact of technology that has rendered the work of librarians and information workers almost unknowable to those teaching in the period 1965-1983. As a result of these reviews and technological changes, many…

  5. "Requestioning" AIDS: An Ethical Reflection From 1993 to Today. Reflections on Claude Vandevyer's "Homosexuals and AIDS: A New Approach to the Illness" from Journal of Homosexuality 25(3).

    Science.gov (United States)

    Lau, Travis

    2016-01-01

    This article serves as one of the supplementary pieces of this special issue on "Mapping Queer Bioethics," in which we take a solipsistic turn to "map" the Journal of Homosexuality itself. Here, the author examines the first feature-length article to address the relationship between HIV status and homosexuality. Lingering on both the temporal gap between the dawn of AIDS in American discourse and its inclusion in this journal, the author asks us to consider (in hindsight) such a delay bearing in mind queer theoretical projects of the present such as gay shame, stigma, and queer biopolitics.

  6. Detection of recurrent 4p16.3 microdeletion with 2p25.3 microduplication by multiplex ligation-dependent probe amplification and array comparative genomic hybridization in a fetus from a family with Wolf–Hirschhorn syndrome

    Directory of Open Access Journals (Sweden)

    Wen-Xu Yang

    2016-02-01

    Conclusion: The combined use of MLPA and aCGH is an effective way to diagnose recurrent WHS. Although WHS is typically caused by a de novo deletion, prenatal diagnosis and genetic counseling are necessary in the next pregnancy in families that have suffered such cases.

  7. Fauna parasitária de peixes oriundos de “pesque-pague” do município de Guariba, São Paulo, Brasil - DOI: 10.4025/actascibiolsci.v28i3.253 Parasitic fauna of cultivated fishes in fee fishing farm of Guariba, São Paulo State, Brazil - DOI: 10.4025/actascibiolsci.v28i3.253

    Directory of Open Access Journals (Sweden)

    Julieta Rodini Engracia de Moraes

    2007-11-01

    Full Text Available Este trabalho descreve a ocorrência e a sazonalidade de parasitos em peixes de “pesque-pague” do município de Guariba, Estado de São Paulo, Brasil (21º15`22``S, 48º18`58``W e 595 m de altitude, durante o período de agosto de 2001 a julho de 2002. A presença de parasitos foi pesquisada em pacu Piaractus mesopotamicus (Characidae, carpa comum Cyprinus carpio (Cyprinidae, tilápia-do-Nilo Oreochromis niloticus (Cichlidae, híbrido tambacu (macho de P. mesopotamicus x fêmea de tambaqui-Colossoma macropomum e piraputanga Brycon hillari (Characidae. Os resultados demonstram que dos 100 peixes examinados, 15% estavam parasitados por pelo menos um dos seguintes parasitos: Trichodina sp.; helmintos monogenóides; copepoditos de Lernaea cyprinacea; L. cyprinacea adulta ou Dolops carvalhoi. Por ordem decrescente, o grau de suscetibilidade dos hospedeiros foi C. carpio, P. mesopotamicus, B. hillari, híbrido tambacu e O. niloticus. Por ordem decrescente, os parasitos encontrados foram helmintos monogenóides, Dolops carvalhoi, Trichodina sp., Lernaea cyprinacea adultas e suas formas jovens.This study describes the occurrence and the seasonality of parasites of cultivated fish from a fee fishing farm located in Guariba, São Paulo State, Brazil (21º15`22`` S, 48º18`58`` W and 595 m of altitude, from August, 2001 to July, 2002. The presence of parasites was researched in pacu Piaractus mesopotamicus (Characidae, common carp Cyprinus carpio (Cyprinidae, nile-tilapia Oreochromis niloticus (Cichlidae, tambacu hybrid (male of P. mesopotamicus x female of tambaqui-Colossoma macropomum and piraputanga Brycon hillari (Characidae. Results demonstrate that out of 100 fish examined, 15% were sponged for at least one of the following parasites: Trichodina sp.; monogenean helminths; copepodits of Lernaea cyprinacea; adults of L. cyprinacea; or Dolops carvalhoi. In decreasing order, the susceptibility degree of the hosts was C. carpio, P. mesopotamicus, B. hillari, tambacu hybrid and O. niloticus. In decreasing order the reported parasites were monogenean helminths, Dolops carvalhoi, Trichodina sp., adults of Lernaea cyprinacea and their young shapes.

  8. Discovery of isotopes of the transuranium elements with 93≤Z≤98

    Energy Technology Data Exchange (ETDEWEB)

    Fry, C.; Thoennessen, M., E-mail: thoennessen@nscl.msu.edu

    2013-01-15

    One hundred and five isotopes of the transuranium elements neptunium, plutonium, americium, curium, berkelium, and californium have been observed so far; the discovery of these isotopes is described. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  9. Separation of Transplutonium Elements from Neutron Irradiated Americium-241

    National Research Council Canada - National Science Library

    UENO, Kaoru; WATANABE, Kenju; SAGAWA, Chiaki; ISHIMORI, Tomitaro

    1974-01-01

    .... The ratios of the amounts present of these isotopes were determined by mass spectrometry. It was not possible to identify 249Bk in the berkelium fraction owing to the interference from other β-ray emitting nuclides. In the californium fraction, both spontaneous fission and a-activities due to 250, 252 were observed.

  10. Neutron-Activated Gamma-Emission: Technology Review

    Science.gov (United States)

    2012-01-01

    flux sources developed for boron neutron capture therapy ( BNCT ), found to be an experimental success in cancer treatment (26). 30 Improved flux on...achievable Am americium API associated particle imaging B boron Be beryllium BNCT boron neutron capture therapy C carbon Cf californium Cl

  11. ORF Alignment: NC_003272 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available VLLDSAASGWNTVEREGISIRHPARFVL 180 ... Query: 253 ALQKKIVEAQKLLPEVKLDYDLRVKISEVCSELDVDGLRGDIVTNRAAKALTAYEGRTEV 31...2 ... ALQKKIVEAQKLLPEVKLDYDLRVKISEVCSELDVDGLRGDIVTNRAAKALTAYEGRTEV Sbjct: 241 ALQKKIVEAQKLLPEVKLDYDLRVKISEVCSELDVDGLRGDIVTNRAAKALTAYEGRTEV 300 ...

  12. ORF Alignment: NC_003155 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available VNGTTNFILDKMDSTGAGYQEALDEATALGYAEA 180 ... Query: 253 CERAADGGSVTARVHPAMIPLTHPLASVRGAYNAVFVESD 292 ... CERAADGGSVTARVHPAM...IPLTHPLASVRGAYNAVFVESD Sbjct: 241 CERAADGGSVTARVHPAMIPLTHPLASVRGAYNAVFVESD 280

  13. Bright Light Therapy for Treatment of Sleep Problems Following Mild TBI https://www.dacspr.documentservices.dla.mil/dtic/livelink func=formwf.formedit and workid=4132484 and subworkid=4132484 and taskid=8 and formID=1 and viewname=jhg and editable=1176347093 and nexturl=%2Fdtic%2Flivelink%3Ffunc%3Dwork%2Etaskdone%26workid%3D4132484%26subworkid%3D4132484%26taskid%3D8%26xAction%3Dsave%26paneindex%3D1%26nexturl%3D%252Fdtic%252Flivelink%253Ffunc%253Dllworkspace and noredisplay=1#

    Science.gov (United States)

    2016-10-01

    changes within prefrontal brain regions associated with executive functions. These findings may have broader implication for using blue- enriched ...proficiency, enrich their training skills expertise, and broaden their understanding of the current research and analyses methods. The project has...treated with a medication like  lithium ,  NO            YES         sodium valproate (Depakote) or lamotrigine (Lamictal)?        THIS QUESTION IS NOT A

  14. Solid-State Neutron Multiplicity Counting System Using Commercial Off-the-Shelf Semiconductor Detectors

    Energy Technology Data Exchange (ETDEWEB)

    Rozhdestvenskyy, S. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

    2017-08-09

    This work iterates on the first demonstration of a solid-state neutron multiplicity counting system developed at Lawrence Livermore National Laboratory by using commercial off-the-shelf detectors. The system was demonstrated to determine the mass of a californium-252 neutron source within 20% error requiring only one-hour measurement time with 20 cm2 of active detector area.

  15. Cold valleys in the radioactive decay of 248−254Cf isotopes

    Indian Academy of Sciences (India)

    Geiger–Nuttal plots of log10(T1/2) vs. Q−1/2 for 48−52Ca emitting from various californium isotopes. Acknowledgement. One of the authors (KPS) would like to thank University Grants Commis- sion, Govt. of India for the financial support under project No. MRP(S)-. 352/2005(X Plan)/KLKA 002/UGC-SWRO. References.

  16. Directed evolution of the periodic table: probing the electronic structure of late actinides.

    Science.gov (United States)

    Marsh, M L; Albrecht-Schmitt, T E

    2017-07-25

    Recent investigations of the coordination chemistry and physical properties of berkelium (Z = 97) and californium (Z = 98) have revealed fundamental differences between post-curium elements and lighter members of the actinide series. This review highlights these developments and chronicles key findings and concepts from the last half-century that have helped usher in a new understanding of the evolution of electronic structure in the periodic table.

  17. Open Source: Potential in Latin America for Radiological Weapons

    Science.gov (United States)

    2010-03-01

    terrorist group would need to acquire a radioactive isotope with a relatively short half-life. 36,37 As an aside, the IAEA verified that depleted...cns.miis.edu/npr/pdfs/123salama.pdf (accessed March 3, 2010), Useful RDD isotopes include cobalt-60, strontium-90, yttrium-90, iridium-192, cesium-137...plutonium-238, radium -226, americium-241, and californium-252. 37 Hansell and Salama, “Does intent equal capability?,” 640-641. 38 Internation Atomic

  18. Book Review: Sarah Michael (2004) Undermining Development: The Absence of Power Among Local NGOs in Africa, Oxford and Bloomington: James Currey and Indiana University Press. ISBN 0-85255-439-7 (Oxford: James Currey) & ISBN 0-253-21772-5 (Bloomington & In

    OpenAIRE

    Mano, Winston

    2005-01-01

    I found this to be a highly analytical and empirical book, partly because it is based on a Ph.D. thesis received from Trinity College, University of Cambridge (2001). Her first book, it powerfully explores how the absence of power structures among local African non-governmental organisations (NGOs) has undermined development in sub-Saharan Africa. None of the local African NGOs she examined were ‘powerful’, in a way similar to ‘powerful’ local NGOs in Asia and Latin America. By ‘power’ she me...

  19. Decision of the Constitutional Review Division of the National Court of The Republic of Estonia : 30 September 1994 : review of the constitutionality of § 25(3) of the Property Law Enforcement Act to the extent that it sought to repeal § 30(2) of t

    Index Scriptorium Estoniae

    1995-01-01

    Riigikohtu lahendi III-4/A-5/94 (Asjaõigusseaduse rakendamise seaduse § 25 lg. 3 Põhiseadusele vastavuse läbivaatamine Eesti NSV taluseaduse § 30 lg. 2 kehtetuks tunnistamise osas) tekst inglise keeles

  20. Choosing the Right Book: Factors that Affect Children’s Reading. A Review of: Maynard, S., Mackay, S., & Smyth, F. (2008. A survey of young people’s reading in England: Borrowing and choosing books. Journal of Librarianship and Information Science, 40(4, 239-253.

    Directory of Open Access Journals (Sweden)

    Gayle Bogel

    2011-03-01

    Full Text Available Objective – To analyze factors affecting book choice: reading recommendations, reasons for choosing series books, book reviews, and school libraries.Design – This secondary analysis of data is based on a selection of findings from a larger 2005 survey that monitored trends in youth reading habits. The large scale 2005 study was designed as a follow up to a 1996 survey. The 2005 survey used online questionnaires and formal statistical analysis to compare gender and age groups. The data on factors affecting book choice were derived from the original questions, responses, and analyses.Setting – Questionnaires were administered in22 primary and 24 secondary schools in the UK with access to computers and internet.Subjects – Almost 4,200 students from 4 to 16 years of age.Methods – Study authors invited approximately 150 schools to participate in the survey. Forty-six schools (31% responded. A total of 22 primary and 24 secondary schools participated in the original study between April and June 2005.This study used comparative analysis to examine factors affecting book choice between gender and age groups. Statistical significance was defined as one percent. Other demographic information was collected, such as ethnicity, language spoken at home, and religion, but was deemed insufficient for any meaningful analysis.There were 4,182 responses to the survey, separated into three age groups: ages 4 to 7 (KS1, ages 7 to 11 (KS2, and ages 11 to 16 (KS3&4.Students were asked to describe themselves as readers by responding to multiple choice questions, and then to provide specific information on the places or people most frequently used as book borrowing sources. Participants were considered “enthusiastic” readers if they “read a lot with pleasure” and “average” readers if they “read an ordinary amount”. Participants responded to additional multiple choice questions on specific factors related to borrowing books and book choices, the process of choosing series, fiction, and nonfiction books.Main Results – Readers: The number of children who described themselves as “enthusiastic” readers decreased with age, and approximately half of the children between 7 and 16 years of age described themselves as “average” readers, average rating increasing slightly through this age group. Investigators found a marked difference in gender within the 4 to 7 year olds: 49.7% percent of girls in this age group considered themselves “enthusiastic,” compared to 37.3% of boys. Only 18.5% of girls considered themselves “reluctant” readers, compared to 28.1% of boys.The longitudinal comparison to the earlier 1996 study found that although the percentage of boys from ages 7 to 16 who described themselves as reluctant readers stayed about the same, the percentage of girls who described themselves as reluctant increased. There was also a dramatic drop in the number of girls who described themselves as enthusiastic; from 51% in 1996 to 17% in 2005.Borrowing Books: Libraries of all types (school, classroom and public were the prime sources for borrowing books. Girls borrowed more books from schools than boys, and girls also borrowed more books from non-library sources (family members and friends than boys. Both boys and girls increasingly reported borrowing more books from friends than from libraries as they grew older.Over half of each age group rated the school library or classroom book corner as having “enough” books. The perception of “too many books” decreased with age. The perception of quality of the classroom or school library also decreased with age. The number of students in the younger age groups who rated the quality of books in the classroom or school library as “very good” was significantly higher than students in the older age groups. The number of student who rated the quality as “okay” doubled from the lower to the higher age group.Choosing Books: Children were asked six questions related to whether the physical book itself provided motivation to read, and six questions related to other factors for book recommendation. Younger readers were more likely to choose a book for its visual appeal, although this factor (interesting cover or illustrations inside was more consistent for boys of all age groups than girls. The author’s name and book blurb were stronger factors for girls in the 7 to 16 age group than for boys.The study authors sought to explore the idea of “shared reading” and asked children in the 7 to 11 and 11 to 16 age groups how often they chose a book based on a recommendation from a friend or family member, a public or school librarian, or other adults. Friends were the strongest recommendation source (43.2% for 7 to 11 year olds and 38.4% for 11to 16 year olds. Recommendations from school or public librarians rated only three to six percent for both age groups.All age groups were asked about choosing series books, and the questions were simplified for the younger age group. All students reported that appealing factors were the consistency of characters, familiar storylines, and familiar writing styles. Some students also noted that the availability of series books positively affected their choices.Print or online book reviews were used “hardly ever or never” by over 40% of the 7 to16 year old age groups, while television or magazine reviews or recommendations were highly rated by over 50% of respondents in the same age groups. Participants chose informational or non-fiction books because of personal interests, hobbies, or recommendations from friends, while they selected fiction or poetry for the blurb, title, or appearance and design of the cover. Celebrity recommendations and books about celebrities were popular reasons for choosing books.When asked who helped them choose books, 53.2% in the 7 to11 age group and 66.1% in the 11to 16 age group stated that no one ever helps them. Of the students who had help choosing books, “family members” was the most common response. Local librarians were not used as a source for recommendations.

  1. Comment on Spracklandus Hoser, 2009 (Reptilia, Serpentes, ELAPIDAE): request for confirmation of availability of the generic name and for the nomenclatural validation of the journal in which it was published (Case 3601; BZN 70:234–237; 71:30–38; 133-135,181-182 ,252-253)

    Science.gov (United States)

    Rhodin, Anders G.J.; Kaiser, Hinrich; van Dijk, Peter Paul; Wüster, Wolfgang; O’Shea, Mark; Archer, Michael; Auliya, Mark; Boitani, Luigi; Bour, Roger; Clausnitzer, Viola; Contreras-MacBeath, Topiltzin; Crother, Brian I.; Daza, Juan M.; Driscoll, Carlos A.; Flores-Villela, Oscar; Frazier, Jack; Fritz, Uwe; Gardner, Alfred L.; Gascon, Claude; Georges, Arthur; Glaw, Frank; Grazziotin, Felipe G.; Groves, Colin P.; Haszprunar, Gerhard; Havaš, Peter; Hero, Jean-Marc; Hoffmann, Michael; Hoogmoed, Marinus S.; Horne, Brian D.; Iverson, John B.; Jäch, Manfred; Jenkins, Christopher L.; Jenkins, Richard K.B.; Kiester, A. Ross; Keogh, J. Scott; Lacher, Thomas E.; Lovich, Jeffrey E.; Luiselli, Luca; Mahler, D. Luke; Mallon, David P.; Mast, Roderic; McDiarmid, Roy W.; Measey, John; Mittermeier, Russell A.; Molur, Sanjay; Mosbrugger, Volker; Murphy, Robert W.; Naish, Darren; Niekisch, Manfred; Ota, Hidetoshi; Parham, James F.; Parr, Michael J.; Pilcher, Nicolas J.; Pine, Ronald H.; Rylands, Anthony B.; Sanderson, James G.; Savage, Jay M.; Schleip, Wulf; Scrocchi, Gustavo J.; Shaffer, H. Bradley; Smith, Eric N.; Sprackland, Robert; Stuart, Simon N.; Vetter, Holger; Vitt, Laurie J.; Waller, Tomás; Webb, Grahame; Wilson, Edward O.; Zaher, Hussam; Thomson, Scott

    2015-01-01

    In Case 3601 Raymond Hoser has asked the Commission to validate for the purposes of nomenclature the name Spracklandus Hoser, 2009, and ‘the journal in which it was published,’ issue 7 of the Australasian Journal of Herpetology (AJH). We note that the entire run of AJH has been written, edited, and published solely by Hoser. Although his requests to the Commission were presented as narrow and, in his words, ‘routine matters,’ we are convinced that they represent an important tipping-point with broad implications of major concern for zoological taxonomy and nomenclature as a whole and, by extension, the greater scientific community. Since Hoser’s actions and works have failed to follow scientific best practices (e.g. Turtle Taxonomy Working Group, 2007, 2014; Kaiser et al., 2013; Kaiser, 2014) and both the Commission’s general Recommendations and Code of Ethics in Appendix A, the global herpetological community has widely rejected his taxonomic decisions and resultant nomenclature. This has unfortunately caused a confusing dual nomenclature to develop in the herpetological community, with most boycotting or ignoring Hoser’s 700+ new names coined in the AJH, while he and a few personal followers actively promote their usage. We believe that suppression of the name Spracklandus, and all issues of AJH, is the only effective way to bring this contentious and confusing issue to resolution. The plenary power available under Article 81.1 of the Code exist specifically to allow the Commission to make rulings in individual cases that disturb stability and cause confusion, whether the works are Code-compliant or not. We maintain that it is in the interest of nomenclatural stability, not only for herpetology, but for all of zoological taxonomy, that the plenary power be invoked to declare the works in AJH unavailable, regardless of any narrow interpretation of their technical Code-compliance. We present our arguments for rejection of the validity of AJH in the following commentary. In view of the wide-reaching implications of this case for all of zoology, and reflecting the deep and broad-based community concern over these issues, our contributing authors include 70 global scientific leaders and accomplished amateurs from a wide variety of zoological disciplines.

  2. Questions Remain about Whether EBM Competencies Learned in Medical School are Retained in Residency. A review of: Dorsch, Josephine L., Meenakshy K. Aiyer, Krishna Gumidyala and Lynne E. Myer. “Retention of EBM Competencies.” Medical Reference Services Quarterly 25.3 (Fall 2006: 45‐57.

    Directory of Open Access Journals (Sweden)

    Suzanne Lewis

    2007-09-01

    Full Text Available Objective – To assess medical graduates’ use of evidence based medicine (EBM in residency, self‐perception of EBM skills, attitudes toward EBM, and the impact of a formal EBM curriculum in their third undergraduate year.Design – A longitudinal follow‐up study by self‐administered questionnaire.Setting – Internal medicine residency programs in US hospitals.Subjects – A convenience sample of 2001 and 2002 graduates of the University of Illinois College of Medicine at Peoria (UICOM‐P (n=78, and their respective residency program directors (n=72.Methods – A student graduate questionnaire (SGQ was sent to all members of UICOM‐P’s 2001 and 2002 graduating classes who had completed the EBM course during their M‐3 Internal Medicine clerkship. A program director questionnaire (PDQ, similar to the SGQ, was sent to the graduates’ residency program directors. The research instrument was tested with a pilot group prior to use, but not validated. The questionnaires consisted of 4 main sections. The first section examined formal and informal EBM programs in the graduates’ residency curriculum. The second section consisted of a self‐assessment of EBM skills by the residents and an assessment of those skills by their program directors. The third section asked graduates to compare their EBM skills to those of their fellow residents who had not been students at UICOM‐P. Similarly, in the third section of the PDQ, program directors were asked to compare the EBM skills of UICOM‐P graduates and non‐UICOM‐P graduates participating in the residency program. The last section concerned professional and demographic characteristics. Copies of the surveys were mailed out to non‐responders after 6 weeks. Results were collated but statistical analysis was not applied.Main results – The response rate was 32% for residents and 35% for program directors. The number of incomplete surveys was not reported. Forty‐four percent of all respondents reported having a formal EBM curriculum for residents, and 76% reported an informal curriculum. For both formal and informal programs, the most commonteaching formats were journal clubs, followed by lectures, teaching rounds, morning reports, bedside consultations, ambulatory clinics and seminars. In section two of the questionnaires, both residentsand program directors rated the residents’ EBM skills similarly. However, the residents rated their skills in searching the literatureand application of findings to clinical practice higher than the program directors. Program directors also rated the residents’ skills in understanding statistics and tests higher than the residents themselves. Twenty‐four percent of both residents and program directors rated the UICOM‐P graduates as “very competent” or“extremely competent” in EBM skills (50. Only 35% of program directors and 27% of residents rated the UICOM‐P graduates’ EBM skills as “usually better” or “always better” than their peers who were not UICOM‐P graduates (50.Conclusion ‐ The authors of this study conclude that, for UICOM‐P graduates, “it might be implied from these results that the EBM skills gained during medical school were retained through their medical school graduation and into their residency training” (51. However, this study has methodological weaknesses which make itdifficult to draw any definite conclusions from the results.

  3. PROCEEDINGS OF THE SYMPOSIUM COMMEMORATING THE 25th ANNIVERSARY OF ELEMENTS 97 and 98 HELD ON JAN. 20, 1975

    Energy Technology Data Exchange (ETDEWEB)

    Seaborg, Glenn T.; Street Jr., Kenneth; Thompson, Stanley G.; Ghiorso, Albert

    1976-07-01

    This volume includes the talks given on January 20, 1975, at a symposium in Berkeley on the occasion of the celebration of the 25th anniversary of the discovery of berkelium and californium. Talks were given at this symposium by the four people involved in the discovery of these elements and by a number of people who have made significant contributions in the intervening years to the investigation of their nuclear and chemical properties. The papers are being published here, without editing, in the form in which they were submitted by the authors in the months following the anniversary symposium, and they reflect rather faithfully the remarks made on that occasion.

  4. Composition containing transuranic elements for use in the homeopathic treatment of aids

    Energy Technology Data Exchange (ETDEWEB)

    Lustig, D.

    1996-04-18

    A homeopathic remedy consisting of a composition containing one or more transuranic elements, particularly plutonium, for preventing and treating acquired immunodeficiency syndrome (AIDS) in humans, as well as seropositivity for human immunodeficiency virus (HIV). Said composition is characterized in that it uses any chemical or isotopic form of one or more transuranic elements (neptunium, plutonium, americium, curium, berkelium, californium or einsteinium), particularly plutonium, said form being diluted and dynamized according to conventional homeopathic methods, particularly the so-called Hahnemann and Korsakov methods, and provided preferably but not exclusively in the form of lactose and/or saccharose globules or granules impregnated with the active principle of said composition. (author).

  5. Advanced development of the spectrum sciences Model 5005-TF, single-event test fixture

    Energy Technology Data Exchange (ETDEWEB)

    Ackermann, M.R.; Browning, J.S. (Sandia National Labs., Albuquerque, NM (USA)); Hughlock, B.W. (Boeing Aerospace and Electronics Co., Seattle, WA (USA)); Lum, G.K. (Lockheed Missiles and Space Co., Sunnyvale, CA (USA)); Tsacoyeanes, W.C. (Draper (Charles Stark) Lab., Inc., Cambridge, MA (USA)); Weeks, M.D. (Spectrum Sciences, Inc., Santa Clara, CA (USA))

    1990-09-01

    This report summarizes the advanced development of the Spectrum Sciences Model 5005-TF, Single-Event Test Fixture. The Model 5005-TF uses a Californium-252 (Cf-252) fission-fragment source to test integrated circuits and other devices for the effects of single-event phenomena. Particle identification methods commonly used in high-energy physics research and nuclear engineering have been incorporated into the Model 5005-TF for estimating the particle charge, mass, and energy parameters. All single-event phenomena observed in a device under test (DUT) are correlated with an identified fission fragment, and its linear energy transfer (LET) and range in the semiconductor material of the DUT.

  6. TOWARD AN IMPROVED UNDERSTANDING OF STRUCTURE AND MAGNETISM IN NEPTUNIUM AND PLUTONIUM PHOSPHONATES AND SULFONATES

    Energy Technology Data Exchange (ETDEWEB)

    Albrecht-Schmitt, Thomas

    2012-03-01

    This grant supported the exploratory synthesis of new actinide materials with all of the actinides from thorium to californium with the exceptions of protactinium and berkelium. We developed detailed structure-property relationships that allowed for the identification of novel materials with selective ion-exchange, selective oxidation, and long-range magnetic ordering. We found novel bonding motifs and identified periodic trends across the actinide series. We identified structural building units that would lead to desired structural features and novel topologies. We also characterized many different spectroscopic trends across the actinide series. The grant support the preparation of approximately 1200 new compounds all of which were structurally characterized.

