WorldWideScience

Sample records for californium 253

  1. Metabolism and toxicity of californium

    International Nuclear Information System (INIS)

    Metabolism of californium can be compared with that of other transplutonium elements. The most important points are as follows: a fast blood clearance and fast bone uptake more important than liver uptake, a relatively high urinary excretion and kidney retention. Blood clearance of californium can be compared with that of americium. Distribution of californium 252 nitrate after intramuscular injection in rats was studied. There are very few experimental data on acute or long term toxicity of californium. (28 references)

  2. Magnetism in californium

    International Nuclear Information System (INIS)

    A SQUID-based magnetic susceptometer has been constructed for studying small radioactive samples at temperatures below 350 K and in magnetic fields up to 50 kilogauss. The device has been used to study californium (element 98) in a number of solid-state forms: the dhcp metal, several oxides (Cf2O3 in both the bcc and monoclinic structures, Cf7O12, CfO2 and BaCfO3), several monopnictides (CfN, CfAs and CfSb) and the trichloride (in both the hexagonal and orthorhombic structures). All of these materials were studied in polycrystalline form, and hexagonal CfCl3 was studied in single-crystal form as well. The susceptometer has the sensitivity to measure samples containing less than 10 micrograms of californium. The magnetic susceptibilities of all of the californium materials at temperatures above about 100 K are described well by the Curie-Weiss relationship. This behavior is consistent with the assumption that the magnetic 5f electrons are localized and that the paramagnetic behavior can be interpreted in terms of the properties of the free ion. The measured values of the effective paramagnetic moment, μ/sub eff/, for all the californium materials that were studied are reasonably consistent with theoretical values based on intermediate coupling models. All of the californium materials showed some indications of cooperative magnetic effects. The dhcp metal was observed to order ferromagnetically at 52 K, and all of the californium compounds studied showed signs of antiferromagnetic ordering, mostly at temperatures below 25 K. 91 refs., 50 figs., 19 tabs

  3. Californium Multiplier (CFX)

    International Nuclear Information System (INIS)

    The availability of 252Cf as an economical high-intensity neutron source has made it possible to construct compact neutron irradiation devices with widespread applications. The simplest such device consists of a single 252Cf source within a moderating and shielding medium. Higher neutron flux levels can be attained either through the use of more 252Cf or through source multiplication by means of a subcritical uranium assembly. Although the use of larger 252Cf sources to achieve higher neutron flux is technically straightforward, an economic penalty is paid as the source strength is increased. Larger californium sources imply larger initial investments to cover the cost of source material and larger operating costs resulting from the decay of the 252Cf source. A Californium Multiplier, the CFX, which produces a flux enhancement of 30 when compared to a conventional moderated 252Cf system has been designed, licensed, built, and tested by IRT Corporation. Such systems are now available on a commercial basis for both neutron radiography and neutron activation analysis. The first commercial CFX system was installed at the Research Laboratories of Eastman Kodak Company in Rochester, NY, in March 1975. This device, using 1 mg of 252Cf, is very stable and the neutron flux generated by the CFX is very reproducible. The performance characteristics of this system are summarized

  4. Californium--palladium metal neutron source material

    Science.gov (United States)

    Dahlen, B.L.; Mosly, W.C. Jr.; Smith, P.K.; Albenesius, E.L.

    1974-01-22

    Californium, as metal or oxide, is uniformly dispersed throughout a noble metal matrix, provided in compact, rod or wire form. A solution of californium values is added to palladium metal powder, dried, blended and pressed into a compact having a uni-form distribution of californium. The californium values are decomposed to californium oxide or metal by heating in an inert or reducing atmosphere. Sintering the compact to a high density closes the matrix around the dispersed californium. The sintered compact is then mechanically shaped into an elongated rod or wire form. (4 claims, no drawings) (Official Gazette)

  5. Californium-252 Neutron Sources for Medical Applications

    International Nuclear Information System (INIS)

    Californium-252 neutron sources are being prepared to investigate the value of this radionuclide in diagnosing and treating diseases. A source resembling a cell-loaded radium needle was developed for neutron therapy. Since therapy needles are normally implanted in the body, very conservative design criteria were established to prevent leakage of radioactive. Methods are being developed to prepare very intense californium sources that could be used eventually for neutron radiography and for diagnosis by neutron activation analysis. This paper discusses these methods

  6. Californium Electrodepositions at Oak Ridge National Laboratory

    Energy Technology Data Exchange (ETDEWEB)

    Boll, Rose Ann [ORNL

    2015-01-01

    Electrodepositions of californium isotopes were successfully performed at Oak Ridge National Laboratory (ORNL) during the past year involving two different types of deposition solutions, ammonium acetate (NH4C2H3O2) and isobutanol ((CH3)2CHCH2OH). A californium product that was decay enriched in 251Cf was recovered for use in super-heavy element (SHE) research. This neutron-rich isotope, 251Cf, provides target material for SHE research for the potential discovery of heavier isotopes of Z=118. The californium material was recovered from aged 252Cf neutron sources in storage at ORNL. These sources have decayed for over 30 years, thus providing material with a very high 251Cf-to-252Cf ratio. After the source capsules were opened, the californium was purified and then electrodeposited using the isobutanol method onto thin titanium foils for use in an accelerator at the Joint Institute for Nuclear Research in Dubna, Russia. Another deposition method, ammonium acetate, was used to produce a deposition containing 1.7 0.1 Ci of 252Cf onto a stainless steel substrate. This was the largest single electrodeposition of 252Cf ever prepared. The 252Cf material was initially purified using traditional ion exchange media, such as AG50-AHIB and AG50-HCl, and further purified using a TEVA-NH4SCN system to remove any lanthanides, resulting in the recovery of 3.6 0.1 mg of purified 252Cf. The ammonium acetate deposition was run with a current of 1.0 amp, resulting in a 91.5% deposition yield. Purification and handling of the highly radioactive californium material created additional challenges in the production of these sources.

  7. Historical review of californium-252 discovery and development

    International Nuclear Information System (INIS)

    This paper discusses the discovery and history of californium 252. This isotope may be synthesized by irradiating plutonium 239, plutonium 242, americium 243, or curium 244 with neutrons in a nuclear reactor. Various experiments and inventions involving 252Cf conducted at the Savannah River Plant are discussed. The evolution of radiotherapy using californium 252 is reviewed

  8. Californium-252: a remarkable versatile radioisotope

    Energy Technology Data Exchange (ETDEWEB)

    Osborne-Lee, I.W.; Alexander, C.W.

    1995-10-10

    A product of the nuclear age, Californium-252 ({sup 252}Cf) has found many applications in medicine, scientific research, industry, and nuclear science education. Californium-252 is unique as a neutron source in that it provides a highly concentrated flux and extremely reliable neutron spectrum from a very small assembly. During the past 40 years, {sup 252}Cf has been applied with great success to cancer therapy, neutron radiography of objects ranging from flowers to entire aircraft, startup sources for nuclear reactors, fission activation for quality analysis of all commercial nuclear fuel, and many other beneficial uses, some of which are now ready for further growth. Californium-252 is produced in the High Flux Isotope Reactor (HFIR) and processed in the Radiochemical Engineering Development Center (REDC), both of which are located at the Oak Ridge National Laboratory (ORNL) in Oak Ridge, Tennessee. The REDC/HFIR facility is virtually the sole supplier of {sup 252}Cf in the western world and is the major supplier worldwide. Extensive exploitation of this product was made possible through the {sup 252}Cf Market Evaluation Program, sponsored by the United States Department of Energy (DOE) [then the Atomic Energy Commission (AEC) and later the Energy Research and Development Administration (ERDA)]. This program included training series, demonstration centers, seminars, and a liberal loan policy for fabricated sources. The Market Evaluation Program was instituted, in part, to determine if large-quantity production capability was required at the Savannah River Laboratory (SRL). Because of the nature of the product and the means by which it is produced, {sup 252}Cf can be produced only in government-owned facilities. It is evident at this time that the Oak Ridge research facility can meet present and projected near-term requirements. The production, shipment, and sales history of {sup 252}Cf from ORNL is summarized herein.

  9. Californium-252: a remarkable versatile radioisotope

    International Nuclear Information System (INIS)

    A product of the nuclear age, Californium-252 (252Cf) has found many applications in medicine, scientific research, industry, and nuclear science education. Californium-252 is unique as a neutron source in that it provides a highly concentrated flux and extremely reliable neutron spectrum from a very small assembly. During the past 40 years, 252Cf has been applied with great success to cancer therapy, neutron radiography of objects ranging from flowers to entire aircraft, startup sources for nuclear reactors, fission activation for quality analysis of all commercial nuclear fuel, and many other beneficial uses, some of which are now ready for further growth. Californium-252 is produced in the High Flux Isotope Reactor (HFIR) and processed in the Radiochemical Engineering Development Center (REDC), both of which are located at the Oak Ridge National Laboratory (ORNL) in Oak Ridge, Tennessee. The REDC/HFIR facility is virtually the sole supplier of 252Cf in the western world and is the major supplier worldwide. Extensive exploitation of this product was made possible through the 252Cf Market Evaluation Program, sponsored by the United States Department of Energy (DOE) [then the Atomic Energy Commission (AEC) and later the Energy Research and Development Administration (ERDA)]. This program included training series, demonstration centers, seminars, and a liberal loan policy for fabricated sources. The Market Evaluation Program was instituted, in part, to determine if large-quantity production capability was required at the Savannah River Laboratory (SRL). Because of the nature of the product and the means by which it is produced, 252Cf can be produced only in government-owned facilities. It is evident at this time that the Oak Ridge research facility can meet present and projected near-term requirements. The production, shipment, and sales history of 252Cf from ORNL is summarized herein

  10. Californium-252 Neutron Therapy in China

    International Nuclear Information System (INIS)

    Californium-252 brachytherapy, believed to be the most successful source for neutron therapy, gives most of the cures as well as long-term and complication-free survivals. Chinese radiation oncologists were interested in californium neutron therapy (Cf-NT) in the early 1980s, but 252Cf sources for medical use were not available in China until 1992 when a californium joint venture was established by the China Institute of Atomic Energy (Beijing) and the Research Institute for Nuclear Reactors (Dimitrovgrad) of Russia. In 1995, 25 seeds of 252Cf with a strength of 3 μg each were sent to China for preclinical investigation. Three years later, a high dose rate (HDR) 252Cf source was imported and transferred into a home-made remote after-loader for intracavitary treatment in Chongqing, and a clinical trail was started in February 1999. This is the first time that Cf-NT was performed for cancer patients in China. Since then, Cf-NT in China has developed rapidly. It is estimated that one-tenth of those radiation oncology centers with brachytherapy practice will be equipped with californium units in 5 yr. That means more than 30 units will be in use in hospitals. That is significant compared with other countries, but it is just one, on average, for each province or one per 40 million people in China. Progress also has been achieved in the 252Cf treatment delivery equipment. Preliminary clinical trails showed complete response observed in all cases treated, with a rapid clearance of tumors and mild reactions in normal tissues. The short-term results are quite encouraging. To deal with problems due to the demand for Cf-NT in China, attention should be paid to the following particulars: (1) A high-strength miniature source is needed for HDR/MDR interstitial therapy to extend the Cf-NT coverage. (2) Basic work on radiophysics and radiobiology needs to be done, including source calibration, clinical dosimetry, clinical RBE determination, and Cf-NT quality assurance

  11. Californium-252 sales and loans at Oak Ridge National Laboratory

    International Nuclear Information System (INIS)

    The production and distribution in the United States of 252Cf has recently been consolidated at the Oak Ridge National Laboratory (ORNL). The 252Cf Industrial Sales/Loan Program and the 252Cf University Load Program, which were formerly located at the Savannah River Plant (SRP), have been combined with the californium production and distribution activities of the Transuranium Element Production Program at ORNL. Californium-252 is sold to commercial users in the form of bulk californium oxide, palladium-californium alloy pellets, or alloy wires. Neutron source capsules, which are fabricated for loans to DOE or other US government agencies, are still available in all forms previously available. The consolidation of all 252Cf distribution activities at the production site is expected to result in better service to users. In particular, customers for neutrons sources will be ale to select from a wider range of neutron source forms, including custom designs, through a single contact point

  12. Californium-252 encapsulation at the Savannah River Laboratory

    International Nuclear Information System (INIS)

    More than 1 g of the neutron-emitting isotope californium-252 has been encapsulated at SRL for worldwide medical, industrial, and research uses. Bulk sales packages have been prepared for the USDOE sales program since 1971. Doubly-encapsulated sources have been prepared for USDOE's market evaluation program since 1968. Californium-252 sources for loan and sales packages satisfy the criteria for Special Form Radioactive Material. Encapsulation is performed in special neutron-shielded containment facilities at SRL. Development of improved source and shipping package designs and processes is continuing. 17 figures

  13. Production, distribution and applications of californium-252 neutron sources

    International Nuclear Information System (INIS)

    The radioisotope 252Cf is routinely encapsulated into compact, portable, intense neutron sources with a 2.6-yr half-life. A source the size of a person's little finger can emit up to 1011 neutrons s-1. Californium-252 is used commercially as a reliable, cost-effective neutron source for prompt gamma neutron activation analysis (PGNAA) of coal, cement and minerals, as well as for detection and identification of explosives, land mines and unexploded military ordnance. Other uses are neutron radiography, nuclear waste assays, reactor start-up sources, calibration standards and cancer therapy. The inherent safety of source encapsulations is demonstrated by 30 yr of experience and by US Bureau of Mines tests of source survivability during explosions. The production and distribution center for the US Department of Energy (DOE) Californium Program is the Radiochemical Engineering Development Center (REDC) at Oak Ridge National Laboratory (ORNL). DOE sells 252Cf to commercial reencapsulators domestically and internationally. Sealed 252Cf sources are also available for loan to agencies and subcontractors of the US government and to universities for educational, research and medical applications. The REDC has established the Californium User Facility (CUF) for Neutron Science to make its large inventory of 252Cf sources available to researchers for irradiations inside uncontaminated hot cells. Experiments at the CUF include a land mine detection system, neutron damage testing of solid-state detectors, irradiation of human cancer cells for boron neutron capture therapy experiments and irradiation of rice to induce genetic mutations

  14. Production, distribution and applications of californium-252 neutron sources.

    Science.gov (United States)

    Martin, R C; Knauer, J B; Balo, P A

    2000-01-01

    The radioisotope 252Cf is routinely encapsulated into compact, portable, intense neutron sources with a 2.6-yr half-life. A source the size of a person's little finger can emit up to 10(11) neutrons s(-1). Californium-252 is used commercially as a reliable, cost-effective neutron source for prompt gamma neutron activation analysis (PGNAA) of coal, cement and minerals, as well as for detection and identification of explosives, land mines and unexploded military ordinance. Other uses are neutron radiography, nuclear waste assays, reactor start-up sources, calibration standards and cancer therapy. The inherent safety of source encapsulations is demonstrated by 30 yr of experience and by US Bureau of Mines tests of source survivability during explosions. The production and distribution center for the US Department of Energy (DOE) Californium Program is the Radiochemical Engineering Development Center (REDC) at Oak Ridge National Laboratory (ORNL). DOE sells 252Cf to commercial reencapsulators domestically and internationally. Sealed 252Cf sources are also available for loan to agencies and subcontractors of the US government and to universities for educational, research and medical applications. The REDC has established the Californium User Facility (CUF) for Neutron Science to make its large inventory of 252Cf sources available to researchers for irradiations inside uncontaminated hot cells. Experiments at the CUF include a land mine detection system, neutron damage testing of solid-state detectors, irradiation of human cancer cells for boron neutron capture therapy experiments and irradiation of rice to induce genetic mutations. PMID:11003521

  15. Production, Distribution, and Applications of Californium-252 Neutron Sources

    Energy Technology Data Exchange (ETDEWEB)

    Balo, P.A.; Knauer, J.B.; Martin, R.C.

    1999-10-03

    The radioisotope {sup 252}Cf is routinely encapsulated into compact, portable, intense neutron sources with a 2.6-year half-life. A source the size of a person's little finger can emit up to 10{sup 11} neutrons/s. Californium-252 is used commercially as a reliable, cost-effective neutron source for prompt gamma neutron activation analysis (PGNAA) of coal, cement, and minerals, as well as for detection and identification of explosives, laud mines, and unexploded military ordnance. Other uses are neutron radiography, nuclear waste assays, reactor start-up sources, calibration standards, and cancer therapy. The inherent safety of source encapsulations is demonstrated by 30 years of experience and by U.S. Bureau of Mines tests of source survivability during explosions. The production and distribution center for the U. S Department of Energy (DOE) Californium Program is the Radiochemical Engineering Development Center (REDC) at Oak Ridge National Laboratory (ORNL). DOE sells The radioisotope {sup 252}Cf is routinely encapsulated into compact, portable, intense neutron sources with a 2.6- year half-life. A source the size of a person's little finger can emit up to 10 neutrons/s. Californium-252 is used commercially as a reliable, cost-effective neutron source for prompt gamma neutron activation analysis (PGNAA) of coal, cement, and minerals, as well as for detection and identification of explosives, laud mines, and unexploded military ordnance. Other uses are neutron radiography, nuclear waste assays, reactor start-up sources, calibration standards, and cancer therapy. The inherent safety of source encapsulations is demonstrated by 30 years of experience and by U.S. Bureau of Mines tests of source survivability during explosions. The production and distribution center for the U. S Department of Energy (DOE) Californium Program is the Radiochemical Engineering Development Center (REDC) at Oak Ridge National Laboratory(ORNL). DOE sells {sup 252}Cf to commercial

  16. Production of extra pure curium and californium preparations

    International Nuclear Information System (INIS)

    Preparations of curium-244,245,248 and californium-249,252 are used for the production of ionizing radiation sources for different applications and fundamental nuclear-physical investigations, placing high requirements on the radiochemical and chemical purity of the preparations. Extraction chromatography using di-(2-ethylhexyl)phosphoric acid (D2EHPA) as extractant was chosen to prepare extra pure curium and californium preparations. In order to identify the optimal conditions of Cm-Cf separation and to remove impurities from them (reagent and other impurities), investigations were performed into the effect of impurities (Na+, Ca2+, Al3+, Fe2+, Fe3+ taken as example), extractant and eluent concentration and solution flow rate on the efficiency of mutual purification of Cm and Cf. Both theoretical and experimental estimations were made of the maximum concentration at which the impurities do not affect the process. The conditions chosen allow mutual purification of milligram amounts of Cm and Cf from impurity elements at E(pur) =102 - 103 during a single chromatographic cycle (E(pur) =>103) using a column with 5 - 10 cm3 volume. In this case the production yield exceeds 98%. The purification of milligram amounts of curium and californium from fission products (lanthanides in general, cerium in particular) was performed in D2EHPA-decane-PbO2-HNO3 and D2EHPA-decane-DTPA-H3-Cit extraction chromatography systems. In order to establish the optimal conditions, the effect of [D2EHPA] and eluent on the mutual purification of Cm and Cf and on their purification from cerium and impurity elements was studied in the D2EHPA-decane-PbO2-HNO3 system. During a single chromatographic cycle the mutual purification factors of TPE and of their purification from impurity cations achieve 102-103, from cerium - E(pur) > 10. In the D2EHPA-decane-DTPA-H3Cit system, the effect of concentration of extractant and eluent pH on the efficiency of Cm and Cf purification from lanthanides was

  17. Prompt neutron spectrum of the spontaneous fission of californium-252

    International Nuclear Information System (INIS)

    The californium-252 spontaneous fission neutron spectrum was measured in the energy range of 0.01 to 10 MeV by the time-of-flight technique using various neutron detectors. The measurements of 252Cf neutron spectrum at energies of 0.01 to 5 MeV were performed as a function of fission fragment kinetic energy. The mean neutron spectrum energy in the range of 0.7 to 10 MeV was found from the results of measurements. The irregularity in the 252Cf neutron spectrum in the neutron energy range of less than 0.7 MeV compared to theoretical values is discussed. The mechanism of 252Cf neutron emission is also discussed on the basis of neutron yield angle measurements. 12 references

  18. Separation of californium from actinides and lanthanides in aqueous solution by electrochemical formation of amalgams

    International Nuclear Information System (INIS)

    The electrochemical reduction of transneptunium elements (Pu to Cf) and rare earths (Eu, Tm) from aqueous complexing solutions to amalgams was studied over a wide range of cathodic potentials in order to achieve optimal separation of californium. The reduction in acetate media (pH 4.5-4.6) at potentials around -1.7 to -1.9 V1 leads to a quantitative extraction of californium into the mercury phase, while more negative potentials are required for the reduction of the lighter transuranium elements and of the lanthanides. Hence, the optimal conditions for the separation of californium from the investigated actinides and lanthanides were determined. Separation factors α between 25 and 90 were found except in the case of Cf/Eu, where poor values (α varying from 7 to 12) were observed. More negative cathodic potentials decrease the selectivity of the reduction process. A similar study with lithium citrate solutions (pH ∝6) shows that satisfactory separation of californium from lighter and heavier actinides is achievable. A separation factor of 88 is obtained for Cf/Am at -1.98 V. The anodic stripping of mixed amalgams (Pu, Am, Cm, Bk, Tm and Cf) Hg in nitric and acetic acid soultions at potentials ranging from +0.1 to -0.7 V proceeds slowly and proved to be ineffective for the separation of californium from light actinides under conditions described. (orig.)

  19. On-line slurry analyses by californium-252

    International Nuclear Information System (INIS)

    In chemical processing technology on-line activation methods gain an increasing importance for process monitoring and control. A method is described according to which the different fluorspar contents at various strategic points of a flotation plant are determined through neutron activation by 100 μg californium-252. A continuous analytical system for onstream process control of slurries was designed and constructed. A compact facility, called SUSAC, allows continuous application of the method on an industrial scale. The main components of the SUSAC facility are the irradiation and measurement cells. The cells are equipped with multistage countercurrent stirrers ensuring a proper radial and vertical distribution of the sample. The hollow shaft of the stirrer of the irradiation cell houses the Cf-source. The NaI-detector has been installed in a recess in the bottom of the measuring cell. The volumes are 9 dm3 for the irradiation cell, 7.5 dm3 for the measuring cell, 1/2 dm3 for the vonnection line and 4 dm3 for feed and drainage lines including the pump. Investigations on the following topics are discussed: selection of stirrers, residence time, flow rate, pulp density, calibration measurements. (T.G.)

  20. Biomedical neutron research at the Californium User Facility for neutron science

    International Nuclear Information System (INIS)

    The Californium User Facility for Neutron Science has been established at Oak Ridge National Laboratory (ORNL). The Californium User Facility (CUF) is a part of the larger Californium Facility, which fabricates and stores compact 252Cf neutron sources for worldwide distribution. The CUF can provide a cost-effective option for research with 252Cf sources. Three projects at the CUF that demonstrate the versatility of 252Cf for biological and biomedical neutron-based research are described: future establishment of a 252Cf-based neutron activation analysis system, ongoing work to produce miniature high-intensity, remotely afterloaded 252Cf sources for tumor therapy, and a recent experiment that irradiated living human lung cancer cells impregnated with experimental boron compounds to test their effectiveness for boron neutron capture therapy

  1. Biomedical neutron research at the Californium User Facility for neutron science

    Energy Technology Data Exchange (ETDEWEB)

    Martin, R.C. [Oak Ridge National Lab., TN (United States); Byrne, T.E. [Roane State Community College, Harriman, TN (United States); Miller, L.F. [Univ. of Tennessee, Knoxville, TN (United States)

    1997-04-01

    The Californium User Facility for Neutron Science has been established at Oak Ridge National Laboratory (ORNL). The Californium User Facility (CUF) is a part of the larger Californium Facility, which fabricates and stores compact {sup 252}Cf neutron sources for worldwide distribution. The CUF can provide a cost-effective option for research with {sup 252}Cf sources. Three projects at the CUF that demonstrate the versatility of {sup 252}Cf for biological and biomedical neutron-based research are described: future establishment of a {sup 252}Cf-based neutron activation analysis system, ongoing work to produce miniature high-intensity, remotely afterloaded {sup 252}Cf sources for tumor therapy, and a recent experiment that irradiated living human lung cancer cells impregnated with experimental boron compounds to test their effectiveness for boron neutron capture therapy.