  7. Detection of rare earth elements in Powder River Basin sub-bituminous coal ash using laser-induced breakdown spectroscopy (LIBS)

    Energy Technology Data Exchange (ETDEWEB)

    Tran, Phuoc [National Energy Technology Lab. (NETL), Pittsburgh, PA, (United State; Mcintyre, Dustin [National Energy Technology Lab. (NETL), Pittsburgh, PA, (United State

    2015-10-01

    We reported our preliminary results on the use of laser-induced breakdown spectroscopy to analyze the rare earth elements contained in ash samples from Powder River Basin sub-bituminous coal (PRB-coal). We have identified many elements in the lanthanide series (cerium, europium, holmium, lanthanum, lutetium, praseodymium, promethium, samarium, terbium, ytterbium) and some elements in the actinide series (actinium, thorium, uranium, plutonium, berkelium, californium) in the ash samples. In addition, various metals were also seen to present in the ash samples

  8. Dicty_cDB: Contig-U10833-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SGHDEMATRNIQIRVINVLKGWVDNYYSDFDDKLIAMLRTFIDQIQIKFPAPASAVNKSL TKMVEKLSPVNDSKHIFNEKT--- ---EFEIYRNIKPPEL...SGHDEMATRNIQIRVINVLKGWVDNYYSDFDDKLIAMLRTFIDQIQIKFPAPASAVNKSL TKMVEKLSPVNDSKHIFNEKT--- ---ri*nl*kh*ttrt...IAMLRTFIDQIQIKFPAPASAVNKSL 540 SGHDEMATRNIQIRVINVLKGWVDNYYSDFDDKLIAMLRTFIDQIQIKFPAPASAVNKSL Sbjct: 253...SGHDEMATRNIQIRVINVLKGWVDNYYSDFDDKLIAMLRTFIDQIQIKFPAPASAVNKSL 312 Query: 541 TKMVEKLSPVNDSKHIFNEKT-----

  9. ORF Alignment: NC_006085 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available otein ... FtsH [Propionibacterium acnes KPA171202] ... Length = 253 ... Query: 158 SKDTPKSTFADVAGCQEAIDEL...QEIREFLAEPAKFQRVGAKIPKGVLLYGPPGTGKTLLA 217 ... SKDTPKSTFADVAGCQEAIDEL...QEIREFLAEPAKFQRVGAKIPKGVLLYGPPGTGKTLLA Sbjct: 1 ... SKDTPKSTFADVAGCQEAIDELQEIREFLAEPAKFQRVGAKIPKGVLLYGPPGTG

  10. ORF Alignment: NC_004578 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ALADRYADVDCS 60 ... Query: 123 VTGKPVIIHTRGARADTLSLLREAALPQAGVLHCFTEDWDMAKAALDMGYYISLSGIVTF 182 ... VTGK...PVIIHTRGARADTLSLLREAALPQAGVLHCFTEDWDMAKAALDMGYYISLSGIVTF Sbjct: 121 VTGKPVIIHTRGA...RADTLSLLREAALPQAGVLHCFTEDWDMAKAALDMGYYISLSGIVTF 180 ... Query: 243 AEQTTANFARLFP 255 ... AEQTTANFARLFP Sbjct: 241 AEQTTANFARLFP 253

  11. The System Engineering Approach: Taiwan Navy Incorporation of Mobile Devices (Smartphone) into Its Force Structure

    Science.gov (United States)

    2015-06-01

    March 2014, http://searchconsumerization.techtarget.com/opinion/How-mobile-antivirus- software-works-and-how-to-know-if-you-need-it. 25 Serge ...appworld.blackberry.com/ webstore/viewAll/ L3Byb2R1Y3R0eXBlL2FwcHMvbGlzdHR5cGUvcG9wdWxhcg%253D%253D/? lang =en&countrycode= US. 56...MvbGlzdHR5cGUvcG9wdWxhcg%253D%253D/? lang =en&countrycode=US. ———. “Enterprise-grade Security for Regulated Industries.” Accessed March 3, 2015. http

  12. GETDB: 113400 [GETDB

    Lifescience Database Archive (English)

    Full Text Available FP uniform epi Larval X-gal uni epi, Adult GFP leg joints. wing hinge. Lethality ...niform epi uni epi, leg joints. wing hinge. - - - - - - - Show 113400 DGRC Number...etics. FM7c Link to clone table - 1 253 Link to cluster table 253 1 Request - epi (SG), a small # of cells u

  13. Deme accounts and the meaning of hosios money in fifth-century Athens

    NARCIS (Netherlands)

    Blok, J.H.

    2010-01-01

    Comparing the accounts of the deme Ikarion (IG I3 253) with those of Rhamnous (IG I3 247 bis and 253; IRhamnous 181 and 182) and Plotheia (IG I3 258), this article argues that the adjective hosios applied to a fund in Ikarion indicates that this money was dêmosios and to be used in a way pleasing

  14. Nanoscale metal-organic frameworks as highly sensitive luminescent sensors for Fe²⁺ in aqueous solution and living cells.

    Science.gov (United States)

    Lu, Ye; Yan, Bing; Liu, Jin-Liang

    2014-09-07

    We report the exploration of fluorescent nanoscale metal-organic frameworks (nMOF-253s) for highly selective and sensitive detection of Fe(2+) ions in aqueous solution. Moreover, nMOF-253 of 50 nm is successfully applied in fluorescent bioimaging and intracellular Fe(2+) sensing in HeLa cells.

  15. 76 FR 23109 - Enhancing Airline Passenger Protections

    Science.gov (United States)

    2011-04-25

    ... from airlines, airports and other industry entities on whether there are any special operational... April 25, 2011 Part IV Department of Transportation 14 CFR Parts 244, 250, 253 Et al. Enhancing Airline..., 253, 259, and 399 RIN 2105-AD92 Enhancing Airline Passenger Protections AGENCY: Office of the...

  16. GETDB: 103887 [GETDB

    Lifescience Database Archive (English)

    Full Text Available t - oenocyte (SG) sg claw internal semi lethal - comment1:A, comment2:53E5-E6 d1 ... internal Lethality semi lethal Also known as - Original Comments comment1:A, comment2:53E5-E6 Disc (Image)

  17. GETDB: 112305 [GETDB

    Lifescience Database Archive (English)

    Full Text Available Ser - 2 808 Link to cluster table 808 1 - lateral epi - epi, mt - - - comment1:A, comment2:53D11 - - - - Sho...arval X-gal epi, mt Adult GFP - Lethality - Also known as - Original Comments comment1:A, comment2:53D11 Dis

  18. O sistemah stihhoslozhenija (preimushtshestvenno na materjale estonskogo i russkogo stihha") / Mihhail Lotman

    Index Scriptorium Estoniae

    Lotman, Mihhail, 1952-

    1998-01-01

    Bibl. lk. 250-253. Kokkuvõte inglise k. "On systems of versification (mostly in russian and Estonian poetry), lk. 253-254. Kokkuvõte eesti k. "Värsisüsteemidest (peamiselt eesti ja värsi näitel). Eesti k. ilmunud: Akadeemia, 1998, nr. 9 ja 10

  19. Dicty_cDB: Contig-U09091-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 53 Score = 180 bits (91), Expect = 1e-45 Identities = 253/253 (100%) Strand = Plus / Plus Query: 234 tcccnat...ntanactaccnctggncaaantaaaactggtttngcnccnantgcaancggnt 293 |||||||||||||||||||||||...||||||||||||||||||||||||||||||||||||| Sbjct: 234 tcccnatntanactaccnctggncaaantaaaactggtttngcnccnantgcaancggn...acncgncnttggangnattgga 413 Query: 414 aancngnccttttaggggcnggnttancnggntttgcccnaaa...nttanttggnaannattggacncgncnttgg 152 Query: 404 angnattggaaancngnccttttaggggcnggnttancnggntttgcccna

  20. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFC253 (Link to dictyBase) - - - Contig-U12804-1 VFC253E (Link... Clone ID VFC253 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U12804-1 Original site URL http://dict... 3D7, chromosome 9; segment 1/5. 34 0.061 9 AC116957 |AC116957.2 Dictyostelium di...ucing significant alignments: (bits) Value AC116957_18( AC116957 |pid:none) Dictyostelium discoideum chromos...skeletal 4.0 %: vacuolar >> prediction for VFC253 is cyt 5' end seq. ID VFC253F 5

  1. Measurements of the neutron capture cross sections and incineration potentials of minor-actinides in high thermal neutron fluxes: Impact on the transmutation of nuclear wastes; Mesures des sections efficaces de capture et potentiels d'incineration des actinides mineurs dans les hauts flux de neutrons: Impact sur la transmutation des dechets

    Energy Technology Data Exchange (ETDEWEB)

    Bringer, O

    2007-10-15

    This thesis comes within the framework of minor-actinide nuclear transmutation studies. First of all, we have evaluated the impact of minor actinide nuclear data uncertainties within the cases of {sup 241}Am and {sup 237}Np incineration in three different reactor spectra: EFR (fast), GT-MHR (epithermal) and HI-HWR (thermal). The nuclear parameters which give the highest uncertainties were thus highlighted. As a result of fact, we have tried to reduce data uncertainties, in the thermal energy region, for one part of them through experimental campaigns in the moderated high intensity neutron fluxes of ILL reactor (Grenoble). These measurements were focused onto the incineration and transmutation of the americium-241, the curium-244 and the californium-249 isotopes. Finally, the values of 12 different cross sections and the {sup 241}Am isomeric branching ratio were precisely measured at thermal energy point. (author)

  2. A gas secondary electron detector

    CERN Document Server

    Drouart, A; Alamanos, N; Auger, F; Besson, P; Bougamont, E; Bourgeois, P; Lobo, G; Pollacco, E C; Riallot, M

    2002-01-01

    A new Secondary Electron gas Detector (SED) is under development to be used in conjunction with an emissive foil to detect low energy heavy ions as an alternative to micro-channel plates. It could measure position and time of flight. Secondary electrons are accelerated to 10 keV so that they can cross through the 0.9 mu m Mylar entrance window. The electrons then are multiplied in the isobutane gas of the detector at 4-10 Torr. A time resolution of 150 ps and a spatial resolution of 3 mm have been obtained by using californium fission fragments on a prototype detector of 7x7 cm sup 2. The advantage of the SED against MCP is that its size is not limited. Our final goal is to build a large size detector (15x40 cm sup 2) that will operate at the focal plane of the VAMOS magnetic spectrometer at GANIL.

  3. Environmental assessment of the thermal neutron activation explosive detection system for concourse use at US airports

    Energy Technology Data Exchange (ETDEWEB)

    Jones, C.G.

    1990-08-01

    This document is an environmental assessment of a system designed to detect the presence of explosives in checked airline baggage or cargo. The system is meant to be installed at the concourse or lobby ticketing areas of US commercial airports and uses a sealed radioactive source of californium-252 to irradiate baggage items. The major impact of the use of this system arises from direct exposure of the public to scattered or leakage radiation from the source and to induced radioactivity in baggage items. Under normal operation and the most likely accident scenarios, the environmental impacts that would be created by the proposed licensing action would not be significant. 44 refs., 19 figs., 18 tabs.

  4. Chelation and stabilization of berkelium in oxidation state +IV

    Science.gov (United States)

    Deblonde, Gauthier J.-P.; Sturzbecher-Hoehne, Manuel; Rupert, Peter B.; An, Dahlia D.; Illy, Marie-Claire; Ralston, Corie Y.; Brabec, Jiri; de Jong, Wibe A.; Strong, Roland K.; Abergel, Rebecca J.

    2017-09-01

    Berkelium (Bk) has been predicted to be the only transplutonium element able to exhibit both +III and +IV oxidation states in solution, but evidence of a stable oxidized Bk chelate has so far remained elusive. Here we describe the stabilization of the heaviest 4+ ion of the periodic table, under mild aqueous conditions, using a siderophore derivative. The resulting Bk(IV) complex exhibits luminescence via sensitization through an intramolecular antenna effect. This neutral Bk(IV) coordination compound is not sequestered by the protein siderocalin—a mammalian metal transporter—in contrast to the negatively charged species obtained with neighbouring trivalent actinides americium, curium and californium (Cf). The corresponding Cf(III)-ligand-protein ternary adduct was characterized by X-ray diffraction analysis. Combined with theoretical predictions, these data add significant insight to the field of transplutonium chemistry, and may lead to innovative Bk separation and purification processes.

  5. The CARIBU EBIS control and synchronization system

    Science.gov (United States)

    Dickerson, Clayton; Peters, Christopher

    2015-01-01

    The Californium Rare Isotope Breeder Upgrade (CARIBU) Electron Beam Ion Source (EBIS) charge breeder has been built and tested. The bases of the CARIBU EBIS electrical system are four voltage platforms on which both DC and pulsed high voltage outputs are controlled. The high voltage output pulses are created with either a combination of a function generator and a high voltage amplifier, or two high voltage DC power supplies and a high voltage solid state switch. Proper synchronization of the pulsed voltages, fundamental to optimizing the charge breeding performance, is achieved with triggering from a digital delay pulse generator. The control system is based on National Instruments realtime controllers and LabVIEW software implementing Functional Global Variables (FGV) to store and access instrument parameters. Fiber optic converters enable network communication and triggering across the platforms.

  6. Off-line commissioning of EBIS and plans for its integration into ATLAS and CARIBU

    Energy Technology Data Exchange (ETDEWEB)

    Ostroumov, P. N., E-mail: ostroumov@anl.gov; Barcikowski, A.; Dickerson, C. A.; Mustapha, B.; Perry, A.; Sharamentov, S. I.; Vondrasek, R. C.; Zinkann, G. [Argonne National Laboratory, Argonne, Illinois 60439 (United States)

    2016-02-15

    An Electron Beam Ion Source Charge Breeder (EBIS-CB) has been developed at Argonne to breed radioactive beams from the CAlifornium Rare Isotope Breeder Upgrade (CARIBU) facility at Argonne Tandem Linac Accelerator System (ATLAS). The EBIS-CB will replace the existing ECR charge breeder to increase the intensity and significantly improve the purity of reaccelerated radioactive ion beams. The CARIBU EBIS-CB has been successfully commissioned offline with an external singly charged cesium ion source. The performance of the EBIS fully meets the specifications to breed rare isotope beams delivered from CARIBU. The EBIS is being relocated and integrated into ATLAS and CARIBU. A long electrostatic beam transport system including two 180° bends in the vertical plane has been designed. The commissioning of the EBIS and the beam transport system in their permanent location will start at the end of this year.

  7. Populations of selected microbial and fungal species growing on the surface of rape seeds following treatment with desiccants or plant growth regulators.

    Science.gov (United States)

    Frac, Magdalena; Jezierska-Tys, Stefania; Tys, Jerzy

    2010-01-01

    The aim of this study was to determine the effects of desiccants and plant growth regulators on selected microbial species affecting rape seeds, with special emphasis on the growth of fungi and identification of the genus and species composition. The experimental material in the study was seeds of winter rape cv. Californium that were collected from the field during combine harvest. The chemical agents applied, both desiccants and growth regulators, generally decreased the populations of bacteria occurring on the surface of rape seeds. The responses of fungi depended upon the type of agent applied and were manifested as either stimulation or inhibition of the growth of the fungal species. The fungi isolated from the surface of rape seeds were characteristic of those found in the field environment (Cladosporium and Penicillium) and typical for those present on the surface of rape seeds (Alternaria).

  8. Reliability of semiconductor and gas-filled diodes for over-voltage protection exposed to ionizing radiation

    Directory of Open Access Journals (Sweden)

    Stanković Koviljka

    2009-01-01

    Full Text Available The wide-spread use of semiconductor and gas-filled diodes for non-linear over-voltage protection results in a variety of possible working conditions. It is therefore essential to have a thorough insight into their reliability in exploitation environments which imply exposure to ionizing radiation. The aim of this paper is to investigate the influence of irradiation on over-voltage diode characteristics by exposing the diodes to californium-252 combined neutron/gamma radiation field. The irradiation of semiconductor over-voltage diodes causes severe degradation of their protection characteristics. On the other hand, gas-filled over-voltage diodes exhibit a temporal improvement of performance. The results are presented with the accompanying theoretical interpretations of the observed changes in over-voltage diode behaviour, based on the interaction of radiation with materials constituting the diodes.

  9. Triton and alpha-particle contribution from LiF converter for neutron dosimeter

    CERN Document Server

    Camacho, M E; Balcazar, M

    1999-01-01

    A personnel neutron dosimeter prototype based on chemical and electrochemical etched CR-39 detector, combined with LiF converter, has been calibrated using an ICRP-like phantom, under a heavy-water moderated Californium source neutron spectra; A conversion factor of 1.052+-126 spots cm sup - sup 2 mSv sup - sup 1 was obtained. The sealing properties of the detector holder showed a ten-fold reduction in radon background when it was tested in a high radon atmosphere. A convenient mechanical shock resistance was achieved in LiF converters by sintering to 11 tons pressure LiF powder at 650 deg. C, during one hour.

  10. Absorbance humusových látek černozemí v ultrafialové a viditelné oblasti spektra

    OpenAIRE

    Brychtová, Martina

    2014-01-01

    Abstract In bachelor thesis we aimed at evaluation of humic substances quality using visible and ultraviolet spectroscopy. Object of our study were ten subtypes of Chernozems. UV-VIS spectra were recorded within the range 200 nm to 700 nm. Absorbance indexes were calculated at: 253/203, 253/230, 250/365, 253/410, 465/665 a 255/465 nm. Results showed differences in absorbance indexes values between chernozem subtypes. Lower absorbance was characteristic Arenic Chernozemkých and higher for Phae...

  11. Study of reproducibility of measurements with the spectrometer of Bonner multispheres

    Energy Technology Data Exchange (ETDEWEB)

    Azevedo, G.A.; Pereira, W.W.; Patrao, K.C.S.; Fonseca, E.S., E-mail: geisadeazevedo@gmail.com, E-mail: walsan@ird.gov.br, E-mail: karla@ird.gov.br, E-mail: evaldo@ird.gov.br [Instituto de Radionprotecao e Dosimetria (IRD/CNEN-RJ), Rio de Janeiro, RJ (Brazil)

    2013-07-01

    This work aims to study the metrological behavior of the Bonner Multisphere Spectrometer (BMS) of the LN / LNMRI / IRD - Laboratorio Metrologia de Neutrons / Laboratorio Nacional de Metrologia e Radiacao Ionizante / Instituto de Radioprotecao e Dosimetria, for measurements in repeatability and reproducibility conditions. Initially, a simulation was done by applying the Monte Carlo method, using the MCNP code and respecting the ISO 8529-1 (2001), using the sources of Californium ({sup 252} Cf), Americium-Beryllium ({sup 241} AmBe) and californium in heavy water (Cf + D{sub 2}O), all located at a distance of 100 cm from the neutron detector ({sup 6}Li (Eu) - crystal scintillator). In this program, the counting of neutrons that are captured by the detector was made. The source is located in the center of a sphere of radius 300 cm. Analyzes the impact of these neutrons in a point of the sphere wall, which in this case acted as a neutron detector and from there, it is estimated the number of neutrons that collide in the whole sphere. The purpose is to obtain the neutron count for different energy bands in a solid field of neutrons, since they have a spectrum ranging from a low to a high energy that can also vary within a particular environment. Wishes to obtain new fields with different sources and moderators materials to be used as new reference fields. Measurements are being conducted for these fields, with the aim of analyzing the variability conditions of the measurement (repeatability and reproducibility) in LEN - Laboratorio de Espectrometria de Neutrons of the LN/LMNRI/IRD. Thus, the spectrometer will be used to improve both the knowledge of the spectrum as the standard of neutrons of the lab, proving that a spectrometry is essential for correct measurement.

  12. NEAR MATHILDE RADIO SCIENCE DATA SET - MFB V1.0

    Data.gov (United States)

    National Aeronautics and Space Administration — The NEAR Mathilde Radio Science Data Set is a time-ordered collection of raw and partially processed data collected during the NEAR flyby of minor planet 253 Mathilde.

  13. Resistance of Two Planarian Species to UV-irradiation

    National Research Council Canada - National Science Library

    Kalafatic, Mirjana; Kovacevic, Goran; Franjevic, Damjan

    2006-01-01

    ...=253.5 nm to two planarian species Dugesia tigrina (Gir.) and Polycelis felina (Daly.). In vivo, UV light effects have been reported to affect intracellular receptors and disrupt simple behaviour...

  14. 75 FR 78617 - Final Flood Elevation Determinations

    Science.gov (United States)

    2010-12-16

    ... downstream of Martin Hot Spring County. Luther King Boulevard. Approximately 1,300 feet +263 downstream of Martin Luther King Boulevard. Town Creek Approximately 2,300 feet +253 Unincorporated Areas of downstream...

  15. Nützt Datenqualität wirklich im CRM?

    OpenAIRE

    Heinrich, Bernd

    2003-01-01

    Nützt Datenqualität wirklich im CRM? : Wirkungszusammenhänge und Implikationen / B. Heinrich, M. Helfert. - In: Wirtschaftsinformatik 2003 / Wolfgang Uhr ... (Hrsg.). - Heidelberg : Physica-Verl. - Bd. 2. (2003). - S.231-253

  16. STOOKE SMALL BODY SHAPE MODELS V2.0

    Data.gov (United States)

    National Aeronautics and Space Administration — This data set contains Philip Stooke shape models for 243 Ida, 253 Mathilde, 951 Gaspra, comet Halley, J5 Amalthea, J14 Thebe, N7 Larissa, N8 Proteus, S10 Janus, S11...

  17. Europejski kryzys migracyjny (Rozważania pozbawione emocji i poprawności politycznej)

    Czech Academy of Sciences Publication Activity Database

    Pánek, Jaroslav

    2016-01-01

    Roč. 6, č. 1 (2016), s. 253-264 ISSN 2084-1213 Institutional support: RVO:67985963 Keywords : Contemporary migration * International Relations * European Union Subject RIV: AB - History OBOR OECD: 6. Humanities and the Arts

  18. Active faulting on the Ninetyeast Ridge and its relation to deformation of the Indo-Australian plate

    Digital Repository Service at National Institute of Oceanography (India)

    Sager, W.W.; Bull, J.M.; Krishna, K.S.

    of volcanic ash cored at DSDP Site 253 [Shipboard Scientific Party, 1974]. Faults were recognized by vertical offsets or discontinuities of sedimentary layers, monoclinal folds, bowing or kinking of sedimentary layers, coherent diffractions cutting...

  19. Active sites engineering of metal-organic frameworks for heterogeneous catalysis

    Energy Technology Data Exchange (ETDEWEB)

    Li, Xinle [Iowa State Univ., Ames, IA (United States)

    2016-12-17

    In conclusion, we have for the first time developed a novel solid base catalyst, Ndoped MOF-253 derived porous carbons (Cz-MOF-253). Cz-MOF-253 is highly porous and exhibit high efficiency in Knoevenagel condensation reaction. Furthermore, Cz-MOF-253 is robust and can be reused up to five times. In comparison, the analogous nitrogen-free catalyst-Cz-DUT-5, and other nitrogen- MOFs derived carbon showed an inferior performance. Moreover, the high basicity and porous nature enable the design of bifunctional catalyst and facilitate tandem condensation-hydrogenation reactions. This work delineates the first attempt that demonstrates MOF-derived carbons as solid base catalyst and its potential application in tandem catalysis. Future work on exploring new catalytic reactions based on such porous Lewis basic MOF-derived carbons is currently underway.

  20. Dealing with food allergies in babies and children

    National Research Council Canada - National Science Library

    Joneja, Janice M. Vickerstaff

    2007-01-01

    ... . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 231 CHAPTER 14 CornAllergy ...243 CHAPTER 15 SeafoodAllergy ...253 CHAPTER 16 The Top Ten Allergens: Avoidance of Milk, Egg, Wheat, Corn, Peanuts, Soy, Tree Nuts...

  1. length-weight relationhip of freshwater wild fish species

    African Journals Online (AJOL)

    Dr Naeem

    2012-06-21

    , condition factor and weight-length relationships: history, meta-analysis and recommendations. J. Appl. Ichthyol., 22: 241-253. Froese R, Pauly D (1998). Fishbase 1998: concepts, design and data sources. ICLARM, Manila.

  2. ORF Alignment: NC_002947 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available s ... putida KT2440] ... Length = 122 ... Query: 132 IELNSSLLFGSGDAMPSDKAFAIIEKVASILKPFANPVHVEGFT...DNLPIRTAQYPTNWEL 191 ... IELNSSLLFGSGDAMPSDKAFAIIEKVASILKPFANPVHVEGFTDNLPI...RTAQYPTNWEL Sbjct: 1 ... IELNSSLLFGSGDAMPSDKAFAIIEKVASILKPFANPVHVEGFTDNLPIRTAQYPTNWEL 60 ... Query: 252 SL 253 ... SL Sbjct: 121 SL 122

  3. Gclust Server: 176023 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available Sequences - 253 NP_009036.1 solute carrier family 22 (organic cation transporter), member 1-like antisense ;...annotation NP_009036.1 solute carrier family 22 (organic cation transporter), member 1-like antisense ;

  4. Combat Neurosis in the Battered Teacher.

    Science.gov (United States)

    Science News, 1978

    1978-01-01

    Investigates the effect of school violence on classroom teachers. The study of 253 Los Angeles inner city classroom teachers reveals that many of them have developed conditions similar to the combat neurosis found in soldiers at war. (HM)

  5. Qualitative trait loci analysis for seed yield and component traits in ...

    African Journals Online (AJOL)

    VANITHA

    2014-02-05

    ,linkage map for cultivated sunflower. Theor. Appl. Genet. 96:15-22. Jinks JL, Pooni HS (1976). Predicting the properties of recombinant inbred lines derived by single seed descent method. Heredity 36:253-. 256. Johnson HW ...

  6. 75 FR 38467 - Procurement List: Proposed Additions

    Science.gov (United States)

    2010-07-02

    ...: 7520-00-NIB-2084--Shoulder Rest, Telephone, Black, Softak II. NSN: 7520-00-NIB-2085--Shoulder Rest... Services Administration. NSN: 7520-01-253-1283--Shoulder Rest, Telephone, Beige, 2\\1/4\\ W x 7'' L. NSN...