  2. Proposed Californium-252 User Facility for Neutron Science at Oak Ridge National Laboratory

    International Nuclear Information System (INIS)

    The Radiochemical Engineering Development Center (REDC) at ORNL has petitioned to establish a Californium-252 User Facility for Neutron Science for academic, industrial, and governmental researchers. The REDC Californium Facility (CF) stores the national inventory of sealed 252Cf neutron source for university and research loans. Within the CF, the 252Cf storage pool and two uncontaminated hot cells currently in service for the Californium Program will form the physical basis for the User Facility. Relevant applications include dosimetry and experiments for neutron tumor therapy; fast and thermal neutron activation analysis of materials; experimental configurations for prompt gamma neutron activation analysis; neutron shielding and material damage studies; and hardness testing of radiation detectors, cameras, and electronics. A formal User Facility simplifies working arrangements and agreements between US DOE facilities, academia, and commercial interests

  3. Emergence of californium as the second transitional element in the actinide series.

    Science.gov (United States)

    Cary, Samantha K; Vasiliu, Monica; Baumbach, Ryan E; Stritzinger, Jared T; Green, Thomas D; Diefenbach, Kariem; Cross, Justin N; Knappenberger, Kenneth L; Liu, Guokui; Silver, Mark A; DePrince, A Eugene; Polinski, Matthew J; Van Cleve, Shelley M; House, Jane H; Kikugawa, Naoki; Gallagher, Andrew; Arico, Alexandra A; Dixon, David A; Albrecht-Schmitt, Thomas E

    2015-01-01

    A break in periodicity occurs in the actinide series between plutonium and americium as the result of the localization of 5f electrons. The subsequent chemistry of later actinides is thought to closely parallel lanthanides in that bonding is expected to be ionic and complexation should not substantially alter the electronic structure of the metal ions. Here we demonstrate that ligation of californium(III) by a pyridine derivative results in significant deviations in the properties of the resultant complex with respect to that predicted for the free ion. We expand on this by characterizing the americium and curium analogues for comparison, and show that these pronounced effects result from a second transition in periodicity in the actinide series that occurs, in part, because of the stabilization of the divalent oxidation state. The metastability of californium(II) is responsible for many of the unusual properties of californium including the green photoluminescence. PMID:25880116

  4. 7 CFR 253.4 - Administration.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Administration. 253.4 Section 253.4 Agriculture... GENERAL REGULATIONS AND POLICIES-FOOD DISTRIBUTION ADMINISTRATION OF THE FOOD DISTRIBUTION PROGRAM FOR HOUSEHOLDS ON INDIAN RESERVATIONS § 253.4 Administration. (a) Federal administration. Within the...

  5. 32 CFR 253.4 - Policy.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false Policy. 253.4 Section 253.4 National Defense Department of Defense (Continued) OFFICE OF THE SECRETARY OF DEFENSE (CONTINUED) MISCELLANEOUS ASSIGNMENT OF... SERVICES § 253.4 Policy. (a) It is the policy of the Department of Defense that an employee shall...

  6. 28 CFR 25.3 - System information.

    Science.gov (United States)

    2010-07-01

    ... 28 Judicial Administration 1 2010-07-01 2010-07-01 false System information. 25.3 Section 25.3 Judicial Administration DEPARTMENT OF JUSTICE DEPARTMENT OF JUSTICE INFORMATION SYSTEMS The National Instant Criminal Background Check System § 25.3 System information. (a) There is established at the FBI...

  7. 36 CFR 25.3 - Supervision; suspensions.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 1 2010-07-01 2010-07-01 false Supervision; suspensions. 25.3 Section 25.3 Parks, Forests, and Public Property NATIONAL PARK SERVICE, DEPARTMENT OF THE INTERIOR NATIONAL MILITARY PARKS; LICENSED GUIDE SERVICE REGULATIONS § 25.3 Supervision; suspensions. (a) The...

  8. 32 CFR 253.5 - Responsibilities.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false Responsibilities. 253.5 Section 253.5 National Defense Department of Defense (Continued) OFFICE OF THE SECRETARY OF DEFENSE (CONTINUED) MISCELLANEOUS... MILITARY SERVICES § 253.5 Responsibilities. (a) The Deputy Under Secretary of Defense for Policy,...

  9. 33 CFR 117.253 - Anacostia River.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Anacostia River. 117.253 Section 117.253 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements District of Columbia § 117.253 Anacostia River....

  10. 40 CFR 265.253 - Containment.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 25 2010-07-01 2010-07-01 false Containment. 265.253 Section 265.253 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES (CONTINUED) INTERIM STATUS... Piles § 265.253 Containment. If leachate or run-off from a pile is a hazardous waste, then either:...

  11. Fissile analysis of Hanford waste using Californium Multiplier/Delayed Neutron Counter system

    International Nuclear Information System (INIS)

    Measurement of low-level (10 ng/g or lower) fissile material (mainly plutonium) in Hanford waste and process samples is becoming increasingly important. A system has been designed consisting of a Californium Multiplier (CFX) and a Delayed Neutron Counter (DNC) to characterize these samples. This report describes hardware and analytical capability of the CFX/DNC system

  12. Study of the shielding for spontaneous fission sources of Californium-252

    International Nuclear Information System (INIS)

    A shielding study is made to attenuate, until maximum permissible levels, the neutrons radiation and photons emitted by spontaneous fission coming from a source of Californium-252. The compound package by a database (Library DLC-23) and the ANISNW code is used, in it version for personal computer. (Author)

  13. Notes from Sidney Coleman's Physics 253a

    CERN Document Server

    Coleman, Sidney

    2011-01-01

    These notes were taken by Brian Hill during Sidney Coleman's lectures on Quantum Field Theory (Physics 253), given at Harvard University in Fall semester of the 1986-1987 academic year. They were recently typeset, edited and reorganized by Bryan Chen and Yuan-Sen Ting. Although most of topics in the second part of the course (Physics 253b) were assembled and published in Coleman's book "Aspects of Symmetry", these notes remain the principal source for the Physics 253a materials. [See also http://www.physics.harvard.edu/about/Phys253.html for a video version of the course given in 1975-1976.

  14. Californium (252Cf) and its use as neutron source in science medicine and technology

    International Nuclear Information System (INIS)

    The application of radionuclides in science and nuclear techniques basically is related to unstable isotopes, which are produced from stable elements in nuclear reactor. Their specifications are various from view point of application . Using of physical and chemical properties of radionuclides in chemistry, for with marking the organic compounds we can exactly explain the mechanism of chemical reactions in medical, biology and bio-chemistry. In these cases the behaviour of radionuclides is very important and the selection of the suitable radionuclides is determined between the elements for investigation aims. The special specification of radio-nuclides analysis such as, half-life, kind of ray and energy should be considered with an special accuracy as well as the laws security regulations from view point of ray-protection should be completely observed mean time working these radio-nuclides. It should be considered that application of radio-isotopes is very important from their special specifications point of view. Applying the radionuclides from technology point of view in sciences and nuclear techniques aren't only limited to three analyses of α, β, and γ, but we can use the share of neutron which are produced from spli ting of heavy nucleus such as Californium252 as a neutron source in the depths of the sea and also determining the concentration of low quantity elements on moon and other spheres. The radioisotope of Californium252 is a neutron useful radiator for investigation in nuclear medical and technology because of automatically rapid split to 3.2% Californium252 radiates 1.34 * 109N/m in each mil/GH which suitable replacement for neutron sources based on (a, n) reaction, for example, Radium-Brellium or Amersium-Brellium. The energy distribution of radiated neutrons from analyzing of Californium252 like the spectrum of neutron which is produced from splitting of U235, Pu239 nucleus has the maximum energy in quantity, En=1 MeV in the range of 1.5 MeV. The

  15. 7 CFR 1901.253 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 12 2010-01-01 2010-01-01 false Definitions. 1901.253 Section 1901.253 Agriculture... lack individual distinction; or (4) That have yielded, or may be likely to yield, information important..., and culture maintained by the Secretary of the Interior under the authority of section 2(b) of...

  16. 40 CFR 761.253 - Chemical analysis.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 30 2010-07-01 2010-07-01 false Chemical analysis. 761.253 Section 761.253 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) TOXIC SUBSTANCES CONTROL ACT... analysis. (a) Extract PCBs from the standard wipe sample collection medium and clean-up the extracted...

  17. 24 CFR 220.253 - Substitute mortgagors.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Substitute mortgagors. 220.253... Contract Rights and Obligations-Homes § 220.253 Substitute mortgagors. (a) Selling mortgagor. The mortgagee... the Commissioner's approval of a substitute mortgagor, as provided by this section. (b)...

  18. Contribution to clinical dosimetry of californium 252 sources used at Gustave Roussy institute

    International Nuclear Information System (INIS)

    The main characteristics of californium 252 sources are presented in the first part of the report. Dose measurements around Californium sources were performed with a pair of ionization multiplication chambers: the first one has an Aluminium wall and is filled with Argon, the second one a plastic tissue-equivalent gas. A set of experiments was performed in order to investigate the relative influence of beta rays on the response of both chambers. Besides the experimental work a computer program was written to calculate the dose distribution around the actual sources made of a series of small active sources placed in catheters. Theoretical data around small sources can be found in the litterature. The comparison between experimental results and theoretical ones has shown a good agreement. The computer program will be included as a sub-routine in the more general computer program used for patients treated with interstitial therapy

  19. Safety Analysis Report for Packaging (SARP) of the Oak Ridge National Laboratory TRU Californium Shipping Container

    International Nuclear Information System (INIS)

    An analytical evaluation of the Oak Ridge National Laboratory TRU Californium Shipping Container was made in order to demonstrate its compliance with the regulations governing off-site shipment of packages that contain radioactive material. The evaluation encompassed five primary categories: structural integrity, thermal resistance, radiation shielding, nuclear criticality safety, and quality assurance. The results of this evaluation demonstrate that the container complies with the applicable regulations

  20. Emergence of californium as the second transitional element in the actinide series

    OpenAIRE

    Cary, Samantha K.; Vasiliu, Monica; Baumbach, Ryan E.; Stritzinger, Jared T.; GREEN, THOMAS D.; Diefenbach, Kariem; Cross, Justin N.; Knappenberger, Kenneth L.; Liu, Guokui; Silver, Mark A.; DePrince, A. Eugene; Polinski, Matthew J.; Van Cleve, Shelley M.; House, Jane H.; Kikugawa, Naoki

    2015-01-01

    A break in periodicity occurs in the actinide series between plutonium and americium as the result of the localization of 5f electrons. The subsequent chemistry of later actinides is thought to closely parallel lanthanides in that bonding is expected to be ionic and complexation should not substantially alter the electronic structure of the metal ions. Here we demonstrate that ligation of californium(III) by a pyridine derivative results in significant deviations in the properties of the resu...

  1. Measurements of integral cross sections in the californium-252 fission neutron spectrum

    International Nuclear Information System (INIS)

    In a low-scattering arrangement cross sections averaged over the californium-252 spontaneous fission neutron spectrum were measured. The reactions 27Al(n,α)46Ti, 47Ti, 48Ti(n,p), 54Fe,56Fe(n,p), 58Ni(n,p), 64Zn(n,p), 115In(n,n') were studied in order to obtain a consistent set of threshold detectors used in fast neutron flux density measurements. Overall uncertainties between 2 and 2.5% could be achieved; corrections due to neutron scattering in source and samples are discussed

  2. Measurement of californium-252 gamma photons depth dose distribution in tissue equivalent material. Vol. 4

    International Nuclear Information System (INIS)

    Phantom of tissue equivalent material with and without bone was used measuring depth dose distribution of gamma-rays from californium-252 source. The source was positioned at center of perspex walled phantom. Depth dose measurements were recorded for X, Y and Z planes at different distances from source. TLD 700 was used for measuring the dose distribution. Results indicate that implantation of bone in tissue equivalent medium cause changes in the gamma depth dose distribution which varies according to variation in bone geometry. 9 figs

  3. Spontaneous Partitioning of Californium from Curium: Curious Cases from the Crystallization of Curium Coordination Complexes

    Energy Technology Data Exchange (ETDEWEB)

    Cary, Samantha K.; Silver, Mark A.; Liu, Guokui; Wang, Jamie C.; Bogart, Justin A.; Stritzinger, Jared T.; Arico, Alexandra A.; Hanson, Kenneth; Schelter, Eric J.; Albrecht-Schmitt, Thomas E.

    2015-12-07

    The reaction of 248CmCl3 with excess 2,6-pyridinedicarboxylic acid (DPA) under mild solvothermal conditions results in crystallization of the tris-chelate complex Cm(HDPA)3·H2O. Approximately half of the curium remains in solution at the end of this process, and evaporation of the mother liquor results in crystallization of the bis-chelate complex [Cm(HDPA)- (H2DPA)(H2O)2Cl]Cl·2H2O. 248Cm is the daughter of the α decay of 252Cf and is extracted in high purity from this parent. However, trace amounts of 249,250,251Cf are still present in all samples of 248Cm. During the crystallization of Cm(HDPA)3·H2O and [Cm(HDPA)(H2DPA)(H2O)2Cl]Cl·2H2O, californium(III) spontaneously separates itself from the curium complexes and is found doped within crystals of DPA in the form of Cf(HDPA)3. These results add to the growing body of evidence that the chemistry of californium is fundamentally different from that of earlier actinides.

  4. 24 CFR 983.253 - Leasing of contract units.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 4 2010-04-01 2010-04-01 false Leasing of contract units. 983.253 Section 983.253 Housing and Urban Development Regulations Relating to Housing and Urban Development... DEVELOPMENT PROJECT-BASED VOUCHER (PBV) PROGRAM Occupancy § 983.253 Leasing of contract units. (a)...

  5. 7 CFR 253.3 - Availability of commodities.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Availability of commodities. 253.3 Section 253.3... FOR HOUSEHOLDS ON INDIAN RESERVATIONS § 253.3 Availability of commodities. (a) Conditions for... commodities to households under the authority of any law, except that distribution may be made (1) on...

  6. 37 CFR 253.2 - Definition of public broadcasting entity.

    Science.gov (United States)

    2010-07-01

    ... broadcasting entity. 253.2 Section 253.2 Patents, Trademarks, and Copyrights COPYRIGHT OFFICE, LIBRARY OF... CONNECTION WITH NONCOMMERCIAL EDUCATIONAL BROADCASTING § 253.2 Definition of public broadcasting entity. As used in this part, the term public broadcasting entity means a noncommercial educational...

  7. 42 CFR 403.253 - Calculation of benefits.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 2 2010-10-01 2010-10-01 false Calculation of benefits. 403.253 Section 403.253... Ratio Provisions § 403.253 Calculation of benefits. (a) General provisions. (1) Except as provided for... values on the initial calculation date of— (A) Expected incurred benefits in the loss ratio...

  8. Dicty_cDB: SSJ253 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available cant alignments: (bits) Value N U49650 |U49650.1 Dictyostelium discoideum calcium-dependent cell adhesion...oducing significant alignments: (bits) Value ( P54657 ) RecName: Full=Calcium-dependent cell adhesion...l.tsukuba.ac.jp/CSM/SS/SSJ2-C/SSJ253Q.Seq.d/ Representative seq. ID SSJ253Z (Link to Original si...te) Representative DNA sequence >SSJ253 (SSJ253Q) /CSM/SS/SSJ2-C/SSJ253Q.Seq.d/ XXXXX...nt cell adhesion molecule-1 (cadA) gene, complete cds. 460 0

  9. The Resolved Stellar Halo of NGC 253

    CERN Document Server

    Bailin, Jeremy; Chappell, Samantha N; Radburn-Smith, David J; de Jong, Roelof S

    2011-01-01

    We have obtained Magellan/IMACS and HST/ACS imaging data that resolve red giant branch stars in the stellar halo of the starburst galaxy NGC 253. The HST data cover a small area, and allow us to accurately interpret the ground-based data, which cover 30% of the halo to a distance of 30 kpc, allowing us to make detailed quantitative measurements of the global properties and structure of a stellar halo outside of the Local Group. The geometry of the halo is significantly flattened in the same sense as the disk, with a projected axis ratio of b/a ~ 0.35 +/- 0.1. The total stellar mass of the halo is estimated to be M_halo ~ 2.5 +/- 1.5 x 10^9 M_sun, or 6% of the total stellar mass of the galaxy, and has a projected radial dependence that follows a power law of index -2.8 +/- 0.6, corresponding to a three-dimensional power law index of ~ -4. The total luminosity and profile shape that we measure for NGC 253 are somewhat larger and steeper than the equivalent values for the Milky Way and M31, but are well within t...

  10. Dicty_cDB: SHD253 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SH (Link to library) SHD253 (Link to dictyBase) - - - - SHD253P (Link to Original site) SHD253F ... .1 Influenza A virus (swine/Cotes d'Armor/1515/99 (H1N1 )) partial N1NA gene for Neuraminidase, genomic RNA ... .1 Influenza A virus (swine/Cotes d'Armor/1482/99 (H1N1 )) partial N1NA gene for Neuraminidase, genomic RNA ...

  11. Fast and efficient charge breeding of the Californium rare isotope breeder upgrade electron beam ion source

    Energy Technology Data Exchange (ETDEWEB)

    Ostroumov, P. N., E-mail: ostroumov@anl.gov; Barcikowski, A.; Dickerson, C. A.; Perry, A.; Sharamentov, S. I.; Vondrasek, R. C.; Zinkann, G. P. [Argonne National Laboratory, Argonne, Illinois 60439 (United States); Pikin, A. I. [Brookhaven National Laboratory, Upton, New York 11973 (United States)

    2015-08-15

    The Electron Beam Ion Source (EBIS), developed to breed Californium Rare Isotope Breeder Upgrade (CARIBU) radioactive beams at Argonne Tandem Linac Accelerator System (ATLAS), is being tested off-line. A unique property of the EBIS is a combination of short breeding times, high repetition rates, and a large acceptance. Overall, we have implemented many innovative features during the design and construction of the CARIBU EBIS as compared to the existing EBIS breeders. The off-line charge breeding tests are being performed using a surface ionization source that produces singly charged cesium ions. The main goal of the off-line commissioning is to demonstrate stable operation of the EBIS at a 10 Hz repetition rate and a breeding efficiency into single charge state higher than 15%. These goals have been successfully achieved and exceeded. We have measured (20% ± 0.7%) breeding efficiency into the single charge state of 28+ cesium ions with the breeding time of 28 ms. In general, the current CARIBU EBIS operational parameters can provide charge breeding of any ions in the full mass range of periodic table with high efficiency, short breeding times, and sufficiently low charge-to-mass ratio, 1/6.3 for the heaviest masses, for further acceleration in ATLAS. In this paper, we discuss the parameters of the EBIS and the charge breeding results in a pulsed injection mode with repetition rates up to 10 Hz.

  12. Fast and efficient charge breeding of the Californium rare isotope breeder upgrade electron beam ion source

    International Nuclear Information System (INIS)

    The Electron Beam Ion Source (EBIS), developed to breed Californium Rare Isotope Breeder Upgrade (CARIBU) radioactive beams at Argonne Tandem Linac Accelerator System (ATLAS), is being tested off-line. A unique property of the EBIS is a combination of short breeding times, high repetition rates, and a large acceptance. Overall, we have implemented many innovative features during the design and construction of the CARIBU EBIS as compared to the existing EBIS breeders. The off-line charge breeding tests are being performed using a surface ionization source that produces singly charged cesium ions. The main goal of the off-line commissioning is to demonstrate stable operation of the EBIS at a 10 Hz repetition rate and a breeding efficiency into single charge state higher than 15%. These goals have been successfully achieved and exceeded. We have measured (20% ± 0.7%) breeding efficiency into the single charge state of 28+ cesium ions with the breeding time of 28 ms. In general, the current CARIBU EBIS operational parameters can provide charge breeding of any ions in the full mass range of periodic table with high efficiency, short breeding times, and sufficiently low charge-to-mass ratio, 1/6.3 for the heaviest masses, for further acceleration in ATLAS. In this paper, we discuss the parameters of the EBIS and the charge breeding results in a pulsed injection mode with repetition rates up to 10 Hz

  13. Design of a homogeneous subcritical nuclear reactor based on thorium with a source of californium 252

    International Nuclear Information System (INIS)

    Full text: One of the energy alternatives to fossil fuels which do not produce greenhouse gases is the nuclear energy. One of the drawbacks of this alternative is the generation of radioactive wastes of long half-life and its relation to the generation of nuclear materials to produce weapons of mass destruction. An option to these drawbacks of nuclear energy is to use Thorium as part of the nuclear fuel which it becomes in U233 when capturing neutrons, that is a fissile material. In this paper Monte Carlo methods were used to design a homogeneous subcritical reactor based on thorium. As neutron reflector graphite was used. The reactor core is homogeneous and is formed of 70% light water as moderator, 12% of enriched uranium UO2(NO3)4 and 18% of thorium Th(NO3)4 as fuel. To start the nuclear fission chain reaction an isotopic source of californium 252 was used with an intensity of 4.6 x 107 s-1. In the design the value of the effective multiplication factor, whose value turned out keff <1 was calculated. Also, the neutron spectra at different distances from the source and the total fluence were calculated, as well as the values of the ambient dose equivalent in the periphery of the reactor. (Author)

  14. Fast and efficient charge breeding of the Californium rare isotope breeder upgrade electron beam ion source.

    Science.gov (United States)

    Ostroumov, P N; Barcikowski, A; Dickerson, C A; Perry, A; Pikin, A I; Sharamentov, S I; Vondrasek, R C; Zinkann, G P

    2015-08-01

    The Electron Beam Ion Source (EBIS), developed to breed Californium Rare Isotope Breeder Upgrade (CARIBU) radioactive beams at Argonne Tandem Linac Accelerator System (ATLAS), is being tested off-line. A unique property of the EBIS is a combination of short breeding times, high repetition rates, and a large acceptance. Overall, we have implemented many innovative features during the design and construction of the CARIBU EBIS as compared to the existing EBIS breeders. The off-line charge breeding tests are being performed using a surface ionization source that produces singly charged cesium ions. The main goal of the off-line commissioning is to demonstrate stable operation of the EBIS at a 10 Hz repetition rate and a breeding efficiency into single charge state higher than 15%. These goals have been successfully achieved and exceeded. We have measured (20% ± 0.7%) breeding efficiency into the single charge state of 28+ cesium ions with the breeding time of 28 ms. In general, the current CARIBU EBIS operational parameters can provide charge breeding of any ions in the full mass range of periodic table with high efficiency, short breeding times, and sufficiently low charge-to-mass ratio, 1/6.3 for the heaviest masses, for further acceleration in ATLAS. In this paper, we discuss the parameters of the EBIS and the charge breeding results in a pulsed injection mode with repetition rates up to 10 Hz. PMID:26329185

  15. Neutron activation analysis at the Californium User Facility for Neutron Science

    International Nuclear Information System (INIS)

    The Californium User Facility (CUF) for Neutron Science has been established to provide 252Cf-based neutron irradiation services and research capabilities including neutron activation analysis (NAA). A major advantage of the CUF is its accessibility and controlled experimental conditions compared with those of a reactor environment The CUF maintains the world's largest inventory of compact 252Cf neutron sources. Neutron source intensities of ≤ 1011 neutrons/s are available for irradiations within a contamination-free hot cell, capable of providing thermal and fast neutron fluxes exceeding 108 cm-2 s-1 at the sample. Total flux of ≥109 cm-2 s-1 is feasible for large-volume irradiation rabbits within the 252Cf storage pool. Neutron and gamma transport calculations have been performed using the Monte Carlo transport code MCNP to estimate irradiation fluxes available for sample activation within the hot cell and storage pool and to design and optimize a prompt gamma NAA (PGNAA) configuration for large sample volumes. Confirmatory NAA irradiations have been performed within the pool. Gamma spectroscopy capabilities including PGNAA are being established within the CUF for sample analysis

  16. Long-term effects of an intracavitary treatment with californium-252 on normal tissue

    International Nuclear Information System (INIS)

    About one hundred fifty swine were exposed to either radium-226 or californium-252 sources in the uterine cervix to determine an RBE for both acute and long-term effects. That value for early changes in the tissues at risk in the treatment of cervical cancer was between 6.2 and 6.8. The incidence of complications increased with time after exposure, especially among animals treated with 252Cf. Analysis of rectal injury showed that ulceration occurred frequently within a year postexposure at doses between 1600 and 2400 rad calculated at 2 cm lateral to the source midline. Fat necrosis and smooth muscle atrophy, resulting in a local rectal stricture, were delayed changes observed in some animals. The lower ureter was the site for a greater frequency of complications than the GI tract. Ureteral stricture often occurred at doses of 1200 rad from 252Cf and 7000 rad from 226Ra. Observation of delayed effects in the uterine-cervix in animals held up to 4 years postexposure indicate that the RBE for 252Cf may be increased to a value as high as 18, while repair may have even decreased it to about 5.6 in the rectum. Fifty swine are still being observed for long-term effects after doses above 800 rad from 252Cf and 5000 rad from 226Ra

  17. Manganese determination om minerals by activation analysis, using the californium-252 as a neutron source

    International Nuclear Information System (INIS)

    Neutron Activation Analysis, using a Californium-252 neutron source, has been applied for the determination of manganese in ores such as pyrolusite, rodonite (manganese silicate)' and blending used in dry-batteries The favorable nuclear properties of manganese, such as high thermal neutron cross-section for the reaction 55Mn (n.gamma)56 Mn, high concentration of manganese in the matrix and short half - life of 56Mn, are an ideal combination for non-destructive analysis of manganese in ores. Samples and standards of manganese dioxide were irradiated for about 20 minutes, followed by a 4 to 15 minutes decay and counted in a single channel pulse-height discrimination using a NaI(Tl) scintillation detector. Counting time was equal to 10 minutes. The interference of nuclear reactions 56Fe(n,p)56Mn and 59 Co (n, α)56 were studied, as well as problems in connection with neutron shadowing during irradiation, gamma-rays attenuation during counting and influence of granulometry of samples. One sample,was also analysed by wet-chemical method (sodium bismuthate) in order to compare results. As a whole, i t was shown that the analytical method of neutron activation for manganese in ores and blending, is a method simple, rapid and with good precision and accuracy. (author)

  18. Five-year cure of cervical cancer treated using californium-252 neutron brachytherapy

    International Nuclear Information System (INIS)

    Female pelvic carcinoma is one of the common malignancies seen at the University of Kentucky Medical Center and often presents in an advanced stage. In 1976, the authors began to test californium-252 neutron brachytherapy (NT) for its efficacy for control of primary and recurrent advanced uterine, cervix, and vaginal cancers. The first protocol used was 5000-5500 rad of whole pelvis irradiation followed by 1-2 Cf-252 insertions using a single tandem placed in the utero-cervico-vaginal region. Of 27 patients with primary carcinomas treated, 10 are alive and well 5 year later (37%). Two of two recurrent tumors were locally controlled but failed later. These patients had advanced cervical, vaginal, or endometrial carcinomas. In 1977, a transitional year, treatment of only unfavorable stages and presentations with NT was initiated. Similar results were obtained with NT as compared to conventional photon therapy (PT). Further improvement in treatment results can be anticipated as NT brachytherapy is used for advanced cancer therapy by more effective treatment schedules and radiation doses. Cf-252 can be used as a radium substitute and achieved similar rates of tumor control and 5-year survivals. 21 references, 2 tables

  19. 14 CFR 21.253 - Type certificates: application.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Type certificates: application. 21.253 Section 21.253 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF TRANSPORTATION... amended type certificate, the manufacturer must submit to the Administrator— (1) An application for a...

  20. Uptake and distribution of californium-252 chloride administered intraperitoneally, intravenously or intratracheally and the effect of in vivo DTPA chelation on intratracheal instillation in the rat

    International Nuclear Information System (INIS)

    The first phase of this investigation, comprising of three groups of animals, was designed to study the fate of californium-252 chloride administered intraperitoneally, intravenously or intratracheally. The second phase, which consisted of two groups of animals, was designed to examine the effectiveness of DTPA chelation therapy in accelerating the excretion and preventing the deposition of californium-252 chloride instilled into the lungs of rats. Immediately following the dose administration of 2 uCi of californium-252 chloride which was dissolved in 0.2 ml of 0.9% NaCl at pH 3.5, each rat was placed in a metabolism cage. Each rat in the first group of phase II was given intraperitoneal injection of CaNa3 DTPA (50 mg/kg) and each rat in the second group was given intraperitoneal injections of 0.9% NaCl. Injections of the DTPA or the NaCl sham were initiated immediately after the intratracheal administration of californium-252 chloride and were continued every three days until sacrifice. Following intraperitoneal, intravenous or intratracheal administration, the whole body retention of californium as a function of time was described by a three component exponential equation. For each mode of administration the short term component exhibited a biological half-life of between 5 and 10 hours; the intermediate component between 4 and 6 days; and the long term component between 200 and 300 days. The organ data obtained following intraperitoneal and intravenous administration were indistinguishable. On day one, the liver retained about 9% of the administered dose and the kidneys retained 2.4%. Retention for these organs decreased to about 1% by day 32. The femurs maintained an almost constant level of 4.5% of the injected dose over the 32 days. The lungs, spleen, heart, and testes showed significant retention of californium

  1. ENEA results in the international comparison organized by BIPM for the measurament of neutron fluxes of a Californium source

    International Nuclear Information System (INIS)

    During the period between May 1978 and August 1984 under the auspices of Section III of CCEMRI of CIPM it has been carried out the international intercomparison of Californium neutron source emission rate. The previous intercomparison was based on Ra-Be (α -n) source measuraments, which took place between 1959 and 1965, and the results showed a total spread of +- 3%. Owing to the better accuracy achived over the following decade the Ra-Be intercomparison was no longer representative of the state of the art, therefore it was decided to arrange the intercomparison based on Californium which in the meantime reached a wide use in the world. Contributions to the intercomparison were received from fourteen laboratories representative of twelve Nations plus the BIPM. The results put into evidence a considerable advance on accuracy in the neutron source emission rate measuraments. The standard deviation of the residuals obtained from least square fit of normalized data resulted +- 0,57%. In the present report it is widely described the Manganese bath method used at ENEA, CRE Casaccia in Roma, and the experimental procedure followed for its absolute calibration. All measuraments are reported and analysed, including those effectuated for corrective factors determination. The final results obtained at ENEA for the circulated Californium source is (3,457 +- 0,013) 10*H7 neutron/s. The analysis of data from all partecipantes has been effectuated and concluded by J. Axton in March 1986 and the conclusions which have been showed in the present report put in evidence the satisfactory results achived by the ENEA

  2. Feasibility and market potential of protein determination of wheat using californium-252

    International Nuclear Information System (INIS)

    To evaluate the feasibility of protein determination by capture gamma-ray analysis using californium-252 neutrons, an in-situ protein analysis system for use by grain handlers has been examined. Three 227 kilogram (approximately) lots of wheat were used to determine the amount of nitrogen present. Protein analyses by the Kjeldahl method were obtained from samples taken before and after the capture gamma-ray analyses. The 5.267-MeV gamma-ray was selected for use in this study as a compromise between efficiency and interference from other elements. The associated counting equipment was a multichannel analyzer with pulse shaping electronic and analysis computing equipment. A linear regression program was used to compare the regions of interest to the Kjeldahl protein averages. The counts composing each peak were summed and normalized using the total count of the hydrogen peak. The normalized nitrogen percentages indicate a significant correlation between the spectral regions and the Kjeldahl analyses. To a first approximation, the value of wheat is the wheat protein. At the present time, protein testing of wheat is destructive, cumbersome, and time-consuming as compared to the potential for capture gamma-ray analysis testing. Assuming that such a protein analysis unit can analyze 42 tonne of wheat per hour, over 120 units would be needed to monitor one-half the U.S. annual wheat production. A 0.5% improvement in processor realizations and grain throughput value of $167.00 per tonne will result in a projected savings of $150,000 per year per unit

  3. Oxygen enhancement ratio (OER) and therapeutic gain factor (GF) for californium-252 at low dose rate

    International Nuclear Information System (INIS)

    The potential benefit of the introduction of californium-252 in interstitial and intracavitary therapy is related to the greater efficiency of its neutron emission against anoxic cancer cells. In that respect, the oxygen enhancement ratio (OER) of the 252Cf emission has been determined for a continuous low dose rate irradiation. The biological system is growth inhibition in Vicia faba bean roots. A new Vicia faba ''BelB'' strain has been used, which better tolerates long periods (up to about 10 hours) of anoxia. In a first series of experiments, for a 252Cf (Dsub(n+γ)) dose rate of 0.11 Gy.h-1, an OER of 1.4+-0.1 was observed (the γ contribution Dγ to the total absorbed dose Dsub(n+γ) was 0.35 at the position of the root tips). In a second series of experiments, in somewhat different geometrical conditions with a 252Cf (Dsub(n+γ)) dose rate of 0.13 Gy.h-1, an OER of 1.5+-0.1 was observed (Dγ/Dsub(n+γ)=0.42). The OER values observed for similar irradiation times, with iridium-192 γ-rays, were 2.3+-0.2 and 2.6+-0.1 respectively, which leads to therapeutic gain factors (GF) of 1.6 and 1.7 respectively. These GF values are slightly lower than those previously obtained (GF=1.8) on the same system, with d(50)-Be p(75)-Be and 15 MeV neutron beams

  4. Application of TSH bioindicator for studying the biological efficiency of neutrons from californium-252 source

    International Nuclear Information System (INIS)

    The effectiveness of neutrons from a Californium-252 source in the induction of various abnormalities in the Tradescantia clone 4430 stamen hair cells (TSH-assay) was studied. The special attention was paid to check whether any enhancement in effects caused by process of boron neutron capture is visible in the cells enriched with boron ions. Two chemicals (borax and BSH) were applied to introduce boron-10 ions into cells. Inflorescence, normal or pretreated with chemicals containing boron, were irradiated in the air with neutrons from a Cf-252 source at KAERI, Taejon, Korea. To estimate the relative biological effectiveness (RBE) in the induction of gene mutations of the neutron beam under the study, Tradescantia inflorescences, without any chemical pretreatment, were irradiated with various doses of X-rays. The ranges of radiation doses used were 0-0.1 Gy in neutrons and 0-0.5 Gy in X-rays. After the time needed to complete the postirradiation repair Tradescantia cuttings were transferred to Cracow, where screening of gene and lethal; mutations, cell cycle alterations in somatic cells have been done, and dose response relationships were figured. The maximal RBE values were estimated in the range of 4.6-6.8. Alterations of RBE value were observed; from 6.8 to 7.8 in the case of plants pretreated with 240 ppm of B-10 from borax, and 4.6 to 6.1 in the case of 400 ppm of B-10 from BSH. Results showed a slight, although statistically insignificant increase in biological efficacy of radiation from the Cf-252 source in samples pretreated with boron containing chemicals. (author)

  5. Uncovering the nucleus candidate for NGC 253

    CERN Document Server

    Günthardt, G I; Camperi, J A; Díaz, R J; Gomez, P L; Bosch, G; Schirmer, M

    2015-01-01

    NGC253 is the nearest spiral galaxy with a nuclear starburst which becomes the best candidate to study the relationship between starburst and AGN activity. However, this central region is veiled by large amounts of dust, and it has been so far unclear which is the true dynamical nucleus. The near infrared spectroscopy could be advantageous in order to shed light on the true nucleus identity. Using Flamingos-2 at Gemini South we have taken deep K-band spectra along the major axis and through the brightest infrared source. We present evidence showing that the brightest near infrared and mid infrared source in the central region, already known as radio source TH7 and so far considered just a stellar supercluster, in fact, presents various symptoms of a genuine galactic nucleus. Therefore, it should be considered a valid nucleus candidate. It is the most massive compact infrared object in the central region, located at 2.0" of the symmetry center of the galactic bar. Moreover, our data indicate that this object i...

  6. Divalent and trivalent gas-phase coordination complexes of californium: evaluating the stability of Cf(ii).

    Science.gov (United States)

    Dau, Phuong D; Shuh, David K; Sturzbecher-Hoehne, Manuel; Abergel, Rebecca J; Gibson, John K

    2016-08-01

    The divalent oxidation state is increasingly stable relative to the trivalent state for the later actinide elements, with californium the first actinide to exhibit divalent chemistry under moderate conditions. Although there is evidence for divalent Cf in solution and solid compounds, there are no reports of discrete complexes in which Cf(II) is coordinated by anionic ligands. Described here is the divalent Cf methanesulfinate coordination complex, Cf(II)(CH3SO2)3(-), prepared in the gas phase by reductive elimination of CH3SO2 from Cf(III)(CH3SO2)4(-). Comparison with synthesis of the corresponding Sm and Cm complexes reveals reduction of Cf(III) and Sm(III), and no evidence for reduction of Cm(III). This reflects the comparative 3+/2+ reduction potentials: Cf(3+) (-1.60 V) ≈ Sm(3+) (-1.55 V) ≫ Cm(3+) (-3.7 V). Association of O2 to the divalent complexes is attributed to formation of superoxides, with recovery of the trivalent oxidation state. The new gas-phase chemistry of californium, now the heaviest element to have been studied in this manner, provides evidence for Cf(II) coordination complexes and similar chemistry of Cf and Sm. PMID:27424652

  7. Hypoxic versus normoxic external-beam irradiation of cervical carcinoma combined with californium-252 neutron brachytherapy. Comparative treatment results of a 5-year randomized study

    Czech Academy of Sciences Publication Activity Database

    Tačev, T.; Vacek, Antonín; Ptáčková, B.; Strnad, V.

    2005-01-01

    Roč. 181, č. 5 (2005), s. 273-284. ISSN 0179-7158 Institutional research plan: CEZ:AV0Z50040507 Keywords : cervical carcinoma * hypoxyradiotherapy * californium-252 Subject RIV: BO - Biophysics Impact factor: 3.490, year: 2005

  8. Solving the Hydration Structure of the Heaviest Actinide Aqua Ion Known: The Californium(III) Case

    Energy Technology Data Exchange (ETDEWEB)

    Den Auwer, Ch.; Guillaumont, D. [CEA Marcoule, Nucl Energy Div, Radiochem Proc Dept, SCPS LILA, 30 (France); Galbis, E.; Pappalardo, Rafael R.; Marcos Sanchez, E. [Univ Seville, Dept Quim Fis, E-41012 Seville (Spain); Hernandez-Cobos, J. [Inst Ciencias Fis, Cuernavaca 62251, Morelos (Mexico); Le Naour, C.; Simoni, E. [Univ Paris Sud, Inst Phys Nucl Orsay, Paris (France)

    2010-07-01

    In summary, the first MC simulation of the trivalent cation of californium, based on an exchangeable hydrated ion-water intermolecular potential, has been shown to extend and improve the hydrated ion model. Likewise, the CfL{sub III}-edge EXAFS spectrum of an acidic 1 mm Cf(ClO{sub 4}){sub 3} aqueous solution recorded under optimized experimental conditions has greatly improved the signal/noise ratio of the only previously recorded spectrum. The comparison of the experimental EXAFS spectrum with the two computed ones, obtained from two different intermolecular potentials that predict eight (BP86) or nine (MP2) water molecules in the first coordination shell, leads to the conclusion that the lowest hydration number is preferred. Then, as Cf{sup III} is the heaviest actinide aqua ion for which there is experimental information, the actinide contraction is supported by the present study. (For U{sup III}, R{sub U-O}=2.56 Angstroms, and CN=9{+-}1; for Pu{sup III}, R{sub Pu-O}=2.51 Angstroms and CN=9{+-}1; for Cm{sup III}, R{sub Cm-O}=2.47 Angstroms and CN=9{+-}1). The role of the second hydration shell is important in defining the structure and dynamics of the Cf{sup III} aqua ion, but the contribution of second-shell water molecules to the EXAFS signal as back-scatters is marginal. Finally, this work gives an illustrative example of the benefits which can be achieved from the combination of experimental X-ray absorption spectroscopy and computer simulations. The usefulness of the simultaneous analysis of the results as well as the importance of the structural statistical average has been clearly demonstrated herein. Each technique independently was not adequate. We believe that this study traces out a still poorly explored combined methodology which may be extremely useful for many other complexes and chemical problems. A systematic theoretical and experimental examination of the other known actinide cations on the same basis should be undertaken to confirm the

  9. Design, construction, and characterization of a facility for neutron capture gamma ray analysis of sulfur in coal using californium-252

    International Nuclear Information System (INIS)

    A study of neutron capture gamma ray analysis of sulfur in coal using californium-252 as a neutron source is reported. Both internal and external target geometries are investigated. The facility designed for and used in this study is described. The external target geometry is found to be inappropriate because of the low thermal neutron flux at the sample location, which must be outside the biological shielding. The internal target geometry is found to have a sufficient thermal neutron flux, but an excessive gamma ray background. A water filled plastic facility, rather than the paraffin filled steel one used in this study, is suggested as a means of increasing flexibility and decreasing the beackground in the internal target geometry

  10. 7 CFR 253.10 - Commodity control, storage and distribution.

    Science.gov (United States)

    2010-01-01

    ... in relation to population density of eligible households. (10) Days and hours of distribution are... 7 Agriculture 4 2010-01-01 2010-01-01 false Commodity control, storage and distribution. 253.10... SERVICE, DEPARTMENT OF AGRICULTURE GENERAL REGULATIONS AND POLICIES-FOOD DISTRIBUTION ADMINISTRATION...

  11. 17 CFR 256.253 - Other deferred credits.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Other deferred credits. 256... HOLDING COMPANY ACT OF 1935 8. Deferred Credits § 256.253 Other deferred credits. This account shall include advance billings and receipts and other deferred credit items, not provided for...

  12. 40 CFR 180.253 - Methomyl; tolerances for residues.

    Science.gov (United States)

    2010-07-01

    ... PROGRAMS TOLERANCES AND EXEMPTIONS FOR PESTICIDE CHEMICAL RESIDUES IN FOOD Specific Tolerances § 180.253... methomyl (S-methyl N- thioacetimidate) in or on the food commodities as follows: Commodity Parts per..., Chinese, bok choy 5 Cabbage, Chinese, napa 5 Cauliflower 2 Celery 3 Collards 6 Corn, field, forage 10...

  13. 37 CFR 253.7 - Recording rights, rates and terms.

    Science.gov (United States)

    2010-07-01

    ... sheets or summaries. PBS and its stations, NPR, or other television public broadcasting entity shall... NONCOMMERCIAL EDUCATIONAL BROADCASTING § 253.7 Recording rights, rates and terms. (a) Scope. This section... than compositions subject to voluntary license agreements, on and for the radio and television...

  14. 37 CFR 253.6 - Performance of musical compositions by other public broadcasting entities.

    Science.gov (United States)

    2010-07-01

    ... compositions by other public broadcasting entities. 253.6 Section 253.6 Patents, Trademarks, and Copyrights... CERTAIN COPYRIGHTED WORKS IN CONNECTION WITH NONCOMMERCIAL EDUCATIONAL BROADCASTING § 253.6 Performance of musical compositions by other public broadcasting entities. (a) Scope. This section applies to...

  15. 27 CFR 46.253 - Destruction of articles by a Presidentially-declared major disaster.

    Science.gov (United States)

    2010-04-01

    ... a Presidentially-declared major disaster. 46.253 Section 46.253 Alcohol, Tobacco Products and....253 Destruction of articles by a Presidentially-declared major disaster. After the dealer has paid the..., or condemned because of a Presidentially-declared major disaster. Subpart C of this part...

  16. Operational experience with the Argonne National Laboratory Californium Rare Ion Breeder Upgrade facility and electron cyclotron resonance charge breeder

    Science.gov (United States)

    Vondrasek, R.; Clark, J.; Levand, A.; Palchan, T.; Pardo, R.; Savard, G.; Scott, R.

    2014-02-01

    The Californium Rare Ion Breeder Upgrade (CARIBU) of the Argonne National Laboratory Argonne Tandem Linac Accelerator System (ATLAS) facility provides low-energy and accelerated neutron-rich radioactive beams to address key nuclear physics and astrophysics questions. A 350 mCi 252Cf source produces fission fragments which are thermalized and collected by a helium gas catcher into a low-energy particle beam with a charge of 1+ or 2+. An electron cyclotron resonance (ECR) ion source functions as a charge breeder in order to raise the ion charge sufficiently for acceleration in the ATLAS linac. The ECR charge breeder has achieved stable beam charge breeding efficiencies of 10.1% for 23Na7+, 17.9% for 39K10+, 15.6% for 84Kr17+, and 12.4% for 133Cs27+. For the radioactive beams, a charge breeding efficiency of 11.7% has been achieved for 143Cs27+ and 14.7% for 143Ba27+. The typical breeding times are 10 ms/charge state, but the source can be tuned such that this value increases to 100 ms/charge state with the best breeding efficiency corresponding to the longest breeding times—the variation of efficiencies with breeding time will be discussed. Efforts have been made to characterize and reduce the background contaminants present in the ion beam through judicious choice of q/m combinations. Methods of background reduction are being investigated based upon plasma chamber cleaning and vacuum practices.

  17. Long-term effects of an intracavitary treatment with californium-252 on normal tissue. [Swine, /sup 226/Ra

    Energy Technology Data Exchange (ETDEWEB)

    Sullivan, M.F.; Beamer, J.L.; Mahony, T.D.; Cross, F.T.; Lund, J.E.; Endres, G.W.R.

    1976-01-01

    About one hundred fifty swine were exposed to either radium-226 or californium-252 sources in the uterine cervix to determine an RBE for both acute and long-term effects. That value for early changes in the tissues at risk in the treatment of cervical cancer was between 6.2 and 6.8. The incidence of complications increased with time after exposure, especially among animals treated with /sup 252/Cf. Analysis of rectal injury showed that ulceration occurred frequently within a year postexposure at doses between 1600 and 2400 rad calculated at 2 cm lateral to the source midline. Fat necrosis and smooth muscle atrophy, resulting in a local rectal stricture, were delayed changes observed in some animals. The lower ureter was the site for a greater frequency of complications than the GI tract. Ureteral stricture often occurred at doses of 1200 rad from /sup 252/Cf and 7000 rad from /sup 226/Ra. Observation of delayed effects in the uterine-cervix in animals held up to 4 years postexposure indicate that the RBE for /sup 252/Cf may be increased to a value as high as 18, while repair may have even decreased it to about 5.6 in the rectum. Fifty swine are still being observed for long-term effects after doses above 800 rad from /sup 252/Cf and 5000 rad from /sup 226/Ra.

  18. ACA [CI] observations of the starburst galaxy NGC 253

    Science.gov (United States)

    Krips, M.; Martín, S.; Sakamoto, K.; Aalto, S.; Bisbas, T. G.; Bolatto, A. D.; Downes, D.; Eckart, A.; Feruglio, Ch.; García-Burillo, S.; Geach, J.; Greve, T. R.; König, S.; Matsushita, S.; Neri, R.; Offner, S.; Peck, A. B.; Viti, S.; Wagg, J.

    2016-07-01

    Context. Carbon monoxide (CO) is widely used as a tracer of the molecular gas in almost all types of environments. However, several shortcomings of CO complicate usaging it as H2 tracer, such as its optical depth effects, the dependence of its abundance on metallicity, or its susceptibility to dissociation in highly irradiated regions. Neutral carbon emission has been proposed to overcome some of these shortcomings and hence to help revealing the limits of CO as a measure of the molecular gas. Aims: We aim to study the general characteristics of the spatially and spectrally resolved carbon line emission in a variety of extragalactic sources and evaluate its potential as complementary H2 tracer to CO. Methods: We used the Atacama Compact Array to map the [CI](3P1-3P0) line emission in the nearby starburst galaxy NGC 253 at unprecedented angular resolution (~3''). This is the first well-resolved interferometric [CI] map of an extragalactic source. Results: We have detected the [CI] line emission at high significance levels along the central disk of NGC 253 and its edges where expanding shells have previously been found in CO. Globally, the distribution of the [CI] line emission strongly resembles that of CO, confirming the results of previous Galactic surveys that [CI] traces the same molecular gas as CO. However, we also identify a significant increase of [CI] line emission with respect to CO in (some of) the outflow or shocked regions of NGC 253, namely the bipolar outflow emerging from the nucleus. A first-order estimate of the [CI] column densities indicates abundances of [CI] that are very similar to the abundance of CO in NGC 253. Interestingly, we find that the [CI] line is marginally optically thick within the disk. Conclusions: The enhancement of the [CI]/CO line ratios (~0.4-0.6) with respect to Galactic values (≤0.1), especially in the shocked regions of NGC 253, clearly indicates that mechanical perturbation such as shocks and the strong radiation

  19. Results with the electron cyclotron resonance charge breeder for the 252Cf fission source project (Californium Rare Ion Breeder Upgrade) at Argonne Tandem Linac Accelerator System

    International Nuclear Information System (INIS)

    The construction of the Californium Rare Ion Breeder Upgrade, a new radioactive beam facility for the Argonne Tandem Linac Accelerator System (ATLAS), is nearing completion. The facility will use fission fragments from a 1 Ci 252Cf source; thermalized and collected into a low-energy particle beam by a helium gas catcher. In order to reaccelerate these beams, an existing ATLAS electron cyclotron resonance (ECR) ion source was redesigned to function as an ECR charge breeder. Thus far, the charge breeder has been tested with stable beams of rubidium and cesium achieving charge breeding efficiencies of 9.7% into 85Rb17+ and 2.9% into 133Cs20+.

  20. Ab initio full-potential study of mechanical properties and magnetic phase stability of californium monopnictides (CfN and CfP)

    Science.gov (United States)

    Amari, S.; Bouhafs, B.

    2016-09-01

    Based on the first-principles methods, the structural, elastic, electronic, properties and magnetic ordering of californium monopnictides CfX (X = P) have been studied using the full-potential augmented plane wave plus local orbitals (FP-L/APW + lo) method within the framework of density functional theory (DFT). The electronic exchange correlation energy is described by generalized gradient approximation GGA and GGA+U (U is the Hubbard correction). The GGA+U method is applied to the rare-earth 5f states. We have calculated the lattice parameters, bulk modulii and the first pressure derivatives of the bulk modulii. The elastic properties of the studied compounds are only investigated in the most stable calculated phase. In order to gain further information, we have calculated Young's modulus, shear modulus, anisotropy factor and Kleinman parameter by the aid of the calculated elastic constants. The results mainly show that californium monopnictides CfX (X = P) have an antiferromagnetic spin ordering. Density of states (DOS) and charge densities for both compounds are also computed in the NaCl (B1) structure.

  1. 43 CFR 30.253 - How must minors or other legal incompetents be represented?

    Science.gov (United States)

    2010-10-01

    ... 43 Public Lands: Interior 1 2010-10-01 2010-10-01 false How must minors or other legal incompetents be represented? 30.253 Section 30.253 Public Lands: Interior Office of the Secretary of the... legal incompetents be represented? Minors and other legal incompetents who are interested parties...

  2. 30 CFR 253.50 - How can MMS refuse or invalidate my OSFR evidence?

    Science.gov (United States)

    2010-07-01

    ... evidence? 253.50 Section 253.50 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR... demonstration is based. (c) If MMS determines you are not complying with the requirements of this part for any... can MMS refuse or invalidate my OSFR evidence? (a) If MMS determines that any OSFR evidence you...

  3. 48 CFR 253.213-70 - Completion of DD Form 1155, Order for Supplies or Services.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Completion of DD Form 1155... Forms 253.213-70 Completion of DD Form 1155, Order for Supplies or Services. Follow the procedures at PGI 253.213-70 for completion of DD Form 1155....