  7. G and P genotypes of rotavirus circulating among children with diarrhea in the Colombian northern coast

    National Research Council Canada - National Science Library

    Urbina, Delfina; Rodríguez, Juan G; Arzuza, Octavio; Parra, Edgar; Young, Gregorio; Castro, Raimundo; del-Portillo, Patricia

    2004-01-01

    A study on the prevalence of rotavirus G and P genotypes was carried out based on 253 stool specimens obtained from children living in the Colombia northern coast region who were less than 3-years-old...

  8. 78 FR 4469 - Biweekly Notice; Applications and Amendments to Facility Operating Licenses and Combined Licenses...

    Science.gov (United States)

    2013-01-22

    ..., Pilgrim Nuclear Power Station (Pilgrim), Plymouth County, Massachusetts Entergy Nuclear Vermont Yankee...--193; IP2--271; IP3--248; Palisades-- ] 249; Pilgrim--239; RBS--178; VY--253; and Waterford--240...

  9. South African Journal of Education - Vol 26, No 2 (2006)

    African Journals Online (AJOL)

    Factors associated with high school learners' poor performance: a spotlight on mathematics and physical science · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Andile Mji, Moses Makgato, 253-266 ...

  10. 21 CFR 160.145 - Dried egg whites.

    Science.gov (United States)

    2010-04-01

    ... this section shall be determined by the analytical method prescribed in “Official Methods of Analysis of the Association of Official Analytical Chemists,” 14th Ed. (1984), section 43.253-43.257, “Protein...

  11. Zur sportlichen Laufbahn von Marathonläufern

    OpenAIRE

    Rümmele, Edgar

    1984-01-01

    Zur sportlichen Laufbahn von Marathonläufern : e. Beitr. zur Psychologie d. Marathonläufers. - Thun u.a. : Deutsch, 1984. - 253, 14 S. - Zugl.: Tübingen, Univ., Diss. - (Beiträge zur Sportwissenschaft ; 1)

  12. Gender Differences in Conceptualizations of STEM Career Interest: Complementary Perspectives from Data Mining, Multivariate Data Analysis and Multidimensional Scaling

    National Research Council Canada - National Science Library

    Gerald Knezek; Rhonda Christensen; Tandra Tyler-Wood; David Gibson

    2015-01-01

    ...), creative tendencies (beta = .253) and dispositions toward mathematics (beta = .200). Additional analyses indicate that engineering appears to be more closely aligned with STEM career aspirations for females than for males...

  13. 77 FR 22842 - Petition for Waiver of Compliance

    Science.gov (United States)

    2012-04-17

    ... modification of the signal system on the signaled siding between Holland and Waverly, Milepost (MP) CG 25.3 to... removal of the crossover and the signals, D243 and 6L, at MP 24.5 on the signaled siding; and the... the siding from MP 24.32 to MP 25.3. The reason given for the proposed change is to improve switching...

  14. Enhanced Image-Aided Navigation Algorithm with Automatic Calibration and Affine Distortion Prediction

    Science.gov (United States)

    2012-03-01

    2.5.1 Distortion Models . . . . . . . . . . . . . . . . . 29 2.5.2 Calibration Algorithms . . . . . . . . . . . . . . 30 2.5.3 Binocular Stereopsis ...calibrate multi-camera systems with non-overlapping fields of view. Further development is presented in the next chapter. 2.5.3 Binocular Stereopsis ...Kalman Filter presented in Section 2.7. Additional information on epipolar geometry and binocular stereopsis can be found in Szeliski’s textbook [19

  15. Thermostable crude endoglucanase produced by Aspergillus ...

    African Journals Online (AJOL)

    Enthalpies of activation of denaturation ( * D H ) were 254.04, 253.96 and 253.88 K J mole-1, at 60, 70 and 80°C respectively, whereas entropies of activation of denaturation ( * D S ) and free energy changes of activation of denaturation ( * D G ) were 406.45, 401.01, 406.07 J mole-1 K-1 and 118.69, 116.41, 110.53 kJ ...

  16. Homeland Security as a Stock Market: Antifragility as a Strategy for Homeland Security

    Science.gov (United States)

    2013-12-01

    Swan events.8 The events of 9/11, Hurricane Katrina, Super Storm Sandy, the Boston bombings , the near misses of Northwest Flight 253, and the bombing ...discusses how overconfidence bias stems from biased self-attribution, first identified by Daryl Bern . When our actions are confirmed by good events...events of 9/11, Hurricane Katrina, Super Storm Sandy, the Boston bombings , the near misses of Northwest Flight 253, and the bombing attempt on

  17. Activation of non-canonical Wnt/JNK pathway by Wnt3a is associated with differentiation fate determination of human bone marrow stromal (mesenchymal) stem cells

    DEFF Research Database (Denmark)

    Qiu, Weimin; Chen, Li; Kassem, Moustapha

    2011-01-01

    patterns induced by Wnt3a treatment in two hMSC lines: hMSC-LRP5(T253) and hMSC-LRP5(T244) cells carrying known mutations of Wnt co-receptor LRP5 (T253I or T244M) that either enhances or represses canonical Wnt signaling, respectively. Wnt3a treatment of hMSC activated not only canonical Wnt signaling...

  18. DDN (Defence Data Network) Protocol Implementations and Vendors Guide

    Science.gov (United States)

    1988-08-01

    Artificial Intelligence Laboratory Room NE43-723 545 Technology Square Cambridge, MA 02139 (617) 253-8843 S John Wroclawski, (JTW@AI.AJ.MIT.EDU...Massachusetts Institute of Technology Artificial Intelligence Laboratory Room NE43-743 545 Technology Square 0 Cambridge, MA 02139 (617) 253-7885 ORDERING...TCP/IP Network Software for PC-DOS Systems CPU: IBM-PC/XT/AT/compatible in conjunction with EXOS 205 Inteligent Ethernet Controller for PCbus 0/s

  19. 1α,25(OH)2D3 differentially regulates miRNA expression in human bladder cancer cells.

    Science.gov (United States)

    Ma, Yingyu; Hu, Qiang; Luo, Wei; Pratt, Rachel N; Glenn, Sean T; Liu, Song; Trump, Donald L; Johnson, Candace S

    2015-04-01

    Bladder cancer is the fourth most commonly diagnosed cancer in men and eighth leading cause of cancer-related death in the US. Epidemiological and experimental studies strongly suggest a role for 1α,25(OH)2D3 in cancer prevention and treatment. The antitumor activities of 1α,25(OH)2D3 are mediated by the induction of cell cycle arrest, apoptosis, differentiation and the inhibition of angiogenesis and metastasis. miRNAs play important regulatory roles in cancer development and progression. However, the role of 1α,25(OH)2D3 in the regulation of miRNA expression and the potential impact in bladder cancer has not been investigated. Therefore, we studied 1α,25(OH)2D3-regulated miRNA expression profiles in human bladder cancer cell line 253J and the highly tumorigenic and metastatic derivative line 253J-BV by miRNA qPCR panels. 253J and 253J-BV cells express endogenous vitamin D receptor (VDR), which can be further induced by 1α,25(OH)2D3. VDR target gene 24-hydroxylase was induced by 1α,25(OH)2D3 in both cell lines, indicating functional 1α,25(OH)2D3 signaling. The miRNA qPCR panel assay results showed that 253J and 253J-BV cells have distinct miRNA expression profiles. Further, 1α,25(OH)2D3 differentially regulated miRNA expression profiles in 253J and 253J-BV cells in a dynamic manner. Pathway analysis of the miRNA target genes revealed distinct patterns of contribution to the molecular functions and biological processes in the two cell lines. In conclusion, 1α,25(OH)2D3 differentially regulates the expression of miRNAs, which may contribute to distinct biological functions, in human bladder 253J and 253J-BV cells. This article is part of a Special Issue entitled '17th Vitamin D Workshop'. Copyright © 2014 Elsevier Ltd. All rights reserved.

  20. Dicty_cDB: SSF320 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSF320 (Link to dictyBase) - - - Contig-U12259-1 SSF320Z (Link... to Original site) - - SSF320Z 644 - - - - Show SSF320 Library SS (Link to library) Clone ID SSF320 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSF3-A/SSF320Q.Seq.d/ Representative seq. ID SSF32...0Z (Link to Original site) Representative DNA sequence >SSF320 (SSF320Q) /CSM/SS/SSF3-A/SSF320Q.Seq.d/ XXXXX...Sequences producing significant alignments: (bits) Value SSI253 (SSI253Q) /CSM/SS/SSI2-C/SSI253Q.Seq.d/ 1047 0.0 SSF320 (SSF3

  1. Gclust Server: 90545 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available 90545 Fal_FRAAL3518 Cluster Sequences Related Sequences(253) 256 3-hydroxyacyl-CoA dehydrogenase... type II (Short-chain type dehydrogenase/reductase) 1 1.00e-45 0.0 0.0 0.0 0.0 3.23 0.0 Show 90545 Cluster ID 90545 Se...quence ID Fal_FRAAL3518 Link to cluster sequences Cluster Sequences Link to related sequences Related Se...quences(253) Sequence length 256 Representative annotation 3-h...ydroxyacyl-CoA dehydrogenase type II (Short-chain type dehydrogenase/reductase) Number of Sequences 1 Homolo

  2. Drug: D05407 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D05407 Drug Penciclovir (USAN/INN); Denavir (TN) C10H15N5O3 253.1175 253.2578 D0540...TICS FOR TOPICAL USE D06BB Antivirals D06BB06 Penciclovir D05407 Penciclovir (USAN/INN) J ANTIINFECTIVES FOR...s excl. reverse transcriptase inhibitors J05AB13 Penciclovir D05407 Penciclovir (...USAN/INN) USP drug classification [BR:br08302] Antivirals Antiherpetic Agents Penciclovir D05407 Penciclovir... (USAN/INN) Antiinfectives [BR:br08307] Antivirals Anti-HSV agent DNA polymerase inhibitor Purine analogue Penciclo

  3. Dicty_cDB: Contig-U02147-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available s: 6905 Number of extensions: 0 Number of successful extensions: 0 Number of sequences better than 10.0: 0 length of query...: 253 length of database: 5,674,871 effective HSP length: 15 effective length of query: 238 ef...: 0 Number of sequences better than 10.0: 0 Length of query: 253 Length of database: 101,790,757,118 Length ...adjustment: 23 Effective length of query: 230 Effective length of database: 99,44...umber of HSP's successfully gapped: 4 Length of query: 84 Length of database: 1,0

  4. Physico-chemical evaluation of wastewater in Katsina metropolis ...

    African Journals Online (AJOL)

    The water is well oxygenated and alkaline in all locations (7.7,7.9 and 7.67), temperature were relatively high (26̊C,25.7̊C and 25.8̊C), DO mean values were 4.6, 3.9 and 4.8 while BOD were 2.6, 2.53 and 2.53. Turbidity values were 11.5, 15.8 and 11.2. Therefore, measure should be put in place to regulate improper ...

  5. Compensated bismuth-loaded plastic scintillators for neutron detection using low-energy pseudo-spectroscopy

    Energy Technology Data Exchange (ETDEWEB)

    Dumazert, Jonathan, E-mail: jonathan.dumazert@cea.fr [CEA, LIST, Laboratoire Capteurs Architectures Electroniques, 91191 Gif-sur-Yvette (France); Coulon, Romain; Bertrand, Guillaume H.V.; Normand, Stéphane [CEA, LIST, Laboratoire Capteurs Architectures Electroniques, 91191 Gif-sur-Yvette (France); Méchin, Laurence [CNRS, UCBN, Groupe de Recherche en Informatique, Image, Automatique et Instrumentation de Caen, 14050 Caen (France); Hamel, Matthieu [CEA, LIST, Laboratoire Capteurs Architectures Electroniques, 91191 Gif-sur-Yvette (France)

    2016-05-21

    Gadolinium-covered modified plastic scintillators show a high potential for the deployment of cost-effective neutron detectors. Taking advantage of the low-energy photon and electron signature of thermal neutron captures in gadolinium-155 and gadolinium-157 however requires a background correction. In order to display a trustable rate, dual compensation schemes appear as an alternative to Pulse Shape Discrimination. This paper presents the application of such a compensation scheme to a two-bismuth loaded plastic scintillator system. A detection scintillator interacts with incident photon and fast neutron radiations and is covered with a gadolinium converter to become thermal neutron-sensitive as well. In the meantime, an identical compensation scintillator, covered with terbium, solely interacts with the photon and fast neutron part of incident radiations. After the acquisition and the treatment of the counting signals from both sensors, a hypothesis test determines whether the resulting count rate after subtraction falls into statistical fluctuations or provides a robust image of neutron activity. A laboratory prototype is tested under both photon and neutron radiations, allowing us to investigate the performance of the overall compensation system. The study reveals satisfactory results in terms of robustness to a cesium-137 background and in terms of sensitivity in presence of a californium-252 source.

  6. Systematic studies of the fundamental chemistry of pyrochlore oxides. An{sub 2}Zr{sub 2}O{sub 7} [An=Pu, Am, Cm, Bk and Cf

    Energy Technology Data Exchange (ETDEWEB)

    Haire, R.G.; Assefa, Z. [Oak Ridge National Laboratory, Oak Ridge, TN (United States); Raison, P.E. [Commissariat a l' Energie Atomique, CEA-Cadarache DRN/DEC/SPUA/LACA (France)

    2002-11-01

    Our efforts to pursue the fundamental science of actinide pyrochlore oxides, An{sub 2}Zr{sub 2}O{sub 7}, (An=plutonium through californium), are presented. We have addressed their structural and chemical behavior via X-ray diffraction, Raman spectroscopy and by considering the pseudo-oxidation potentials of the actinides. The structure, fundamental chemistry, ionic radii and the electronic configuration of the specific actinide involved in these oxide systems all have a significant impact on their science. We are also exploring a calculational approach based on valence-bond relationships to assess the position of the oxygen atoms located at the general crystallographic position. The oxygen position is important regarding the chemical behavior and thermal stability of these materials. Also considered is the structural stability of the materials regarding self-irradiation, and with some compounds, their resistance towards oxidation. These aspects will be discussed using a systematic evaluation of the five-actinide systems together with comparable lanthanide systems studied. (author)

  7. 1982 US-CEC neutron personnel dosimetry intercomparison study

    Energy Technology Data Exchange (ETDEWEB)

    Swaja, R.E.; Sims, C.S.; Greene, R.T.; Schraube, H.; Burger, G.

    1983-11-01

    A neutron personnel dosimetry intercomparison study was conducted during April 19-23, 1982, as a joint effort between the United States and the Commission of European Communities. Dosimeters from 48 participating agencies were mounted on cylindrical phantoms and exposed to a range of low-level dose equivalents (0.48-13.91 mSv neutron and 0.02-1.32 mSv gamma) in nine different radiation fields. Exposure conditions considered in this study included four mixed-field spectra produced using the Health Physics Research Reactor, four monoenergetic neutron fields generated by accelerators, and one 15-cm D/sub 2/O-moderated californium source spectrum. In general, neutron results reported by the participating agencies were consistent with expected dosimeter performance based on energy response characteristics of the detection systems. Albedo dosimeters, which were the most popular neutron monitoring systems used in this study, provided the best overall accuracy for all exposure conditions. Film, Cr-39 recoil track, and Th-232 fission track systems generally underestimated dose equivalents relative to reference values. Associated gamma measurements showed that TLD monitors produced more accurate results than film dosimeters although both systems overestimated gamma dose equivalents in mixed radiation fields. 24 references, 10 figures, 19 tables.

  8. Application of the backward extrapolation method to pulsed neutron sources

    Energy Technology Data Exchange (ETDEWEB)

    Talamo, Alberto; Gohar, Yousry

    2018-01-01

    Particle detectors operated in pulse mode are subjected to the dead-time effect. When the average of the detector counts is constant over time, correcting for the dead-time effect is simple and can be accomplished by analytical formulas. However, when the average of the detector counts changes over time it is more difficult to take into account the dead-time effect. When a subcritical nuclear assembly is driven by a pulsed neutron source, simple analytical formulas cannot be applied to the measured detector counts to correct for the dead-time effect because of the sharp change of the detector counts over time. This work addresses this issue by using the backward extrapolation method. The latter can be applied not only to a continuous (e.g. californium) external neutron source but also to a pulsed external neutron source (e.g. by a particle accelerator) driving a subcritical nuclear assembly. The backward extrapolation method allows to obtain from the measured detector counts both the dead-time value and the real detector counts.

  9. The cross sections of fusion-evaporation reactions: the most promising route to superheavy elements beyond Z=118

    Science.gov (United States)

    Jadambaa, Khuyagbaatar

    2017-11-01

    The synthesis of superheavy elements beyond oganesson (Og), which has atomic number Z = 118, is currently one of the main topics in nuclear physics. An absence of sufficient amounts of target material with atomic numbers heavier than californium (Z = 98) forces the use of projectiles heavier than 48Ca (Z = 20), which has been successfully used for the discoveries of elements with Z = 114 - 118 in complete fusion reactions. Experimental cross sections of 48Ca with actinide targets behave very differently to "cold" and "hot" fusion-evaporation reactions, where doubly-magic lead and deformed actinides are used as targets, respectively. The known cross sections of these reactions have been analysed compared to calculated fission barriers. It has been suggested that observed discrepancies between the cross sections of 48Ca-induced and other fusionevaporation reactions originate from the shell structure of the compound nucleus, which lies in the island of the stability. Besides scarcely known data on other reactions involving heavier projectiles, the most promising projectile for the synthesis of the elements beyond Og seems to be 50Ti. However, detailed studies of 50Ti, 54Cr, 58Fe and 64Ni-induced reactions are necessary to be performed in order to fully understand the complexities of superheavy element formation.

  10. Report to the DOE nuclear data committee. [EV RANGE 10-100; CROSS SECTIONS; PHOTONEUTRONS; NEUTRONS; GAMMA RADIATION; COUPLED CHANNEL THEORY; DIFFERENTIAL CROSS SECTIONS; MEV RANGE 01-10; ; CAPTURE; GAMMA SPECTRA; THERMAL NEUTRONS; COMPUTER CALCULATIONS; DECAY; FISSION PRODUCTS; FISSION YIELD; SHELL MODELS; NUCLEAR DATA COLLECTIONS

    Energy Technology Data Exchange (ETDEWEB)

    Struble, G.L.; Haight, R.C.

    1981-03-01

    Topics covered include: studies of (n, charged particle) reactions with 14 to 15 MeV neutrons; photoneutron cross sections for /sup 15/N; neutron radiative capture; Lane-model analysis of (p,p) and (n,n) scattering on the even tin isotopes; neutron scattering cross sections for /sup 181/Ta, /sup 197/Au, /sup 209/Bi, /sup 232/Th, and /sup 238/U inferred from proton scattering and charge exchange cross sections; neutron-induced fission cross sections of /sup 245/Cm and /sup 242/Am; fission neutron multiplicities for /sup 245/Cm and /sup 242/Am; the transport of 14 MeV neutrons through heavy materials 150 < A < 208; /sup 249/Cm energy levels from measurement of thermal neutron capture gamma rays; /sup 231/Th energy levels from neutron capture gamma ray and conversion electron spectroscopy; new measurements of conversion electron binding energies in berkelium and californium; nuclear level densities; relative importance of statistical vs. valence neutron capture in the mass-90 region; determination of properties of short-lived fission products; fission yield of /sup 87/Br and /sup 137/I from 15 nuclei ranging from /sup 232/Th to /sup 249/Cf; evaluation of charged particle data for the ECPL library; evaluation of secondary charged-particle energy and angular distributions for ENDL; and evaluated nuclear structure libraries derived from the table of isotopes. (GHT)

  11. Activation analysis of ITER blanket first wall

    Energy Technology Data Exchange (ETDEWEB)

    Lopatkin, A.; Muratov, V. [RDIPE (NIKIET), Moscow (Russian Federation)

    1998-09-01

    To analyze the activation of ITER blanket structural components, the authors have prepared the AUCDAS code that calculates changes in nuclide concentrations and radioactivity characteristics during neutron irradiation and during cooling. UCDAS takes into account all neutron reactions and decay types, the prepared library of constants contains nuclear data of nuclides from hydrogen to californium. A comparative analysis of the results as obtained using UCDAS code and the widely known FISPACT code is given. The analysis of decay heat, gas generation and activity of ITER blanket first wall`s structural components was carried out. The beryllium coating, copper alloy and stainless steel were analysed. Calculations were performed for the first plasma burning pulse, 6 months and 1 year of operation in accordance with the ITER scenario. The materials recommended by ITER central team and their Russian analogs were considered: TGR and B1 (beryllium coating), GlidCop AL-25 Ds and Br-MKX (copper alloy), 316LN-IG and 12Cr18Ni10Ti (stainless steel). It has been demonstrated that there is a difference in all of the considered characteristics between the above materials. It is caused by impurities which are present in the materials. The report also considers the accumulation of gases (H, D, T, He{sup 3}, He{sup 4}) in the above materials. Besides, the change in the activity of irradiated materials during the cooling of up to 10{sup 7} years was calculated. (orig.) 7 refs.

  12. Toward achieving flexible and high sensitivity hexagonal boron nitride neutron detectors

    Science.gov (United States)

    Maity, A.; Grenadier, S. J.; Li, J.; Lin, J. Y.; Jiang, H. X.

    2017-07-01

    Hexagonal boron nitride (h-BN) detectors have demonstrated the highest thermal neutron detection efficiency to date among solid-state neutron detectors at about 51%. We report here the realization of h-BN neutron detectors possessing one order of magnitude enhancement in the detection area but maintaining an equal level of detection efficiency of previous achievement. These 3 mm × 3 mm detectors were fabricated from 50 μm thick freestanding and flexible 10B enriched h-BN (h-10BN) films, grown by metal organic chemical vapor deposition followed by mechanical separation from sapphire substrates. Mobility-lifetime results suggested that holes are the majority carriers in unintentionally doped h-BN. The detectors were tested under thermal neutron irradiation from californium-252 (252Cf) moderated by a high density polyethylene moderator. A thermal neutron detection efficiency of ˜53% was achieved at a bias voltage of 200 V. Conforming to traditional solid-state detectors, the realization of h-BN epilayers with enhanced electrical transport properties is the key to enable scaling up the device sizes. More specifically, the present results revealed that achieving an electrical resistivity of greater than 1014 Ωṡcm and a leakage current density of below 3 × 10-10 A/cm2 is needed to fabricate large area h-BN detectors and provided guidance for achieving high sensitivity solid state neutron detectors based on h-BN.

  13. Design of the low energy beam transport line between CARIBU and the EBIS charge breeder

    Energy Technology Data Exchange (ETDEWEB)

    Perry, A., E-mail: aperry4@hawk.iit.edu [Argonne National Laboratory, Argonne, IL 60439, USA and Illinois Institute of Technology, Chicago, IL 60616 (United States); Ostroumov, P. N.; Barcikowski, A.; Dickerson, C.; Kondrashev, S. A.; Mustapha, B.; Savard, G. [Argonne National Laboratory, Argonne, IL 60439 (United States)

    2015-01-09

    An Electron Beam Ion Source Charge Breeder (EBIS-CB) has been developed to breed radioactive beams from the CAlifornium Rare Isotope Breeder Upgrade (CARIBU) facility at ATLAS. The EBIS-CB will replace the existing ECR charge breeder to increase the intensity and improve the purity of reaccelerated radioactive ion beams. The EBIS-CB is in the final stage of off-line commissioning. Currently, we are developing a low energy beam transport (LEBT) system to transfer CARIBU beams to the EBIS-CB. As was originally planned, an RFQ cooler-buncher will precede the EBIS-CB. Recently, it was decided to include a multi-reflection time-of-flight (MR-TOF) mass-spectrometer following the RFQ. MR-TOF is a relatively new technology used to purify beams with a mass-resolving power up to 3×10{sup 5} as was demonstrated in experiments at CERN/ISOLDE. Very high purity singly-charged radioactive ion beams will be injected into the EBIS for charge breeding and due to its inherent properties, the EBIS-CB will maintain the purity of the charge bred beams. Possible contamination of residual gas ions will be greatly suppressed by achieving ultra-high vacuum in the EBIS trap. This paper will present and discuss the design of the LEBT and the overall integration of the EBIS-CB into ATLAS.

  14. Analysis of patents on mining technology

    Energy Technology Data Exchange (ETDEWEB)

    Menyailo, N.I.; Grishchenko, A.N.; Ratner, M.V.; Kobylyanskii, A.Ya.; Tyshlek, E.G.

    1987-09-01

    Analyses the current work being carried out with the aim of developing and perfecting coal mining technology with regard to improving safety and working conditions (equipment is currently responsible for 6.3% of all hazards in coal mines) by examining patents of class ES 21 S produced in the USSR, USA, UK, FRG, Japan and France between 1970-1984. By far the majority of patents is concerned with improving technology and productivity and a disappointing number deals with safety matters (only 7.2% of the patents for new cutter loader designs deal with dust suppression systems and most of these come from the FRG; no patents for powered mining complexes deal with the problem of noise and vibration reduction). The patents with the most direct relevance to health and safety concern remote control devices for mining equipment, in particular, devices based on radioactive isotopes (e.g. cesium-137, americum-241, selenium-75, californium-252) but measures for monitoring them and protecting against them are not found.

  15. MinT: Middleware for Cooperative Interaction of Things

    Directory of Open Access Journals (Sweden)

    Soobin Jeon

    2017-06-01

    Full Text Available This paper proposes an Internet of Things (IoT middleware called Middleware for Cooperative Interaction of Things (MinT. MinT supports a fully distributed IoT environment in which IoT devices directly connect to peripheral devices easily construct a local or global network, and share their data in an energy efficient manner. MinT provides a sensor abstract layer, a system layer and an interaction layer. These enable integrated sensing device operations, efficient resource management, and active interconnection between peripheral IoT devices. In addition, MinT provides a high-level API to develop IoT devices easily for IoT device developers. We aim to enhance the energy efficiency and performance of IoT devices through the performance improvements offered by MinT resource management and request processing. The experimental results show that the average request rate increased by 25% compared to Californium, which is a middleware for efficient interaction in IoT environments with powerful performance, an average response time decrease of 90% when resource management was used, and power consumption decreased by up to 68%. Finally, the proposed platform can reduce the latency and power consumption of IoT devices.