  4. 48 CFR 253.215-70 - DD Form 1547, Record of Weighted Guidelines Application.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false DD Form 1547, Record of... Forms 253.215-70 DD Form 1547, Record of Weighted Guidelines Application. Follow the procedures at PGI 253.215-70 for completing DD Form 1547....

  5. 48 CFR 253.208-2 - DD Form 448-2, Acceptance of MIPR.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false DD Form 448-2, Acceptance... REGULATIONS SYSTEM, DEPARTMENT OF DEFENSE CLAUSES AND FORMS FORMS Prescription of Forms 253.208-2 DD Form 448-2, Acceptance of MIPR. Follow the procedures at PGI 253.208-2 for use of DD Form 448-2....

  6. 44 CFR 206.253 - Insurance requirements for facilities damaged by disasters other than flood.

    Science.gov (United States)

    2010-10-01

    ... facilities damaged by disasters other than flood. 206.253 Section 206.253 Emergency Management and Assistance FEDERAL EMERGENCY MANAGEMENT AGENCY, DEPARTMENT OF HOMELAND SECURITY DISASTER ASSISTANCE FEDERAL DISASTER... by disasters other than flood. (a) Prior to approval of a Federal grant for the restoration of...

  7. Long-term effects of intratracheally instilled 253EsCl3 in rats

    International Nuclear Information System (INIS)

    ts administered 253EsCl3 by intratracheal instillation developed more bone tumors and fewer lung tumors than similar rats administered 239Pu(NO3)4. In explanation, it is suggested that 253Es may irradiatete bone surface cells more effectively while 239Pu may irradiate a greater total number of cells in the lung. (U.S.)

  8. 30 CFR 253.31 - How can I use a surety bond as OSFR evidence?

    Science.gov (United States)

    2010-07-01

    ...? 253.31 Section 253.31 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR... you submit to MMS as OSFR evidence must: (1) Be licensed to do business in the State in which the... participation in insurance-type risks. (b) A surety bond that you submit as OSFR evidence must include all...

  9. 29 CFR 779.253 - What is included in computing the total annual inflow volume.

    Science.gov (United States)

    2010-07-01

    ... volume. 779.253 Section 779.253 Labor Regulations Relating to Labor (Continued) WAGE AND HOUR DIVISION... computing the total annual inflow volume. The goods which the establishment purchases or receives for resale that move or have moved across State lines must “amount in total annual volume to $250,000 or more.”...

  10. Anatomy of a controversy: Application of the Langevin technique to the analysis of the Californium-252 Source-Driven Noise Analysis method for subcriticality determination

    International Nuclear Information System (INIS)

    The expressions for the power spectral density of the noise equivalent sources have been calculated explicitly for the (a) stochastic transport equation, (b) the one-speed transport equaton, (c) the one-speed P1 equations, (d) the one-speed diffusion equation and (e) the point kinetic equation. The stochastic nature of Fick's law in (d) has been emphasized. The Langevin technique has been applied at various levels of approximation to the interpretation of the Californium-252 Source-Driven Noise Analysis (CSDNA) experiment for determining the reactivity in subcritical media. The origin of the controversy surrounding this method has been explained. The foundations of the CSDNA method as a viable experimental technique to infer subcriticality from a measured ratio of power spectral densities of the outputs of two neutron detectors and a third external source detector has been examined by solving the one-speed stochastic diffusion equation for a point external Californium-252 source and two detectors in an infinite medium. The expression relating reactivity to the measured ratio of PSDs was found to depend implicitly on k itself. Through a numerical analysis fo this expression, the authors have demonstrated that for a colinear detector-source-detector configuration for neutron detectors far from the source, the expression for the subcritical multiplication factor becomes essentially insensitive to k, hence, demonstrating some possibility for the viability of this technique. However, under more realistic experimental conditions, i.e., for finite systems in which diffusion theroy is not applicable, the measurement of the subcritical multiplication factor from a single measured ratio of PSDs, without extensive transport calculations, remains doubtful

  11. Application of SCGE assay, classical cytogenetics and FISH for studying in vitro californium-252 neutrons irradiations and BSH pretreatment on human lymphocytes

    International Nuclear Information System (INIS)

    Recently, there has been observed a tendency to apply various energy neutrons for tumor therapy and particularly low energy neutrons from various sources, including californium-252 source, for cancer radiotherapy based on the neutron capture. In this study peripheral blood lymphocytes were used as a model for human cells and three methods were applied to assess the effectiveness of californium-252 neutrons irradiations in vitro in normal cells or pre-treated with compound enriched in B-10 ion. Human blood samples or isolated lymphocytes were irradiated with neutrons from isotopic 252Cf source at the Faculty of Nuclear Physics and Technics at University of Mining and Metallurgy (both neutron source and samples were placed in polyethylene block). Chemical pretreatment with BSH (Na210B12H11SH) was done to introduce boron-10 ion into cells in order to check any enhancement effect due to the process of boron neutron capture. Comet assay was done to investigate the DNA damage. Classical cytogenetics was applied to assess the frequencies of unstable aberrations (dicentrics and rings). Fluorescence in situ hybridization (FISH) with probes for chromosomes 1, 4 (14.3% of whole genome) and pancentromeric probe was performed to evaluate the frequencies of stable aberrations. Linear (or close to linear) increase of DNA damage and aberration frequency was observed with dose of radiation both for lymphocytes untreated or pre-treated with BSH. Very little differences (statistically insignificant) due to radiation dose and BSH pretreatment were observed in the frequencies of SCEs detected in the second mitosis. There is no significant difference between boron pre-treated and not treated cells, and even slightly higher effects were observed in case of the highest dose without BSH pretreatment. The level of translocations observed is comparable with the frequencies of dicentrics and rings. (author)

  12. 37 CFR 253.5 - Performance of musical compositions by public broadcasting entities licensed to colleges and...

    Science.gov (United States)

    2010-07-01

    ... compositions by public broadcasting entities licensed to colleges and universities. 253.5 Section 253.5 Patents... BROADCASTING § 253.5 Performance of musical compositions by public broadcasting entities licensed to colleges... terms of this section. (c) Royalty rate. A public broadcasting entity within the scope of this...

  13. 30 CFR 253.12 - May I ask MMS for a determination of whether I must demonstrate OSFR?

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false May I ask MMS for a determination of whether I must demonstrate OSFR? 253.12 Section 253.12 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT... Amount of OSFR § 253.12 May I ask MMS for a determination of whether I must demonstrate OSFR? You...

  14. Spectroscopy of Globular Clusters in the Sculptor Group Galaxies NGC 253 and NGC 55

    CERN Document Server

    Beasley, M A

    1999-01-01

    We have obtained spectra for 103 published globular cluster candidates in the Sculptor Group galaxies NGC 253 and NGC 55. On the basis of radial velocities and digitized plate images, 14 globular clusters are identified in NGC 253 and one probable globular cluster is identified in NGC 55. The majority of the objects in the sample appear to be background galaxies. We have obtained and analysed COSMOS plate scans of NGC 253 and NGC 55 and use these along with the spectroscopically identified clusters to define new samples of globular cluster candidates in the two galaxies which should have reduced contamination.

  15. Californium-252 neutron sources

    International Nuclear Information System (INIS)

    Major production programs for the Savannah River reactors and the High Flux Isotopes Reactor at Oak Ridge have made 252Cf one of the most available and, at the USAEC's sales price of $10/μg, one of the least-expensive isotopic neutron sources. Reactor production has totaled approximately 2 g, and, based on expected demand, an additional 10 g will be produced in the next decade. The approximately 800 mg chemically separated to date has been used to prepare over 600 neutron sources. Most, about 500, have been medical sources containing 1 to 5 μg of 252Cf plated in needles for experimental cancer therapy studies. The remainder have generally been point sources containing 10 μg to 12 mg of oxide for activation, well logging, or radiography uses. Bulk sources have also been supplied to the commercial encapsulators. The latest development has been the production of 252Cf cermet wire which can be cut into almost contamination-free lengths of the desired 252Cf content. Casks are available for transport of sources up to 50 mg. Subcritical assemblies have been developed to multiply the source neutrons by a factor of 10 to 40, and collimators and thermalizers have also been extensively developed to shape the neutron flux and energy distributions for special applications. (U.S.)

  16. Calculations of Nuclear Astrophysics and Californium Fission Neutron Spectrum Averaged Cross Section Uncertainties Using ENDF/B-VII.1, JEFF-3.1.2, JENDL-4.0 and Low-fidelity Covariances

    International Nuclear Information System (INIS)

    Nuclear astrophysics and californium fission neutron spectrum averaged cross sections and their uncertainties for ENDF materials have been calculated. Absolute values were deduced with Maxwellian and Mannhart spectra, while uncertainties are based on ENDF/B-VII.1, JEFF-3.1.2, JENDL-4.0 and Low-Fidelity covariances. These quantities are compared with available data, independent benchmarks, EXFOR library, and analyzed for a wide range of cases. Recommendations for neutron cross section covariances are given and implications are discussed

  17. Oxidation-reduction properties of americium, curium, berkelium, californium, einsteinium and fermium, and thermodynamic consequences for the 5f series

    International Nuclear Information System (INIS)

    The amalgamation of 5f elements from Am to Fm has been studied by using 241Am, 244Cm, 249Bk, 249Cf, 252Cf, 253Es, 254Es, 252Fm and 255Fm with two electrochemical methods, radiocoulometry and radiopolarography, perfectly adapted to investigate extremely diluted solutions when the concentration of electroactive species is as low as 10-16M. The theory of radiocoulometry has been developed in the general cases of reversible and irreversible electrode process. It has been used to interpret the experimental data on the kinetic curves of amalgamation, and to estimate the standard rate constant of the electrode process in complexing medium (citric). On the other hand the radiopolarographic method has been applied to study the mechanism of reduction at the dropping mercury electrode of cations M3+ in aqueous medium to the metal M with formation of amalgam. The results are exploited into two directions: 1- Acquisition of some data concerning the oxidation-reduction properties of elements from Am to Fm. Therefore the standard electrode E0 [M(III-0)] potentials for Bk, Cf and Es, and the standard electrode E0 [M(II-0)] potential for Fm are estimated and the relative stability of each oxidation state (from II to VII) of 5f elements is discussed; 2- Acquisition of unknown thermodynamic data on transcalifornium elements. Correlations between 4f and 5f elements are precised and some divergences appear for the second half of 4f and 5f series (i.e. for 65<=Z<=71 and 97<=Z<=103)

  18. Californium interrogation prompt neutron (CIPN) instrument for non-destructive assay of spent nuclear fuel-Design concept and experimental demonstration

    Science.gov (United States)

    Henzlova, D.; Menlove, H. O.; Rael, C. D.; Trellue, H. R.; Tobin, S. J.; Park, Se-Hwan; Oh, Jong-Myeong; Lee, Seung-Kyu; Ahn, Seong-Kyu; Kwon, In-Chan; Kim, Ho-Dong

    2016-01-01

    This paper presents results of the first experimental demonstration of the Californium Interrogation Prompt Neutron (CIPN) instrument developed within a multi-year effort launched by the Next Generation Safeguards Initiative Spent Fuel Project of the United States Department of Energy. The goals of this project focused on developing viable non-destructive assay techniques with capabilities to improve an independent verification of spent fuel assembly characteristics. For this purpose, the CIPN instrument combines active and passive neutron interrogation, along with passive gamma-ray measurements, to provide three independent observables. This paper describes the initial feasibility demonstration of the CIPN instrument, which involved measurements of four pressurized-water-reactor spent fuel assemblies with different levels of burnup and two initial enrichments. The measurements were performed at the Post-Irradiation Examination Facility at the Korea Atomic Energy Institute in the Republic of Korea. The key aim of the demonstration was to evaluate CIPN instrument performance under realistic deployment conditions, with the focus on a detailed assessment of systematic uncertainties that are best evaluated experimentally. The measurements revealed good positioning reproducibility, as well as a high degree of insensitivity of the CIPN instrument's response to irregularities in a radial burnup profile. Systematic uncertainty of individual CIPN instrument signals due to assembly rotation was found to be orientation in the instrument.

  19. Large family of compact radio sources in the starburst nucleus of NGC 253

    International Nuclear Information System (INIS)

    Deep VLA maps of NGC 253 show that it has at least 35 compact radio sources similar to those in the prototypical IR starburst galaxy M82. It is noted that NGC 253 is a twin of M82 in IR spectrum and luminosity as well as distance. Some of the sources in M82 which are rapidly expanding and fading are believed to be extremely young supernova remnants. Most of the sources detected in NGC 253 are unresolved or only marginally resolved, with typical diameters no greater than 2-5 pc. If they are young supernova remnants expanding at 12,000 km/s, the source ages are no more than 160-400 yr. This requires a supernova rate of about 1/0.1 yr. If the compact radio sources are indeed young supernova remnants, star formation must have ceased shortly after the progenitors of the current supernovae were produced. 12 references

  20. Late effects of inhaled 253Es(NO3)3 in the rat

    International Nuclear Information System (INIS)

    The lungs of rats exposed to 253Es(NO3)3 aerosols sustained the greatest cumulative radiation dose, approximately 6-fold higher than the skeletal dose. Malignant lung tumors (incidence 8.5, 27.6%) were observed after a mean cumulative lung dose of 26 and 400 rad, respectively. Higher lung doses were associated with severe life shortening that precluded the expression of delayed effects. Osteosarcomas of the skeleton (incidence 6.9%) were found after a mean cumulative skeletal dose of 68 rad. Earlier studies, which showed a high incidence of bone tumors and relatively fewer lung tumors after intratracheal instillation of 253EsCl3, were not confirmed in this study with inhaled 253Es(NO3)3

  1. High energy (gamma)-ray emission from the starburst nucleus of NGC 253

    Energy Technology Data Exchange (ETDEWEB)

    Domingo-Santamaria, E; Torres, D F

    2005-06-15

    The high density medium that characterizes the central regions of starburst galaxies and its power to accelerate particles up to relativistic energies make these objects good candidates as {gamma}-rays sources. In this paper, a self-consistent model of the multifrequency emission of the starburst galaxy NGC 253, from radio to gamma-rays, is presented. The model is in agreement with all current measurements and provides predictions for the high energy behavior of the NGC 253 central region. Prospects for observations with the HESS array and GLAST satellite are especially discussed.

  2. 40 CFR 147.253 - Existing Class I, II (except enhanced recovery and hydrocarbon storage) and III wells authorized...

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 22 2010-07-01 2010-07-01 false Existing Class I, II (except enhanced recovery and hydrocarbon storage) and III wells authorized by rule. 147.253 Section 147.253 Protection of... recovery and hydrocarbon storage) and III wells authorized by rule. Maximum injection pressure. The...

  3. 30 CFR 253.14 - How do I determine the worst case oil-spill discharge volume?

    Science.gov (United States)

    2010-07-01

    ... discharge volume that you determined under whichever of the following regulations applies: (1) 30 CFR Part... estimate for the first 24 hours. (2) 40 CFR Part 112—Oil Pollution Prevention; or (3) 49 CFR Part 194... discharge volume? 253.14 Section 253.14 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF...

  4. G0.253+0.016: A centrally condensed, high-mass protocluster

    CERN Document Server

    Rathborne, J M; Jackson, J M; Foster, J B; Contreras, Y; Garay, G; Testi, L; Alves, J F; Bally, J; Bastian, N; Kruijssen, J M D; Bressert, E

    2014-01-01

    Despite their importance as stellar nurseries and the building blocks of galaxies, very little is known about the formation of the highest mass clusters. The dense clump G0.253+0.016 represents an example of a clump that may form an Arches-like, high-mass cluster. Here we present molecular line maps toward G0.253+0.016 taken as part of the MALT90 molecular line survey, complemented with APEX observations. Combined, these data reveal the global physical properties and kinematics of G0.253+0.016. Recent Herschel data show that while the dust temperature is low (~19 K) toward its centre, the dust temperature on the exterior is higher (~27 K) due to external heating. Our new molecular line data reveal that, overall, the morphology of dense gas detected toward G0.253+0.016 matches very well its IR extinction and dust continuum emission. An anti-correlation between the dust and gas column densities toward its centre indicates that the clump is centrally condensed with a cold, dense interior in which the molecular g...

  5. The world on a train: global narration in Geoff Ryman’s 253

    Directory of Open Access Journals (Sweden)

    Berthold Schoene,

    2013-08-01

    Full Text Available The focus of this essay is an exploration of Geoff Ryman’s interactive novel 253, which was originally released online as 253, or Tube Theatre: A Novel for the Internet on London Underground in Seven Cars and a Crash and then, two years later in 1998, also as a ‘print remix’. Examining Ryman’s text as an example of contemporary global narration, Schoene explores the cosmopolitan techniques and structural devices employed in 253 not merely to envisage the individual’s immersion in global community but to facilitate an enduring interactive experience of it. Aligning the hypertextuality of 253 with Jean-Luc Nancy’s philosophy of community, Schoene argues that Ryman’s use of hyperlinks does not destroy plot, but deconstructs it, reconceiving it as fluid and ‘inoperative’ instead of strictly telos-driven. With close reference to Ryman’s ‘The World on a Train’, his BBC News tribute to the 52 victims of the 7/7 London terrorist attacks, the essay concludes by looking at the new cosmopolitical currency acquired by Ryman’s novel – a currency it did not originally have in the mid-1990s.

  6. 48 CFR 253.208-1 - DD Form 448, Military Interdepartmental Purchase Request.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false DD Form 448, Military... DD Form 448, Military Interdepartmental Purchase Request. Follow the procedures at PGI 253.208-1 for use of DD Form 448....

  7. 30 CFR Appendix to Part 253 - List of U.S. Geological Survey Topographic Maps

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false List of U.S. Geological Survey Topographic Maps Appendix to Part 253 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR OFFSHORE OIL.... Geological Survey Topographic Maps Alabama (1:24,000 scale): Bellefontaine; Bon Secour Bay; Bridgehead;...

  8. Ozone decomposition under the irradiation of 253.7 nm in the presence of methyl bromide

    Institute of Scientific and Technical Information of China (English)

    2000-01-01

    In this paper the mechanism and kinetic of ozone decomposition under the irradiation of 253.7 nm UV-light were studied.The quantum yield of the ozone depletion in the presence of methyl bromide is further determined and a reaction model is provided to explain the experimental fact.

  9. Jiaxing Eastern Steel Cord Co., Ltd. Invested USD 253 Million for Expansion

    Institute of Scientific and Technical Information of China (English)

    Hao Tian

    2012-01-01

    To develop the company, Jiaxing Eastern Cord Co., Ltd. determined to invest USD 253 million (amounting to RMB 1.593 billion yuan) to construct a new factory in Jiaxing Economic and Technological Development Zone with steel cord annual production capacity of 80 thousand tons and solar silicon wafer cutting wire annual production capacity of 20 thousand tons by off- site expansion.

  10. 42 CFR 441.253 - Sterilization of a mentally competent individual aged 21 or older.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 4 2010-10-01 2010-10-01 false Sterilization of a mentally competent individual... LIMITS APPLICABLE TO SPECIFIC SERVICES Sterilizations § 441.253 Sterilization of a mentally competent individual aged 21 or older. FFP is available in expenditures for the sterilization of an individual only...

  11. 7 CFR 1944.253 - Notice of funding availability, application process and selection.

    Science.gov (United States)

    2010-01-01

    ... Housing Services Program § 1944.253 Notice of funding availability, application process and selection. (a... selection process. The Secretary concerned will designate the maximum allowable size for grants. (b... 7 Agriculture 13 2010-01-01 2009-01-01 true Notice of funding availability, application...

  12. Biological Efficiency of Californium-252 Source Evaluated by Comet Assay, Classical Cytogenetics and FISH in Human Lymphocytes Irradiated without and with BSH Pretreatment

    International Nuclear Information System (INIS)

    Biological effectiveness of californium-252 source was evaluated after irradiations in vitro of normal or pre-treated with compound enriched in B-10 ion cells. Peripheral blood lymphocytes were used as a model for human cells. DNA and chromosomal damage were studied to compare biological effectiveness of irradiation. Human blood samples or isolated lymphocytes were irradiated with the isotopic source of 252Cf, at the Faculty of Physics and Nuclear Techniques at the University of Mining and Metallurgy (both neutron source and samples were placed in ''infinite'' polyethylene block). Chemical pretreatment with Na210B12H11SH (BSH) was performed to introduce boron-10 ion into cells in order to check any enhancement effect due to the process of boron neutron capture. Single cell gel electrophoresis also known as the Comet assay was done to investigate the DNA damage. Classical cytogenetic analysis was applied to assess the frequencies of unstable aberrations (dicentrics, rings and a centric fragments). To evaluate the frequencies of stable aberrations the fluorescence in situ hybridisation (FISH) with probes for chromosomes 1, 4 (14.3% of the whole genome) was performed. Linear (or close to linear) increase with radiation dose were observed for the DNA damage and aberration frequencies in lymphocytes both untreated or pre-treated with BSH. Levels of translocations evaluated for the whole genome were comparable with the frequencies of dicentrics and rings. No significant differences were detected due to radiation dose in the frequencies of sister chromatid exchanges (SCE) detected in the second mitosis. No statistically significant differences were observed in various biological end-points between normal or boron pre-treated cells. (author)

  13. Absorption filaments toward the massive clump G0.253+0.016

    Energy Technology Data Exchange (ETDEWEB)

    Bally, John, E-mail: John.Bally@colorado.edu [Department of Astrophysical and Planetary Sciences, University of Colorado, UCB 389, Boulder, CO 80309 (United States); Rathborne, J. M.; Bressert, E.; Contreras, Y., E-mail: Jill.Rathborne@csiro.au, E-mail: ebressert@gmail.com, E-mail: Yanett.Contreras@csiro.au [CSIRO Astronomy and Space Science, P.O. Box 76, Epping NSW 1710 (Australia); and others

    2014-11-01

    ALMA HCO{sup +} observations of the infrared dark cloud G0.253+0.016 located in the central molecular zone of the Galaxy are presented. The 89 GHz emission is area-filling, optically thick, and sub-thermally excited. Two types of filaments are seen in absorption against the HCO{sup +} emission. Broad-line absorption filaments (BLAs) have widths of less than a few arcseconds (0.07-0.14 pc), lengths of 30-50 arcsec (1.2-1.8 pc), and absorption profiles extending over a velocity range larger than 20 km s{sup –1}. The BLAs are nearly parallel to the nearby G0.18 non-thermal filaments and may trace HCO{sup +} molecules gyrating about highly ordered magnetic fields located in front of G0.253+0.016 or edge-on sheets formed behind supersonic shocks propagating orthogonal to our line of sight in the foreground. Narrow-line absorption filaments (NLAs) have line widths less than 20 km s{sup –1}. Some NLAs are also seen in absorption in other species with high optical depth, such as HCN, and occasionally in emission where the background is faint. The NLAs, which also trace low-density, sub-thermally excited HCO{sup +} molecules, are mostly seen on the blueshifted side of the emission from G0.253+0.016. If associated with the surface of G0.253+0.016, the kinematics of the NLAs indicate that the cloud surface is expanding. The decompression of entrained, milli-Gauss magnetic fields may be responsible for the re-expansion of the surface layers of G0.253+0.016 as it recedes from the Galactic center following a close encounter with Sgr A.

  14. The adsorption of peroxynitric acid on ice between 230 K and 253 K

    OpenAIRE

    Ulrich, T.; M. Ammann; Leutwyler, S.; T. Bartels-Rausch

    2012-01-01

    Peroxynitric acid uptake to ice and snow has been proposed to be a major loss process from the atmosphere with impacts on the atmospheric oxidation capacity. Here we present results from a laboratory study on the interaction of peroxynitric acid with water ice at low concentration. Experiments were performed in a coated wall flow tube at atmospheric pressure and in the environmentally relevant temperature range of 230 K to 253 K. The interaction was found to be fully reversible and decomposit...

  15. The adsorption of peroxynitric acid on ice between 230 K and 253 K

    OpenAIRE

    Ulrich, T.; M. Ammann; Leutwyler, S.; T. Bartels-Rausch

    2011-01-01

    Peroxynitric acid uptake to ice and snow has been proposed to be a major loss process from the atmosphere with impacts on the atmospheric oxidation capacity. Here we present results from a laboratory study on the interaction of peroxynitric acid with water ice at low concentrations. Experiments were performed in a coated wall flow tube at atmospheric pressure and in the environmentally relevant temperature range of 230 K to 253 K. The interaction was found to be fully reversible and decomposi...

  16. Theoretical Explanation of the Cosmic Ray Perpendicular Diffusion Coefficient in the Nearby Starburst Galaxy NGC 253

    OpenAIRE

    Buffie, Kaitlynn; Heesen, Volker; Shalchi, Andreas

    2012-01-01

    Diffusion coefficients are usually used to describe the propagation of Cosmic Rays through the Universe. Whereas such transport parameters can be obtained from experiments in the Solar System, it is difficult to determine diffusion coefficients in the Milky Way or in external galaxies. Recently a value for the perpendicular diffusion coefficient in the nearby starburst halaxy NGC 253 has been proposed. In the present paper we reproduce this value theoretically by using an advanced analytical ...

  17. RRS James Clark Ross Cruise 253, 26 Jul -25 Aug 2011. Arctic methane hydrates

    OpenAIRE

    Wright, I.C.; et al, .

    2012-01-01

    The cruise built on the successful geophysical and geochemical mapping, undertaken during the 2008 IPY voyage JCR211 (Westbrook et al., 2009) that made the first comprehensive survey of methane bubble plume venting along the western Svalbard margin. The main achievements of JCR253 included the recovery of the ESONET demonstration mission AOEM - MASOX seafloor lander (with recovery of 10 months of physical and biogeochemical parameters from a vigorous bubble plume site) and its deployment for ...

  18. Complete genome sequence of Corynebacterium glutamicum B253, a Chinese lysine-producing strain.

    Science.gov (United States)

    Wu, Yong; Li, Pengpeng; Zheng, Ping; Zhou, Wenjuan; Chen, Ning; Sun, Jibin

    2015-08-10

    We disclosed the complete genome sequence of Corynebacterium glutamicum B253, an important lysine-producing strain in China. The genome consists a circular chromosome (3,159,203bp) and a plasmid (24,775bp), encoding 2767 protein coding genes in total. The genome contains all genes for lysine biosynthesis, and some mutations potentially relevant to lysine production were detected in comparison with sequence of other C. glutamicum. PMID:25953304

  19. Refinement of the critical 2p25.3 deletion region

    DEFF Research Database (Denmark)

    De Rocker, Nina; Vergult, Sarah; Koolen, David;

    2015-01-01

    PURPOSE: Submicroscopic deletions of chromosome band 2p25.3 are associated with intellectual disability and/or central obesity. Although MYT1L is believed to be a critical gene responsible for intellectual disability, so far no unequivocal data have confirmed this hypothesis. METHODS: In this stu...... syndromal intellectual disability. Moreover, because 17 patients present with obesity/overweight, haploinsufficiency of MYT1L might predispose to weight problems with childhood onset.Genet Med 17 6, 460-466....

  20. The St. Jude Medical Valve: Early Clinical Results in 253 Patients

    OpenAIRE

    Duncan, J. Michael; Cooley, Denton A.; Livesay, James J.; Ott, David A.; Reul, George J.; Walker, William E.; Frazier, O. Howard

    1983-01-01

    The St. Jude Medical cardiac valve is a low-profile, bileaflet, central-flow prosthesis made entirely of pyrolytic carbon. A total of 261 St. Jude valves were implanted in 253 patients during a 25-month period. Perioperative mortality for the entire series was 9.1%, including patients undergoing reoperation for valve disease and those having associated cardiac procedures. There were four nonfatal thromboembolic episodes during the follow-up period, resulting in a risk of thromboembolism for a...

  1. Satellite accretion in action: a tidally disrupting dwarf spheroidal around the nearby spiral galaxy NGC 253

    CERN Document Server

    Romanowsky, Aaron J; Martin, Nicolas F; Morales, Gustavo; Jennings, Zachary G; GaBany, R Jay; Brodie, Jean P; Grebel, Eva K; Schedler, Johannes; Sidonio, Michael

    2015-01-01

    We report the discovery of NGC 253-dw2, a dwarf spheroidal (dSph) galaxy candidate undergoing tidal disruption around a nearby spiral galaxy, NGC 253 in the Sculptor group: the first such event identified beyond the Local Group. The dwarf was found using small-aperture amateur telescopes, and followed up with Suprime-Cam on the 8 m Subaru Telescope in order to resolve its brightest stars. Using g- and R_c-band photometry, we detect a red giant branch consistent with an old, metal-poor stellar population at a distance of ~ 3.5 Mpc. From the distribution of likely member stars, we infer a highly elongated shape with a semi-major axis half-light radius of (2 +/- 0.4) kpc. Star counts also yield a luminosity estimate of ~ 2x10^6 L_Sun,V (M_V ~ -10.7). The morphological properties of NGC 253-dw2 mark it as distinct from normal dSphs and imply ongoing disruption at a projected distance of ~ 50 kpc from the main galaxy. Our observations support the hierarchical paradigm wherein massive galaxies continously accrete l...

  2. Hydrogen Fluoride toward Luminous Nearby Galaxies: NGC 253 and NGC 4945

    CERN Document Server

    Monje, R R; Falgarone, E; Lis, D C; Neufeld, D A; Phillips, T G; Güsten, R

    2014-01-01

    We present the detection of hydrogen fluoride, HF, in two luminous nearby galaxies NGC 253 and NGC 4945 using the Heterodyne Instrument for the Far-Infrared (HIFI) on board the Herschel Space Observatory. The HF line toward NGC 253 has a P-Cygni profile, while an asymmetric absorption profile is seen toward NGC 4945. The P-Cygni profile in NGC 253 suggests an outflow of molecular gas with a mass of M(H$_2$)$_{out}$ $\\sim$ 1 $\\times$ 10$^7$ M$_\\odot$ and an outflow rate as large as \\.{M} $\\sim$ 6.4 M$_\\odot$ yr$^{-1}$. In the case of NGC 4945, the axisymmetric velocity components in the HF line profile is compatible with the interpretation of a fast-rotating nuclear ring surrounding the nucleus and the presence of inflowing gas. The gas falls into the nucleus with an inflow rate of $\\le$ 1.2 M$_\\odot$ yr$^{-1}$, inside a inner radius of $\\le$ 200 pc. The gas accretion rate to the central AGN is much smaller, suggesting that the inflow can be triggering a nuclear starburst. From these results, the HF $J = 1-0$ ...

  3. Hemorroidectomia convencional versus hemorroidopexia mecânica (PPH: estudo retrospectivo de 253 casos Conventional hemorrhoidectomy versus stapled hemorrhoidopexy (PPH: a retrospective study of 253 patients

    Directory of Open Access Journals (Sweden)

    Raphael Marianelli

    2009-03-01

    Full Text Available O objetivo deste estudo foi rever a experiência do serviço de coloproctologia do HSPM-SP no tratamento cirúrgico da doença hemorroidária. Estudou-se retrospectivamente 253 pacientes portadores de hemorroidas submetidos à cirurgia no período de 10/05/2004 a 31/12/2007. Foram estabelecidos dois grupos: Grupo 1 Pacientes operados pela técnica convencional (212; Grupo 2 Pacientes operados pelo PPH (41. Estudou-se, pela revisão de prontuários, as características epidemiológicas, indicações, resultados e complicações de cada grupo. Entre os 253 pacientes analisados, 170 eram mulheres, com média de idade de 50 anos. O tempo operatório médio foi de 52 minutos para o grupo 1, e 31 minutos para o grupo 2 (p=0,0001. O tempo médio de alta ambulatorial foi de 10 e 6 semanas para o grupo 1 e 2, respectivamente (p=0,021. As complicações totalizaram 28 casos no grupo 1, e 3 casos no grupo 2 (p>0,05. Cerca de 13 casos no grupo 1, e 1 caso no grupo 2 necessitaram de reintervenção cirúrgica. Neste serviço a técnica mais utilizada foi a hemorroidectomia convencional. O método do PPH apresentou tempo operatório mais curto, e recuperação pós-operatória mais breve. Houve uma maior tendência a complicações tardias e recidivas com o grupo de hemorroidectomia convencional, porém sem significância estatística.The aim of this study was to review the experience of the Coloproctology Department of HSPM-SP in the treatment of hemorrhoids. We have retrospectively studied 253 patients submitted to the surgical treatment of hemorrhoids between 05/10/ 2004 and 12/31/2007. Patients were distributed in groups: Group 1 Conventional Hemorrhoidectomy (212; Group 2 Stapled Hemorrhoidopexy (41. Epidemiology, indications, results and complications were studied based on registers. From 253 patients studied, 170 were women, with a mean age of 50 years. Mean operating time was 52 minutes (25 -120 in group 1 and 31 minutes (20 - 65 in group 2 (p=0

  4. DISCOVERY OF A NEW FAINT DWARF GALAXY ASSOCIATED WITH NGC 253

    International Nuclear Information System (INIS)

    We report the discovery of a new faint dwarf galaxy, which we dub Scl-MM-Dw1, at a projected distance of ∼65 kpc from the spiral galaxy NGC 253. The discovery results from the Panoramic Imaging Survey of Centaurus and Sculptor (PISCeS), a program with the Magellan/Megacam imager to study faint substructure in resolved stellar light around massive galaxies outside of the Local Group. We measure a tip of the red giant branch distance to Scl-MM-Dw1 of D = 3.9 ± 0.5 Mpc, consistent with that of NGC 253, making their association likely. The new dwarf's stellar population is complex, with an old, metal-poor red giant branch (≳10 Gyr, [Fe/H] ∼ –2), and an asymptotic giant branch with an age of ∼500 Myr. Scl-MM-Dw1 has a half-light radius of rh = 340 ± 50 pc and an absolute magnitude of MV  = –10.3 ± 0.6 mag, comparable to the Milky Way's satellites at the same luminosity. Once complete, our imaging survey of NGC 253 and other nearby massive galaxies will provide a census of faint substructure in halos beyond the Local Group, both to put our own environment into context and to confront models of hierarchical structure formation

  5. Dark Filaments in the Galaxy NGC 253 - a Boiling Galactic Disk -

    OpenAIRE

    Sofue, Yoshiaki; Wakamatsu, Ken-ichi; Malin, David F.

    1994-01-01

    We study the morphology of dark lanes and filaments in the dust-rich galaxy NGC 253 using an unsharp-masked $B$-band optical photograph. Dust features are classified as `arcs', which have heights and scale radius of about 100 to 300 pc, connecting two or more dark clouds, and `loops' and `bubbles', which are developed forms of arcs, expanding into the disk-halo interface. These have diameters of a few hundred pc to $\\sim 1$ kpc. Among the bubbles, we notice a peculiar round-shaped bubble abov...

  6. Rotational properties of $^{252, 253, 254}$No. Influence of pairing correlations

    OpenAIRE

    Duguet, T.; Bonche, P.; Heenen, P. -H.

    2000-01-01

    Rotational bands of $^{252, 253, 254}$No and the fission barriers of $^{254}$No at spin 0$\\hbar$ and 20$\\hbar$ are calculated with the Hartree-Fock-Bogolyubov theory and the Lipkin-Nogami approximate particle number projection. The SLy4 Skyrme force is used in the particle-hole channel. A zero-range force with and without density-dependence is used in the particle-particle channel. The experimental ground state deformation (${\\cal{Q}}_{20}$ = 32.8 b) is reproduced as well as the increase of t...

  7. Californium Recovery from Palladium Wire

    Energy Technology Data Exchange (ETDEWEB)

    Burns, Jon D. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States)

    2014-08-01

    The recovery of 252Cf from palladium-252Cf cermet wires was investigated to determine the feasibility of implementing it into the cermet wire production operation at Oak Ridge National Laboratory’s Radiochemical Engineering Development Center. The dissolution of Pd wire in 8 M HNO3 and trace amounts of HCl was studied at both ambient and elevated temperatures. These studies showed that it took days to dissolve the wire at ambient temperature and only 2 hours at 60°C. Adjusting the ratio of the volume of solvent to the mass of the wire segment showed little change in the kinetics of dissolution, which ranged from 0.176 mL/mg down to 0.019 mL/mg. A successful chromatographic separation of 153Gd, a surrogate for 252Cf, from Pd was demonstrated using AG 50x8 cation exchange resin with a bed volume of 0.5 mL and an internal diameter of 0.8 cm.

  8. The Temperature Distribution of Dense Molecular Gas in the Center of NGC 253

    CERN Document Server

    Ott, J; Henkel, C; Walter, F; Ott, Juergen; Weiss, Axel; Henkel, Christian; Walter, Fabian

    2005-01-01

    [abridged] We present interferometric maps of ammonia (NH3) of the nearby starburst galaxy NGC 253 [star formation rate: ~2.8 Mo yr^(-1)]. The observations have been taken with the Australia Telescope Compact Array and include the para-NH3 (1,1), (2,2), and the ortho-NH3 (3,3) and (6,6) inversion lines. Six major complexes of dense ammonia are identified, three of them on either side of the starburst center, out to projected galactocentric radii of \\~250 pc. [...] The application of radiative transfer large velocity gradient models reveals that the bulk of the ammonia molecules is embedded in a one-temperature gas phase. Kinetic temperatures of this gas are ~200 and 140 K toward the south-west and north-east [of the nucleus of NGC 253], respectively. The temperatures under which ammonia was formed in the past are with >~30 K also warmer toward the south-west than toward the north-east (~15-20 K). This is indicated by the ortho-to-para ammonia ratio which is ~1 and 1.5-2.5 toward the south-west and north-east,...

  9. Gamma-ray observations of NGC 253 and M82 with OSSE

    Science.gov (United States)

    Bhattacharya, D.; The, L. -S.; Kurfess, J. D.; Clayton, D. D.; Gehrels, N.; Leising, M. D.; Grabelsky, D. A.; Johnson, W. N.; Jung, G. V.; Kinzer, R. L.

    1994-01-01

    Gamma-ray observations of the nearby starburst galaxies NGC 253 and M82 over the energy range (0.05-10) MeV have been obtained with the Oriented Scintillation Spectrometer Experiment (OSSE) spectrometer on the Compton Gamma-Ray Observatory (CGRO). The priority of these galaxies as OSSE targets had been established on the grounds that the average supernova rate may be high in starbursts as indicated by infrared and radio observations, and at distances of approximately 3 Mpc a significant chance of supernova gamm-ray line detection exists. NGC 253 was detected in continuum emission up to 165 keV with a total significance of 4.4 sigma and an estimated luminosity of 3 x 10(exp 40) ergs/s. The spectrum is best fit by a power law of photon index approximately 2.5. We consider the possible contribution of different emission mechanisms, including inverse Compton scattering, bremsstrahlung, discrete sources, and Type Ia/Ib supernova continuum to the measured flux. No significant continuum flux was observed from M82. A search for the gamma-ray line from the decay of the most abundant radioactive element produced in supernovae (Ni-56 yields Co-56 yields Fe-56) yielded no significant detection: the 3 sigma upper limits to the line fluxes at 0.158, 0.812, 0.847, and 1.238 MeV for both galaxies are obtained.

  10. A tidally disrupting dwarf galaxy in the halo of NGC 253

    CERN Document Server

    Toloba, Elisa; Spekkens, Kristine; Crnojevic, Denija; Simon, Joshua; Guhathakurta, Puragra; Strader, Jay; Caldwell, Nelson; McLeod, Brian; Seth, Anil

    2015-01-01

    We report the discovery of Scl-MM-Dw2, a new dwarf galaxy at a projected separation of $\\sim$50 kpc from NGC 253, as part of the PISCeS (Panoramic Imaging Survey of Centaurus and Sculptor) project. We measure a tip of the red giant branch distance of $3.12\\pm0.30$ Mpc, suggesting that Scl-MM-Dw2 is likely a satellite of NGC 253. We qualitatively compare the distribution of red giant branch (RGB) stars in the color-magnitude diagram with theoretical isochrones and find that it is consistent with an old, $\\sim$12 Gyr, and metal poor, $-2.3<$[Fe/H]$<-1.1$, stellar population. We also detect a small number of asymptotic giant branch stars consistent with a metal poor $2-3$ Gyr population in the center of the dwarf. Our non-detection of HI in a deep Green Bank Telescope spectrum implies a gas fraction $M_{HI}/L_V<0.02$ Msun/Lsun. The stellar and gaseous properties of Scl-MM-Dw2 suggest that it is a dwarf spheroidal galaxy. Scl-MM-Dw2 has a luminosity of $M_V=-12.1\\pm0.5$ mag and a half-light radius of $r_...

  11. On the temperature structure of the Galactic Centre cloud G0.253-0.016

    CERN Document Server

    Clark, Paul C; Ragan, Sarah E; Shetty, Rahul; Klessen, Ralf S

    2013-01-01

    We present a series of smoothed particle hydrodynamical models of G0.253-0.016 (also known as 'The Brick'), a very dense molecular cloud that lies close to the Galactic Centre. We explore how its gas and dust temperatures react as we vary the strength of both the interstellar radiation field (ISRF) and the cosmic ray ionisation rate (CRIR). As the physical extent of G0.253-0.016 along our line-of-sight is unknown, we consider two possibilities: one in which the longest axis is that measured in the plane of the sky (9.4 pc in length), and one in which it is along the line of sight, in which case we take it to be 17 pc. To recover the observed gas and dust temperatures, we find find that the ISRF must be around 1000 times the solar neighbourhood value, and the CRIR must be roughly 1E-14 /s, regardless of the geometries studied. For such high values of the CRIR, we find that cooling in the cloud's interior is dominated by neutral oxygen, in contrast to standard molecular clouds, which at the same densities are m...

  12. A 2 mm spectral line survey of the starburst galaxy NGC 253

    CERN Document Server

    Martín, S; Henkel, C; Martín-Pintado, J; Mauersberger, R

    2006-01-01

    We present the first unbiased molecular line survey towards an extragalactic source, namely the nuclear region of the starburst galaxy NGC 253. The scan covers the frequency band from 129.1 to 175.2 GHz, i.e. most of the 2mm atmospheric window. We identify 111 spectral features as transitions from 25 different molecular species. Eight of which (three tentatively) are detected for the first time in the extragalactic interstellar medium. Among these newly detected species, we detected the rare isotopomers 34SO and HC18O+. Tentative detections of two deuterated species, DNC and N2D+, are reported for the first time from a target beyond the Magellanic Clouds. Additionally, three hydrogen recombination lines are identified, while no organic molecules larger than methanol are detected. Column densities and rotation temperatures are calculated for all the species, including an upper limit to the ethanol abundance. A comparison of the chemical composition of the nuclear environment of NGC 253 with those of selected n...

  13. DETECTION OF 36 GHz CLASS I METHANOL MASER EMISSION TOWARD NGC 253

    International Nuclear Information System (INIS)

    We have used the Australia Telescope Compact Array to search for emission from the 4–1 → 30 E transition of methanol (36.2 GHz) toward the center of the nearby starburst galaxy NGC 253. Two regions of emission were detected, offset from the nucleus along the same position angle as the inner spiral arms. The emission is largely unresolved on a scale of 5'', has a FWHM line width of <30 km s–1, and an isotropic luminosity orders of a magnitude larger than that observed in any Galactic star formation region. These characteristics suggest that the 36.2 GHz methanol emission is most likely a maser, although observations with higher angular and spectral resolution are required to confirm this. If it is a maser, this represents the first detection of a class I methanol maser outside the Milky Way. The 36.2 GHz methanol emission in NGC 253 has more than an order of magnitude higher isotropic luminosity than the widespread emission recently detected toward the center of the Milky Way. If emission from this transition scales with the nuclear star formation rate, then it may be detectable in the central regions of many starburst galaxies. Detection of methanol emission in ultra-luminous infrared galaxies would open up a new tool for testing for variations in fundamental constants (particularly the proton-to-electron mass ratio) on cosmological scales

  14. ON THE TEMPERATURE STRUCTURE OF THE GALACTIC CENTER CLOUD G0.253+0.016

    International Nuclear Information System (INIS)

    We present a series of smoothed particle hydrodynamical models of G0.253+0.016 (also known as The Brick), a very dense molecular cloud that lies close to the Galactic center. We explore how its gas and dust temperatures react as we vary the strength of both the interstellar radiation field (ISRF) and the cosmic-ray ionization rate (CRIR). The cloud has an extent in the plane of the sky of roughly 3.4 pc × 9.4 pc. As its size along the line of sight is unknown, we consider two cases. In our fiducial, high-density model, we adopt a depth along the line of sight of 3.4 pc, and in the low-density model we assume an extent along the line of sight of 17 pc. To recover the observed gas and dust temperatures, we find that the ISRF must be around 1000 times the solar neighborhood value, and the CRIR must be roughly 10–14 s–1, regardless of the geometries studied. For such high values of the CRIR, we find that cooling in the cloud's interior is dominated by neutral oxygen, in contrast to standard molecular clouds, which at the same densities are mainly cooled via CO. Our results suggest that the conditions near G0.253+0.016 are more extreme than those generally accepted for the inner 500 pc of the galaxy.

  15. Fe K LINE COMPLEX IN THE NUCLEAR REGION OF NGC 253

    International Nuclear Information System (INIS)

    A bright, nearby edge-on starburst galaxy, NGC 253, was studied using the Suzaku, XMM, and Chandra X-ray observatories. With Suzaku and XMM we detected complex line structure of Fe K, which is resolved into three lines (Fe I at 6.4 keV, Fe XXV at 6.7 keV, and Fe XXVI at 7.0 keV) around the center of NGC 253. Especially, the Fe I and Fe XXVI lines are the first clear detections, with a significance of >99.99% and 99.89% estimated by a Monte Carlo procedure. Imaging spectroscopy with Chandra revealed that the emission is distributed in ∼60 arcsec2 region around the nucleus, which suggests that the source is not only the buried active galactic nucleus. The flux of highly ionized Fe lines can be explained by the accumulation of 10-1000 supernova remnants that are the result of high star-forming activity, while the Fe I line flux is consistent with the fluorescent line emission expected with the molecular clouds in the region.

  16. Absorption Filaments Towards the Massive Clump G0.253+0.016

    CERN Document Server

    Bally, John; Longmore, S N; Jackson, J M; Alves, J F; Bressert, E; Contreras, Y; Foster, J B; Garay, G; Ginsburg, A; Johnston, K G; Kruijssen, J M D; Testi, L; Walsh, A J

    2014-01-01

    ALMA HCO+ observations of the infrared dark cloud G0.253+0.016 located in the Central Molecular Zone of the Galaxy are presented. The 89 GHz emission is area-filling, optically thick, and sub-thermally excited. Two types of filaments are seen in absorption against the HCO+ emission. Broad-line absorption filaments (BLAs) have widths of less than a few arcseconds (0.07 - 0.14 pc), lengths of 30 to 50 arcseconds (1.2 - 1.8 pc), and absorption profiles extending over a velocity range larger than 20 km/sec. The BLAs are nearly parallel to the nearby G0.18 non-thermal filaments and may trace HCO+ molecules gyrating about highly ordered magnetic fields located in front of G0.253+0.016 or edge-on sheets formed behind supersonic shocks propagating orthogonal to our line-of-sight in the foreground. Narrow-line absorption filaments (NLAs) have line-widths less than 20 km/sec. Some NLAs are also seen in absorption in other species with high optical depth such as HCN and occasionally in emission where the background is f...

  17. The submillimeter C and CO lines in Henize 2-10 and NGC 253

    CERN Document Server

    Bayet, E; Phillips, T G; Contursi, A

    2004-01-01

    The purpose of this paper is to describe a method for determining a cooling template for galaxies, using nearby galaxies, and applicable to future observations of distant galaxies. We observed two starburst galaxies (NGC 253 and Henize 2-10) with the Caltech Submillimeter Observatory in the rotational lines of carbon monoxide 12CO(J=3-2), (J=6-5) and (J=7-6) for both, and also 12CO(J=4-3) and 13CO(J=3-2) for Henize 2-10 and in the 3P2-3P1 fine-structure transitions of atomic carbon [CI] at 809 GHz for NGC 253. Some of these observations have been made previously, but the present multitransition study (including data found in the literature) is the most complete to date for the two galaxies. From these observations, we have derived the properties of the warm and dense molecular gas in the galaxy nuclei. We used an LTE analysis and an LVG radiative transfer model to determine physical conditions of the interstellar medium in both sources and predicted integrated line properties of all CO transitions up to 12CO(...

  18. Topography of prostaglandin H synthase. Antiinflammatory agents and the protease-sensitive arginine 253 region.

    Science.gov (United States)

    Kulmacz, R J

    1989-08-25

    Prostaglandin H synthase catalyzes two reactions: the bis-dioxygenation of arachidonic acid to form prostaglandin G2 (cyclooxygenase activity), and the reduction of hydroperoxides to the corresponding alcohols (peroxidase activity). The cyclooxygenase activity can be selectively inhibited by many nonsteroidal antiinflammatory agents including indomethacin. In the native synthase, there is a single prominent protease-sensitive region, located near Arg253; binding of the heme prosthetic group makes the synthase resistant to proteases. To investigate the spatial relationship between the area of the synthase which interacts with indomethacin and the protease-sensitive region, the effects of indomethacin and similar agents on the protease sensitivity of the two enzymatic activities and of the synthase polypeptide were examined. Incubation of the synthase apoenzyme with trypsin (3.6% w/w) resulted in the time-dependent coordinate loss (75% at 1 h) of both enzymatic activities and the cleavage (85% at 1 h) of the 70-kDa subunit into 38- and 33-kDa fragments, indicating that proteolytic cleavage of the polypeptide at Arg253, destroyed both activities of the synthase simultaneously. Indomethacin, (S)-flurbiprofen, or meclofenamate (each at 20 microM) rendered both activities and the synthase polypeptide (at 5 microM subunit) resistant to attack by trypsin or proteinase K; these agents also inhibited the cyclooxygenase activity of the intact synthase. Two reversible cyclooxygenase inhibitors, ibuprofen and flufenamate, also made both of the activities and the synthase polypeptide more resistant to trypsin. Titration of the apoenzyme with indomethacin (0-3 mol/mol of synthase dimer) resulted in proportional increases in the inhibition of the cyclooxygenase and in the resistance to attack by trypsin. (R)-Flurbiprofen did not increase the resistance to protease or appreciably inhibit the cyclooxygenase. These results suggest that the same stereospecific interaction of these

  19. Suppression of star formation in the galaxy NGC 253 by a starburst-driven molecular wind.

    Science.gov (United States)

    Bolatto, Alberto D; Warren, Steven R; Leroy, Adam K; Walter, Fabian; Veilleux, Sylvain; Ostriker, Eve C; Ott, Jürgen; Zwaan, Martin; Fisher, David B; Weiss, Axel; Rosolowsky, Erik; Hodge, Jacqueline

    2013-07-25

    The under-abundance of very massive galaxies in the Universe is frequently attributed to the effect of galactic winds. Although ionized galactic winds are readily observable, most of the expelled mass (that is, the total mass flowing out from the nuclear region) is likely to be in atomic and molecular phases that are cooler than the ionized phases. Expanding molecular shells observed in starburst systems such as NGC 253 (ref. 12) and M 82 (refs 13, 14) may facilitate the entrainment of molecular gas in the wind. Although shell properties are well constrained, determining the amount of outflowing gas emerging from such shells and the connection between this gas and the ionized wind requires spatial resolution better than 100 parsecs coupled with sensitivity to a wide range of spatial scales, a combination hitherto not available. Here we report observations of NGC 253, a nearby starburst galaxy (distance ∼ 3.4 megaparsecs) known to possess a wind, that trace the cool molecular wind at 50-parsec resolution. At this resolution, the extraplanar molecular gas closely tracks the Hα filaments, and it appears to be connected to expanding molecular shells located in the starburst region. These observations allow us to determine that the molecular outflow rate is greater than 3 solar masses per year and probably about 9 solar masses per year. This implies a ratio of mass-outflow rate to star-formation rate of at least 1, and probably ∼3, indicating that the starburst-driven wind limits the star-formation activity and the final stellar content. PMID:23887428

  20. 7 CFR 1726.253 - Prior approved contract modification related to alternative bid provision for payment to...