  16. MinT: Middleware for Cooperative Interaction of Things

    Science.gov (United States)

    Jeon, Soobin; Jung, Inbum

    2017-01-01

    This paper proposes an Internet of Things (IoT) middleware called Middleware for Cooperative Interaction of Things (MinT). MinT supports a fully distributed IoT environment in which IoT devices directly connect to peripheral devices easily construct a local or global network, and share their data in an energy efficient manner. MinT provides a sensor abstract layer, a system layer and an interaction layer. These enable integrated sensing device operations, efficient resource management, and active interconnection between peripheral IoT devices. In addition, MinT provides a high-level API to develop IoT devices easily for IoT device developers. We aim to enhance the energy efficiency and performance of IoT devices through the performance improvements offered by MinT resource management and request processing. The experimental results show that the average request rate increased by 25% compared to Californium, which is a middleware for efficient interaction in IoT environments with powerful performance, an average response time decrease of 90% when resource management was used, and power consumption decreased by up to 68%. Finally, the proposed platform can reduce the latency and power consumption of IoT devices. PMID:28632182

  17. An Account of Oak Ridge National Laboratory's Thirteen Research Reactors

    Energy Technology Data Exchange (ETDEWEB)

    Rosenthal, Murray Wilford [ORNL

    2009-08-01

    The Oak Ridge National Laboratory has built and operated 13 nuclear reactors in its 66-year history. The first was the graphite reactor, the world's first operational nuclear reactor, which served as a plutonium production pilot plant during World War II. It was followed by two aqueous-homogeneous reactors and two red-hot molten-salt reactors that were parts of power-reactor development programs and by eight others designed for research and radioisotope production. One of the eight was an all-metal fast burst reactor used for health physics studies. All of the others were light-water cooled and moderated, including the famous swimming-pool reactor that was copied dozens of times around the world. Two of the reactors were hoisted 200 feet into the air to study the shielding needs of proposed nuclear-powered aircraft. The final reactor, and the only one still operating today, is the High Flux Isotope Reactor (HFIR) that was built particularly for the production of californium and other heavy elements. With the world's highest flux and recent upgrades that include the addition of a cold neutron source, the 44-year-old HFIR continues to be a valuable tool for research and isotope production, attracting some 500 scientific visitors and guests to Oak Ridge each year. This report describes all of the reactors and their histories.

  18. Neutron Detector Signal Processing to Calculate the Effective Neutron Multiplication Factor of Subcritical Assemblies

    Energy Technology Data Exchange (ETDEWEB)

    Talamo, Alberto [Argonne National Lab. (ANL), Argonne, IL (United States). Nuclear Engineering Division; Gohar, Yousry [Argonne National Lab. (ANL), Argonne, IL (United States). Nuclear Engineering Division

    2016-06-01

    This report describes different methodologies to calculate the effective neutron multiplication factor of subcritical assemblies by processing the neutron detector signals using MATLAB scripts. The subcritical assembly can be driven either by a spontaneous fission neutron source (e.g. californium) or by a neutron source generated from the interactions of accelerated particles with target materials. In the latter case, when the particle accelerator operates in a pulsed mode, the signals are typically stored into two files. One file contains the time when neutron reactions occur and the other contains the times when the neutron pulses start. In both files, the time is given by an integer representing the number of time bins since the start of the counting. These signal files are used to construct the neutron count distribution from a single neutron pulse. The built-in functions of MATLAB are used to calculate the effective neutron multiplication factor through the application of the prompt decay fitting or the area method to the neutron count distribution. If the subcritical assembly is driven by a spontaneous fission neutron source, then the effective multiplication factor can be evaluated either using the prompt neutron decay constant obtained from Rossi or Feynman distributions or the Modified Source Multiplication (MSM) method.

  19. Fast neutron tomography with real-time pulse-shape discrimination in organic scintillation detectors

    Energy Technology Data Exchange (ETDEWEB)

    Joyce, Malcolm J., E-mail: m.joyce@lancaster.ac.uk [Department of Engineering, Lancaster University, Lancaster, Lancashire LA1 4YW (United Kingdom); Agar, Stewart [Department of Engineering, Lancaster University, Lancaster, Lancashire LA1 4YW (United Kingdom); Aspinall, Michael D. [Hybrid Instruments Ltd., Gordon Manley Building, Lancaster Environment Centre, Lancaster University, Lancaster LA1 4YW (United Kingdom); Beaumont, Jonathan S.; Colley, Edmund; Colling, Miriam; Dykes, Joseph; Kardasopoulos, Phoevos; Mitton, Katie [Department of Engineering, Lancaster University, Lancaster, Lancashire LA1 4YW (United Kingdom)

    2016-10-21

    A fast neutron tomography system based on the use of real-time pulse-shape discrimination in 7 organic liquid scintillation detectors is described. The system has been tested with a californium-252 source of dose rate 163 μSv/h at 1 m and neutron emission rate of 1.5×10{sup 7} per second into 4π and a maximum acquisition time of 2 h, to characterize two 100×100×100 mm{sup 3} concrete samples. The first of these was a solid sample and the second has a vertical, cylindrical void. The experimental data, supported by simulations with both Monte Carlo methods and MATLAB®, indicate that the presence of the internal cylindrical void, corners and inhomogeneities in the samples can be discerned. The potential for fast neutron assay of this type with the capability to probe hydrogenous features in large low-Z samples is discussed. Neutron tomography of bulk porous samples is achieved that combines effective penetration not possible with thermal neutrons in the absence of beam hardening.

  20. Report on the workshop "Decay spectroscopy at CARIBU: advanced fuel cycle applications, nuclear structure and astrophysics". 14-16 April 2011, Argonne National Laboratory, USA.

    Energy Technology Data Exchange (ETDEWEB)

    Kondev, F.; Carpenter, M.P.; Chowdhury, P.; Clark, J.A.; Lister, C.J.; Nichols, A.L.; Swewryniak, D. (Nuclear Engineering Division); (Univ. of Massachusetts); (Univ. of Surrey)

    2011-10-06

    A workshop on 'Decay Spectroscopy at CARIBU: Advanced Fuel Cycle Applications, Nuclear Structure and Astrophysics' will be held at Argonne National Laboratory on April 14-16, 2011. The aim of the workshop is to discuss opportunities for decay studies at the Californium Rare Isotope Breeder Upgrade (CARIBU) of the ATLAS facility with emphasis on advanced fuel cycle (AFC) applications, nuclear structure and astrophysics research. The workshop will consist of review and contributed talks. Presentations by members of the local groups, outlining the status of relevant in-house projects and availabile equipment, will also be organized. time will also be set aside to discuss and develop working collaborations for future decay studies at CARIBU. Topics of interest include: (1) Decay data of relevance to AFC applications with emphasis on reactor decay heat; (2) Discrete high-resolution gamma-ray spectroscopy following radioactive decya and related topics; (3) Calorimetric studies of neutron-rich fission framgents using Total ABsorption Gamma-Ray Spectrometry (TAGS) technique; (4) Beta-delayed neutron emissions and related topics; and (5) Decay data needs for nuclear astrophysics.

  1. The cross sections of fusion-evaporation reactions: the most promising route to superheavy elements beyond Z=118

    Directory of Open Access Journals (Sweden)

    Jadambaa Khuyagbaatar

    2017-01-01

    Full Text Available The synthesis of superheavy elements beyond oganesson (Og, which has atomic number Z = 118, is currently one of the main topics in nuclear physics. An absence of sufficient amounts of target material with atomic numbers heavier than californium (Z = 98 forces the use of projectiles heavier than 48Ca (Z = 20, which has been successfully used for the discoveries of elements with Z = 114 - 118 in complete fusion reactions. Experimental cross sections of 48Ca with actinide targets behave very differently to “cold” and “hot” fusion-evaporation reactions, where doubly-magic lead and deformed actinides are used as targets, respectively. The known cross sections of these reactions have been analysed compared to calculated fission barriers. It has been suggested that observed discrepancies between the cross sections of 48Ca-induced and other fusionevaporation reactions originate from the shell structure of the compound nucleus, which lies in the island of the stability. Besides scarcely known data on other reactions involving heavier projectiles, the most promising projectile for the synthesis of the elements beyond Og seems to be 50Ti. However, detailed studies of 50Ti, 54Cr, 58Fe and 64Ni-induced reactions are necessary to be performed in order to fully understand the complexities of superheavy element formation.

  2. Intracavitary moderator balloon combined with (252)Cf brachytherapy and boron neutron capture therapy, improving dosimetry in brain tumour and infiltrations.

    Science.gov (United States)

    Brandão, S F; Campos, T P R

    2015-07-01

    This article proposes a combination of californium-252 ((252)Cf) brachytherapy, boron neutron capture therapy (BNCT) and an intracavitary moderator balloon catheter applied to brain tumour and infiltrations. Dosimetric evaluations were performed on three protocol set-ups: (252)Cf brachytherapy combined with BNCT (Cf-BNCT); Cf-BNCT with a balloon catheter filled with light water (LWB) and the same set-up with heavy water (HWB). Cf-BNCT-HWB has presented dosimetric advantages to Cf-BNCT-LWB and Cf-BNCT in infiltrations at 2.0-5.0 cm from the balloon surface. However, Cf-BNCT-LWB has shown superior dosimetry up to 2.0 cm from the balloon surface. Cf-BNCT-HWB and Cf-BNCT-LWB protocols provide a selective dose distribution for brain tumour and infiltrations, mainly further from the (252)Cf source, sparing the normal brain tissue. Malignant brain tumours grow rapidly and often spread to adjacent brain tissues, leading to death. Improvements in brain radiation protocols have been continuously achieved; however, brain tumour recurrence is observed in most cases. Cf-BNCT-LWB and Cf-BNCT-HWB represent new modalities for selectively combating brain tumour infiltrations and metastasis.

  3. Intracavitary moderator balloon combined with 252Cf brachytherapy and boron neutron capture therapy, improving dosimetry in brain tumour and infiltrations

    Science.gov (United States)

    Brandão, S F

    2015-01-01

    Objective: This article proposes a combination of californium-252 (252Cf) brachytherapy, boron neutron capture therapy (BNCT) and an intracavitary moderator balloon catheter applied to brain tumour and infiltrations. Methods: Dosimetric evaluations were performed on three protocol set-ups: 252Cf brachytherapy combined with BNCT (Cf-BNCT); Cf-BNCT with a balloon catheter filled with light water (LWB) and the same set-up with heavy water (HWB). Results: Cf-BNCT-HWB has presented dosimetric advantages to Cf-BNCT-LWB and Cf-BNCT in infiltrations at 2.0–5.0 cm from the balloon surface. However, Cf-BNCT-LWB has shown superior dosimetry up to 2.0 cm from the balloon surface. Conclusion: Cf-BNCT-HWB and Cf-BNCT-LWB protocols provide a selective dose distribution for brain tumour and infiltrations, mainly further from the 252Cf source, sparing the normal brain tissue. Advances in knowledge: Malignant brain tumours grow rapidly and often spread to adjacent brain tissues, leading to death. Improvements in brain radiation protocols have been continuously achieved; however, brain tumour recurrence is observed in most cases. Cf-BNCT-LWB and Cf-BNCT-HWB represent new modalities for selectively combating brain tumour infiltrations and metastasis. PMID:25927876

  4. Investigation of Workplace-like Calibration Fields via a Deuterium-Tritium (D-T) Neutron Generator.

    Science.gov (United States)

    Mozhayev, Andrey V; Piper, Roman K; Rathbone, Bruce A; McDonald, Joseph C

    2017-04-01

    Radiation survey meters and personal dosimeters are typically calibrated in reference neutron fields based on conventional radionuclide sources, such as americium-beryllium (Am-Be) or californium-252 (Cf), either unmodified or heavy-water moderated. However, these calibration neutron fields differ significantly from the workplace fields in which most of these survey meters and dosimeters are being used. Although some detectors are designed to yield an approximately dose-equivalent response over a particular neutron energy range, the response of other detectors is highly dependent upon neutron energy. This, in turn, can result in significant over- or underestimation of the intensity of neutron radiation and/or personal dose equivalent determined in the work environment. The use of simulated workplace neutron calibration fields that more closely match those present at the workplace could improve the accuracy of worker, and workplace, neutron dose assessment. This work provides an overview of the neutron fields found around nuclear power reactors and interim spent fuel storage installations based on available data. The feasibility of producing workplace-like calibration fields in an existing calibration facility has been investigated via Monte Carlo simulations. Several moderating assembly configurations, paired with a neutron generator using the deuterium tritium (D-T) fusion reaction, were explored.

  5. Production of medical radioisotopes in the ORNL High Flux Isotope Reactor (HFIR) for cancer treatment and arterial restenosis therapy after PTCA

    Energy Technology Data Exchange (ETDEWEB)

    Knapp, F.F. Jr.; Beets, A.L.; Mirzadeh, S.; Alexander, C.W.; Hobbs, R.L.

    1998-06-01

    The High Flux Isotope Reactor (HFIR) at the Oak Ridge National Laboratory (ORNL) represents an important resource for the production of a wide variety of medical radioisotopes. In addition to serving as a key production site for californium-252 and other transuranic elements, important examples of therapeutic radioisotopes which are currently routinely produced in the HFIR for distribution include dysprosium-166 (parent of holmium-166), rhenium-186, tin-117m and tungsten-188 (parent of rhenium-188). The nine hydraulic tube (HT) positions in the central high flux region permit the insertion and removal of targets at any time during the operating cycle and have traditionally represented a major site for production of medical radioisotopes. To increase the irradiation capabilities of the HFIR, special target holders have recently been designed and fabricated which will be installed in the six Peripheral Target Positions (PTP), which are also located in the high flux region. These positions are only accessible during reactor refueling and will be used for long-term irradiations, such as required for the production of tin-117m and tungsten-188. Each of the PTP tubes will be capable of housing a maximum of eight HT targets, thus increasing the total maximum number of HT targets from the current nine, to a total of 57. In this paper the therapeutic use of reactor-produced radioisotopes for bone pain palliation and vascular brachytherapy and the therapeutic medical radioisotope production capabilities of the ORNL HFIR are briefly discussed.

  6. lEinstein's Last Dream: The Space-Time Unifi-cation of Fundamental ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 10; Issue 12. Einstein's Last Dream: The Space - Time Unification of Fundamental Forces. Abdus Salam. Volume 10 Issue 12 December 2005 pp 246-253. Fulltext. Click here to view fulltext PDF. Permanent link:

  7. Micro and nanohardness testing of laser welds

    Czech Academy of Sciences Publication Activity Database

    Šebestová, H.; Čtvrtlík, Radim; Chmelíčková, H.; Tomáštík, J.

    2014-01-01

    Roč. 15, č. 3 (2014), s. 247-253 ISSN 1454-9069 R&D Projects: GA TA ČR TA01010517 Institutional support: RVO:68378271 Keywords : Vickers microhardness * depth sensing indentation * laser welding Subject RIV: JP - Industrial Processing Impact factor: 1.658, year: 2014

  8. Is Medical Student Writing Wrong?

    Science.gov (United States)

    Frisof, Kenneth B.; Moseley, James L.

    The prevalence of writing errors made by third-year medical students from the class of 1981 at a large midwestern medical school was studied. The papers of 253 students taking family medicine were evaluated for spelling, grammar, and punctuation errors. Four types of grammar errors and seven punctuation errors were analyzed, and each word…

  9. Pollutant removal in subsurface wastewater infiltration systems with ...

    African Journals Online (AJOL)

    1College of Life Science, Shenyang Normal University, 253, Huanghe Street, Shenyang 110034, China. ABSTRACT. Organic pollutant and .... A/N cycle, the system was firstly subjected to aeration for 1 h with an airflow rate of 2 L/min, and ... Composite samples were used in each analysis. All analyses were conducted in ...

  10. 40 CFR Appendix A to Subpart IIIi... - Determination of Capture Efficiency of Automobile and Light-Duty Truck Spray Booth Emissions From...

    Science.gov (United States)

    2010-07-01

    ... conduct panel tests on the production paint line in your facility or in a laboratory simulation of the... bell zone immediately followed by a controlled robotic zone.) Separate panel tests are required for non... contiguous controlled spray booth zones being tested (laboratory test). 2.5.3Remove and weigh the wet panel...

  11. Sequence Classification: 777644 [

    Lifescience Database Archive (English)

    Full Text Available Non-TMB Non-TMH Non-TMB Non-TMB Non-TMB Non-TMB >gi|17510145|ref|NP_490670.1| similar to transposable elemen...ts found in bilateria (25.3 kD) (1A558) || http://www.ncbi.nlm.nih.gov/protein/17510145 ...

  12. ORF Alignment: NC_003919 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_003919 gi|21244071 >1swvA 4 253 5 214 5e-24 ... gb|AAM38189.1| indigoidine synthes...is-like protein [Xanthomonas axonopodis pv. ... citri str. 306] ref|NP_643653.1| indigoidine ...

  13. Sadhana | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Sadhana; Volume 35; Issue 3. Issue front cover thumbnail. Volume 35, Issue 3. June 2010, pages 241-392. pp 241-253. An approximate method for lateral stability analysis of wall-frame buildings including shear deformations of walls · Kanat Burak Bozdogan Duygu Ozturk · More Details Abstract Fulltext ...

  14. Tidally Induced Variations of PMC Altitudes and Ice Water Content Using a Data Assimilation System

    Science.gov (United States)

    2010-04-01

    69° N ( Andenes , Norway) and 85 235 km geometric altitude in Figure 5. In addition, we performed five short term integrations of the 236 forecast...intercomparison between two approaches to calculating winds and the Andenes data. 251 252 2.2 Ice Particle Trajectories and CARMA 253 254 As noted

  15. Nature Watch

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 20; Issue 3. Nature Watch: Symbiosis in Coastal Marine Communities. Neelam Pereira. Feature Article Volume 20 Issue 3 March 2015 pp 245-253. Fulltext. Click here to view fulltext PDF. Permanent link:

  16. Measuring Students' Perceptions of Personal and Social Responsibility and the Relationship to Intrinsic Motivation in Urban Physical Education

    Science.gov (United States)

    Li, Weidong; Wright, Paul M.; Rukavina, Paul Bernard; Pickering, Molly

    2008-01-01

    The purpose of the current study was to test the validity and reliability of a two-factor model of the Personal and Social Responsibility Questionnaire (PSRQ) and examine the relationships between perceptions of personal and social responsibility and intrinsic motivation in physical education. Participants were 253 middle school students who…

  17. Znovuuvedení kritické analýzy diskurzu do českého prostředí

    Czech Academy of Sciences Publication Activity Database

    Homoláč, Jiří; Mrázková, Kamila

    2017-01-01

    Roč. 78, č. 3 (2017), s. 237-253 ISSN 0037-7031 Institutional support: RVO:68378092 Keywords : critical discourse analysis * discourse-historical approach * discursive strategies * topos Subject RIV: AI - Linguistics OBOR OECD: Linguistics Impact factor: 0.625, year: 2016

  18. Evaluation of Criteria Associated with Abdominal Fitness Testing.

    Science.gov (United States)

    Robertson, Loarn D.; Magnusdottir, Hjordis

    1987-01-01

    The use of the timed sit up as a measure of abdominal fitness has been challenged. This article describes experiments designed to evaluate a modified curl up test as an alternative. Subjects were 20 college students averaging 25.3 years of age. Results are discussed. (Author/MT)

  19. Design and Implementation of Practical Constraint Logic Programming Systems

    Science.gov (United States)

    1992-08-24

    Jonathan Ostroff and Jeff Klein, is described in [135]. It reasons about discrete event processes, and the query used to obtain these results is the...274, 1988. [91 Arvind and D.E. Culler . Dataflow architectures. In Annual Reviews in Computer Science, volume 1, pages 225-253. Annual Reviews Inc

  20. Primary school students’ strategies in early algebra problem solving supported by an online game

    NARCIS (Netherlands)

    van den Heuvel-Panhuizen, M.H.A.M|info:eu-repo/dai/nl/069266255; Kolovou, A.|info:eu-repo/dai/nl/313715947; Robitzsch, A.

    2013-01-01

    In this study we investigated the role of a dynamic online game on students’ early algebra problem solving. In total 253 students from grades 4, 5, and 6 (10–12 years old) used the game at home to solve a sequence of early algebra problems consisting of contextual problems addressing covarying

  1. Mobile Geospatial Information Systems for Land Force Operations: Analysis of Operational Needs and Research Opportunities

    Science.gov (United States)

    2010-03-01

    WPC (Italian "Soldato Futuro ") 4. EADS Warrior 21 5. Elbitsystems (Israel) Military Tactical Computer 6. L-3 Communications LDT II 7. Northrop...Humansystems® Mobile GIS Page 2-53 DRS Technologies, SELEX LRT-440 WPC (Italian "Soldato Futuro ") Housekeeping Functions (internal device functionality

  2. AcEST: DK952224 [AcEST

    Lifescience Database Archive (English)

    Full Text Available p|Q9UTC8|OS9_SCHPO Protein OS-9 homolog OS=Schizosaccharomyces ... 32 2.2 sp|Q8CGM2|RP1L1_MOUSE Retinitis pi...EVSSCAYSMTIHVPGLCSLPAF 253 Query: 392 QGTEEVESD 418 + E++ S+ Sbjct: 254 KIQEDIPSE 262 >sp|Q8CGM2|RP1L1_MOUSE Retinitis

  3. Florae Malesianae Precursores III. Dialium L. (Caesalpiniaceae)

    NARCIS (Netherlands)

    Wit, de H.C.D.

    1953-01-01

    Dialium hydnocarpoides, sp. nov. — Foliola (15)17—19, elliptice oblonga, 4.5—6.5(8.5) cm longa, 2—2.5(3) cm lata, apice abrupte breviter acuminata. Sepala extus pubescentia, intus puberula. Stamina 2, raro 3. Ovarium in receptaculo plano, lato, strigoso excentrice insertum. Stylus glaber. Legumen

  4. Pictorial interlude: Caught up in a 'whirl' | Kuehnast | South African ...

    African Journals Online (AJOL)

    A patient with the 'whirl sign' on computed tomography is 25.3 times as likely as a patient without the sign to have small-bowel obstruction (SBO) necessitating surgery. The 'whirl sign' therefore has an important role in the assessment of patients with clinical and radiological signs of SBO.

  5. A new vehicle for herbicide application using crude glycerin, a by ...

    African Journals Online (AJOL)

    H3PO4 for use as a vehicle for the application the herbicide Togar. The work was conducted in the laboratory of ... physicochemical characteristics for use as vehicle for herbicide application. The conductivity and viscosity of the .... Chloride (%). 6.86. 2.53 5.18. Electrical conductivity (µS/cm) 1626.0 505.5 378.3. Ashes (%).

  6. 76 FR 63602 - Voting Rights Act Amendments of 2006, Determinations Under Section 203

    Science.gov (United States)

    2011-10-13

    ... telephone at (800) 253-3931 or visit the Voting Section Internet site at http://www.justice.gov/crt/about... 110921596-1557-01] Voting Rights Act Amendments of 2006, Determinations Under Section 203 AGENCY: Bureau of... 203 of the Voting Rights Act of 1965, as amended, this notice publishes the Bureau of the Census...

  7. Secondary queens in the parthenogenetic termite Cavitermes tuberosus develop through a transitional helper stage

    Czech Academy of Sciences Publication Activity Database

    Hellemans, S.; Fournier, D.; Hanus, Robert; Roisin, Y.

    2017-01-01

    Roč. 19, č. 6 (2017), s. 253-262 ISSN 1520-541X Institutional support: RVO:61388963 Keywords : facultative parthenogenesis * replacement queens * termites * asexual queen succession * ontogeny * Cavitermes Subject RIV: EG - Zoology Impact factor: 2.243, year: 2016

  8. The effect of high load training on psychomotor speed

    NARCIS (Netherlands)

    Nederhof, E.; Lemmink, K.; Zwerver, J.; Mulder, T.

    The purpose of the present study was to investigate whether overreached athletes show psychomotor slowness after a period of high load training. Fourteen well-trained cyclists (10 male, 4 female, mean age 25.3 [SD = 4.1] years, mean maximal oxygen consumption 65.5 [SD=8.1] ml/ kg-min) performed a

  9. Impact of Robotic Dispensing Machines in German Pharmacies on ...

    African Journals Online (AJOL)

    To assess the impact of robotic dispensing machines in community pharmacies on staff efficiency and sales of over-the-counter drugs. Setting: The study was done on 253 community pharmacies in Germany that use a robotic dispensing machine manufactured by ROWA during 2008. Method: Data concerning the financial ...

  10. Chikungunya Arthritis Mechanisms in the Americas (CAMA): A cross sectional analysis of chikungunya arthritis patients 22 months post infection demonstrates a lack of viral persistence in synovial fluid

    Science.gov (United States)

    2017-06-30

    Chronic obstructive pulmonary disease Diabetes Hypertension Depression 1 (4.0%) 0 0 0 0 1 (4.0%) 7 (28.0%) 1 (4.0%) 0 1...Zoonotic Diseases. 2015;15(4): 241-249. 469 (19) Asgari S. Epigenetic modifications underlying symbiont-host interactions. Adv Genet . 2014;86: 253-276

  11. Electrocatalysis of hemoglobin in ionic liquid BMIMPF 6 and CuS ...

    African Journals Online (AJOL)

    The results indicated that the BMIMPF6-CuS nanocomposite could be used for the preparation of electrochemical biosensor. KEY WORDS: Hemoglobin, Direct electrochemistry, Copper sulfide nanosphere, 1-Butyl-3-methylimidazolium hexafluorophosphate, Hydrogen peroxide. Bull. Chem. Soc. Ethiop. 2011, 25(3) ...

  12. Approaching the Affective Factors of Information Seeking: The Viewpoint of the Information Search Process Model

    Science.gov (United States)

    Savolainen, Reijo

    2015-01-01

    Introduction: The article contributes to the conceptual studies of affective factors in information seeking by examining Kuhlthau's information search process model. Method: This random-digit dial telephone survey of 253 people (75% female) living in a rural, medically under-serviced area of Ontario, Canada, follows-up a previous interview study…

  13. Oversight on Current Status and Administration of Federal Student Assistance Programs. Hearings before the Subcommittee on Postsecondary Education of the Committee on Education and Labor, House of Representatives. Ninety-Seventh Congress, Second Session (January 27, 28 and February 2, 3, and 4, 1982).

    Science.gov (United States)

    Congress of the U.S., Washington, DC. House Committee on Education and Labor.