    Science.gov (United States)

    2010-01-01

    ... AGRICULTURE ELECTRIC SYSTEM CONSTRUCTION POLICIES AND PROCEDURES Modifications to RUS Standard Contract Forms § 1726.253 Prior approved contract modification related to alternative bid provision for payment to... 7 Agriculture 11 2010-01-01 2010-01-01 false Prior approved contract modification related...

  1. 37 CFR 253.4 - Performance of musical compositions by PBS, NPR and other public broadcasting entities engaged in...

    Science.gov (United States)

    2010-07-01

    ... compositions by PBS, NPR and other public broadcasting entities engaged in the activities set forth in 17 U.S.C... NONCOMMERCIAL EDUCATIONAL BROADCASTING § 253.4 Performance of musical compositions by PBS, NPR and other public broadcasting entities engaged in the activities set forth in 17 U.S.C. 118(d). The following schedule of...

  2. 5 CFR 532.253 - Special rates or rate ranges for leader, supervisory, and production facilitating positions.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Special rates or rate ranges for leader....253 Special rates or rate ranges for leader, supervisory, and production facilitating positions. (a... shall establish special rates for leader, supervisory, and production facilitating positions,...

  3. En undersøgelse af de 253 første nyrestensbehandlinger med 3. generations Siemens Lithoskop™

    DEFF Research Database (Denmark)

    Kruckow, Line; Eldrup, Jesper

    Introduktion: Kandidatspecialets formål er at undersøge et års behandlinger af nyresten ved ny stenknuser, Siemens Lithoskop. Undersøgelsen fokuserer på hvorvidt stenstørrelse, BMI og stenplacering har indflydelse på stenfrihedsraten. Metode: Mellem 6/12-11 og 11/12-12 blev 253 behandlinger og be...

  4. Design of a homogeneous subcritical nuclear reactor based on thorium with a source of californium 252; Diseno de un reactor nuclear subcritico homogeneo a base de Torio con una fuente de Californio 252

    Energy Technology Data Exchange (ETDEWEB)

    Delgado H, C. E.; Vega C, H. R. [Universidad Autonoma de Zacatecas, Unidad Academica de Estudios Nucleares, Cipres No. 10, Fracc. La Penuela, 98068 Zacatecas, Zac. (Mexico); Sajo B, L., E-mail: ce_delgado89@hotmail.com [Universidad Simon Bolivar, Laboratorio de Fisica Nuclear, Apdo. 89000, 1080A Caracas (Venezuela, Bolivarian Republic of)

    2015-10-15

    Full text: One of the energy alternatives to fossil fuels which do not produce greenhouse gases is the nuclear energy. One of the drawbacks of this alternative is the generation of radioactive wastes of long half-life and its relation to the generation of nuclear materials to produce weapons of mass destruction. An option to these drawbacks of nuclear energy is to use Thorium as part of the nuclear fuel which it becomes in U{sup 233} when capturing neutrons, that is a fissile material. In this paper Monte Carlo methods were used to design a homogeneous subcritical reactor based on thorium. As neutron reflector graphite was used. The reactor core is homogeneous and is formed of 70% light water as moderator, 12% of enriched uranium UO{sub 2}(NO{sub 3}){sub 4} and 18% of thorium Th(NO{sub 3}){sub 4} as fuel. To start the nuclear fission chain reaction an isotopic source of californium 252 was used with an intensity of 4.6 x 10{sup 7} s{sup -1}. In the design the value of the effective multiplication factor, whose value turned out k{sub eff} <1 was calculated. Also, the neutron spectra at different distances from the source and the total fluence were calculated, as well as the values of the ambient dose equivalent in the periphery of the reactor. (Author)

  5. Manganese determination om minerals by activation analysis, using the californium-252 as a neutron source; Determinacao de manganes em minerios, por analise por ativacao, usando californio-252 como fonte de neutrons

    Energy Technology Data Exchange (ETDEWEB)

    Cardoso, Antonio

    1976-07-01

    Neutron Activation Analysis, using a Californium-252 neutron source, has been applied for the determination of manganese in ores such as pyrolusite, rodonite (manganese silicate)' and blending used in dry-batteries The favorable nuclear properties of manganese, such as high thermal neutron cross-section for the reaction {sup 55}Mn (n.gamma){sup 56} Mn, high concentration of manganese in the matrix and short half - life of {sup 56}Mn, are an ideal combination for non-destructive analysis of manganese in ores. Samples and standards of manganese dioxide were irradiated for about 20 minutes, followed by a 4 to 15 minutes decay and counted in a single channel pulse-height discrimination using a NaI(Tl) scintillation detector. Counting time was equal to 10 minutes. The interference of nuclear reactions {sup 56}Fe(n,p){sup 56}Mn and {sup 59} Co (n, {alpha}){sup 56} were studied, as well as problems in connection with neutron shadowing during irradiation, gamma-rays attenuation during counting and influence of granulometry of samples. One sample,was also analysed by wet-chemical method (sodium bismuthate) in order to compare results. As a whole, i t was shown that the analytical method of neutron activation for manganese in ores and blending, is a method simple, rapid and with good precision and accuracy. (author)

  6. Cloning and Sequence Analysis of ω-gliadin Genes from Wheat Variety Shaan 253%小麦品种陕253ω-醇溶蛋白基因的克隆及序列分析

    Institute of Scientific and Technical Information of China (English)

    李敏; 李哲清; 刘俊; 高翔; 陈其皎; 董剑; 赵万春; 李艳亮; 王明霞; 陈瑞佶; 庞红喜

    2010-01-01

    为了获得优良品种陕253有关ω-醇溶蛋白基因的相关信息,根据已报道的ω-醇溶蛋白基因序列设计特异引物,采用PCR方法对小麦(Triticum aestivum L.)品种陕253总DNA进行扩增,回收1 000 bp左右的片段,经纯化、克隆并测序,获得5个不同的ω-醇溶蛋白新基因,命名为Gli-S253-1、Gli一S253-2、Gli-S253-3、Gli-S253-4和Gli-S253-5,GenBank登录号分别为:GQ423428、GQ423429、GQ423430、GQ423431和GQ423432.序列分析表明:(1)ω-醇溶蛋白基因沉默主要有4种类型(Q→*、I→*、R→*和W→*),并以第一种类型为主(占66.6%);(2)从三联体密码角度看,谷氨酰胺(Q)的两种编码方式最容易发生沉默突变(CAA→TAA和CAG→TAG);(3)从突变位点来看,沉默主要发生于三联体密码的第一位碱基(占77.8%),第二位碱基发生突变的频率占33.3%,但未见第三位沉默突变;GQ423428出现了罕见的ATA→TAA类沉默,同时涉及两个位点的变异;(4)就基因沉默突变的数目而言,GQ423428和GQ423429各高达6次,其中4个位点(349、373、478和592)为上述5条记录所共有;(5)从编码成熟蛋白的结构上看,沉默突变主要集中于ω-醇溶蛋白重复区,信号肽区及N-端区未发现此类变异;(6)进化分析表明,小麦族的ω-gliadin/secalin分成3支,其中小麦来源的ω-gliadin聚成一支.上述结果表明,本研究从陕253成功分离到5条存在丰富多样性的ω-醇溶蛋白编码基因,为深入研究优质的来源及分子辅助育种提供参考.

  7. The adsorption of peroxynitric acid on ice between 230 K and 253 K

    Science.gov (United States)

    Ulrich, T.; Ammann, M.; Leutwyler, S.; Bartels-Rausch, T.

    2012-02-01

    Peroxynitric acid uptake to ice and snow has been proposed to be a major loss process from the atmosphere with impacts on the atmospheric oxidation capacity. Here we present results from a laboratory study on the interaction of peroxynitric acid with water ice at low concentration. Experiments were performed in a coated wall flow tube at atmospheric pressure and in the environmentally relevant temperature range of 230 K to 253 K. The interaction was found to be fully reversible and decomposition was not observed. Analysis based on the Langmuir adsorption model showed that the partitioning of peroxynitric acid to ice is orders of magnitude lower than of nitric acid and similar to nitrous acid partitioning behavior. The partition coefficient (KLinC) and its temperature dependency can be described by 3.74 × 10-12 × e(7098/T) [cm]. Atmospheric implications are discussed and show that the uptake to cirrus clouds or to snow-packs in polar areas is an important sink for peroxynitric acid in the environment.

  8. The adsorption of peroxynitric acid on ice between 230 K and 253 K

    Directory of Open Access Journals (Sweden)

    T. Ulrich

    2012-02-01

    Full Text Available Peroxynitric acid uptake to ice and snow has been proposed to be a major loss process from the atmosphere with impacts on the atmospheric oxidation capacity. Here we present results from a laboratory study on the interaction of peroxynitric acid with water ice at low concentration. Experiments were performed in a coated wall flow tube at atmospheric pressure and in the environmentally relevant temperature range of 230 K to 253 K. The interaction was found to be fully reversible and decomposition was not observed. Analysis based on the Langmuir adsorption model showed that the partitioning of peroxynitric acid to ice is orders of magnitude lower than of nitric acid and similar to nitrous acid partitioning behavior. The partition coefficient (KLinC and its temperature dependency can be described by 3.74 × 10−12 × e(7098/T [cm]. Atmospheric implications are discussed and show that the uptake to cirrus clouds or to snow-packs in polar areas is an important sink for peroxynitric acid in the environment.

  9. The adsorption of peroxynitric acid on ice between 230 K and 253 K

    Directory of Open Access Journals (Sweden)

    T. Ulrich

    2011-09-01

    Full Text Available Peroxynitric acid uptake to ice and snow has been proposed to be a major loss process from the atmosphere with impacts on the atmospheric oxidation capacity. Here we present results from a laboratory study on the interaction of peroxynitric acid with water ice at low concentrations. Experiments were performed in a coated wall flow tube at atmospheric pressure and in the environmentally relevant temperature range of 230 K to 253 K. The interaction was found to be fully reversible and decomposition was not observed. Analysis based on the Langmuir adsorption model showed that the partitioning of peroxynitric acid to ice is orders of magnitude lower than of nitric acid and similar to nitrous acid partitioning behavior. The partition coefficient (KLinC and its temperature dependency can be described by 3.74×10−12×e(7098/T [cm]. Atmospheric implications are discussed and show that the uptake to cirrus clouds or to snow-packs in polar areas is an important sink for peroxynitric acid in the environment.

  10. Radiative and mechanical feedback into the molecular gas of NGC 253

    CERN Document Server

    Rosenberg, M J F; van der Werf, P P; Israel, F P; Meijerink, R; Weiß, A; Requena-Torres, M A; Güsten, R

    2014-01-01

    Starburst galaxies are undergoing intense periods of star formation. Understanding the heating and cooling mechanisms in these galaxies can give us insight to the driving mechanisms that fuel the starburst. Molecular emission lines play a crucial role in the cooling of the excited gas. With SPIRE on the Herschel Space Observatory we have observed the rich molecular spectrum towards the central region of NGC 253. CO transitions from J=4-3 to 13-12 are observed and together with low-J line fluxes from ground based observations, these lines trace the excitation of CO. By studying the CO excitation ladder and comparing the intensities to models, we investigate whether the gas is excited by UV radiation, X-rays, cosmic rays, or turbulent heating. Comparing the $^{12}$CO and $^{13}$CO observations to large velocity gradient models and PDR models we find three main ISM phases. We estimate the density, temperature,and masses of these ISM phases. By adding $^{13}$CO, HCN, and HNC line intensities, we are able to const...

  11. VizieR Online Data Catalog: NGC253 near-infrared H2 emission (Rosenberg+,

    Science.gov (United States)

    Rosenberg, M. J. F.; van der Werf, P. P.; Israel, F. P.

    2012-11-01

    All observations were made with SINFONI at the ESO VLT. We observed in the H, and K bands using a spatial pixel scale of 0.25" corresponding to a field of view of 8" by 8" per frame and a spectral resolution of 2000, 3000 and 4000 respectively, which corresponds to a velocity resolution of 149.8, 99.9 and 74.9km/s. All science observations were taken in the ABA'nodding mode (300s of object, 300s of sky, 300s of object), where A' is slightly offset from A. The object exposures are aligned and averaged during the reconstruction of the data cube. The observations of NGC 253 were made in visitor mode on August 28th, 2005. In order to capture the full extent of the H2 emission, consecutive frames were taken in the K band moving further away from the center, along the disk until H2 was no longer detected. This resulted in 6 separate pointings. Since there are also H2 transitions in the H band, a similar strategy was used, resulting in 4 separate pointings. We used the standard reduction techniques of the SINFONI pipeline on all observations, including corrections for flat field, dark current, nonlinearity of pixels, distortion, and wavelength calibration. We obtained the flux calibration and atmospheric corrections from observations of a standard star, namely HR 2058 in the H band and HD 20001 in the K band (2 data files).

  12. SMA Observations of the Extended CO(6-5) Emission in the Starburst Galaxy NGC253

    CERN Document Server

    Krips, Melanie; Peck, Alison; Sakamoto, Kazushi; Neri, Roberto; Gurwell, Mark; Petitpas, Glen; Zhao, Jun-Hui

    2016-01-01

    We present observations of the $^{12}$CO(6-5) line and 686GHz continuum emission in NGC253 with the Submillimeter Array at an angular resolution of ~4arcsec. The $^{12}$CO(6-5) emission is clearly detected along the disk and follows the distribution of the lower $^{12}$CO line transitions with little variations of the line ratios in it. A large-velocity gradient analysis suggests a two-temperature model of the molecular gas in the disk, likely dominated by a combination of low-velocity shocks and the disk wide PDRs. Only marginal $^{12}$CO(6-5) emission is detected in the vicinity of the expanding shells at the eastern and western edges of the disk. While the eastern shell contains gas even warmer (T$_{\\rm kin}$>300~K) than the hot gas component (T$_{\\rm kin}$=300K) of the disk, the western shell is surrounded by gas much cooler (T$_{\\rm kin}$=60K) than the eastern shell but somewhat hotter than the cold gas component of the disk (for similar H$_2$ and CO column densities), indicative of different (or differe...

  13. The NIR structure of the barred galaxy NGC253 from VISTA

    CERN Document Server

    Iodice, E; Rejkuba, M; Neeser, M J; Greggio, L; Gonzalez, O A; Irwin, M; Emerson, J P

    2014-01-01

    [abridged] We used J and Ks band images acquired with the VISTA telescope as part of the science verification to quantify the structures in the stellar disk of the barred Sc galaxy NGC253. Moving outward from the galaxy center, we find a nuclear ring within the bright 1 kpc diameter nucleus, then a bar, a ring with 2.9 kpc radius. From the Ks image we obtain a new measure of the deprojected length of the bar of 2.5 kpc. The bar's strength, as derived from the curvature of the dust lanes in the J-Ks image, is typical of weak bars. From the deprojected length of the bar, we establish the corotation radius (R_CR=3 kpc) and bar pattern speed (Omega_b = 61.3 km /s kpc), which provides the connection between the high-frequency structures in the disk and the orbital resonances induced by the bar. The nuclear ring is located at the inner Lindblad resonance. The second ring does not have a resonant origin, but it could be a merger remnant or a transient structure formed during an intermediate stage of the bar formatio...

  14. Henry's Law vaporization studies and thermodynamics of einsteinium-253 metal dissolved in ytterbium

    International Nuclear Information System (INIS)

    The cohesive energy of metallic einsteinium determines whether einsteinium is a trivalent or divalent metal. The enthalpy of sublimation, a measure of the cohesive energy, is calculated from the partial pressures of einsteinium over an alloy. The partial pressure of 253Es has been measured over the range 470--870 K, using combined target and mass spectrometric Knudsen effusion techniques. An alloy was prepared with einsteinium dissolved in a ytterbium solvent to produce a very dilute solution. Partial pressure measurements on the alloy were amenable to the experimental technique and a data analysis using a Henry's law treatment of the data. Vapor pressure data are combined with an estimated crystal entropy S0298 and ΔC0/sub p/ for ytterbium, to produce enthalpy, entropy, and free energy functions from 298 to 1300 K. The vapor pressure of einsteinium in a dilute einsteinium--ytterbium alloy is described by the equation log P(atm) = -(6815 +- 216)/T+2.576 +- 0.337, from which we calculate for the enthalpy of sublimation of pure einsteinium ΔH0298 (second law) = 31.76 kcal/mol. The value of the enthalpy of sublimation is consistent with the conclusion that Es is a divalent metal

  15. Dark filaments in the galaxy NGC 253 - a boiling galactic disk -

    CERN Document Server

    Sofue, Y; David, F; Yoshiaki Sofue; Ken-ichi Wakamatsu

    1994-01-01

    Abstract We study the morphology of dark lanes and filaments in the dust-rich galaxy NGC 253 using an unsharp-masked B-band optical photograph. Dust features are classified as `arcs', which have heights and scale radius of about 100 to 300 pc, connecting two or more dark clouds, and `loops' and `bubbles', which are developed forms of arcs, expanding into the disk-halo interface. These have diameters of a few hundred pc to \\sim 1 kpc. Among the bubbles, we notice a peculiar round-shaped bubble above the nucleus, which could be a large-diameter (\\sim 300 pc) supernova remnant exploded in the halo over the nucleus. We also find `vertical dust streamers', which comprise bunches of narrow filaments with a thickness of a few tens of pc and are almost perpendicular to the galactic plane, extending coherently for 1 to 2 kpc toward the halo. Finally, we note `short vertical dust filaments' (or spicules) are found in the central region. We interpret these features as due to three-dimensional structures of gas extending...

  16. Dark filaments in the galaxy NGC 253: A boiling galactic disk

    Science.gov (United States)

    Sofue, Yoshiaki; Wakamatsu, Ken-Ichi; Malin, David F.

    1994-12-01

    We study the morphology of dark lanes and filaments in the dust-rich galaxy NGC 253 using an unsharp-masked B-band optical photograph. Dust features are classified as 'arcs,' which have heights and scale radius of about 100 to 300 pc, connecting two or more dark clouds, and 'loops' and 'bubbles,' which are developed forms of arcs, expanding into the disk-halo interface. These have diameters of a few hundred pc to approximately 1 kpc. Among the bubbles, we notice a peculiar round-shaped bubble above the nucleus, which could be a large-diameter (approximately 300 pc) supernova remnant exploded in the halo over the nucleus. We also find 'vertical dust streamers,' which comprise bunches of narrow filaments with a thickness of a few tens of pc and are almost perpendicular to the galactic plane, extending coherently for 1 to 2 kpc toward the halo. Finally, we note 'short vertical dust filaments' (or spicules) are found in the central region. We interpret these features as due to three-dimensional structures of gas extending from the disk into the halo. We propose a 'boiling disk' model where the filamentary features are produced by star-forming activity in the disk as well as the influence of magnetic fluxes. We discuss the implication of the model for the chemical evolution of the interstellar medium (ISM) in a galaxy disk.

  17. ALMA Multi-line Imaging of the Nearby Starburst Galaxy NGC 253

    CERN Document Server

    Meier, David S; Bolatto, Alberto D; Leroy, Adam K; Ott, Jürgen; Rosolowsky, Erik; Veilleux, Sylvain; Warren, Steven R; Weiss, Axel; Zwaan, Martin A; Zschaechner, Laura K

    2015-01-01

    We present spatially resolved ($\\sim$50 pc) imaging of molecular gas species in the central kiloparsec of the nearby starburst galaxy NGC 253, based on observations taken with the Atacama Large Millimeter/submillimeter Array (ALMA). A total of 50 molecular lines are detected over a 13 GHz bandwidth imaged in the 3 mm band. Unambiguous identifications are assigned for 27 lines. Based on the measured high CO/C$^{17}$O isotopic line ratio ($\\gtrsim$350), we show that $^{12}$CO(1-0) has moderate optical depths. A comparison of the HCN and HCO$^{+}$ with their $^{13}$C-substituted isotopologues shows that the HCN(1-0) and HCO$^{+}$(1-0) lines have optical depths at least comparable to CO(1-0). H$^{13}$CN/H$^{13}$CO$^{+}$ (and H$^{13}$CN/HN$^{13}$C) line ratios provide tighter constraints on dense gas properties in this starburst. SiO has elevated abundances across the nucleus. HNCO has the most distinctive morphology of all the bright lines, with its global luminosity dominated by the outer parts of the central re...

  18. Evidence that widespread star formation may be underway in G0.253+016, "The Brick"

    CERN Document Server

    Marsh, K A; Whitworth, A P; Clark, P C

    2016-01-01

    Image cubes of differential column density as a function of dust temperature are constructed for Galactic Centre molecular cloud G0.253+0.016 ("The Brick") using the recently described PPMAP procedure. The input data consist of continuum images from the Herschel Space Telescope in the wavelength range 70-500 $\\mu$m, supplemented by previously published interferometric data at 1.3 mm wavelength. While the bulk of the dust in the molecular cloud is consistent with being heated externally by the local interstellar radiation field, our image cube shows the presence, near one edge of the cloud, of a filamentary structure whose temperature profile suggests internal heating. The structure appears as a cool ($\\sim 14$ K) tadpole-like feature, $\\sim 6$ pc in length, in which is embedded a thin spine of much hotter ($\\sim$ 40-50 K) material. We interpret these findings in terms of a cool filament whose hot central region is undergoing gravitational collapse and fragmentation to form a line of protostars. If confirmed, ...

  19. The Compact Star-forming Complex at the Heart of NGC 253

    Science.gov (United States)

    Davidge, T. J.

    2016-02-01

    We discuss integral field spectra of the compact star-forming complex that is the brightest near-infrared (NIR) source in the central regions of the starburst galaxy NGC 253. The spectra cover the H and K passbands and were recorded with the Gemini NIR Spectrograph during subarcsecond seeing conditions. Absorption features in the spectrum of the star-forming complex are weaker than in the surroundings. An absorption feature is found near 1.78 μm that coincides with the location of a C2 bandhead. If this feature is due to C2 then the star-forming complex has been in place for at least a few hundred Myr. Emission lines of Brγ, [Fe ii], and He i 2.06 μm do not track the NIR continuum light. Pockets of star-forming activity that do not have associated concentrations of red supergiants, and so likely have ages growth in its stellar mass. This research has made use of the NASA/IPAC Infrared Science Archive, which is operated by the Jet Propulsion Laboratory, California Institute of Technology, under contract with the National Aeronautics and Space Administration.

  20. CO (J=7->6) Observations of NGC 253 Cosmic Ray Heated Warm Molecular Gas

    CERN Document Server

    Bradford, C M; Stacey, G J; Bolatto, A D; Jackson, J M; Savage, M L; Davidson, J A; Higdon, S J

    2003-01-01

    We report observations of the CO J=7->6 transition toward the starburst nucleus of NGC 253. This is the highest-excitation CO measurement in this source to date, and allows an estimate of the molecular gas excitation conditions. Comparison of the CO line intensities with a large velocity gradient, escape probability model indicates that the bulk of the 2-5 x 10^7 solar masses of molecular gas in the central 180 pc is highly excited. A model with T ~ 120 K, n_H_2 ~ 4.5 x 10^4 cm^-3 is consistent with the observed CO intensities as well as the rotational H2 lines observed with ISO. The inferred mass of warm, dense molecular gas is 10--30 times the atomic gas mass as traced through its [CII] and [OI] line emission. This large mass ratio is inconsistent with photodissociation region models where the gas is heated by far-UV starlight. It is also not likely that the gas is heated by shocks in outflows or cloud-cloud collisions. We conclude that the best mechanism for heating the gas is cosmic rays, which provide a ...

  1. The Compact Star-Forming Complex at the Heart of NGC 253

    CERN Document Server

    Davidge, T J

    2016-01-01

    We discuss integral field spectra of the compact star-forming complex that is the brightest near-infrared (NIR) source in the central regions of the starburst galaxy NGC 253. The spectra cover the H and K passbands and were recorded with the Gemini NIR Spectrograph during sub-arcsec seeing conditions. Absorption features in the spectrum of the star-forming complex are weaker than in the surroundings. An absorption feature is found near 1.78um that coincides with the location of a C2 bandhead. Emission lines of Brgamma, [FeII], and HeI2.06um do not track the NIR continuum light. Pockets of star-forming activity that do not have associated concentrations of red supergiants, and so likely have ages < 8 Myr, are found along the western edge of the complex, and there is evidence that one such pocket contains a rich population of Wolf-Rayet stars. Unless the star-forming complex is significantly more metal-poor than the surroundings, then a significant fraction of its total mass is in stars with ages < 8 Myr....

  2. 253.7nm紫外光照条件下溴对臭氧损耗影响%Affection of Bromide on the 253.7 nm Photosensitized Decomposition of Ozone

    Institute of Scientific and Technical Information of China (English)

    李朝敏; 张振满; 侯健; 潘循皙; 侯惠奇

    1998-01-01

    In this paper quantum yield for the photosensitized decomposition of ozone in the pure O3,O3+O2(N2) systems under the irradiation of 253.7 nm is studied. The quantum yield of the depletion ozone by bromide under the condition similar to stratosphere is further determinated, the ratio of two branches of BrO+BrO reaction is 5.25±0.26.

  3. Alma view of G0.253+0.016: Can cloud-cloud collision form the cloud?

    Energy Technology Data Exchange (ETDEWEB)

    Higuchi, Aya E. [Joint ALMA Observatory, Alonso de Córdova 3107, Vitacura, Santiago (Chile); Chibueze, James O. [National Astronomical Observatory of Japan 2-21-1 Osawa, Mitaka, Tokyo 181-8588 (Japan); Habe, Asao; Takahira, Ken [Department of Physics, Faculty of Science, Hokkaido University, Kita 10 Nishi 8 Kita-ku, Sapporo 060-0810 (Japan); Takano, Shuro, E-mail: aya.higuchi@nao.ac.jp, E-mail: ahiguchi@mx.ibaraki.ac.jp [Nobeyama Radio Observatory, Nobeyama, Minamimaki, Minamisaku, Nagano 384-1305 (Japan)

    2014-06-01

    We present the results of the sulfur monoxide, SO, line emission observations of G0.253+0.016 with the Atacama Large Millimeter/Submillimeter Array at an angular resolution of 1.''7. The dense and massive molecular cloud of G0.253+0.016 is highly sub-structured, yet it shows no obvious signs of cluster formation. We found three outstanding features of the cloud from the SO emission, namely, shell structure with a radius of 1.3 pc, large velocity gradients of 20 km s{sup –1} pc{sup –1} with the cloud, and cores with large velocity dispersions (30-40 km s{sup –1}) around the shell structure. We suggest that these large-velocity dispersion cores will form high-mass stars in the future. In an attempt to explore the formation scenario of the dense cloud, we compared our results with numerical simulations; therefore, we propose that G0.253+0.016 may have formed due to a cloud-cloud collision process.

  4. On carbon and oxygen isotope ratios in starburst galaxies: New data from NGC253 and Mrk231 and their implications

    CERN Document Server

    Henkel, C; Ao, Y; Aalto, S; Danielson, A L R; Papadopoulos, P P; Garcia-Burillo, S; Aladro, R; Impellizzeri, C M V; Mauersberger, R; Martin, S; Harada, N

    2014-01-01

    Using the IRAM 30-m telescope, CN and CO isotopologues have been measured toward the central regions of the nearby starburst galaxy NGC253 and the prototypical ultraluminous infrared galaxy Mrk231. In NGC253, the 12C/13C ratio is 40+-10. Assuming that the ratio also holds for the CO emitting gas, this yields 16O/18O = 145+-36 and 16O/17O = 1290+-365 and a 32S/34S ratio close to that measured for the local interstellar medium (20-25). No indication for vibrationally excited CN is found. Peak line intensity ratios between NGC253 and Mrk231 are ~100 for 12C16O and 12C18O J=1-0, while the ratio for 13C16O J=1-0 is ~250. This and similar 13CO and C18O line intensities in the J=1-0 and 2-1 transitions of Mrk231 suggest 12C/13C ~ 100 and 16O/18O ~ 100, in agreement with values obtained for the less evolved ultraluminous merger Arp220. Also accounting for other extragalactic data, 12C/13C ratios appear to vary over a full order of magnitude, from >100 in ultraluminous high redshift galaxies to ~100 in more local such...

  5. Spectral analysis and interpretation of the \\gamma-ray emission from the Starburst galaxy NGC 253

    CERN Document Server

    Abramowski, A; Aharonian, F; Akhperjanian, A G; Anton, G; Balzer, A; Barnacka, A; Becherini, Y; Becker, J; Bernlöhr, K; Birsin, E; Biteau, J; Bochow, A; Boisson, C; Bolmont, J; Bordas, P; Brucker, J; Brun, F; Brun, P; Bulik, T; Büsching, I; Carrigan, S; Casanova, S; Cerruti, M; Chadwick, P M; Charbonnier, A; Chaves, R C G; Cheesebrough, A; Cologna, G; Conrad, J; Couturier, C; Dalton, M; Daniel, M K; Davids, I D; Degrange, B; Deil, C; Dickinson, H J; Djannati-Ataï, A; Domainko, W; Drury, L O'C; Dubus, G; Dutson, K; Dyks, J; Dyrda, M; Egberts, K; Eger, P; Espigat, P; Fallon, L; Fegan, S; Feinstein, F; Fernandes, M V; Fiasson, A; Fontaine, G; Förster, A; Füßling, M; Gajdus, M; Gallant, Y A; Garrigoux, T; Gast, H; Gérard, L; Giebels, B; Glicenstein, J F; Glück, B; Göring, D; Grondin, M -H; Häffner, S; Hague, J D; Hahn, J; Hampf, D; Harris, J; Hauser, M; Heinz, S; Heinzelmann, G; Henri, G; Hermann, G; Hillert, A; Hinton, J A; Hofmann, W; Hofverberg, P; Holler, M; Horns, D; Jacholkowska, A; Jahn, C; Jamrozy, M; Jung, I; Kastendieck, M A; Katarzyński, K; Katz, U; Kaufmann, S; Khélifi, B; Klochkov, D; Kluźniak, W; Kneiske, T; Komin, Nu; Kosack, K; Kossakowski, R; Krayzel, F; Laffon, H; Lamanna, G; Lenain, J -P; Lennarz, D; Lohse, T; Lopatin, A; Lu, C -C; Marandon, V; Marcowith, A; Masbou, J; Maurin, G; Maxted, N; Mayer, M; McComb, T J L; Medina, M C; Méhault, J; Moderski, R; Mohamed, M; Moulin, E; Naumann, C L; Naumann-Godo, M; de Naurois, M; Nedbal, D; Nekrassov, D; Nguyen, N; Nicholas, B; Niemiec, J; Nolan, S J; Ohm, S; Wilhelmi, E de Oña; Opitz, B; Ostrowski, M; Oya, I; Panter, M; Arribas, M Paz; Pekeur, N W; Pelletier, G; Perez, J; Petrucci, P -O; Peyaud, B; Pita, S; Pühlhofer, G; Punch, M; Quirrenbach, A; Raue, M; Reimer, A; Reimer, O; Renaud, M; Reyes, R de los; Rieger, F; Ripken, J; Rob, L; Rosier-Lees, S; Rowell, G; Rudak, B; Rulten, C B; Sahakian, V; Sanchez, D A; Santangelo, A; Schlickeiser, R; Schulz, A; Schwanke, U; Schwarzburg, S; Schwemmer, S; Sheidaei, F; Skilton, J L; Sol, H; Spengler, G; Stawarz, Ł; Steenkamp, R; Stegmann, C; Stinzing, F; Stycz, K; Sushch, I; Szostek, A; Tavernet, J -P; Terrier, R; Tluczykont, M; Valerius, K; van Eldik, C; Vasileiadis, G; Venter, C; Viana, A; Vincent, P; Völk, H J; Volpe, F; Vorobiov, S; Vorster, M; Wagner, S J; Ward, M; White, R; Wierzcholska, A; Zacharias, M; Zajczyk, A; Zdziarski, A A; Zech, A; Zechlin, H -S

    2012-01-01

    Very-high-energy (VHE; E >100 GeV) and high-energy (HE; 100 MeV < E < 100 GeV) data from \\gamma-ray observations performed with the H.E.S.S. telescope array and the Fermi-LAT instrument, respectively, are analysed in order to investigate the non-thermal processes in the starburst galaxy NGC 253. The VHE \\gamma-ray data can be described by a power law in energy with differential photon index \\Gamma=2.14 \\pm 0.18_stat \\pm 0.30_sys and differential flux normalisation at 1 TeV of F_0 = (9.6 \\pm 1.5_stat (+5.7,-2.9)_sys) x 10^{-14} TeV^{-1} cm^{-2} s^{-1}. A power-law fit to the differential HE \\gamma-ray spectrum reveals a photon index of \\Gamma=2.24 \\pm 0.14_stat \\pm 0.03_sys and an integral flux between 200 MeV and 200 GeV of F(0.2-200 GeV) = (4.9 \\pm 1.0_stat \\pm 0.3_sys) x 10^{-9} cm^{-2} s^{-1}. No evidence for a spectral break or turnover is found over the dynamic range of both the LAT instrument and the H.E.S.S. experiment: a combined fit of a power law to the HE and VHE \\gamma-ray data results in a ...

  6. Common Strategy for Adult and Pediatric Medulloblastoma: A Multicenter Series of 253 Adults

    International Nuclear Information System (INIS)

    Purpose: To assess prognostic factors for adults with medulloblastoma in a multicenter, retrospective study. Methods and Materials: Data were collected by file review or mail inquiry for 253 adults treated between 1975 to 2004. Radiologists or surgeons assessed disease characteristics, such as volume and extension. Patients were classified as having either high- or standard-risk disease. Prognostic factors were analyzed. Results: Median patient age was 29 years. Median follow-up was 7 years. Radiotherapy was delivered in 246 patients and radiochemotherapy in 142. Seventy-four patients relapsed. Respective 5- and 10-year overall survival rates were 72% and 55%. Univariate analysis showed that survival significantly correlated with metastasis, postsurgical performance status, brainstem involvement, involvement of the floor of the fourth ventricle (V4), and radiation dose to the spine and to the posterior cerebral fossa (PCF). By multivariate analysis, brainstem, V4 involvement, and dose to the PCF were negative prognostic factors. In the standard-risk subgroup there was no overall survival difference between patients treated with axial doses of ≥34 Gy and patients treated with craniospinal doses <34 Gy plus chemotherapy. Conclusion: We report the largest series of medulloblastoma in adults. Prognostic factors were similar to those observed in children. Results suggest that patients with standard-risk disease could be treated with radiochemotherapy, reducing doses to the craniospinal area, maintaining at least 50 Gy to the PCF. The role of chemotherapy for this group is still unclear. A randomized study should be performed to confirm these results, but because frequency is very low, such a study would be difficult

  7. The dynamics and star-forming potential of the massive Galactic centre cloud G0.253+0.016

    Science.gov (United States)

    Johnston, K. G.; Beuther, H.; Linz, H.; Schmiedeke, A.; Ragan, S. E.; Henning, Th.

    2014-08-01

    Context. The massive infrared dark cloud G0.253+0.016 projected ~45 pc from the Galactic centre contains ~105 M⊙ of dense gas whilst being mostly devoid of observed star-formation tracers. Aims: Our goals are therefore to scrutinise the physical properties, dynamics and structure of this cloud with reference to its star-forming potential. Methods: We have carried out a concerted SMA and IRAM 30 m study of this enigmatic cloud in dust continuum, CO isotopologues, several shock tracing molecules, as well as H2CO to trace the gas temperature. In addition, we include ancillary far-IR and sub-mm Herschel and SCUBA data in our analysis. Results: We detect and characterise a total of 36 dust cores within G0.253+0.016 at 1.3 mm and 1.37 mm, with masses between 25 and approximately 250 M⊙, and find that the kinetic temperature of the gas traced by H2CO ratios is >320 K on size-scales of ~0.15 pc. Analysis of the position-velocity diagrams of our observed lines shows broad linewidths and strong shock emission in the south of the cloud, indicating that G0.253+0.016 is colliding with another cloud at vLSR ~ 70 km s-1. We confirm via an analysis of the observed dynamics in the Central Molecular Zone that it is an elongated structure, orientated with Sgr B2 closer to the Sun than Sgr A*, however our results suggest that the actual geometry may be more complex than an elliptical ring. We find that the column density probability distribution function of G0.253+0.016 derived from SMA and SCUBA dust continuum emission is log-normal with no discernible power-law tail, consistent with little star formation, and that its width can be explained in the framework of theory predicting the density structure of clouds created by supersonic, magnetised turbulence. We also present the Δ-variance spectrum of this region, a proxy for the density power spectrum of the cloud, and show it is consistent with that expected for clouds with no current star formation. Finally, we show that even

  8. AKARI Near-Infrared Spectroscopic Observations of Interstellar Ices in Edge-on Starburst Galaxy NGC253

    CERN Document Server

    Yamagishi, Mitsuyoshi; Ishihara, Daisuke; Oyabu, Shinki; Onaka, Takashi; Shimonishi, Takashi; Suzuki, Toyoaki

    2011-01-01

    We present the spatially-resolved near-infrared (2.5-5.0 um) spectra of the edge-on starburst galaxy NGC253 obtained with the Infrared Camera onboard AKARI. Near the center of the galaxy, we clearly detect the absorption features of interstellar ices (H_2O: 3.05 um, CO_2: 4.27 um, and XCN: 4.62 um) and the emission of polycyclic aromatic hydrocarbons (PAHs) at 3.29 um and hydrogen recombination line Br alpha at 4.05 um. We find that the distributions of the ices differ from those of the PAH and gas. We calculate the column densities of the ices and derive the abundance ratios of N(CO_2)/N(H_2O) = 0.17 +- 0.05. They are similar to those obtained around the massive young stellar objects in our Galaxy (0.17 +- 0.03), although much stronger interstellar radiation field and higher dust temperature are expected near the center of NGC253.

  9. Analysis of t(9;17)(q33.2;q25.3) chromosomal breakpoint regions and genetic association reveals novel candidate genes for bipolar disorder

    DEFF Research Database (Denmark)

    Rajkumar, A.P.; Christensen, Jane H.; Mattheisen, Manuel;

    2015-01-01

    OBJECTIVES: Breakpoints of chromosomal abnormalities facilitate identification of novel candidate genes for psychiatric disorders. Genome-wide significant evidence supports the linkage between chromosome 17q25.3 and bipolar disorder (BD). Co-segregation of translocation t(9;17)(q33.2;q25.3) with...... psychiatric disorders has been reported. We aimed to narrow down these chromosomal breakpoint regions and to investigate the associations between single nucleotide polymorphisms within these regions and BD as well as schizophrenia (SZ) in large genome-wide association study samples. METHODS: We cross......-linked Danish psychiatric and cytogenetic case registers to identify an individual with both t(9;17)(q33.2;q25.3) and BD. Fluorescent in situ hybridization was employed to map the chromosomal breakpoint regions of this proband. We accessed the Psychiatric Genomics Consortium BD (n = 16,731) and SZ (n = 21...

  10. Apert Syndrome: Molecularly Confirmed C.758C>G (P.Pro253Arg) in FGFR2

    International Nuclear Information System (INIS)

    A 5-day-old girl was referred to our clinic for evaluation of congenital malformations. She was identified with a pathogenic mutation c.758C>G (p.Pro253Arg) in FGFR2 gene using targeted exome sequencing. The de novo mutation was confirmed with Sanger sequencing in the patient and her parents. She showed occipital plagiocephaly with frontal bossing (Figure A and B). Skull frontal and lateral radiography revealed fusion of most of the sutures except coronal suture, with convolutional markings (Figure D and E). She had complete cleft palate (Figure C). Her fused bilateral hands showed type II syndactyly with complete syndactyly between the ring and the little fingers (Figure F1-F3). Both toes were simple syndactyly with side-to-side fusion of skin (Figure G1-)

  11. Apert Syndrome: Molecularly Confirmed C.758C>G (P.Pro253Arg) in FGFR2

    Energy Technology Data Exchange (ETDEWEB)

    Cha Gon, Lee, E-mail: leechagon@eulji.ac.kr [Department of Pediatrics, Eulji General Hospital, College of Medicine, Eulji University, 68 Hangeulbiseok-ro, Nowon-gu, Seoul 139-711 (Korea, Republic of)

    2016-03-21

    A 5-day-old girl was referred to our clinic for evaluation of congenital malformations. She was identified with a pathogenic mutation c.758C>G (p.Pro253Arg) in FGFR2 gene using targeted exome sequencing. The de novo mutation was confirmed with Sanger sequencing in the patient and her parents. She showed occipital plagiocephaly with frontal bossing (Figure A and B). Skull frontal and lateral radiography revealed fusion of most of the sutures except coronal suture, with convolutional markings (Figure D and E). She had complete cleft palate (Figure C). Her fused bilateral hands showed type II syndactyly with complete syndactyly between the ring and the little fingers (Figure F1-F3). Both toes were simple syndactyly with side-to-side fusion of skin (Figure G1-)

  12. 78 FR 43888 - Compliance Policy Guide Sec. 253.100-Use of Units of Plasma and Fresh Frozen Plasma Which Have...

    Science.gov (United States)

    2013-07-22

    ... published in the Federal Register on January 3, 2012 (77 FR 7), with an effective date of July 2, 2012, FDA... transfusion if stored at ] appropriate temperatures per industry standards.'' (See 77 FR 7 at 14). With this... HUMAN SERVICES Food and Drug Administration Compliance Policy Guide Sec. 253.100--Use of Units of...

  13. Detection and analysis of pathogenic microorganism in the stool specimens from 253 chronic diarrhea patients with HIV infection%253例HIV感染合并慢性腹泻患者粪便标本的病原微生物检测分析

    Institute of Scientific and Technical Information of China (English)

    王慧珠; 华文浩; 李敏; 田敬华; 张燕; 王玉光; 李兴旺; 赵辉

    2012-01-01

    Objective To investigate the pathogenic profiles of chronic diarrhea patients with AIDS, for the better prevention and treatment. Methods The stool specimens in AIDS patients with chronic diarrhea were analyzed by the smear and dyeing detection method. Detection methods included direct smear for the detection of Giardia lamblia stiles, Grain stain method for fungi and mold, acid fast stain ( Ziehl-Neelsen ) for Mycobacterium, improved acid fast stain for the detection of Cryptosporidium. Stool isolation culture to identify Shigella dysenteriae, Salmonella Typhi, enteroinvasive E. Coli and fungi; aerobic culture to identify campylobacter, gold-labeled antibodies method for the detection of C. Difficile. Results Total of 159 strains of bacteria were identified, including fungi 45% ( 114/253 ) and Cryptosporidium 12.6% ( 32/253 ), Mycobacterium 2. 4% ( 6/253 ), C. Difficile 1. 58% ( 4/253 ), campylobacter 0. 8% (2/253 ), salmonella 0. 4%( 1/253 ). Conclusions Fungi, Cryptosporidium, Mycobacterium, C. Difficile. Are the major pathogens for chronic diarrhea in patients with AIDS. The identification of pathogen could make the prevention and treatment proceeding faster and better.%目的 探讨HIV感染者慢性腹泻的病原学种类及其特点,使患者得到及时的预防和治疗.方法 对253例慢性腹泻HIV感染者的粪便标本首先进行了涂片及染色检测,直接涂片检测蓝氏贾第鞭毛虫,采用革兰染色检测真菌孢子及菌丝,抗酸染色(萋-尼氏染色法)检测分枝杆菌,用改良抗酸染色法检测隐孢子虫,采用常规粪便培养检测志贺菌、沙门菌、肠侵袭性大肠埃希菌及真菌,采用微需氧培养检测空肠弯曲菌,采用金标法检测难辨梭状芽孢杆菌毒素(A+B).结果 本研究共检测出各种病原微生物159株,其中真菌最多,占45%(114/253),隐胞子虫占12.6%(32/253),结核分枝杆菌占2.4%(6/253),难辨梭状芽孢杆菌占1.58%(4/253),空肠弯曲菌占0.8%(2/253),

  14. Percutaneous vertebroplasty in 1,253 levels: results and long-term effectiveness in a single centre

    Energy Technology Data Exchange (ETDEWEB)

    Masala, Salvatore; Mastrangeli, Roberta; Petrella, Maria Chiara; Massari, Francesco; Ursone, Antonio; Simonetti, Giovanni [Universita di Roma ' ' Tor Vergata' ' , Department of Diagnostic and Molecular Imaging, Interventional Radiology and Radiotherapy, Rome (Italy)

    2009-01-15

    Several authors claim that vertebroplasty (PVT) is a successful technique, but long-term effectiveness is still debated. Our goal was to evaluate the effectiveness of PVT in patients with symptomatic vertebral fractures that had not responded to conservative treatment. In our centre, 624 patients with 1,253 compression fractures were treated by PVT. Imaging studies, clinical visits and short- and long-term follow-up were assessed by visual analogue scale (VAS) testing of pain. Statistical analysis was performed to evaluate pain response after PVT (paired two-tailed t-test) and to assess any differences in pain due to different lesions (ANOVA test). We found a statistically significant improvement in the patients' quality of life, particularly in pain (P<0.001). The average VAS value pre-PVT was 8.0{+-}2.5, which significantly dropped to 1.5{+-}0.4 by 12 months. There were no significant differences in pain response between the groups of patients with different underlying disease. There was a low complication rate in our study. PVT should be considered the treatment of choice in vertebral fractures with refractory pain. With strict evaluation of the clinical indications and subspecialised operators, long-term effectiveness is probable. (orig.)

  15. Abundant Methanol Masers but no New Evidence for Star Formation in GCM0.253+0.016

    CERN Document Server

    Mills, E A C; Ludovici, D A; Lang, C C; Ott, J; Morris, M R; Schmitz, S

    2015-01-01

    We present new observations of the quiescent giant molecular cloud GCM0.253+0.016 in the Galactic center, using the upgraded Karl G. Jansky Very Large Array. Observations were made at wavelengths near 1 cm, at K (24 to 26 GHz) and Ka (27 and 36 GHz) bands, with velocity resolutions of 1-3 km/s and spatial resolutions of ~0.1 pc, at the assumed 8.4 kpc distance of this cloud. The continuum observations of this cloud are the most sensitive yet made, and reveal previously undetected emission which we attribute primarily to free-free emission from external ionization of the cloud. In addition to the sensitive continuum map, we produce maps of 12 molecular lines: 8 transitions of NH3 -- (1,1),(2,2),(3,3),(4,4),(5,5),(6,6),(7,7) and (9,9), as well as the HC3N (3-2) and (4-3) lines, and CH3OH 4(-1) - 3(0) the latter of which is known to be a collisionally-excited maser. We identify 148 CH3OH 4(-1) - 3(0) (36.2 GHz) sources, of which 68 have brightness temperatures in excess of the highest temperature measured for th...

  16. No reference video quality estimation based on human visual system for 2.5/3G devices

    Science.gov (United States)

    Massidda, Francesco; Giusto, Daniele D.; Perra, Cristian

    2005-03-01

    2.5/3G devices should achieve satisfactory QoS, overcoming mobile standards drawbacks. In-service/blind quality monitoring is essential in order to improve perceptual quality according to Human Visual System. Several techniques have been proposed for image/video quality assessment. A novel no-reference quality index which uses an effective HVS model is proposed. Luminance masking, Contrast Sensitivity Function and temporal masking are taken into account with fast in-service algorithms. The proposed index is able to assess blockiness distortion with a fast image-domain measure. Compression/post-processing blurring effects are measured with a standard approach. Moving artifacts distortion is evaluated taking into account standard deviation with respect to a natural image statistical model. Several distortion effects, in wireless noisy channels with low video-streaming/playback bit rates (e.g. edge busyness and image persistence) are evaluated. A multi-level pooling algorithm (block, temporal-window, frame, and sequence levels) is used. Validation tests have been developed in order to assess index performance and computational complexity. The final measure provides human-like threshold-effect and high correlation with subjective data. Low complexity algorithms can be derived for real-time, HVS-based, QoS management for low-power consumer devices. Different distortion effects (e.g. ringing and jerkiness) can be easily included.

  17. Nustar and Chandra insight into the nature of the 3-40 kev nuclear emission in NGC 253

    DEFF Research Database (Denmark)

    Lehmer, B. D.; Wik, D. R.; Hornschemeier, A. E.;

    2013-01-01

    We present results from three nearly simultaneous Nuclear Spectroscopic Telescope Array ( NuSTAR ) and Chandra monitoring observations between 2012 September 2 and 2012 November 16 of the local star-forming galaxy NGC 253. The 3-40 keV intensity of the inner ~ 20 arcsec ( ~ 400 pc) nuclear region......, as measured by NuSTAR , varied by a factor of ~ 2 across the three monitoring observations. The Chandra data reveal that the nuclear region contains three bright X-ray sources, including a luminous ( L2-10 keV ~ few × 1039 erg s-1 ) point source located ~ 1 arcsec from the dynamical center of the...... galaxy (within the 3σ positional uncertainty of the dynamical center); this source drives the overall variability of the nuclear region at energies ≳3 keV. We make use of the variability to measure the spectra of this single hard X-ray source when it was in bright states. The spectra are well described...