    The management and operations of federal student assistance programs are addressed in hearings before the Committee on Education and Labor. In fiscal year 1981, the Office of Inspector General (OIG), Department of Education (ED) issued 4,811 audit reports on postsecondary education programs. Costs disallowed or questioned amounted to $25.3

  14. Browse Title Index

    African Journals Online (AJOL)

    Items 101 - 150 of 253 ... OE Umezinwa. Vol 13, No 1 (2012), Music as Edae: The Implications for Music Therapy in Nigeria, Abstract PDF. CO Aluede. Vol 18, No 2 (2017): Special Edition, Music Education: A Vehicle for Fostering Positive Youth Development, Abstract PDF. Ebele V. Ojukwu. Vol 17, No 3 (2017), Musicians and ...

  15. A- and C-weighted sound levels as predictors of the annoyance caused by shooting sounds, for various facade attenuation types

    NARCIS (Netherlands)

    Vos, J.

    2003-01-01

    In a previous study on the annoyance caused by a great variety of shooting sounds [J. Acoust. Soc. Am. 109, 244-253 (2001)], it was shown that the annoyance, as rated indoors with the windows closed, could be adequately predicted from the outdoor A-weighted and C-weighted sound-exposure levels [ASEL

  16. Indication of Importance of Including Soil Microbial Characteristics into Biotope Valuation Method.

    Czech Academy of Sciences Publication Activity Database

    Trögl, J.; Pavlorková, Jana; Packová, P.; Seják, J.; Kuráň, P.; Kuráň, J.; Popelka, J.; Pacina, J.

    2016-01-01

    Roč. 8, č. 3 (2016), č. článku 253. ISSN 2071-1050 Institutional support: RVO:67985858 Keywords : biotope assessment * biotope valuation method * soil microbial communities Subject RIV: DJ - Water Pollution ; Quality Impact factor: 1.789, year: 2016

  17. Danger in the reef

    DEFF Research Database (Denmark)

    Laustsen, Andreas Hougaard; Gutiérrez, José Maria; Redsted Rasmussen, Arne

    2015-01-01

    (71.2%), three-finger toxins (3FTx; 25.3%), cysteine-rich secretory proteins (CRISP; 2.5%), and traces of a complement control module protein (CCM; 0.2%). Using a Toxicity Score, the most lethal components were determined to be short neurotoxins. Whole venom had an intravenous LD50 of 0.07 mg...

  18. 28 CFR 42.203 - Discrimination prohibited.

    Science.gov (United States)

    2010-07-01

    ... summary punishment, or deny any individual the rights guaranteed by the Constitution to all persons; (9..., section 815(c)(1) of the JSIA shall be interpreted by the Office consistently with title VII of the Civil Rights Act of 1964, Public Law 88-352, 79 Stat. 253, as amended by the Equal Employment Opportunity Act...

  19. Zoopharmacognosy-Self-Medication in Wild Animals

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 13; Issue 3. Zoopharmacognosy - Self-Medication in Wild Animals. Rajasekar Raman Sripathi Kandula. General Article Volume 13 Issue 3 March 2008 pp 245-253. Fulltext. Click here to view fulltext PDF. Permanent link:

  20. Factores conductuales en el deterioro de la circulación interior de la vivienda de interés social tipo cuádruplex /

    OpenAIRE

    Quintero Híjar, Marco Antonio

    2011-01-01

     tesis que para obtener el grado de Doctor en Arquitectura, presenta Marco Antonio Quintero Híjar ; asesor Miguel Hierro Gómez. 253 páginas : ilustraciones. Doctorado en Arquitectura UNAM, Facultad de Arquitectura, 2011

  1. 76 FR 10385 - Agency Information Collection Activities: Various Contract Related Forms That Will be Included in...

    Science.gov (United States)

    2011-02-24

    ... SECURITY Agency Information Collection Activities: Various Contract Related Forms That Will be Included in... Legislation Office, DHS will submit the following information collection request (ICR) to the Office of... to correct the cost from $236,253.00 to zero. DATES: Comments are encouraged and will be accepted...

  2. Dissolved petroleum hydrocarbons along the oil tanker route in the southern Bay of Bengal

    Digital Repository Service at National Institute of Oceanography (India)

    Topgi, R.S.; Noronha, R.J.; Fondekar, S.P.; SenGupta, R.

    Concentrations of dissolved petroleum hydrocarbons during 3 cruises (Nos. 51, 66 and 68) of R V Gaveshani, along the oil tanker route, in the southern Bay of Bengal at 0, 10 and 20 m were 19.95 + or - 3.38, 16.78 + or - 2.53 and 13.45 + or - 2.17 mu...

  3. Study of ecological consequence of the bloom (Noctiluca miliaris) in off shore waters of the Northern Arabian Sea

    Digital Repository Service at National Institute of Oceanography (India)

    Dwivedi, R.M.; Chauhan, R.; Solanki, H.U.; Raman, M.; Matondkar, S.G.P.; Madhu, V.R.; Meenakumari, B.

    , NO. 4, AUGUST 2012 306 Schools of flying fishes and large size squids were observed during night at one bloom station in March 2007 (FORV-253). Also, on one occasion baby sharks were found swimming inside the bloom patch. These observations...

  4. ISSN 2073-9990 East Cent. Afr. J. surg. (Online) 11

    African Journals Online (AJOL)

    Hp 630 Dual Core

    PUD) has remained a relatively common condition worldwide, with annual incidence ranging from 0.10% to 0.19%2. However in Canada, PUD comprises 7.5% of the GI disorders, followed by celiac disease (2.5%)3. In Togo, the prevalence.

  5. Sustainability analysis of human settelements in South Africa

    CSIR Research Space (South Africa)

    Du Plessis, C

    2002-07-01

    Full Text Available indicators...............................................................................13 2.5.3 Sustainable urban structure and form .................................................................14 2.5.4 Sus tainable c ities... and degradation....................................................................................53 5.3.3 Protec tion of the envir onment .............................................................................54 5.4 Urban form and structure...

  6. Environmental Compliance Assessment System (ECAS).

    Science.gov (United States)

    1993-03-01

    ienphos, Hinosan 2 252. 0-Ethyl S,S-dipropyl phosphorodithioate: Ethoprophos , Mocap, Prophos 253. Ethylene chiorohydrin: 2-chioroethanol 254. Ethyl 4...Phenylmercury acetate: PMA, PMAC 54. 0-Ethyl S.S-dipropyl phosphorodithioate: Ethoprophos . Mocap, Prophos 55. S-2-Ethylthioethyl 0.0-dimethyl

  7. The Relationship between Organizational Support, Work-Family Conflict, and the Job-Life Satisfaction of University Coaches

    Science.gov (United States)

    Dixon, Marlene A.; Sagas, Michael

    2007-01-01

    This study examined the relationship between organizational support, work-family conflict, and job and life satisfaction among coaches. Data from collegiate head coaches with families (N = 253) were gathered through a mailed questionnaire. Results from a series of covariance structure models indicated that a partially mediated model was the best…

  8. Pediatric Palliative Care: A Personal Story

    Medline Plus

    Full Text Available ... Little Stars 11,912 views 10:35 Teen Cancer Stories | UCLA Daltrey/Townshend Teen & Young Adult Cancer Program - Duration: 11:08. UCLA Health 253,855 ... views 56:31 The Ugly Truth of Pediatric Cancer - Duration: 5:21. KidsCancerChannel 61,687 views 5: ...

  9. Predictors of Emotional Eating during Adolescents' Transition to College: Does Body Mass Index Moderate the Association between Stress and Emotional Eating?

    Science.gov (United States)

    Wilson, Shana M.; Darling, Katherine E.; Fahrenkamp, Amy J.; D'Auria, Alexandra L.; Sato, Amy F.

    2015-01-01

    Objective: This study sought to (1) examine perceived stress and resources to cope with stress as predictors of emotional eating during the transition to college and (2) determine whether body mass index (BMI) moderated the emotional eating-stress relationship. Participants: Participants were 97 college freshmen (73% female; BMI: M = 25.3

  10. Malaria Prevalence and Local Beliefs in Transmission and Control ...

    African Journals Online (AJOL)

    , too much exposure to sunlight 25.3%, eating of oily foods 16.7%, cold weather 14.2% and witchcraft 1.2%. There was a statistical difference among the local beliefs on transmission. Local beliefs associated with malaria prevention in the ...

  11. Dicty_cDB: Contig-U02496-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 170049 ) Pongo abelii clone CH253-36B9, WORKING DRAFT SEQU... 46 2.7 1 ( AC169000 ) Colobus guereza... clone CH272-65C17, WORKING DRAFT ... 46 2.7 1 ( AC168999 ) Colobus guereza clone CH272-12

  12. Vampirical Stick Pins, Deleuzian Folds, Noir Pastiches and other Wearability Conundrums: Fashion in Film

    DEFF Research Database (Denmark)

    Langkjær, Michael Alexander

    2012-01-01

    Anmeldelsesartikel (review article) overfjorten bidrag i antologien Fashion in Film, som belyser forskellige sider af forholdet mellem mode og film.Fashion in Film er redigeret af Adrienne Munich (Bloomington: Indiana University Press, 2011, 360 sider, ISBN 978-0-253-22299-2)....

  13. Terrorism: A Selected Bibliography

    Science.gov (United States)

    2009-12-01

    Islam. 72min. Princeton: Films Media Group, 2007. DVD. (BP161.3 .E93 2007) 9 LONG WAR Books, Documents, and Internet Resources Aaron, David, ed...253pp. (PN4784 .T45N11 2007) Steuter, Erin, and Deborah Wills. At War with Metaphor: Media, Propaganda, and Racism in the War on Terror. Lanham

  14. Ambitions and opportunities for assessing military performance in crisis response operations

    NARCIS (Netherlands)

    Beeres, R.J.M.; Waard, de E.J.; Bollen, M.

    2010-01-01

    This paper addresses the issue of measuring armed forces’ performance in crisis response operations. By means of interviews (17 respondents) and a large scale survey (1,253 respondents) field and general officers of the Netherlands Armed Forces (NAF) have been questioned on perceived organisational

  15. Bulletin of Materials Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science. J Rakshit. Articles written in Bulletin of Materials Science. Volume 23 Issue 4 August 2000 pp 249-253 Nitride Ceramics. Optimization of time–temperature schedule for nitridation of silicon compact on the basis of silicon and nitrogen reaction kinetics · J Rakshit P K Das.

  16. AcEST: DK951302 [AcEST

    Lifescience Database Archive (English)

    Full Text Available OS=Zea m... 75 3e-12 tr|A5ATK9|A5ATK9_VITVI Putative uncharacterized protein OS=Vitis... 75 3e-12 tr|B6TMJ7|B6TMJ...jct: 193 SESPNKIPEETGYGKYESSKTGLFVKINMDGVPIGRKVDLKACDSYEKLSYAVDDLFRGL 252 Query: 661 VS 666 +S Sbjct: 253 LS 254 >tr|B6TMJ7|B6TMJ

  17. Animalien hilkortasuna Ugaz, Ollin eta Asurako ubideetan (Ezkurra/Eratsun, Nafarroa

    Directory of Open Access Journals (Sweden)

    ELOSEGI, M.M.

    2010-01-01

    Full Text Available Se ha contabilizado la mortalidad de vertebrados en dos canales de sendas centrales hidroléctricas de la cuenca del Urumea en Navarra. Durante dos años, en los 2,7 km de Ugaz se han contabilizado 253 vertebrados ahogados y 765 en los 8,35 km de Zumarresta.

  18. 42 CFR 447.255 - Related information.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 4 2010-10-01 2010-10-01 false Related information. 447.255 Section 447.255 Public... Facility Services Payment Rates § 447.255 Related information. The Medicaid agency must submit, with the assurances described in § 447.253(a), the following information: (a) The amount of the estimated average...

  19. SYNTHESIS, STEREOCHEMISTRY AND ANTIMICROBIAL ...

    African Journals Online (AJOL)

    Preferred Customer

    Synthesis, stereochemistry and antimicrobial activity of copper(II) and nickel(II) complexes. Bull. Chem. Soc. Ethiop. 2011, 25(3). 363 recorded in DMF using a Perkin-Elmer 575 spectrophotometer (USA). Nuclear magnetic ... ESR spectra of the complexes were obtained on a Varian E4-EPR spectrometer at about 9.4 GHz ...

  20. Bulletin of Materials Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science. N K PANDEY. Articles written in Bulletin of Materials Science. Volume 40 Issue 2 April 2017 pp 253-262. Electrical and optical properties of ZnO–WO 3 nanocomposite and its application as a solid-state humidity sensor · VANDNA SHAKYA N K PANDEY SUNEET KUMAR ...

  1. Ficus palaeoracemosa sp. nov.–A new fossil leaf from the Kasauli ...

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Earth System Science; Volume 120; Issue 2. Ficus palaeoracemosa sp. nov. – A new fossil leaf from the Kasauli Formation of Himachal Pradesh and its palaeoclimatic significance. Gaurav Srivastava Rashmi Srivastava R C Mehrotra. Volume 120 Issue 2 April 2011 pp 253-262 ...

  2. Bulletin of the Chemical Society of Ethiopia - Vol 30, No 2 (2016)

    African Journals Online (AJOL)

    Two ligand oxidio-vanadium(IV) complexes as novel efficient catalysts in multicomponent reactions for synthesis of tetrahydrobenzopyran derivatives · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. M. Abaszadeh, M. Seifi, S. Y. Ebrahimipour, 253-262.

  3. Journal of Special Operations Medicine, Volume 7, Edition 3

    Science.gov (United States)

    2007-01-01

    pounds, as well as bioactive substances that increase proinflammatory and immunosuppressive responses. TRIM, or transfusion related immunomodulation , is a...Effect of blood transfusions on subsequent kidney transplants. Transplant Proc; 5:253–259. 80. Blajchman MA. (2002). Immunomodulation and blood trans...display win- dows, and highway billboards sport advertisements of anti- helminthics complete with attractive illustrations of the parasites. This

  4. 48 CFR Appendix I to Chapter 15 - Environmental Protection Agency; Class Justification for Other Than Full and Open Competition in...

    Science.gov (United States)

    2010-10-01

    ... Prison Industries and the Government Printing Office I Appendix I to Chapter 15 Federal Acquisition Regulations System ENVIRONMENTAL PROTECTION AGENCY Ch. 15, App. I Appendix I to Chapter 15—Environmental... open competition under the authority in 41 U.S.C. 253(c)(5) as sources required by statute, i.e., 18 U...

  5. ABA and Diverse Cultural and Linguistic Environments: A Welsh Perspective

    Science.gov (United States)

    Jones, E. W.; Hoerger, M.; Hughes, J. C.; Williams, B. M.; Jones, B.; Moseley, Y.; Hughes, D. R.; Prys, D.

    2011-01-01

    Gwynedd Local Education Authority (LEA) in North West Wales, UK, is funding a small-scale autism-specific specialist education service using ABA methodology. The program is available through the medium of Welsh, English or bilingually, depending on the individual needs of the child (Jones and Hoerger in Eur J Behav Anal 10:249-253,…

  6. VizieR Online Data Catalog: Observed sample of z~0.7 massive galaxies (Gallazzi+, 2014)

    Science.gov (United States)

    Gallazzi, A.; Bell, E. F.; Zibetti, S.; Brinchmann, J.; Kelson, D. D.

    2017-07-01

    The sample has been selected from the COMBO-17 catalog of the Extended Chandra Deep Field South (E-CDFS) survey (Wolf et al. 2004A&A...421..913W, Cat. II/253; see also Section 2.4.1) to have photometric redshift (or spectroscopic when available) in the range 0.65=designed. (1 data file).

  7. 77 FR 42727 - Environmental Impacts Statements; Notice of Availability

    Science.gov (United States)

    2012-07-20

    ...-motorized Areas, Beaverhead and Jefferson Counties, MT, Comment Period Ends: 09/04/2012, Contact: Patty.../27/2012, Contact: Thomas Bonetti 413-253-8307. Revision to FR Notice Published 06/08/2012; Extending... the Conservation Pool, Funding, Jefferson/Douglas Counties, CO, Comment Period Ends: 09/06/2012...

  8. EST Table: FY038841 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available /04 40 %/253 aa gi|91078946|ref|XP_974065.1| PREDICTED: similar to Outer dense fiber protein 2 (Out...er dense fiber of sperm tails protein 2) (84 kDa outer dense fiber protein) (Cenexin) [Tribolium castaneum] FS892927 bmte ...

  9. Author Index

    Indian Academy of Sciences (India)

    Callebaut, D. K. Prediction of Peaks in Wolf Numbers in Cycle 24 according to. Actual Numbers of Polar Faculae, 69. C¸ elik G ültekin Investigation of the Effects of Expectation Values for Radii on the. Determination of Transition Probabilities using WBEPM Theory, 367. Chaudhary Diksha see Verma, S. R., 253. Chen, P. F. ...

  10. 76 FR 30978 - Employment and Training Administration Program Year (PY) 2011 Workforce Investment Act (WIA...

    Science.gov (United States)

    2011-05-27

    ...,253,180 for State service area grants; $5,688,600 for migrant and seasonal farmworker housing... Mexico 946,732 New York 1,656,708 North Carolina 2,690,959 North Dakota 607,492 Ohio 1,259,904 Oklahoma 1...

  11. Data of evolutionary structure change: 2UXML-2UX3M [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 2UXML-2UX3M 2UXM 2UX3 L M -----ALLSFE--------------RKYRVPGG--TLVG.../alignment> 0 2UXM L 2UX...U CA 253 VAL CA 231 GLY CA 185 GLY CA 184 2UX...3 M 2UX3M 1 2UXM L 2UXML

  12. Clonal Expansion of New Penicillin-Resistant Clade of Neisseria meningitidis Serogroup W Clonal Complex 11, Australia.

    Science.gov (United States)

    Mowlaboccus, Shakeel; Jolley, Keith A; Bray, James E; Pang, Stanley; Lee, Yung Thin; Bew, Jane D; Speers, David J; Keil, Anthony D; Coombs, Geoffrey W; Kahler, Charlene M

    2017-08-01

    In Western Australia, Neisseria meningitidis serogroup W clonal complex 11 became the predominant cause of invasive meningococcal disease in 2016. We used core-genome analysis to show emergence of a penicillin-resistant clade that had the penA_253 allele. This new penicillin-resistant clade might affect treatment regimens for this disease.

  13. Mineralogical data on angelaite, Cu2AgPbBiS4, from the Los Manantiales District, Chubut, Argentina

    DEFF Research Database (Denmark)

    Topa, D.; Paar, W.H.; Putz, H.

    2010-01-01

    . It has a metallic luster and a dark grey streak. The VHN10 ranges between 245 and 263 kg/mm3 (mean 253), corresponding to a Mohs hardness of 3½. In plane-polarized light, it is strongly bireflectant and pleochroic from light grey with a brownish tint to light cream with a greenish tint. Angelaite...

  14. Primary School Students' Strategies in Early Algebra Problem Solving Supported by an Online Game

    Science.gov (United States)

    van den Heuvel-Panhuizen, Marja; Kolovou, Angeliki; Robitzsch, Alexander

    2013-01-01

    In this study we investigated the role of a dynamic online game on students' early algebra problem solving. In total 253 students from grades 4, 5, and 6 (10-12 years old) used the game at home to solve a sequence of early algebra problems consisting of contextual problems addressing covarying quantities. Special software monitored the…

  15. 32 CFR 154.18 - Certain positions not necessarily requiring access to classified information.

    Science.gov (United States)

    2010-07-01

    ... under the Internal Security Act of 1950 to issue orders and regulations for the protection of property... employees. Each Nonappropriated Fund employee who is employed in a position of trust as designated by an... for assignment with the Armed Forces overseas (32 CFR part 253). (f) Officials authorized to issue...

  16. Projectile Motion on an Inclined Misty Surface: II. Scoring a Goal

    Science.gov (United States)

    Foong, S. K.; Lim, C. C.; Kuppan, L.

    2009-01-01

    Feedback on part I of this series (Ho "et al" 2009 "Phys. Educ." 44 253) motivated us to make hitting the target more interesting with a simple innovation: changing the target to a ring shaped hoop or goalpost and shooting for it in the "air", as if playing basketball on the inclined plane. We discuss in detail the…

  17. Understanding Women\\'s Economic And Social Human Rights ...

    African Journals Online (AJOL)

    This article considers the evolution of women\\'s rights in international human rights law. It then moves on to consider the gender dimension of economic, social and cultural rights before examining constraints to their enjoyment and enforcement. East African Journal of Peace and Human Rights Vol. 12 (2) 2006: pp. 232-253 ...

  18. Download this PDF file

    African Journals Online (AJOL)

    Patel J, NemotoT, Rosner D, Dao TL. Pickren JW. Axillary lymph node metastasis from an occult breast cancer. Cancer 1981; 47: 2923-2927. 10. Beller FK, Nienhaus H, Niedner W,. Holzgreve W. Bilateral breast cancers: the frequency of undiagnosed cancers. Am J. Obstet Gynecol 1986; 155: 247-253. 11. Halsted W. The ...

  19. Examination of genetic diversity in common bean ( Phaseolus ...

    African Journals Online (AJOL)

    To study the pattern of genetic diversity in 45 genotypes of common bean, 19 RAPD primers were used. Of 253 bands produced, 236 bands (94.22%) were polymorphic in which maximum number (20 polymorphic bands) were observed in the profiles of the primer OPB-07. Highest PIC value (0.79) was observed for the ...

  20. The new Caribbean Nitrogen Index to assess nitrogen dynamics in vegetable production systems in southwestern Puerto Rico

    Science.gov (United States)

    Nutrient loss from agricultural fields is one of the main factors influencing surface- and ground-water quality. Typical fertilizer nitrogen (N) consumption rates in vegetable production systems and horticultural crops in Puerto Rico, fluctuate between 112 to 253 kg N/ha. Nitrogen use efficiency of ...

  1. Bacterial response to nanodiamonds and graphene oxide sheets

    Czech Academy of Sciences Publication Activity Database

    Kromka, Alexander; Jíra, Jaroslav; Štenclová, Pavla; Kříha, V.; Kozak, Halyna; Beranová, J.; Vretenár, V.; Skakalova, V.; Rezek, Bohuslav

    2016-01-01

    Roč. 253, č. 12 (2016), 2481-2485 ISSN 0370-1972 R&D Projects: GA MŠk LM2015087; GA ČR GA15-01687S Institutional support: RVO:68378271 Keywords : diamond nanoparticles * graphene oxide * antibacterial properties * Escherichia coli Subject RIV: EE - Microbiology, Virology Impact factor: 1.674, year: 2016

  2. Defining the role of common variation in the genomic and biological architecture of adult human height

    NARCIS (Netherlands)

    Wood, Andrew R.; Esko, Tonu; Yang, Jian; Vedantam, Sailaja; Pers, Tune H.; Gustafsson, Stefan; Chun, Audrey Y.; Estrada, Karol; Luan, Jian'an; Kutalik, Zoltan; Amin, Najaf; Buchkovich, Martin L.; Croteau-Chonka, Damien C.; Day, Felix R.; Duan, Yanan; Fall, Tove; Fehrmann, Rudolf; Ferreira, Teresa; Jackson, Anne U.; Karjalainen, Juha; Lo, Ken Sin; Locke, Adam E.; Maegi, Reedik; Mihailov, Evelin; Porcu, Eleonora; Randall, Joshua C.; Scherag, Andre; Vinkhuyzen, Anna A. E.; Westra, Harm-Jan; Winkler, Thomas W.; Workalemahu, Tsegaselassie; Zhao, Jing Hua; Absher, Devin; Albrecht, Eva; Anderson, Denise; Baron, Jeffrey; Beekman, Marian; Demirkan, Ayse; Ehret, Georg B.; Feenstra, Bjarke; Feitosa, Mary F.; Fischer, Krista; Fraser, Ross M.; Goel, Anuj; Gong, Jian; Justice, Anne E.; Kanoni, Stavroula; Kleber, Marcus E.; Kristiansson, Kati; Lim, Unhee; Lotay, Vaneet; Lui, Julian C.; Mangino, Massimo; Mateo Leach, Irene; Medina-Gomez, Carolina; Nalls, Michael A.; Nyholt, Dale R.; Palmer, Cameron D.; Pasko, Dorota; Pechlivanis, Sonali; Prokopenko, Inga; Ried, Janina S.; Ripke, Stephan; Shungin, Dmitry; Stancakova, Alena; Strawbridge, Rona J.; Sung, Yun Ju; Tanaka, Toshiko; Teumer, Alexander; Trompet, Stella; van der Laan, Sander W.; van Setten, Jessica; Van Vliet-Ostaptchouk, Jana V.; Wang, Zhaoming; Yengo, Loic; Zhang, Weihua; Afzal, Uzma; Arnloev, Johan; Arscott, Gillian M.; Bandinelli, Stefania; Barrett, Amy; Bellis, Claire; Bennett, Amanda J.; Berne, Christian; Blueher, Matthias; Bolton, Jennifer L.; Boettcher, Yvonne; Boyd, Heather A.; Bruinenberg, Marcel; Buckley, Brendan M.; Buyske, Steven; Caspersen, Ida H.; Chines, Peter S.; Clarke, Robert; Claudi-Boehm, Simone; Cooper, Matthew; Daw, E. Warwick; De Jong, Pim A.; Deelen, Joris; Delgado, Graciela; Denny, Josh C.; Dhonukshe-Rutten, Rosalie; Dimitriou, Maria; Doney, Alex S. F.; Doerr, Marcus; Eklund, Niina; Eury, Elodie; Folkersen, Lasse; Garcia, Melissa E.; Geller, Frank; Giedraitis, Vilmantas; Go, Alan S.; Grallert, Harald; Grammer, Tanja B.; Graessler, Juergen; Groenberg, Henrik; de Groot, Lisette C. P. G. M.; Groves, Christopher J.; Haessler, Jeffrey; Hall, Per; Haller, Toomas; Hallmans, Goran; Hannemann, Anke; Hartman, Catharina A.; Hassinen, Maija; Hayward, Caroline; Heard-Costa, Nancy L.; Helmer, Quinta; Hemani, Gibran; Henders, Anjali K.; Hillege, Hans L.; Hlatky, Mark A.; Hoffmann, Wolfgang; Hoffmann, Per; Holmen, Oddgeir; Houwing-Duistermaat, Jeanine J.; Illig, Thomas; Isaacs, Aaron; James, Alan L.; Jeff, Janina; Johansen, Bent; Johansson, Asa; Jolley, Jennifer; Juliusdottir, Thorhildur; Junttila, Juhani; Kho, Abel N.; Kinnunen, Leena; Klopp, Norman; Kocher, Thomas; Kratzer, Wolfgang; Lichtner, Peter; Lind, Lars; Lindstroem, Jaana; Lobbens, Stephane; Lorentzon, Mattias; Lu, Yingchang; Lyssenko, Valeriya; Magnusson, Patrik K. E.; Mahajan, Anubha; Maillard, Marc; McArdle, Wendy L.; McKenzie, Colin A.; McLachlan, Stela; McLaren, Paul J.; Menni, Cristina; Merger, Sigrun; Milani, Lili; Moayyeri, Alireza; Monda, Keri L.; Morken, Mario A.; Mueller, Gabriele; Mueller-Nurasyid, Martina; Musk, Arthur W.; Narisu, Narisu; Nauck, Matthias; Nolte, Ilja M.; Noethen, Markus M.; Oozageer, Laticia; Pilz, Stefan; Rayner, Nigel W.; Renstrom, Frida; Robertson, Neil R.; Rose, Lynda M.; Roussel, Ronan; Sanna, Serena; Scharnagl, Hubert; Scholtens, Salome; Schumacher, Fredrick R.; Schunkert, Heribert; Scott, Robert A.; Sehmi, Joban; Seufferlein, Thomas; Shin, Jianxin; Silventoinen, Karri; Smit, Johannes H.; Smith, Albert Vernon; Smolonska, Joanna; Stanton, Alice V.; Stirrups, Kathleen; Stott, David J.; Stringham, Heather M.; Sundstrom, Johan; Swertz, Morris A.; Syvanen, Ann-Christine; Tayo, Bamidele O.; Thorleifsson, Gudmar; Tyrer, Jonathan P.; van Dijk, Suzanne; van Schoor, Natasja M.; van der Velde, Nathalie; van Heemst, Diana; van Oort, Floor V. A.; Vermeulen, Sita H.; Verweij, Niek; Vonk, Judith M.; Waite, Lindsay L.; Waldenberger, Melanie; Wennauer, Roman; Wilkens, Lynne R.; Willenborg, Christina; Wilsgaard, Tom; Wojczynski, Mary K.; Wong, Andrew; Wright, Alan F.; Zhang, Qunyuan; Arveiler, Dominique; Bakker, Stephan J. L.; Beilby, John; Bergman, Richard N.; Bergmann, Sven; Biffar, Reiner; Blangero, John; Boomsma, Dorret I.; Bornstein, Stefan R.; Bovet, Pascal; Brambilla, Paolo; Brown, Morris J.; Campbell, Harry; Caulfield, Mark J.; Chakravarti, Aravinda; Collins, Rory; Collins, Francis S.; Crawford, Dana C.; Cupples, L. Adrienne; Danesh, John; de Faire, Ulf; den Ruijter, Hester M.; Erbel, Raimund; Erdmann, Jeanette; Eriksson, Johan G.; Farrall, Martin; Ferrannini, Ele; Ferrieres, Jean; Ford, Ian; Forouhi, Nita G.; Forrester, Terrence; Gansevoort, Ron T.; Gejman, Pablo V.; Gieger, Christian; Golay, Alain; Gottesman, Omri; Gudnason, Vilmundur; Gyllensten, Ulf; Haas, David W.; Hall, Alistair S.; Harris, Tamara B.; Hattersley, Andrew T.; Heath, Andrew C.; Hengstenberg, Christian; Hicks, Andrew A.; Hindorff, Lucia A.; Hingorani, Aroon D.; Hofman, Albert; Hovingh, G. Kees; Humphries, Steve E.; Hunt, Steven C.; Hypponen, Elina; Jacobs, Kevin B.; Jarvelin, Marjo-Riitta; Jousilahti, Pekka; Jula, Antti M.; Kaprio, Jaakko; Kastelein, John J. P.; Kayser, Manfred; Kee, Frank; Keinanen-Kiukaanniemi, Sirkka M.; Kiemeney, Lambertus A.; Kooner, Jaspal S.; Kooperberg, Charles; Koskinen, Seppo; Kovacs, Peter; Kraja, Aldi T.; Kumari, Meena; Kuusisto, Johanna; Lakka, Timo A.; Langenberg, Claudia; Le Marchand, Loic; Lehtimaki, Terho; Lupoli, Sara; Madden, Pamela A. F.; Mannisto, Satu; Manunta, Paolo; Marette, Andre; Matise, Tara C.; McKnight, Barbara; Meitinger, Thomas; Moll, Frans L.; Montgomery, Grant W.; Morris, Andrew D.; Morris, Andrew P.; Murray, Jeffrey C.; Nelis, Mari; Ohlsson, Claes; Oldehinkel, Albertine J.; Ong, Ken K.; Ouwehand, Willem H.; Pasterkamp, Gerard; Peters, Annette; Pramstaller, Peter P.; Price, Jackie F.; Qi, Lu; Raitakari, Olli T.; Rankinen, Tuomo; Rao, D. C.; Rice, Treva K.; Ritchie, Marylyn; Rudan, Igor; Salomaa, Veikko; Samani, Nilesh J.; Saramies, Jouko; Sarzynski, Mark A.; Schwarz, Peter E. H.; Sebert, Sylvain; Sever, Peter; Shuldiner, Alan R.; Sinisalo, Juha; Steinthorsdottir, Valgerdur; Stolk, Ronald P.; Tardif, Jean-Claude; Toenjes, Anke; Tremblay, Angelo; Tremoli, Elena; Virtamo, Jarmo; Vohl, Marie-Claude; Amouyel, Philippe; Asselbergs, Folkert W.; Assimes, Themistocles L.; Bochud, Murielle; Boehm, Bernhard O.; Boerwinkle, Eric; Bottinger, Erwin P.; Bouchard, Claude; Cauchi, Stephane; Chambers, John C.; Chanock, Stephen J.; Cooper, Richard S.; de Bakker, Paul I. W.; Dedoussis, George; Ferrucci, Luigi; Franks, Paul W.; Froguel, Philippe; Groop, Leif C.; Haiman, Christopher A.; Hamsten, Anders; Hayes, M. Geoffrey; Hui, Jennie; Hunter, David J.; Hveem, Kristian; Jukema, J. Wouter; Kaplan, Robert C.; Kivimaki, Mika; Kuh, Diana; Laakso, Markku; Liu, Yongmei; Martin, Nicholas G.; Maerz, Winfried; Melbye, Mads; Moebus, Susanne; Munroe, Patricia B.; Njolstad, Inger; Oostra, Ben A.; Palmer, Colin N. A.; Pedersen, Nancy L.; Perola, Markus; Perusse, Louis; Peters, Ulrike; Powell, Joseph E.; Power, Chris; Quertermous, Thomas; Rauramaa, Rainer; Reinmaa, Eva; Ridker, Paul M.; Rivadeneira, Fernando; Rotter, Jerome I.; Saaristo, Timo E.; Saleheen, Danish; Schlessinger, David; Slagboom, P. Eline; Snieder, Harold; Spector, Tim D.; Strauch, Konstantin; Stumvoll, Michael; Tuomilehto, Jaakko; Uusitupa, Matti; van der Harst, Pim; Voelzke, Henry; Walker, Mark; Wareham, Nicholas J.; Watkins, Hugh; Wichmann, H-Erich; Wilson, James F.; Zanen, Pieter; Deloukas, Panos; Heid, Iris M.; Lindgren, Cecilia M.; Mohlke, Karen L.; Speliotes, Elizabeth K.; Thorsteinsdottir, Unnur; Barroso, Ines; Fox, Caroline S.; North, Kari E.; Strachan, David P.; Beckmann, Jacques S.; Berndt, Sonja I.; Boehnke, Michael; Borecki, Ingrid B.; McCarthy, Mark I.; Metspalu, Andres; Stefansson, Kari; Uitterlinden, Andre G.; van Duijn, Cornelia M.; Franke, Lude; Willer, Cristen J.; Price, Alkes L.; Lettre, Guillaume; Loos, Ruth J. F.; Weedon, Michael N.; Ingelsson, Erik; O'Connell, Jeffrey R.; Abecasis, Goncalo R.; Chasman, Daniel I.; Goddard, Michael E.; Visscher, Peter M.; Hirschhorn, Joel N.; Frayling, Timothy M.

    2014-01-01

    Using genome-wide data from 253,288 individuals, we identified 697 variants at genome-wide significance that together explained one-fifth of the heritability for adult height. By testing different numbers of variants in independent studies, we show that the most strongly associated similar to 2,000,

  3. A case study of a density structure over a vertical magnetic field region in the Martian ionosphere

    Czech Academy of Sciences Publication Activity Database

    Duru, F.; Gurnett, D. A.; Dieval, C.; Morgan, D. D.; Píša, David; Lundin, R.

    2016-01-01

    Roč. 43, č. 10 (2016), s. 4665-4672 ISSN 0094-8276 Institutional support: RVO:68378289 Keywords : mars -express * ionosphere * anomalies * ionospheric plasma * Mars Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 4.253, year: 2016 http://onlinelibrary.wiley.com/doi/10.1002/2016GL068686/abstract

  4. You have been Friended by the U.S. Military; Using Social Networking Services for IO Messaging

    Science.gov (United States)

    2010-12-01

    detonate plastic explosives hidden in his underwear while on board Northwest Airlines Flight 253, en-route from Amsterdam to Detroit, Michigan, on...April and December of 2003 to distributors that said they were building digital satellite decoders for shipment to Iraq.49 The explosion of satellite

  5. 76 FR 64375 - Iroquois National Wildlife Refuge, Genesee County and Orleans County, NY; Final Comprehensive...

    Science.gov (United States)

    2011-10-18

    ... hours at above address. FOR FURTHER INFORMATION CONTACT: Thomas Roster, Project Leader, 585- 948-5445, or Thomas Bonetti, Planning Team Leader, 413-253-8307 (phone); [email protected] (e-mail... us in managing and administering Iroquois NWR for the next 15 years. Background The National Wildlife...

  6. Examination of Learner and Situation Level Variables: Choice of Speech Act and Request Strategy by Spanish L2 Learners

    Science.gov (United States)

    Kuriscak, Lisa

    2015-01-01

    This study focuses on variation within a group of learners of Spanish (N = 253) who produced requests and complaints via a written discourse completion task. It examines the effects of learner and situational variables on production--the effect of proficiency and addressee-gender on speech-act choice and the effect of perception of imposition on…

  7. Ultraviolet absorptions of non-stoichiometric lead chloride PbCl2

    NARCIS (Netherlands)

    Vries, K.J. de; Santen, J.H. van

    1964-01-01

    Tempering evaporated lead chloride films in a nitrogen atmosphere without or with excess lead or chlorine results in extra absorption bands between 268 and 360 mμ and at about 253 mμ, and in a change of the existing absorption at 265.5 mμ (measured at liquid nitrogen temperature). These absorption

  8. Acute toxicity studies of aqueous stem bark extract of Ximenia ...

    African Journals Online (AJOL)

    STORAGESEVER

    2008-05-16

    May 16, 2008 ... Based on the result of the acute toxicity test, white Swiss albino mice of average weight 25.3 g divided into 3 groups of one animal per group were intraperitoneally/orally administered 1600, 2900 and. 5000 mg/kg body weight, aqueous bark extract in water. Death was monitored over a period of 24 h.

  9. Journal of Earth System Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Earth System Science. R C Mehrotra. Articles written in Journal of Earth System Science. Volume 120 Issue 2 April 2011 pp 253-262. Ficus palaeoracemosa sp. nov. – A new fossil leaf from the Kasauli Formation of Himachal Pradesh and its palaeoclimatic significance · Gaurav Srivastava Rashmi ...

  10. The Interpersonal and Psychological Functioning of Women Who Experienced Childhood Physical Abuse, Incest, and Parental Alcoholism.

    Science.gov (United States)

    Fox, Kathleen M.; Gilbert, Brenda O.

    1994-01-01

    Questionnaires assessing childhood physical abuse, childhood incest, and parental alcoholism were completed by 253 college women. Analysis of level of depression; self-esteem; and involvement with physically abusive, sexually assaultive, sexually coercive, and chemically dependent partners revealed support for an additive model of trauma that…

  11. The Well of Fortitude

    Science.gov (United States)

    2008-02-26

    Northouse , Peter , G. 2004. Leadership : Theory and practice . Thousand Oaks, CA: Sage Publications...characteristics -social motivation -will/motivation -debates -‘fire-side’ chats - leadership , leadership , leadership training & study -chaos theory - study...Franklin Covey Co. Smith, Tara. 1999. Justice as a Personal Virtue. Social Theory and Practice . 25(3): 361-384. Toner, James H. 2000.

  12. Chanda Arya

    Indian Academy of Sciences (India)

    This study presents a scientometric analysis of 253 articles published in Sadhana during the year 2005–2009. Five volumes of the journal are taken up to observe the distribution of contribution, authorship pattern, institution-wise distribution, geographical distribution of contribution, average length of paper, tables and ...

  13. Browse Title Index

    African Journals Online (AJOL)

    Items 151 - 200 of 253 ... VA Alabi. Vol 15, No 1 (2014), Subjective Welfarism, Communitarian Paternalism and the Aristotelian Quest for the Good Society, Abstract PDF. A Afolayan, F Offor. Vol 15, No 2 (2014), Sufism Shat'h versus Surrealism Literature and Art, Abstract PDF. Z Abdollah. Vol 15, No 1 (2014), Technè, Dianoia ...

  14. Temporal and spatial variations in hydrographic conditions of Mandovi estuary

    Digital Repository Service at National Institute of Oceanography (India)

    Varma, K.K.; Rao, L.V.G.; Cherian, T.

    Nine stations over a stretch of 21 km of Periyar river estuary were sampled during January to December 1981. Particulate matter varied from 3-253 mg.1 super(1) at the surface and 24.8-257mg.1 super(1) at the bottom. Particulate organic carbon ranged...

  15. Improved Outcome of Fracture Treatment by Early Operative ...

    African Journals Online (AJOL)

    treated by early operative reduction because of shorter hospital stay. early return to work. ... bed rest is avoided and shortened hospital stay is ... The types of operations done were analysed in Table l. which has shown major differences between. 1997 and 1998 in the operative fixation of fractures (25.3 % in 1997 compared ...

  16. Prevalence and risk factors of ticks infesting cattle reared on the ...

    African Journals Online (AJOL)

    and climatic factors under different field conditions. Vet. Prasitolo., 75, 241-253. Ambrose, N., Lloyd, D. and Maillard, J. C., 1999. Immune response to Dermatophilus congolensis infections. Parasitol. Today., 15, 295-300. Birhanu T. and Abdalla, S., 2014. Prevalence and distribution of tick infestation on cattle at Fitche Selale, ...

  17. Lifetime and baseline alcohol intake and risk of cancer of the upper aero-digestive tract in the European prospective investigation into cancer and nutrition (EPIC) study

    NARCIS (Netherlands)

    Weikert, Cornelia; Dietrich, Thomas; Boeing, Heiner; Bergmann, Manuela M.; Boutron-Ruault, Marie Christine; Clavel-Chapelon, Francoise; Allen, Naomi; Key, Tim; Lund, Eiliv; Olsen, Anja; Tjonneland, Anne; Overvad, Kim; Rohrmann, Sabine; Linseisen, Jakob; Pischon, Tobias; Trichopoulou, Antonia; Weinehall, Lars; Johansson, Ingegerd; Sanchez, Maria-Jose; Agudo, Antonio; Barricarte, Aurelio; Amiano, Pilar; Chirlaque, Maria-Dolores; Ramon Quiros, J.; Wirfalt, Elisabet; Peeters, Petra H.; Bueno-de-Mesquita, H. Bas; Vrieling, Alina; Pala, Valeria; Palli, Domenico; Vineis, Paolo; Tumino, Rosario; Panico, Salvatore; Bingham, Sheila; Khaw, Kay-Tee; Norat, Teresa; Jenab, Mazda; Ferrari, Pietro; Slimani, Nadia; Riboli, Elio

    2009-01-01

    Recent alcohol consumption is all established risk factor for squamous cell carcinoma (SCC) or the upper aero-digestive tract. In contrast, the role or lifetime exposure to alcohol with regard to risk of SCC is not well established. Historical data oil alcohol use are available in 271,253

  18. Lifelong Learning and the E-Strategy of the Open University of the Netherlands: ou.nl

    NARCIS (Netherlands)

    Westera, Wim; Kalz, Marco

    2008-01-01

    Westera, W., & Kalz, M. (2008). Lifelong Learning and the E-Strategy of the Open University of the Netherlands: ou.nl. In J. Stratmann & M. Kerres (Eds.), E-strategy, Strategisches Informationsmanagement für Forschung und Lehre, Medien in de Wissenschaft Band 46 (pp. 253-266). Gesellschaft für

  19. (IEQ) Assessment in Hospital Buildings: A Confirmatory Factor

    African Journals Online (AJOL)

    Sultan

    patients (36.8%) and 253 staff (28.9%) participated in the study, while the remaining. 304 (34.3%) are patient ... indices of factor analysis are the method of. Ninlyat / Isa/ Gofwen extraction which involved using the principal ... V arimax rotation method was employed with coefficient suppressed absolute value of below. 0.4.

  20. In search of the main properties of phthalocyanines participating in toxicity against cyanobacteria

    Czech Academy of Sciences Publication Activity Database

    Jančula, Daniel; Maršálek, Blahoslav; Novotná, Zlatica; Černý, J.; Karásková, M.; Rakušan, J.

    2009-01-01

    Roč. 77, č. 11 (2009), s. 1520-1525 ISSN 0045-6535 R&D Projects: GA MŠk 1M0571 Institutional research plan: CEZ:AV0Z60050516 Keywords : phthalocyanine s * cyanobycteria * toxicity Subject RIV: EF - Botanics Impact factor: 3.253, year: 2009

  1. Probing the localization of charge and the extent of disorder through electronic transport on Au nanoparticle–copper phthalocyanine multijunction networks

    Czech Academy of Sciences Publication Activity Database

    Balliou, A.; Kazim, Samrana; Pfleger, Jiří; Rakušan, J.; Skoulatakis, G.; Kennou, S.; Glezos, N.

    2016-01-01

    Roč. 253, č. 5 (2016), s. 1009-1019 ISSN 0370-1972 R&D Projects: GA MŠk(CZ) 7AMB12GR022; GA ČR(CZ) GAP108/12/1143 Institutional support: RVO:61389013 Keywords : Au nanoparticles * carrier localization * electrical transport Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering Impact factor: 1.674, year: 2016

  2. 41 CFR 109-25.302 - Office furniture, furnishings, and equipment.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false Office furniture... SUPPLY AND PROCUREMENT 25-GENERAL 25.3-Use Standards § 109-25.302 Office furniture, furnishings, and... contractors shall establish criteria for the use of office furniture, furnishings, and equipment. ...

  3. 41 CFR 101-25.302 - Office furniture, furnishings, and equipment.

    Science.gov (United States)

    2010-07-01

    ... 41 Public Contracts and Property Management 2 2010-07-01 2010-07-01 true Office furniture...-GENERAL 25.3-Use Standards § 101-25.302 Office furniture, furnishings, and equipment. (a) Each executive agency shall establish criteria for the use of office furniture, furnishings, and equipment. Such...

  4. Population genetics related to adaptation in elite oat germplasm

    Science.gov (United States)

    Six hundred thirty five oat lines and 2,635 SNP loci were used to evaluate population structure, linkage disequilibrium (LD) and genotype-phenotype association with heading date. The first five principal components (PC) accounted for 25.3% of genetic variation. Neither the eigenvalues of the first 2...

  5. Data of evolutionary structure change: 1AIJM-2UWSL [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available Chain>1AIJM TVVDN----WYVWG ture...> ----HHHHH> ATOM 4524 CA THR M 289 45.252 112.669 58.253 1.0...DChain>2UWSL TIWFDQWVDWWQWW cture> GGGGGHHH...Chain> 2UWSL RVPGG--TLVGG > -- ...FSTLLG > > ATOM 2450 CA ARG M 29

  6. Relationship between the Religious Attitude, Self-Efficacy, and Life Satisfaction in High School Teachers of Mahshahr City

    Science.gov (United States)

    Bigdeloo, Masoomeh; Bozorgi, Zahra Dasht

    2016-01-01

    This study aims to investigate the relationship between the religious attitude, self-efficacy, and life satisfaction in high school teachers of Mahshahr City. To this end, 253 people of all high school teachers in Mahshahr City, in Iran were selected as the sample using the multistage cluster sampling method. For data collection, Glock and Stark's…

  7. 75 FR 44809 - Office of the Secretary Submission for OMB Review: Comment Request

    Science.gov (United States)

    2010-07-29

    ....253). OMB Control Number: 1218-0216. Affected Public: Business or other for-profits. Estimated Number... public information collection requests (ICR) to the Office of Management and Budget (OMB) for review and...), Office of Management and Budget, Room 10235, Washington, DC 20503, Telephone: 202-395-7316/Fax: 202-395...

  8. Major depressive disorder as a co-morbid diagnosis in ...

    African Journals Online (AJOL)

    Adele

    those related to the causation and definition of mental disorders. It is increasingly recognized that the validity of ... defined by their syndromes should be regarded as valid only if they have been shown to be discrete entities with ..... schizophrenia.Mol Psychiatry 2002; 7(3):247-253. 43. Meltzer HY, Alphs L, Green AI, et al.

  9. Annotated checklist of Solanum L. (Solanaceae) for Peru

    Science.gov (United States)

    The genus Solanum is among the most species-rich genera both of the Peruvian flora and of the tropical Andes in general. The present revised checklist treats 276 species of Solanum L., of which 253 are native, while 23 are introduced and/or cultivated. A total of 74 Solanum species (29% of native sp...

  10. Psychological Assessment of Patrolman Qualifications in Relation to Field Performance; The Identification of Predictors for Overall Performance of Patrolmen and the Relation between Predictors and Specific Patterns of Exceptional and Marginal Performance.

    Science.gov (United States)

    Chicago Police Dept., IL.

    Behavioral scientists have been slow in the development of effective procedures and in empirical validation of psychological testing instruments for selecting law enforcement personnel. This study involved 253 supervisory sergeants and field lieutenants and 2,327 uniformed patrolmen of the Chicago Police Department (CPD). Three major performance…

  11. "I work all the time- he just waits for the animals to come back": social impacts of climate changes: a Greenlandic case study

    NARCIS (Netherlands)

    van Voorst, R.

    2009-01-01

    Understanding human adaptation to climate changes is one of the most important research issues within the area of global environmental change, accounting for the fact that people worldwide are currently adapting to their changing environment (Adger and Kelly 2000: 253; Smit et al. 2008). The

  12. Data of evolutionary structure change: 1BS5B-3CMDB [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1BS5B-3CMDB 1BS5 3CMD B B SVLQ---VLHIPDERLRKVAKPVE-EVNAEIQRIVDDMF...ne> GLU CA 209 3CMD B 3CMD...e>GLY CA 253 ILE CA 241 3CMD... B 3CMDB ILSHSVQDACL ...> ARG CA 309 ALA CA 299 LEU CA 263 3CMD

  13. Spectroscopic Investigation of Materials for Frequency Agile Laser Systems.

    Science.gov (United States)

    1985-01-01

    diffusion and fluorescence quenching in Nd. La I P5O 1 4 crystals Christopher M. Lawson and Richard C. Powell Physics Department, Oklahoma State...Festkorperprobleme, edited by H. J. Ref. 12. Queisser )Pergamon, New York, 1975), Vol. 15, p. 253. 39P. Reineker and R. Kuhne, Phys. Rev. B 21, 2448 (1980). 16H

  14. Common Purpose Liability versus Joint Enterprise: A Practical View on the ICC's Hierarchy of Liability Theories

    NARCIS (Netherlands)

    Cupido, M.

    2016-01-01

    On 7 March 2014, Trial Chamber II of the International Criminal Court (ICC) convicted Germain Katanga for war crimes and crimes against humanity. Katanga's conviction is based on the concept of common purpose liability as regulated in Article 25(3)(d) of the Rome Statute. This liability theory

  15. De-Schooling Art and Design: Illich Redux

    Science.gov (United States)

    Hardy, Tom

    2012-01-01

    Using Ivan Illich's seminal works, "Deschooling Society" and "Tools for Conviviality" as touchstones, this paper returns to further pursue the thrust of my article in "iJADE" 25.3 (2006), "Domain poisoning: the redundancy of current models of assessment through art," and might be considered as a more radical addendum. The central strand of…

  16. Synthesis of C3-symmetric tri(alkylamino) guests and their interaction with cyclodextrins

    Czech Academy of Sciences Publication Activity Database

    Bednaříková, T.; Tošner, Z.; Horský, Jiří; Jindřich, J.

    2015-01-01

    Roč. 81, 1-2 (2015), s. 141-152 ISSN 0923-0750 Institutional support: RVO:61389013 Keywords : cyclodextrin * supramolecular interactions * C3-symmetric guests Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 1.253, year: 2015

  17. Trajectory Control and Optimization for Responsive Spacecraft

    Science.gov (United States)

    2012-03-22

    ν = L− tan−1 ( h k ) (2.53) Kepler’s equation in terms of equinoctial elements is derived directly from the classical Kepler equation (2.54) using the...dospectral Methods . 35. Escobal, P. R., Methods of Orbit Determination, John Wiley & Sons, Inc, 1965. 36. Larson, W. J. and Wertz, J. R., editors, Space

  18. Near-miss maternal morbidity from severe haemorrhage at ...

    African Journals Online (AJOL)

    Results. Of 20 527 caesarean sections , there were 93 near misses and 7 maternal deaths from BDACS. Dominant risk factors for near misses were previous caesarean section (43.9%), anaemia (25.3%) and pregnancy-induced hypertension (28.6%). Eighteen women were transferred to higher levels of care, and 8 (44.4%) ...

  19. : tous les projets | Page 43 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Le Mexique affiche l'un des plus hauts taux de surpoids et d'obésité au monde. Région: North and Central America, Mexico. Programme: Food, Environment, and Health. Financement total : CA$ 253,500.00. Surmonter les obstacles à la mise en oeuvre de la réglementation de l'alimentation en milieu scolaire au Mexique.

  20. Genome-wide meta-analysis in alopecia areata resolves HLA associations and reveals two new susceptibility loci

    NARCIS (Netherlands)

    Betz, Regina C; Petukhova, Lynn; Ripke, Stephan; Huang, Hailiang; Menelaou, Androniki; Redler, Silke; Becker, Tim; Heilmann, Stefanie; Yamany, Tarek; Duvic, Madeliene; Hordinsky, Maria; Norris, David; Price, Vera H; Mackay-Wiggan, Julian; de Jong, Annemieke; DeStefano, Gina M; Moebus, Susanne; Böhm, Markus; Blume-Peytavi, Ulrike; Wolff, Hans; Lutz, Gerhard; Kruse, Roland; Bian, Li; Amos, Christopher I; Lee, Annette; Gregersen, Peter K; Blaumeiser, Bettina; Altshuler, David; Clynes, Raphael; de Bakker, Paul I W; Nöthen, Markus M; Daly, Mark J; Christiano, Angela M

    2015-01-01

    Alopecia areata (AA) is a prevalent autoimmune disease with 10 known susceptibility loci. Here we perform the first meta-analysis of research on AA by combining data from two genome-wide association studies (GWAS), and replication with supplemented ImmunoChip data for a total of 3,253 cases and

  1. Dynamic temperature fields under Mars landing sites and implications for supporting microbial life.

    Science.gov (United States)

    Ulrich, Richard; Kral, Tim; Chevrier, Vincent; Pilgrim, Robert; Roe, Larry

    2010-01-01

    While average temperatures on Mars may be too low to support terrestrial life-forms or aqueous liquids, diurnal peak temperatures over most of the planet can be high enough to provide for both, down to a few centimeters beneath the surface for some fraction of the time. A thermal model was applied to the Viking 1, Viking 2, Pathfinder, Spirit, and Opportunity landing sites to demonstrate the dynamic temperature fields under the surface at these well-characterized locations. A benchmark temperature of 253 K was used as a lower limit for possible metabolic activity, which corresponds to the minimum found for specific terrestrial microorganisms. Aqueous solutions of salts known to exist on Mars can provide liquid solutions well below this temperature. Thermal modeling has shown that 253 K is reached beneath the surface at diurnal peak heating for at least some parts of the year at each of these landing sites. Within 40 degrees of the equator, 253 K beneath the surface should occur for at least some fraction of the year; and, within 20 degrees , it will be seen for most of the year. However, any life-form that requires this temperature to thrive must also endure daily excursions to far colder temperatures as well as periods of the year where 253 K is never reached at all.

  2. File list: Unc.Neu.05.AllAg.Hypothalamus [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Unc.Neu.05.AllAg.Hypothalamus mm9 Unclassified Neural Hypothalamus SRX956254,SRX956...253 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/Unc.Neu.05.AllAg.Hypothalamus.bed ...

  3. File list: ALL.Neu.05.AllAg.Hypothalamus [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available ALL.Neu.05.AllAg.Hypothalamus mm9 All antigens Neural Hypothalamus SRX956254,SRX956...253 http://dbarchive.biosciencedbc.jp/kyushu-u/mm9/assembled/ALL.Neu.05.AllAg.Hypothalamus.bed ...

  4. Download this PDF file

    African Journals Online (AJOL)

    User

    and plant residues are important sources of nutrient but they are unable to supply all the nutrients ... requirements for plant nutrients. ..... Table 4: Relationship between socio-economic factors and satisfaction level. Variables. Regression coefficient Standard error p-value. Farm income. 2.706. 2.369. 0.253. Source of credit.

  5. Bulletin of Materials Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science. P Sarah. Articles written in Bulletin of Materials Science. Volume 26 Issue 2 February 2003 pp 247-253 Electrical Properties. Impedance spectroscopy study of polycrystalline Bi6Fe2Ti3O18 · K Srinivas P Sarah S V Suryanarayana · More Details Abstract Fulltext PDF.

  6. Photosynthetic characterization of a rolled leaf mutant of rice (Oryza ...

    African Journals Online (AJOL)

    Lfngwang

    2012-03-29

    Mar 29, 2012 ... minimal fluorescence level during illumination (F0'), a black cloth was rapidly placed around the leaf and the leaf-clip holder in the presence of far-red ..... Using chlorophyll fluorescence to assess the fraction of absorbed light allocated to thermal dissipation of excess excitation. Physiol. Planta. 98: 253-264 ...

  7. Factorial Structure of the New Ecological Paradigm Scale in Two French Samples

    Science.gov (United States)

    Fleury-Bahi, Ghozlane; Marcouyeux, Aurore; Renard, Elise; Roussiau, Nicolas

    2015-01-01

    The principal objective of this research is to test the factorial structure of the New Ecological Paradigm scale on a population of men and women residing in France. The tested model is a second-order factorial model. This factorial structure is evaluated on two separate samples to test the stability of the solution (a first sample of 253

  8. Age-Related DNA Methylation Changes and Neoplastic Transformation of the Human Prostate

    Science.gov (United States)

    2011-07-01

    airways. Cell 1998 Jan 23;92(2):253-63. (3) Casci T, Vinos J, Freeman M. Sprouty, an intracellular inhibitor of Ras signaling. Cell 1999 Mar 5;96...63. 3. Casci T, Vinos J, Freeman M. Sprouty, an intracellular inhibitor of Ras signaling. Cell 1999; 96:655-65. 4. Kramer S, Okabe M, Hacohen N

  9. Mõne läänemeresoome sufiksi taustast / Ago Künnap

    Index Scriptorium Estoniae

    Künnap, Ago, 1941-

    2009-01-01

    Vastukaja artiklile: Grünthal, Riho. The Mordvinic languages between bush and tree : a historical reappraisal // Sámit, sánit, sátnehámit : riepmočála Pekka Sammallahtii miessemánu 21. beaivve 2007. Helsinki : Suomalais-Ugrilainen Seura, 2007. (Suomalais-Ugrilaisen Seuran toimituksia ; 253)

  10. Bulletin of Materials Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science. P K Das. Articles written in Bulletin of Materials Science. Volume 23 Issue 4 August 2000 pp 249-253 Nitride Ceramics. Optimization of time–temperature schedule for nitridation of silicon compact on the basis of silicon and nitrogen reaction kinetics · J Rakshit P K Das.

  11. Domain Modeling: NP_940918.1 [SAHG[Archive

    Lifescience Database Archive (English)

    Full Text Available NP_940918.1 chr11 The Crystal Structure of UDP-GalNAc: polypeptide alpha-N-acetylga...lactosaminyltransferase-T1 c1xhba_ chr11/NP_940918.1/NP_940918.1_holo_133-601.pdb blast 251D,253H,345G,382H,

  12. Download this PDF file

    African Journals Online (AJOL)

    Reprint Requests to: Dr. O.M. Oluwatosin, Division of Plastic Surgery, Department of. Surgery, University ... were popularized in Europe by Gilles3 and in the .... Plastic surgery of the face. London Oxford 1920. 4. Brown JB, Cannon B. Composite free grafts and cartilage from the ear. Surg Gynecol Obst 1946; 32: 253-255. 5.

  13. Intestinal metaplasia and Helicobacter pylori: an endoscopic bioptic study of the gastric antrum

    NARCIS (Netherlands)

    Craanen, M. E.; Dekker, W.; Blok, P.; Ferwerda, J.; Tytgat, G. N.

    1992-01-01

    To study the relationship between intestinal metaplasia and Helicobacter pylori infection, 2274 gastroscopic antral biopsies taken from 533 patients were examined. Overall, intestinal metaplasia was found in 135 patients (25.3%) and H pylori in 289 patients (54.2%). The prevalence of intestinal

  14. Daily and Momentary Mood and Stress Are Associated with Binge Eating and Vomiting in Bulimia Nervosa Patients in the Natural Environment

    Science.gov (United States)

    Smyth, Joshua M.; Wonderlich, Stephen A.; Heron, Kristin E.; Sliwinski, Martin J.; Crosby, Ross D.; Mitchell, James E.; Engel, Scott G.

    2007-01-01

    The relation of mood and stress to binge eating and vomiting in the natural environments of patients with bulimia nervosa (BN) was examined using real-time data collection. Women (n = 131; mean age = 25.3 years) with BN carried a palmtop computer for 2 weeks and completed ratings of positive affect (PA), negative affect (NA), anger/hostility (AH),…

  15. Modifiable risk factors of coronary heart disease in male first time ...

    African Journals Online (AJOL)

    ... total cholesterol, physical working capacity and predicted aerobic capacity. The majority of subjects (50.9 %) displayed two or more, 27.3 % three or more and 8.2 % four or more, risk factors for coronary heart disease (CHD). Of the 253 subjects tested 43.2 % were inactive before they joined the health and fitness centre.

  16. Adaptation to Stress: An Investigation into the Lives of United States Military Families with a Child Who Is Disabled.

    Science.gov (United States)

    Fallon, Moira A.; Russo, Theresa J.

    2003-01-01

    This study surveyed 253 military families with children who have disabilities to determine if they experienced difficulties in adapting to military life. Responses indicated that 25 percent of children with disabilities were 3 years or younger and 75 percent were age 4 through 6 years. Twenty-one families reported not having adjusted to military…

  17. Social aspects of conservation in the Eastern Arc Mountain forests ...

    African Journals Online (AJOL)

    Social aspects of conservation in the Eastern Arc Mountain forests. CSL Chachage. Abstract. Journal of East African Natural History Vol. 87 (1&2) 1998: 253-263. Full Text: EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT.

  18. SAJSM 376.indd

    African Journals Online (AJOL)

    Intraexaminer reliability, interexaminer reliability and mean values for nine lower extremity skeletal measures in healthy naval midshipmen. J. Orthop Sports Phys Ther 1997:25(4):253-263. 10. Gheluwe van B, Kirby AK, Roosen P, Phillips RD. Reliability and accuracy of biomechanical measurements of the lower extremity.

  19. Special Inspector General for Afghanistan Reconstruction

    Science.gov (United States)

    2014-04-30

    activ- ities that facilitate private investment, industrial development, banking and financial system development, agricultural diversification and...farmers with alternative livelihoods .253 The Ministry of Counter Narcotics (MCN) is the lead government agency for developing counternarcotics policy...alternative livelihood programs, which are discussed in the Economic and Social Development section of this report on page 179. According to an April 2014

  20. SERIES ARTICLES

    Indian Academy of Sciences (India)

    (598–668). ( Illustration: Subhankar Biswas ). Front Cover. Back Cover. 227. Inside Back Cover. Flowering Trees. (Credit: K Sankara Rao, IISc). Science Smiles. Ayan Guha. 253. Information &. Announcements. The Infosys Prize. BOOK REVIEW. 295 A Journey to the Stars. N Rathnasree. REFLECTIONS. 299 Darshana Jolts.

  1. in vitro production of virus free sweet potato [ipomoea batatas (l

    African Journals Online (AJOL)

    preferred customer

    Sun, H., Ge, X., Hao, Z. and Peng, M. (2010). Cellulase production by Trichoderma sp. on apple pomace under solid state fermentation. African J. Biotech. 9(2):163–166. 23. Szakacs, G., Tengerdy, R.T. and Nagy, V. (2006). Cellulases. In: Enzyme Technology ed., pp. 253–. 274, (Pandey, A., Colin, W., Soccol, C.R. and.

  2. ECAJS Vol 15 no 1 FINAL April 2010 _Repaired_ to Bioline 6th ...

    African Journals Online (AJOL)

    user

    2010-06-06

    Jun 6, 2010 ... Methods: Between 1st January 2005 and 31st December 2005, a total of 253 patients were treated in Tikur Anbessa ... amputation, fracture, dislocation, or extensive soft tissue injury and presented within the 24 hours of the occurrence to Tikur Anbessa ... patients had physiotherapy. Mean duration of follow ...

  3. Gclust Server: 128128 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available 128128 OSA_Os06g0658800 Cluster Sequences Related Sequences(8) 253 no annotation 1 1.00e-99 14.29 0.0...0 0.0 0.0 0.0 0.0 Show 128128 Cluster ID 128128 Sequence ID OSA_Os06g0658800 Link to cluster sequences

  4. School children's accessibility to insecticide-treated bednets in peri ...

    African Journals Online (AJOL)

    Technology and the Parents' School. Association. Verbal consent was obtained from the school children who participated in the study. Results. Demographic characteristics. There were 454 study participants of whom 253. (55.7%) were male and 201 (44.3%) female. The mean age was 14 years, range 10-19 years,.

  5. METAL CHELATING AGENTS IV: ELECTRON IONIZATION AND ...

    African Journals Online (AJOL)

    The electron ionization (EI) and ammonia chemical ionization [CI (NH3)] mass spectral studies on 2-phenyl acetophenone semicarbazone are reported. The El spectrum shows a clearly identifiable molecular ion peak of weak intensity at m/z 253 and the base peak is observed at m/z 77. The CI (NH3) spectrum is ...

  6. Whole genome sequence of “Candidatus Liberibacter asiaticus” from a huanglongbing-affected citrus tree in Central Florida

    Science.gov (United States)

    The draft genome sequence of “Candidatus Liberibacter asiaticus” strain FL17, isolated from an HLB-affected citrus tree in central Florida, was determined. The FL17 genome comprised 1,227,253 bp with a G+C content of 36.5%, 1,175 predicted open reading frames, and 53 RNA genes....

  7. Bank Risk-Taking Abroad : Does Home-Country Regulation and Supervision Matter

    NARCIS (Netherlands)

    Ongena, S.; Popov, A.; Udell, G.F.

    2011-01-01

    This paper provides the first empirical evidence on how home-country regulation and supervision affects bank risk-tailing in hostr-country markets. We analyze lending by 136 banks to 8,253 firms in 1,513 different localities across 13 countries. We find strong evidence that laxer regulatory

  8. The International Diversification of Banks and the Value of their Cross-Border M&A Advice

    NARCIS (Netherlands)

    de Jong, A.; Ongena, S.; van der Poel, M.

    2010-01-01

    This paper investigates the effects of international diversification of banks on the value of their M&A advice. We study bidder returns to 1,253 cross-border M&A announcements. We find that acquirers engaging a more internationally diversified financial advisor generate lower excess returns.

  9. Prevention of the Post traumatic Fibrotic Response in Joints

    Science.gov (United States)

    2016-12-01

    joint contracture includes: (i) inflam - mation, (ii) proliferation of activated cells, and (iii) enhanced production of extracellular matrix macro...The metalloproteases meprin alpha and meprin beta: unique enzymes in inflam - mation, neurodegeneration, cancer and fibrosis. Biochem J 450:253–264. 19

  10. Neurocysticercosis - experience at the teaching hospitals ofthe ...

    African Journals Online (AJOL)

    Hyg 1934; 27: 343-363. 21. Arseni C, Cristescu A. Epilepsy due to cerebral cysticercosis. Epilepsia (Amst) 1972; 13: 253-258. 22. Hemandez AL, Garaizar e. Childhood cerebral cysticercosis: clini- cal features and computed tomographic findings in 89 Mexican children. Can] Neurol Sci 1982; 9: 401-407. 23. Zini D, Farrell V, ...

  11. Architecture of European Plastic Surgery

    NARCIS (Netherlands)

    Nicolai, J. -P. A.; Banic, A.; Molea, G.; Mazzola, R.; Poell, J. G.

    2006-01-01

    The architecture of European Plastic Surgery was published in 1996 [Nicolai JPA, Scuderi N. Plastic surgical Europe in an organogram. Eur J Plast Surg 1996; 19: 253-6.] It is the objective of this paper to update information of that article. Continuing medical education (CME), science, training,

  12. A Look at EFL Technical Students' Use of Learning Strategies in Taiwan

    Science.gov (United States)

    Chu, Yu-Wei; Huang, Bih-Shia; Shih, Ming-Piao; Tsai, Chih-Hsin

    2012-01-01

    253 freshmen taking Freshman English from a university of technology in the central Taiwan participated in this study. The purposes of this research were to explore what learning strategy was used more frequently by college students and to investigate the variance of using learning strategies among students of different English proficiency levels.…

  13. Factors Affecting the Job Satisfaction of Latino/a Immigrants in the Midwest

    Science.gov (United States)

    Valdivia, Corinne; Flores, Lisa Y.

    2012-01-01

    This study examined the job satisfaction of 253 Latino/a newcomers in three rural communities in the Midwest. Specifically, the authors explored the effects of ethnic identity, Anglo acculturation, Latino/a acculturation, perceptions of the community (social relations, discrimination/racism, and language pressures), job tenure, work hours, and…

  14. Designing pH-responsive and dielectric hydrogels from cellulose ...

    Indian Academy of Sciences (India)

    Author Affiliations. Xiaoyuan Gao1 Kishor Kumar Sadasivuni1 Hyun-Chan Kim1 Seung-Ki Min1 Jaehwan Kim1. Center for EAPap Actuator, Dept. of Mechanical Engineering, Inha University, 253 Yonghyun-Dong, Nam-Ku, Incheon 402-751, South Korea ...

  15. The Predictive Degree of University Students' Levels of Metacognition and Need for Cognition on Their Academic Achievement

    Science.gov (United States)

    Akpur, Ugur

    2017-01-01

    The purpose of this study is to find out the predictive degree of university students' levels of need for cognition and metacognition on their academic achievement. A total of 253 university students formed the study group. To collect the data of the study, "The Metacognition Awareness Inventory" (MAI) and "The Need for Cognition…

  16. An analysis of patients transported by a private helicopter ...

    African Journals Online (AJOL)

    Bay, the reverse was found, interfacility transfers making up the majority of the cases attended to: of a total of 1 418 flights,. 1 253 (88.4%) were interfacility transfers and only 165 (11.6%) primary responses. [7]. Many international studies have focused on either primary transfers or interfacility transfers, and there have been ...

  17. Mukhopadhyay, Prof. Dhrubajyoti

    Indian Academy of Sciences (India)

    Date of birth: 19 September 1938. Specialization: Structural Geology, Precambrian Geology Address: G-7, MIG Housing Colony, 25/3, Raja Manindra Road, Kolkata 700 037, W.B.. Contact: Residence: (033) 2556 8099. Mobile: 94330 92581. Email: dhruba_38@yahoo.co.uk. YouTube; Twitter; Facebook; Blog ...

  18. Optimism and Psychological Resilience in Relation to Depressive Symptoms in University Students: Examining the Mediating Role of Self-Esteem

    Science.gov (United States)

    Kapikiran, Sahin; Acun-Kapikiran, Necla

    2016-01-01

    This study examined the role of self-esteem as a mediator in the relationships between optimism and psychological resilience on depressive symptoms in university students. A total of 494 undergraduate students, comprising of 253 female and 241 male participated in this study. Participants' ages ranged from 18 to 30 (M = 20.85, SD = 1.57).…

  19. Effect of Sports Club Activities on the Physique and Physical Fitness of Young Japanese Males

    Science.gov (United States)

    Noguchi, Takanori; Demura, Shin-ichi; Shimada, Shigeru; Kobayashi, Hidetsugu; Yamaji, Shunsuke; Yamada, Takayoshi

    2013-01-01

    This study compared the growth and development of the physique and physical fitness of young Japanese males who belong to sports clubs and those who did not based on longitudinal data obtained over four years. Physique and physical fitness tests were administered to 253 healthy male technical college students four times from the 9 to 12 grade.…

  20. 19 CFR 10.252 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Definitions. 10.252 Section 10.252 Customs Duties... ATPDEA beneficiary country, of which the manager or managers, chairman of the board of directors or of... duty and free of any quantitative restrictions in the case of tuna described in § 10.253(a)(1) and free...

  1. xv ORIGINAL ARTICLE

    African Journals Online (AJOL)

    Dr Oboro VO

    natural trypanosomiasis remains economically importance in cattle, goats and sheep in Nigeria. Key words: Animal ..... dairy goats. Rev. Vet. Sci. 39:252-253. 11. Whitelaw, D.D; Kaaya, G.P;. Moulton, J.E; Moloo, S.K;. Murrary, M. (1985). Susceptibility of different breeds of goats in Kenya to experimental infections.

  2. Valence and inner-valence shell dissociative photoionization of CO in the 26-33 eV range. II. Molecular-frame and recoil-frame photoelectron angular distributions

    DEFF Research Database (Denmark)

    Lebech, M.; Houver, J.C.; Raseev, G.

    2012-01-01

    V, and 32.5 eV. A comparison of experimental and theoretical RFPADs allows us to identify the ionic states detected in the experimental studies. In addition to previously identified states, we found evidence for the 2 (2)Delta state with an ionization potential of 25.3 eV and (2)Sigma(+) states...

  3. The Relationship Between Life Course Factors, Parental ...

    African Journals Online (AJOL)

    RESULTS: Out of the 324 adolescents who completed the questionnaire, 25.3% reported visiting a dentist within a period of one year. Childhood dental visit, childhood dental experience, housing, internal and external locus of control and self-efficacy were significantly associated with recent dental visit (p<0.05). Participants ...

  4. The achievement of glycaemic, blood pressure and LDL cholesterol ...

    African Journals Online (AJOL)

    Women represented. 55% (n = 143/261) of the cohort and the mean duration of diabetes for the population was approximately 16 years in 2013. The study population consisted of the following patient ethnicities: African. (42.9%), Caucasian (25.3%), Indians/Asian (26.1%) and Mixed. Ancestry (5.7%). Glucose management.

  5. Aiding and Abetting: The Responsibility of Business Leaders under the Rome Statute of the International Criminal Court

    Directory of Open Access Journals (Sweden)

    Caspar Plomp

    2014-08-01

    Full Text Available While no business leaders have yet been charged before the International Criminal Court (ICC, such future proceedings will typically be conducted with reference to the accessorial mode of liability of aiding and abetting, under Article 25(3(c of the Rome Statute of the ICC. There exist diverse and competing interpretations of Article 25(3(c. This paper aims to advocate the creation of a dominant interpretation of Article 25(3(c and, consequently, to the clarification of the potential responsibility of business leaders who aid or abet crimes under the jurisdiction of the Rome Statute, in two ways. First, it asks whether Article 25(3(c can be interpreted in harmony with the dominant practice on aiding and abetting in international criminal law generally. Second, it presents a case study on the provision of arms by the Russian corporation Rosoboronexport to the Syrian government, which is likely to have committed crimes against humanity since March 2011 and war crimes since mid-2012. The theoretical conclusions are applied to a discussion on the potential criminal responsibility of the Director General of Rosoboronexport for aiding and abetting the commission of international crimes by high-level Syrian officials.

  6. Defining the role of common variation in the genomic and biological architecture of adult human height

    NARCIS (Netherlands)

    Wood, Andrew R.; Esko, Tonu; Yang, Jian; Vedantam, Sailaja; Pers, Tune H.; Gustafsson, Stefan; Chu, Audrey Y.; Estrada, Karol; Luan, Jian'an; Kutalik, Zoltán; Amin, Najaf; Buchkovich, Martin L.; Croteau-Chonka, Damien C.; Day, Felix R.; Duan, Yanan; Fall, Tove; Fehrmann, Rudolf; Ferreira, Teresa; Jackson, Anne U.; Karjalainen, Juha; Lo, Ken Sin; Locke, Adam E.; Mägi, Reedik; Mihailov, Evelin; Porcu, Eleonora; Randall, Joshua C.; Scherag, André; Vinkhuyzen, Anna A. E.; Westra, Harm-Jan; Winkler, Thomas W.; Workalemahu, Tsegaselassie; Zhao, Jing Hua; Absher, Devin; Albrecht, Eva; Anderson, Denise; Baron, Jeffrey; Beekman, Marian; Demirkan, Ayse; Ehret, Georg B.; Feenstra, Bjarke; Feitosa, Mary F.; Fischer, Krista; Fraser, Ross M.; Goel, Anuj; Gong, Jian; Justice, Anne E.; Kanoni, Stavroula; Kleber, Marcus E.; Kristiansson, Kati; Lim, Unhee; Lotay, Vaneet; Lui, Julian C.; Mangino, Massimo; Mateo Leach, Irene; Medina-Gomez, Carolina; Nalls, Michael A.; Nyholt, Dale R.; Palmer, Cameron D.; Pasko, Dorota; Pechlivanis, Sonali; Prokopenko, Inga; Ried, Janina S.; Ripke, Stephan; Shungin, Dmitry; Stancáková, Alena; Strawbridge, Rona J.; Sung, Yun Ju; Tanaka, Toshiko; Teumer, Alexander; Trompet, Stella; van der Laan, Sander W.; van Setten, Jessica; van Vliet-Ostaptchouk, Jana V.; Wang, Zhaoming; Yengo, Loïc; Zhang, Weihua; Afzal, Uzma; Arnlöv, Johan; Arscott, Gillian M.; Bandinelli, Stefania; Barrett, Amy; Bellis, Claire; Bennett, Amanda J.; Berne, Christian; Blüher, Matthias; Bolton, Jennifer L.; Böttcher, Yvonne; Boyd, Heather A.; Bruinenberg, Marcel; Buckley, Brendan M.; Buyske, Steven; Caspersen, Ida H.; Chines, Peter S.; Clarke, Robert; Claudi-Boehm, Simone; Cooper, Matthew; Daw, E. Warwick; de Jong, Pim A.; Deelen, Joris; Delgado, Graciela; Denny, Josh C.; Dhonukshe-Rutten, Rosalie; Dimitriou, Maria; Doney, Alex S. F.; Dörr, Marcus; Eklund, Niina; Eury, Elodie; Folkersen, Lasse; Garcia, Melissa E.; Geller, Frank; Giedraitis, Vilmantas; Go, Alan S.; Grallert, Harald; Grammer, Tanja B.; Gräßler, Jürgen; Grönberg, Henrik; de Groot, Lisette C. P. G. M.; Groves, Christopher J.; Haessler, Jeffrey; Hall, Per; Haller, Toomas; Hallmans, Goran; Hannemann, Anke; Hartman, Catharina A.; Hassinen, Maija; Hayward, Caroline; Heard-Costa, Nancy L.; Helmer, Quinta; Hemani, Gibran; Henders, Anjali K.; Hillege, Hans L.; Hlatky, Mark A.; Hoffmann, Wolfgang; Hoffmann, Per; Holmen, Oddgeir; Houwing-Duistermaat, Jeanine J.; Illig, Thomas; Isaacs, Aaron; James, Alan L.; Jeff, Janina; Johansen, Berit; Johansson, Åsa; Jolley, Jennifer; Juliusdottir, Thorhildur; Junttila, Juhani; Kho, Abel N.; Kinnunen, Leena; Klopp, Norman; Kocher, Thomas; Kratzer, Wolfgang; Lichtner, Peter; Lind, Lars; Lindström, Jaana; Lobbens, Stéphane; Lorentzon, Mattias; Lu, Yingchang; Lyssenko, Valeriya; Magnusson, Patrik K. E.; Mahajan, Anubha; Maillard, Marc; McArdle, Wendy L.; McKenzie, Colin A.; McLachlan, Stela; McLaren, Paul J.; Menni, Cristina; Merger, Sigrun; Milani, Lili; Moayyeri, Alireza; Monda, Keri L.; Morken, Mario A.; Müller, Gabriele; Müller-Nurasyid, Martina; Musk, Arthur W.; Narisu, Narisu; Nauck, Matthias; Nolte, Ilja M.; Nöthen, Markus M.; Oozageer, Laticia; Pilz, Stefan; Rayner, Nigel W.; Renstrom, Frida; Robertson, Neil R.; Rose, Lynda M.; Roussel, Ronan; Sanna, Serena; Scharnagl, Hubert; Scholtens, Salome; Schumacher, Fredrick R.; Schunkert, Heribert; Scott, Robert A.; Sehmi, Joban; Seufferlein, Thomas; Shi, Jianxin; Silventoinen, Karri; Smit, Johannes H.; Smith, Albert Vernon; Smolonska, Joanna; Stanton, Alice V.; Stirrups, Kathleen; Stott, David J.; Stringham, Heather M.; Sundström, Johan; Swertz, Morris A.; Syvänen, Ann-Christine; Tayo, Bamidele O.; Thorleifsson, Gudmar; Tyrer, Jonathan P.; van Dijk, Suzanne; van Schoor, Natasja M.; van der Velde, Nathalie; van Heemst, Diana; van Oort, Floor V. A.; Vermeulen, Sita H.; Verweij, Niek; Vonk, Judith M.; Waite, Lindsay L.; Waldenberger, Melanie; Wennauer, Roman; Wilkens, Lynne R.; Willenborg, Christina; Wilsgaard, Tom; Wojczynski, Mary K.; Wong, Andrew; Wright, Alan F.; Zhang, Qunyuan; Arveiler, Dominique; Bakker, Stephan J. L.; Beilby, John; Bergman, Richard N.; Bergmann, Sven; Biffar, Reiner; Blangero, John; Boomsma, Dorret I.; Bornstein, Stefan R.; Bovet, Pascal; Brambilla, Paolo; Brown, Morris J.; Campbell, Harry; Caulfield, Mark J.; Chakravarti, Aravinda; Collins, Rory; Collins, Francis S.; Crawford, Dana C.; Cupples, L. Adrienne; Danesh, John; de Faire, Ulf; den Ruijter, Hester M.; Erbel, Raimund; Erdmann, Jeanette; Eriksson, Johan G.; Farrall, Martin; Ferrannini, Ele; Ferrières, Jean; Ford, Ian; Forouhi, Nita G.; Forrester, Terrence; Gansevoort, Ron T.; Gejman, Pablo V.; Gieger, Christian; Golay, Alain; Gottesman, Omri; Gudnason, Vilmundur; Gyllensten, Ulf; Haas, David W.; Hall, Alistair S.; Harris, Tamara B.; Hattersley, Andrew T.; Heath, Andrew C.; Hengstenberg, Christian; Hicks, Andrew A.; Hindorff, Lucia A.; Hingorani, Aroon D.; Hofman, Albert; Hovingh, G. Kees; Humphries, Steve E.; Hunt, Steven C.; Hypponen, Elina; Jacobs, Kevin B.; Jarvelin, Marjo-Riitta; Jousilahti, Pekka; Jula, Antti M.; Kaprio, Jaakko; Kastelein, John J. P.; Kayser, Manfred; Kee, Frank; Keinanen-Kiukaanniemi, Sirkka M.; Kiemeney, Lambertus A.; Kooner, Jaspal S.; Kooperberg, Charles; Koskinen, Seppo; Kovacs, Peter; Kraja, Aldi T.; Kumari, Meena; Kuusisto, Johanna; Lakka, Timo A.; Langenberg, Claudia; Le Marchand, Loic; Lehtimäki, Terho; Lupoli, Sara; Madden, Pamela A. F.; Männistö, Satu; Manunta, Paolo; Marette, André; Matise, Tara C.; McKnight, Barbara; Meitinger, Thomas; Moll, Frans L.; Montgomery, Grant W.; Morris, Andrew D.; Morris, Andrew P.; Murray, Jeffrey C.; Nelis, Mari; Ohlsson, Claes; Oldehinkel, Albertine J.; Ong, Ken K.; Ouwehand, Willem H.; Pasterkamp, Gerard; Peters, Annette; Pramstaller, Peter P.; Price, Jackie F.; Qi, Lu; Raitakari, Olli T.; Rankinen, Tuomo; Rao, D. C.; Rice, Treva K.; Ritchie, Marylyn; Rudan, Igor; Salomaa, Veikko; Samani, Nilesh J.; Saramies, Jouko; Sarzynski, Mark A.; Schwarz, Peter E. H.; Sebert, Sylvain; Sever, Peter; Shuldiner, Alan R.; Sinisalo, Juha; Steinthorsdottir, Valgerdur; Stolk, Ronald P.; Tardif, Jean-Claude; Tönjes, Anke; Tremblay, Angelo; Tremoli, Elena; Virtamo, Jarmo; Vohl, Marie-Claude; Amouyel, Philippe; Asselbergs, Folkert W.; Assimes, Themistocles L.; Bochud, Murielle; Boehm, Bernhard O.; Boerwinkle, Eric; Bottinger, Erwin P.; Bouchard, Claude; Cauchi, Stéphane; Chambers, John C.; Chanock, Stephen J.; Cooper, Richard S.; de Bakker, Paul I. W.; Dedoussis, George; Ferrucci, Luigi; Franks, Paul W.; Froguel, Philippe; Groop, Leif C.; Haiman, Christopher A.; Hamsten, Anders; Hayes, M. Geoffrey; Hui, Jennie; Hunter, David J.; Hveem, Kristian; Jukema, J. Wouter; Kaplan, Robert C.; Kivimaki, Mika; Kuh, Diana; Laakso, Markku; Liu, Yongmei; Martin, Nicholas G.; März, Winfried; Melbye, Mads; Moebus, Susanne; Munroe, Patricia B.; Njølstad, Inger; Oostra, Ben A.; Palmer, Colin N. A.; Pedersen, Nancy L.; Perola, Markus; Pérusse, Louis; Peters, Ulrike; Powell, Joseph E.; Power, Chris; Quertermous, Thomas; Rauramaa, Rainer; Reinmaa, Eva; Ridker, Paul M.; Rivadeneira, Fernando; Rotter, Jerome I.; Saaristo, Timo E.; Saleheen, Danish; Schlessinger, David; Slagboom, P. Eline; Snieder, Harold; Spector, Tim D.; Strauch, Konstantin; Stumvoll, Michael; Tuomilehto, Jaakko; Uusitupa, Matti; van der Harst, Pim; Völzke, Henry; Walker, Mark; Wareham, Nicholas J.; Watkins, Hugh; Wichmann, H.-Erich; Wilson, James F.; Zanen, Pieter; Deloukas, Panos; Heid, Iris M.; Lindgren, Cecilia M.; Mohlke, Karen L.; Speliotes, Elizabeth K.; Thorsteinsdottir, Unnur; Barroso, Inês; Fox, Caroline S.; North, Kari E.; Strachan, David P.; Beckmann, Jacques S.; Berndt, Sonja I.; Boehnke, Michael; Borecki, Ingrid B.; McCarthy, Mark I.; Metspalu, Andres; Stefansson, Kari; Uitterlinden, André G.; van Duijn, Cornelia M.; Franke, Lude; Willer, Cristen J.; Price, Alkes L.; Lettre, Guillaume; Loos, Ruth J. F.; Weedon, Michael N.; Ingelsson, Erik; O'Connell, Jeffrey R.; Abecasis, Goncalo R.; Chasman, Daniel I.; Goddard, Michael E.; Visscher, Peter M.; Hirschhorn, Joel N.; Frayling, Timothy M.; McCarty, Catherine A.; Starren, Justin; Peissig, Peggy; Berg, Richard; Rasmussen, Luke; Linneman, James; Miller, Aaron; Choudary, Vidhu; Chen, Lin; Waudby, Carol; Kitchner, Terrie; Reeser, Jonathan; Fost, Norman; Wilke, Russell A.; Chisholm, Rex L.; Avila, Pedro C.; Greenland, Philip; Hayes, M. Geoff; Kho, Abel; Kibbe, Warren A.; Lemke, Amy A.; Lowe, William L.; Smith, Maureen E.; Wolf, Wendy A.; Pacheco, Jennifer A.; Thompson, William K.; Humowiecki, Joel; Law, May; Chute, Christopher; Kullo, Iftikar; Koenig, Barbara; de Andrade, Mariza; Bielinski, Suzette; Pathak, Jyotishman; Savova, Guergana; Wu, Joel; Henriksen, Joan; Ding, Keyue; Hart, Lacey; Palbicki, Jeremy; Larson, Eric B.; Newton, Katherine; Ludman, Evette; Spangler, Leslie; Hart, Gene; Carrell, David; Jarvik, Gail; Crane, Paul; Burke, Wylie; Fullerton, Stephanie Malia; Trinidad, Susan Brown; Carlson, Chris; Hutchinson, Fred; McDavid, Andrew; Roden, Dan M.; Clayton, Ellen; Haines, Jonathan L.; Masys, Daniel R.; Churchill, Larry R.; Cornfield, Daniel; Crawford, Dana; Darbar, Dawood; Denny, Joshua C.; Malin, Bradley A.; Ritchie, Marylyn D.; Schildcrout, Jonathan S.; Xu, Hua; Ramirez, Andrea Havens; Basford, Melissa; Pulley, Jill; Alizadeh, Behrooz Z.; de Boer, Rudolf A.; Boezen, H. Marike; van der Klauw, Melanie M.; Navis, Gerjan; Ormel, Johan; Postma, Dirkje S.; Rosmalen, Judith G. M.; Slaets, Joris P.; Wolffenbuttel, Bruce H. R.; Wijmenga, Cisca; Kathiresan, Sekar; Voight, Benjamin F.; Purcell, Shaun; Musunuru, Kiran; Ardissino, Diego; Mannucci, Pier M.; Anand, Sonia; Engert, James C.; Reilly, Muredach P.; Rader, Daniel J.; Morgan, Thomas; Spertus, John A.; Stoll, Monika; Girelli, Domenico; McKeown, Pascal P.; Patterson, Chris C.; Siscovick, David S.; O'Donnell, Christopher J.; Elosua, Roberto; Peltonen, Leena; Schwartz, Stephen M.; Melander, Olle; Altshuler, David; Merlini, Pier Angelica; Berzuini, Carlo; Bernardinelli, Luisa; Peyvandi, Flora; Tubaro, Marco; Celli, Patrizia; Ferrario, Maurizio; Fetiveau, Raffaela; Marziliano, Nicola; Casari, Giorgio; Galli, Michele; Ribichini, Flavio; Rossi, Marco; Bernardi, Francesco; Zonzin, Pietro; Piazza, Alberto; Yee, Jean; Friedlander, Yechiel; Marrugat, Jaume; Lucas, Gavin; Subirana, Isaac; Sala, Joan; Ramos, Rafael; Meigs, James B.; Williams, Gordon; Nathan, David M.; MacRae, Calum A.; Havulinna, Aki S.; Berglund, Goran; Asselta, Rosanna; Duga, Stefano; Spreafico, Marta; Daly, Mark J.; Nemesh, James; Korn, Joshua M.; McCarroll, Steven A.; Surti, Aarti; Guiducci, Candace; Gianniny, Lauren; Mirel, Daniel; Parkin, Melissa; Burtt, Noel; Gabriel, Stacey B.; Thompson, John R.; Braund, Peter S.; Wright, Benjamin J.; Balmforth, Anthony J.; Ball, Stephen G.; Schunkert, I. Heribert; Linsel-Nitschke, Patrick; Lieb, Wolfgang; Ziegler, Andreas; König, Inke R.; Fischer, Marcus; Stark, Klaus; Grosshennig, Anika; Preuss, Michael; Schreiber, Stefan; Ouwehand, Willem; Scholz, Michael; Cambien, Francois; Goodall, Alison; Li, Mingyao; Chen, Zhen; Wilensky, Robert; Matthai, William; Qasim, Atif; Hakonarson, Hakon H.; Devaney, Joe; Burnett, Mary-Susan; Pichard, Augusto D.; Kent, Kenneth M.; Satler, Lowell; Lindsay, Joseph M.; Waksman, Ron; Knouff, Christopher W.; Waterworth, Dawn M.; Walker, Max C.; Mooser, Vincent; Epstein, Stephen E.; Scheffold, Thomas; Berger, Klaus; Huge, Andreas; Martinelli, Nicola; Olivieri, Oliviero; Corrocher, Roberto; Hólm, Hilma; Do, Ron; Xie, Changchun; Siscovick, David; Matise, Tara; Buyske, Steve; Higashio, Julia; Williams, Rasheeda; Nato, Andrew; Ambite, Jose Luis; Deelman, Ewa; Manolio, Teri; Hindorff, Lucia; Heiss, Gerardo; Taylor, Kira; Franceschini, Nora; Avery, Christy; Graff, Misa; Lin, Danyu; Quibrera, Miguel; Cochran, Barbara; Kao, Linda; Umans, Jason; Cole, Shelley; MacCluer, Jean; Person, Sharina; Pankow, James; Gross, Myron; Fornage, Myriam; Durda, Peter; Jenny, Nancy; Patsy, Bruce; Arnold, Alice; Buzkova, Petra; Haines, Jonathan; Murdock, Deborah; Glenn, Kim; Brown-Gentry, Kristin; Thornton-Wells, Tricia; Dumitrescu, Logan; Bush, William S.; Mitchell, Sabrina L.; Goodloe, Robert; Wilson, Sarah; Boston, Jonathan; Malinowski, Jennifer; Restrepo, Nicole; Oetjens, Matthew; Fowke, Jay; Zheng, Wei; Spencer, Kylee; Pendergrass, Sarah; Le Marchand, Loïc; Wilkens, Lynne; Park, Lani; Tiirikainen, Maarit; Kolonel, Laurence; Cheng, Iona; Wang, Hansong; Shohet, Ralph; Haiman, Christopher; Stram, Daniel; Henderson, Brian; Monroe, Kristine; Schumacher, Fredrick; Anderson, Garnet; Prentice, Ross; LaCroix, Andrea; Wu, Chunyuan; Carty, Cara; Rosse, Stephanie; Young, Alicia; Haessler, Jeff; Kocarnik, Jonathan; Lin, Yi; Jackson, Rebecca; Duggan, David; Kuller, Lew

    2014-01-01

    Using genome-wide data from 253,288 individuals, we identified 697 variants at genome-wide significance that together explained one-fifth of the heritability for adult height. By testing different numbers of variants in independent studies, we show that the most strongly associated ∼2,000, ∼3,700

  7. El espíritu de Dostoyevski. [Reseña

    OpenAIRE

    García-Cuadrado, J.A. (José Ángel)

    2010-01-01

    Reseña de Nikolay BERDIAEV, El espíritu de Dostoyevski, traducción Olga Trankova Tabatadze; prólogo Artur Mrówczynski-Van Allen, Publicaciones del Centro Internacional para el Estudio del Oriente Cristiano, Granada: Editorial Nuevo Inicio, 2008, 253 pp., 15,5 x 21,5, ISBN 978-84-936102-1-0.

  8. Dentofacial injuries in commercial motorcycle accidents in Cameroon

    African Journals Online (AJOL)

    Dentofacial injuries in commercial motorcycle accidents in Cameroon: Pattern and cost implication of care. ... Soft tissue injuries were most frequent (91.2%) followed by trauma to the teeth (83.5%), of which 62.3% were tooth loss. Mandibular fracture was commoner than maxillary fracture; (45% versus 25.3%). A total of ...

  9. Suppression of Innate Immune Response by Primary Human Keratinocytes Expressing HPV-16 E6 and E7

    Science.gov (United States)

    2005-01-01

    its role against infections. Annals of Allergy, Asthma , & Immunology 88:253-64. 105. Viac, J., I. Guerin-Reverchon, Y. Chardonnet, and A. Bremond...S. Murakami. 2002. IL-15 up-regulates iNOS expression and NO production by gingival epithelial cells. Biochemical & Biophysical Research

  10. Double Ramp Loss Based Reject Option Classifier

    Science.gov (United States)

    2015-05-22

    Dataset Description We report experimental results on 1 synthetic datasets and 2 datasets taken from UCI ML repository [2]. 1. Synthetic Dataset...constrained indefinite quadratic problems by d.c. algorithms. Journal of Global Optimization 11, 253–285 (1997) 2. Bache, K., Lichman, M.: UCI machine

  11. Association of ADAM33 gene polymorphisms with adult-onset ...

    Indian Academy of Sciences (India)

    The study included 175 patients with mild intermittent ( n = 44 ), mild persistent ( n = 108 ) or moderate persistent ( n = 23 ) subgroups of asthma, and 253 nonasthmatic control individuals. SNPs were genotyped with the help of restriction fragment length polymorphism polymerase chain reaction (RFLP-PCR) method, and ...

  12. Physiological changes during the ovarian cycle of the female rock ...

    African Journals Online (AJOL)

    styg drasties na ovulasie en bly net hoog totdat die eiers gelll word. Die begin van die tweede dooierneerleggingsiklus. (Desember) geskied in die teenwoordigheid van ho~ plasma- progesteroonvlakke. S.-Afr. Tydskr. Dierk. 1984, 19: 253 - 260. J.H. YaD Wyk. Present address: Department of Herpetology, National Museum.

  13. Gclust Server: 20655 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available 20655 YelB_CYB_1782 Cluster Sequences Related Sequences(27) 253 conserved hypotheti...cal protein 5 1.00e-50 0.0 0.0 8.0 6.67 6.45 0.0 Show 20655 Cluster ID 20655 Sequence ID YelB_CYB_1782 Link

  14. Immediate skin and mucosal symptoms from pot plants and vegetables in gardeners and greenhouse workers

    DEFF Research Database (Denmark)

    Paulsen, E; Skov, Per Stahl; Andersen, Klaus Ejner

    1998-01-01

    Short-lived occupational skin symptoms of irritant or urticarial nature were commonly reported among 253 attendants in a clinical study on occupational dermatitis in Danish gardeners and greenhouse workers. Aimed prick or scratch-patch testing for immediate skin and mucosal symptoms was performed...

  15. BANip: Enabling Remote Healthcare Monitoring with Body Area Networks

    NARCIS (Netherlands)

    Dokovski, N.T.; van Halteren, Aart; Widya, I.A.; Guelfi, Nicolas; Astesiano, Egidio; Reggio, Gianna

    2004-01-01

    This paper presents a Java service platform for mobile healthcare that enables remote health monitoring using 2.5/3G public wireless networks. The platform complies with todayrsquos healthcare delivery models, in particular it incorporates some functionality of a healthcare call center, a

  16. Genome-wide association analysis identifies six new loci associated with forced vital capacity

    NARCIS (Netherlands)

    D.W. Loth (Daan); M.S. Artigas; S.A. Gharib (Sina); L.V. Wain (Louise); N. Franceschini (Nora); B. Koch (Beate); T.D. Pottinger (Tess); G.D. Smith; Q. Duan (Qing); C. Oldmeadow (Christopher); M.K. Lee (Mi Kyeong); D.P. Strachan (David); A.L. James (Alan); J.E. Huffman (Jennifer); V. Vitart (Veronique); A. Ramasamy (Adaikalavan); N.J. Wareham (Nick); J. Kaprio (Jaakko); X.-Q. Wang (Xin-Qun); H. Trochet (Holly); M. Kähönen (Mika); C. Flexeder (Claudia); E. Albrecht (Eva); L.M. Lopez (Lorna); B. Thyagarajan (Bharat); A.C. Alves (Alexessander Couto); S. Enroth (Stefan); E. Omenaas (Ernst); P.K. Joshi (Peter); M. Fall (Magnus); A. Viñuela (Ana); L.J. Launer (Lenore); L.R. Loehr (Laura); M. Fornage (Myriam); G. Li (Guo); J.B. Wilk (Jemma); W. Tang (Wenbo); A. Manichaikul (Ani); L. Lahousse (Lies); T.B. Harris (Tamara); K.E. North (Kari); A.R. Rudnicka (Alicja); J. Hui (Jennie); X. Gu (Xiangjun); T. Lumley (Thomas); A.F. Wright (Alan); N. Hastie (Nick); S. Campbell (Susan); R. Kumar (Rajesh); I. Pin (Isabelle); R.A. Scott (Robert); K.H. Pietilainen (Kirsi Hannele); I. Surakka (Ida); Y. Liu (Yongmei); E.G. Holliday (Elizabeth); H. Schulz (Holger); J. Heinrich (Joachim); G. Davies (Gail); J.M. Vonk (Judith); M.K. Wojczynski (Mary ); A. Pouta (Anneli); A. Johansson (Åsa); S.H. Wild (Sarah); E. Ingelsson (Erik); F. Rivadeneira Ramirez (Fernando); H. Völzke (Henry); P.G. Hysi (Pirro); G. Eiriksdottir (Gudny); A.C. Morrison (Alanna); J.I. Rotter (Jerome); W. Gao (Wei); D.S. Postma (Dirkje); W.B. White (Wendy); S.S. Rich (Stephen); A. Hofman (Albert); T. Aspelund (Thor); D. Couper (David); L.J. Smith (Lewis); B.M. Psaty (Bruce); K. Lohman (Kurt); E.G. Burchard (Esteban); A.G. Uitterlinden (André); M. Garcia (Melissa); B.R. Joubert (Bonnie); W.L. McArdle (Wendy); A.W. Musk (Arthur); C.R.W. Hansel (Christian); S.R. Heckbert (Susan); L. Zgaga (Lina); J.B.J. van Meurs (Joyce); P. Navarro (Pau); I. Rudan (Igor); Y.-M. Oh (Yeon-Mok); S. Redline (Susan); D.L. Jarvis (Deborah); J.H. Zhao (Jing Hua); T. Rantanen (Taina); G.T. O'Connor (George); S. Ripatti (Samuli); R.J. Scott (Rodney); S. Karrasch (Stefan); H. Grallert (Harald); N.C. Gaddis (Nathan); J.M. Starr (John); C. Wijmenga (Cisca); R.L. Minster (Ryan); C.W. Lederer (Carsten); J. Pekkanen (Juha); U. Gyllensten (Ulf); H. Campbell (Harry); A.P. Morris (Andrew); S. Gläser (Sven); C.J. Hammond (Christopher); K.M. Burkart (Kristin); J.P. Beilby (John); S.B. Kritchevsky (Stephen); V. Gudnason (Vilmundur); D.B. Hancock (Dana); O.D. Williams (Dale); O. Polasek (Ozren); T. Zemunik (Tatijana); I. Kolcic (Ivana); M.F. Petrini (Marcy); K.T. de Jong (Kim); M. Wjst (Matthias); W.H. Kim (Woo); D.J. Porteous (David J.); G. Scotland (Generation); B.H. Smith (Blair); A. Viljanen (Anne); M. Heliovaara (Markku); J. Attia (John); I. Sayers (Ian); R. Hampel (Regina); C. Gieger (Christian); I.J. Deary (Ian); H.M. Boezen (Marike); A.B. Newman (Anne); M.-R. Jarvelin (Marjo-Riitta); J.F. Wilson (James); L. Lind (Lars); B.H.Ch. Stricker (Bruno); A. Teumer (Alexander); T.D. Spector (Timothy); E. Melén (Erik); M.J. Peters (Marjolein); L.A. Lange (Leslie); R.G. Barr (Graham); K.R. Bracke (Ken); F.M. Verhamme (Fien); J. Sung (Joohon); P.S. Hiemstra (Pieter); P.A. Cassano (Patricia); A. Sood (Akshay); C. Hayward (Caroline); J. Dupuis (Josée); I.P. Hall (Ian); G.G. Brusselle (Guy); M.D. Tobin (Martin); S.J. London (Stephanie)

    2014-01-01

    textabstractForced vital capacity (FVC), a spirometric measure of pulmonary function, reflects lung volume and is used to diagnose and monitor lung diseases. We performed genome-wide association study meta-analysis of FVC in 52,253 individuals from 26 studies and followed up the top associations in

  17. TrgI, toluene repressed gene I, a novel gene involved in toluene-tolerance in Pseudomonas putida S12

    NARCIS (Netherlands)

    Volkers, R.J.M.; Ballerstedt, H.; Ruijssenaars, H.; De Bont, J.A.M.; De Winde, J.H.; Wery, J.

    2008-01-01

    Pseudomonas putida S12 is well known for its remarkable solvent tolerance. Transcriptomics analysis of this bacterium grown in toluene-containing chemostats revealed the differential expression of 253 genes. As expected, the genes encoding one of the major solvent tolerance mechanisms, the solvent

  18. TrgI, toluene repressed gene I, a novel gene involved in toluene-tolerance in Pseudomonas putida S12

    NARCIS (Netherlands)

    Volkers, R.J.M.; Ballerstedt, H.; Ruijssenaars, H.; Bont, J.A.M. de; Winde, J.H. de; Wery, J.

    2009-01-01

    Pseudomonas putida S12 is well known for its remarkable solvent tolerance. Transcriptomics analysis of this bacterium grown in toluene-containing chemostats revealed the differential expression of 253 genes. As expected, the genes encoding one of the major solvent tolerance mechanisms, the solvent

  19. Short Communication

    African Journals Online (AJOL)

    Mean separation was accomplished using the PDIFF option of the LSMEANS statement. Intake of CF and LCF were compared using a paired T-test in SAS. For cost of gain calculations, 0.253, 0.286, and 0.132 US dollars per kg of feed were assumed for CF, LCF, and SS, respectively. Cost of gain was calculated as the.

  20. Temporal and spatial variations in particulate matter, particulate organic carbon and attenuation coefficient in Cochin Backwaters

    Digital Repository Service at National Institute of Oceanography (India)

    Devi, K.S.

    Nine stations over a stretch of 21 km of Periyar river estuary were sampled during January to December 1981. Particulate matter varied from 3-253 mg.1 super(1) at the surface and 24.8-257mg.1 super(1) at the bottom. Particulate organic carbon ranged...