  18. Creep rupture of the 21Cr 11Ni Si N REM stainless steel 253MA - Data collation and assessment

    Energy Technology Data Exchange (ETDEWEB)

    Linde, Lars; Sandstroem, R.

    1998-02-01

    Creep data for the heat resistant austenitic stainless steel 253MA (21Cr 11Ni 1.7Si 0.17N REM) have been collated and assessed as part of the work in the European Creep Collaborative Committee (ECCC) Working Group (WG) 3.3. The data were assessed using the guidelines provided by ECCC WG 1. In the present assessment, two methods using different types of time-temperature parameters (TTP) have been utilised. One of the methods, the Free Temperature Method (FTM) represents a new approach, which takes into account the slope changes in the stress-time relationships with temperature. The other method, the Averaging Method (AM), was based on conventional TTPs. Post-assessment tests, also proposed by ECCC, were applied to the results of both methods. The requirements in the post-assessment tests were all met by the AM and, except in one case, by the FTM. However, creep rupture values from the FTM for this steel were found to provide and accurate description of the material behaviour and were recommended for use in the European Standard 3 refs, 15 figs, 3 tabs

  19. Congenital Hydrocephalus and Hemivertebrae Associated With De NOVO Partial Monosomy 6q (6q25.3→qter

    Directory of Open Access Journals (Sweden)

    Li Y

    2015-06-01

    Full Text Available This study was conducted to describe a prenatal case of congenital hydrocephalus and hemivertebrae with a 6q terminal deletion and to investigate the possible correlation between the genotype and phenotype of the proband. We performed an array-based comparative genomic hybridization (aCGH analysis on a fetus diagnosed with congenital hydrocephalus and hemivertebrae. The deletion, spanning 10.06 Mb from 6q25.3 to 6qter, was detected in this fetus. The results of aCGH, karyotype and fluorescent in situ hybridization (FISH analyses in the healthy parents were normal, which confirmed that the proband’s copy- number variant (CNV was de novo. This deleted region encompassed 97 genes, including 28 OMIM genes. We discussed four genes (TBP, PSMB1, QKI and Pacrg that may be responsible for hydrocephalus while the T gene may have a role in hemivertebra. We speculate that five genes in the 6q terminal deletion region were potentially associated with hemivertebrae and hydrocephalus in the proband.

  20. Percutaneous vertebroplasty in 1,253 levels: results and long-term effectiveness in a single centre

    International Nuclear Information System (INIS)

    Several authors claim that vertebroplasty (PVT) is a successful technique, but long-term effectiveness is still debated. Our goal was to evaluate the effectiveness of PVT in patients with symptomatic vertebral fractures that had not responded to conservative treatment. In our centre, 624 patients with 1,253 compression fractures were treated by PVT. Imaging studies, clinical visits and short- and long-term follow-up were assessed by visual analogue scale (VAS) testing of pain. Statistical analysis was performed to evaluate pain response after PVT (paired two-tailed t-test) and to assess any differences in pain due to different lesions (ANOVA test). We found a statistically significant improvement in the patients' quality of life, particularly in pain (P<0.001). The average VAS value pre-PVT was 8.0±2.5, which significantly dropped to 1.5±0.4 by 12 months. There were no significant differences in pain response between the groups of patients with different underlying disease. There was a low complication rate in our study. PVT should be considered the treatment of choice in vertebral fractures with refractory pain. With strict evaluation of the clinical indications and subspecialised operators, long-term effectiveness is probable. (orig.)

  1. 750 mW continuous-wave solid-state deep ultraviolet laser source at the 253.7 nm transition in mercury.

    Science.gov (United States)

    Scheid, Martin; Markert, Frank; Walz, Jochen; Wang, Jiayu; Kirchner, Martin; Hänsch, Theodor W

    2007-04-15

    A high-power continuous-wave coherent light source at 253.7 nm is described. It is based on a solid-state Yb:YAG disk laser with two successive frequency doubling stages and is capable of generating stable output powers of up to 750 mW. Spectroscopy of the 6 (1)S(0)-6 (3)P(1) transition of mercury has been demonstrated. PMID:17375166

  2. Biological, chemical and other data collected aboard the THOMAS G. THOMPSON during cruise TN253 in the North Pacific Ocean from 2010-08-26 to 2010-09-07 (NODC Accession 0104358)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NODC accession 0104358 includes biological, chemical, optical, physical and underway data collected aboard the THOMAS G. THOMPSON during cruise TN253 in the North...

  3. RX J15542+2721: An Apparently Magnetic Cataclysmic Variable with a 2.53 Hour Orbital Period

    Science.gov (United States)

    Thorstensen, John R.; Fenton, William H.

    2002-01-01

    Time-resolved spectroscopy and photometry of the cataclysmic variable (CV) star RX J15542+2721 show it to have an orbital period of 2.53 hr, putting it in the middle of the so-called CV period gap from 2 to 3 hr. Observations taken 2001 March show it in a low state with relatively weak emission lines and a strong contribution from a secondary star near type M4. Contemporaneous I-band differential photometry shows ellipsoidal variations. In 2001 May the emission lines were stronger and of higher excitation, with prominent He II λ4686, the secondary star less visible, and the ellipsoidal variations masked by flickering. By 2001 June the object had returned to a state similar to the March observations. RX J15542+2721 appears to be an AM Her-type magnetic CV. Archival plate material, although sparse, indicates that the object may spend most of its time close to minimum light. This, and a weak indication of a 2-3 hr ``trough'' in the histogram of AM Her star orbital periods, suggest that the mass transfer rate may be somewhat depressed among AM Her stars in this period range. The spectral type of the secondary and the orbital period are consistent with a distance of roughly 210 pc. A proper motion μ=28+/-4 mas yr-1 is found, corresponding to a transverse velocity ~28 km s-1 at the nominal distance. The radial velocity variations of the M dwarf secondary are detected, and their phase is essentially as expected based on the ellipsoidal variations. The data suggest fairly typical masses for the system components, and a more detailed study might constrain the white dwarf mass rather accurately.

  4. Acute kidney injury in a tropical country: a cohort study of 253 patients in an infectious diseases intensive care unit

    Directory of Open Access Journals (Sweden)

    Elizabeth De Fransceco Daher

    2014-01-01

    Full Text Available Introduction: Acute kidney injury (AKI is a frequent and potentially fatal complication in infectious diseases. The aim of this study was to investigate the clinical aspects of AKI associated with infectious diseases and the factors associated with mortality. Methods: This retrospective study was conducted in patients with AKI who were admitted to the intensive care unit (ICU of a tertiary infectious diseases hospital from January 2003 to January 2012. The major underlying diseases and clinical and laboratory findings were evaluated. Results: A total of 253 cases were included. The mean age was 46±16 years, and 72% of the patients were male. The main diseases were human immunodeficiency virus (HIV infection, HIV/acquired immunodeficiency syndrome (AIDS (30%, tuberculosis (12%, leptospirosis (11% and dengue (4%. Dialysis was performed in 70 cases (27.6%. The patients were classified as risk (4.4%, injury (63.6% or failure (32%. The time between AKI diagnosis and dialysis was 3.6±4.7 days. Oliguria was observed in 112 cases (45.7%. The Acute Physiology and Chronic Health Evaluation (APACHE II scores were higher in patients with HIV/AIDS (57±20, p-value=0.01 and dengue (68±11, p-value=0.01. Death occurred in 159 cases (62.8%. Mortality was higher in patients with HIV/AIDS (76.6%, p-value=0.02. A multivariate analysis identified the following independent risk factors for death: oliguria, metabolic acidosis, sepsis, hypovolemia, the need for vasoactive drugs, the need for mechanical ventilation and the APACHE II score. Conclusions: AKI is a common complication in infectious diseases, with high mortality. Mortality was higher in patients with HIV/AIDS, most likely due to the severity of immunosuppression and opportunistic diseases.

  5. SMA Observations of the Extended 12CO(J = 6–5) Emission in the Starburst Galaxy NGC 253

    Science.gov (United States)

    Krips, M.; Martín, S.; Peck, A. B.; Sakamoto, K.; Neri, R.; Gurwell, M.; Petitpas, G.; Zhao, Jun-Hui

    2016-04-01

    We present observations of the 12CO(J = 6–5) line and 686 GHz continuum emission in NGC 253 with the Submillimeter Array at an angular resolution of ∼4″. The 12CO(J = 6–5) emission is clearly detected along the disk and follows the distribution of the lower 12CO line transitions with little variation of the line ratios. A large velocity gradient analysis suggests a two-temperature model of the molecular gas in the disk, likely dominated by a combination of low-velocity shocks and the disk-wide photodissociation regions. Only marginal 12CO(J = 6–5) emission is detected in the vicinity of the expanding shells at the eastern and western edges of the disk. While the eastern shell contains gas even warmer (Tkin > 300 K) than the hot gas component (Tkin = 300 K) of the disk, the western shell is surrounded by gas much cooler (Tkin = 60 K) than the eastern shell but somewhat hotter than the cold gas component of the disk (for similar H2 and CO column densities), indicative of different (or differently efficient) heating mechansisms. The continuum emission at 686 GHz in the disk agrees well in shape and size with that at lower (sub)millimeter frequencies, exhibiting a spectral index consistent with thermal dust emission. We find dust temperatures of ∼10–30 K and largely optically thin emission. However, our fits suggest a second (more optically thick) dust component at higher temperatures ({T}{{d}}\\gt 60 K), similar to the molecular gas. We estimate a global dust mass of ∼106 {M}ȯ for the disk, translating into a gas-to-dust mass ratio of a few hundred, consistent with other nearby active galaxies.

  6. Effect of UV irradiation (253.7 nm) on free Legionella and Legionella associated with its amoebae hosts.

    Science.gov (United States)

    Cervero-Aragó, Sílvia; Sommer, Regina; Araujo, Rosa M

    2014-12-15

    Water systems are the primary reservoir for Legionella spp., where the bacteria live in association with other microorganisms, such as free-living amoebae. A wide range of disinfection treatments have been studied to control and prevent Legionella colonization but few of them were performed considering its relation with protozoa. In this study, the effectiveness of UV irradiation (253.7 nm) using low-pressure lamps was investigated as a disinfection method for Legionella and amoebae under controlled laboratory conditions. UV treatments were applied to 5 strains of Legionella spp., 4 strains of free-living amoeba of the genera Acanthamoeba and Vermamoeba, treating separately trophozoites and cysts, and to two different co-cultures of Legionella pneumophila with the Acanthamoeba strains. No significant differences in the UV inactivation behavior were observed among Legionella strains tested which were 3 logs reduced for fluences around 45 J/m(2). UV irradiation was less effective against free-living amoebae; which in some cases required up to 990 J/m(2) to obtain the same population reduction. UV treatment was more effective against trophozoites compared to cysts; moreover, inactivation patterns were clearly different between the genus Acanthamoeba and Vermamoeba. For the first time data about Vermamoeba vermiformis UV inactivation has been reported in a study. Finally, the results showed that the association of L. pneumophila with free-living amoebae decreases the effectiveness of UV irradiation against the bacteria in a range of 1.5-2 fold. That fact demonstrates that the relations established between different microorganisms in the water systems can modify the effectiveness of the UV treatments applied. PMID:25306486

  7. Spontaneous growth pattern in 253 Chinese girls with Turner′s syndrome%253例中国Turner综合征患者的自然生长曲线

    Institute of Scientific and Technical Information of China (English)

    中华医学会儿科学分会内分泌遗传代谢学组; Turner综合征生长方式研究协作组

    2001-01-01

    Objective To analyze the spontaneous growth pattern in Chinesegirls with Turner′s syndrome (TS), and to make Chinese TS growth curves for clinical practice. Methods The pretreatment mixed longitudinal and cross-sectional height, weight and bone age measurements of 253 patients with Turner′s syndrome from 8 hospitals of 5 provinces in China were analyzed. The measurements were obtained from patients aged from birth to 30 years. It was required that only one observation should be included per year for one child. A total of 289 height measurements and 106 bone age measurements were obtained. The Chinese TS growth curves were developed by curve estimation and compared with that of the normal girls. Height z scores (HtSDS) of the TS girls were calculated according to the development data of normal girls from 9 cities of China. Weight for height z scores (HtWSDS) of TS patients were calculated according to the patients′ actual height and weight. Results Mean birth length (n=6) was (47.2±2.5) cm, mean height z score (HtSDS) of the birth length was -1.52. The difference between the mean height of TS and the normal girls of the same age gradually increased from 8.03 cm at the age of 3 years to 27.89 cm at the age of 13 years, it gradually decreased to 18.87 cm at the age of 20 years. Mean adult height was (140.0±7.9) cm. The ~(+2s)area of TS patients′ growth curves and the ~(-2s)area of the normal growth curves were in the same range before the age of 8 years, which became partly different from 8 years old children and completely different at 13-14 years of age. There was no evidence of a pubertal height spurt in TS girls. Bone age was increasingly retarded, it was less than 2 years below chronological age before 12 years of age and more than 3 years below chronological age after the age of 13 years. Mean HtWSDS of all age groups were above the means of the normal girls except for that of the 4-year-old group, which was -0.55. Mean HtWSDS of the

  8. Nustar and Chandra Insight into the Nature of the 3-40 Kev Nuclear Emission in Ngc 253

    Science.gov (United States)

    Lehmer, Bret D.; Wik, Daniel R.; Hornschemeier, Ann E.; Ptak, Andrew; Antoniu, V.; Argo, M.K.; Bechtol, K.; Boggs, S.; Christensen, F.E.; Craig, W.W.; Hailey, C.J.; Harrison, F.A.; Krivonos, R.; Leyder, Jean-Christophe Xavier Georges; Maccarone, T.J.; Stern, D.; Venters, T.; Zezas, A.; Zhang, W.W.

    2013-01-01

    We present results from three nearly simultaneous Nuclear Spectroscopic Telescope Array (NuSTAR) and Chandra monitoring observations between 2012 September 2 and 2012 November 16 of the local star-forming galaxy NGC 253. The 3-40 kiloelectron volt intensity of the inner approximately 20 arcsec (approximately 400 parsec) nuclear region, as measured by NuSTAR, varied by a factor of approximately 2 across the three monitoring observations. The Chandra data reveal that the nuclear region contains three bright X-ray sources, including a luminous (L (sub 2-10 kiloelectron volt) approximately few × 10 (exp 39) erg per s) point source located approximately 1 arcsec from the dynamical center of the galaxy (within the sigma 3 positional uncertainty of the dynamical center); this source drives the overall variability of the nuclear region at energies greater than or approximately equal to 3 kiloelectron volts. We make use of the variability to measure the spectra of this single hard X-ray source when it was in bright states. The spectra are well described by an absorbed (power-law model spectral fit value, N(sub H), approximately equal to 1.6 x 10 (exp 23) per square centimeter) broken power-law model with spectral slopes and break energies that are typical of ultraluminous X-ray sources (ULXs), but not active galactic nuclei (AGNs). A previous Chandra observation in 2003 showed a hard X-ray point source of similar luminosity to the 2012 source that was also near the dynamical center (Phi is approximately equal to 0.4 arcsec); however, this source was offset from the 2012 source position by approximately 1 arcsec. We show that the probability of the 2003 and 2012 hard X-ray sources being unrelated is much greater than 99.99% based on the Chandra spatial localizations. Interestingly, the Chandra spectrum of the 2003 source (3-8 kiloelectron volts) is shallower in slope than that of the 2012 hard X-ray source. Its proximity to the dynamical center and harder Chandra spectrum

  9. El Límite a la Protección de las Tierras Indígenas de la Ley 19.253

    Directory of Open Access Journals (Sweden)

    Mario Salamanca Huenchullán

    Full Text Available Este trabajo aborda el tema del límite a la protección de las tierras indígenas, que como una exigencia del interés nacional introduce en la legislación chilena la Ley Indígena 19.253, en su relación con la expropiación para la construcción de obras públicas, que en virtud de la utilidad pública se construyen sobre estas mismas tierras.

  10. Temperature dependence of strength, ductility and impact strength for quenched alloys of Fe-Cr-Mn system at 20, -196 and -253 deg C

    International Nuclear Information System (INIS)

    Physical and mechanical properties of 48 alloys, belonging to different phase regions of a quenched state diagram for Fe-Cr-Mn system (containing about 0.03% of C) at 20, -196 and -253 deg C, are studied. Alloys of a different strength, plasticity and impact strength level are revealed. The region of austenitic alloys, containing 10-14% Cr and 24-30% Mn and having maximum values of relative elongation (> 50%) and impact strength (KCV > 2.6 MJ/m2) at cryogenic temperatures, is found

  11. Nuevos resultados sobre la cinem\\'atica global y nuclear de NGC 253: movimientos no circulares y emisi\\'on en Br-gamma

    CERN Document Server

    Camperi, J A; Diaz, R J; Aguero, M P; Gimeno, G; Pessev, P

    2016-01-01

    Continuing with previous research (Camperi et al. 2011),new heliocentric radial velocity distributions are presented for the nearby galaxy NGC 253, obtained from the ionized hydrogen recombination line H-alpha. These distributions have been derived from long-slit spectroscopy for various position angles. It is also shown the heliocentric radial velocity distribution corresponding to part of the infrared data (ionized hydrogen recombination line Br-gamma) observed with the Phoenix spectrograph of the Gemini South Observatory. Sequential mapping with the long slit using this instrument will enable to study in detail the kinematics of the galaxy's core, which is strongly obscured by dust.

  12. Cosmic rays and the magnetic field in the nearby starburst galaxy NGC253 III. Helical magnetic fields in the nuclear outflow

    OpenAIRE

    Heesen, Volker; Beck, Rainer; Krause, Marita; Dettmar, Ralf-Jürgen

    2011-01-01

    Magnetic fields are a good tracer for gas compression by shock waves, which can be caused by interaction of star-formation driven outflows from individual star formation sites as described in the chimney model. We study the magnetic field structure in the central part of the nuclear starburst galaxy NGC 253 with spatial resolutions between 40 and 150 pc to detect any filamentary emission associated with the nuclear outflow. New VLA observations at 3 cm with 7.5" resolution were combined with ...

  13. Compressibility and thermal expansion of hydrous ringwoodite with 2.5(3) wt% H[subscript 2]O

    Energy Technology Data Exchange (ETDEWEB)

    Ye, Yu; Brown, David A.; Smyth, Joseph R.; Panero, Wendy R.; Jacobsen, Steven D.; Chang, Yun-Yuan; Townsend, Joshua P.; Thomas, Sylvia-Monique; Hauri, Erik H.; Dera, Przemyslaw; Frost, Daniel J. (Bayreuth); (Colorado); (CIW); (UC); (NWU); (OSU)

    2016-07-29

    Ringwoodite ({gamma}-Mg{sub 2}SiO{sub 4}) is the stable polymorph of olivine in the transition zone between 525-660 km depth, and can incorporate weight percent amounts of H{sub 2}O as hydroxyl, with charge compensated mainly by Mg vacancies (Mg{sup 2+} = 2H{sup +}), but also possibly as (Si{sup 4+} = 4H{sup +} and Mg{sup 2+} + 2H{sup +} = Si{sup 4+}). We synthesized pure Mg ringwoodite containing 2.5(3) wt% H{sub 2}O, measured by secondary ion mass spectrometry (SIMS), and determined its compressibility at 300 K by single-crystal and powder X-ray diffraction (XRD), as well as its thermal expansion behavior between 140 and 740 K at room pressure. A third-order Birch-Murnaghan equation of state (BM3 EOS) fits values of the isothermal bulk modulus K{sub T0} = 159(7) GPa and (dK{sub T}/dP){sub P = 0} = K' = 6.7(7) for single-crystal XRD; K{sub T0} = 161(4) GPa and K' = 5.4(6) for powder XRD, with K{sub T0} = 160(2) GPa and K' = 6.2(3) for the combined data sets. At room pressure, hydrous ringwoodite breaks down by an irreversible unit-cell expansion above 586 K, which may be related to dehydration and changes in the disorder mechanisms. Single-crystal intensity data were collected at various temperatures up to 736 K, and show that the cell volume V(cell) has a mean thermal expansion coefficient {alpha}{sub V0} of 40(4) x 10{sup -6}/K (143-736 K), and 29(2) x 10{sup -6}/K (143-586 K before irreversible expansion). V(Mg) have {alpha}{sub 0} values of 41(3) x 10{sup -6}/K (143-736 K), and V(Si) has {alpha}{sub 0} values of 20(3) x 10{sup -6}/K (143-586 K) and 132(4) x 10{sup -6}K (586-736 K). Based on the experimental data and previous work from {sup 29}Si NMR, we propose that during the irreversible expansion, a small amount of H{sup +} cations in Mg sites transfer to Si sites without changing the cubic spinel structure of ringwoodite, and the substituted Si{sup 4+} cations move to the normally vacant octahedral site at (1/2, 1/2, 0). Including new SIMS

  14. Spatially Resolving a Starburst Galaxy at Hard X-ray Energies: NuSTAR, Chandra, AND VLBA Observations of NGC 253

    CERN Document Server

    Wik, Daniel R; Hornschemeier, Ann E; Yukita, Mihoko; Ptak, Andrew; Zezas, Andreas; Antoniou, Vallia; Argo, Megan K; Bechtol, Keith; Boggs, Steven; Christensen, Finn; Craig, William; Hailey, Charles; Harrison, Fiona; Krivanos, Roman; Maccarone, Thomas J; Stern, Daniel; Venters, Tonia; Zhang, William W

    2014-01-01

    Prior to the launch of NuSTAR, it was not feasible to spatially resolve the hard (E > 10 keV) emission from galaxies beyond the Local Group. The combined NuSTAR dataset, comprised of three ~165 ks observations, allows spatial characterization of the hard X-ray emission in the galaxy NGC 253 for the first time. As a follow up to our initial study of its nuclear region, we present the first results concerning the full galaxy from simultaneous NuSTAR, Chandra, and VLBA monitoring of the local starburst galaxy NGC 253. Above ~10 keV, nearly all the emission is concentrated within 100" of the galactic center, produced almost exclusively by three nuclear sources, an off-nuclear ultraluminous X-ray source (ULX), and a pulsar candidate that we identify for the first time in these observations. We detect 21 distinct sources in energy bands up to 25 keV, mostly consisting of intermediate state black hole X-ray binaries. The global X-ray emission of the galaxy - dominated by the off-nuclear ULX and nuclear sources, whic...

  15. Association between 17q25.3-rs6465657 polymorphism and prostate cancer susceptibility: a meta-analysis based on 19 studies

    Directory of Open Access Journals (Sweden)

    Jiang X

    2016-07-01

    Full Text Available Xiao Jiang,1,2 Mei Zhang,3 Xiao-Yan Bai,1 Shujing Li,1 Huijian Wu1 1Laboratory of Molecular Medicine & Pharmacy, School of Life Science and Biotechnology, Dalian University of Technology, Dalian, People’s Republic of China; 2Department of Gastroenterology, Dalian Municipal Central Hospital Affiliated of Dalian Medical University, Dalian, People’s Republic of China; 3Department of Biochemistry and Molecular Biology, Heilongjiang University of Chinese Medicine, Haerbin, People’s Republic of China Background: Genome-wide association studies have identified rs6465657 polymorphism at chromosome 17q25.3 as a new prostate cancer (PCa susceptibility locus in people of European descent. However, subsequent replication studies have yielded inconsistent results among different ethnicities. In this study, a comprehensive meta-analysis was conducted to systematically evaluate the relationship between rs6465657 polymorphism and PCa risk.Methods: All the articles involved were identified from PubMed, EMBASE, Web of Science, EBSCO databases, and Google Scholar before December 2015. The odds ratios (ORs with corresponding 95% confidence internals (95% CIs were pooled under the allele model. Fourteen eligible articles with 19 studies were finally included.Results: In the overall population, the 17q25.3-rs6465657C allele was found to be significantly associated with increased risk of PCa compared to the T allele (OR =1.097; 95% CI: 1.061–1.134; P<0.001. In the subgroup analysis stratified by ethnicity, significantly increased risk was found in the Caucasian population (OR =1.120; 95% CI: 1.078–1.162; P<0.001, while the difference of OR did not reach the statistical significance in the Asian or African-American population. The analyses of sensitivity indicated the robust stability of the results, and the Begg’s and Egger’s test indicated that no publication bias existed.Conclusion: The current meta-analysis suggested that the 17q25.3-rs6465657

  16. Measurements of the viscosity of carbon dioxide at temperatures from (253.15 to 473.15) K with pressures up to 1.2 MPa

    International Nuclear Information System (INIS)

    Highlights: • A new rotating-body viscometer for the low-pressure region was presented. • A viscosity dependent offset was compensated by calibrating the viscometer. • The viscosity of carbon dioxide was measured at low pressures. • Measurements were carried out from T = (253.15 to 473.15) K with p ≤ 1.2 MPa. • The relative expanded combined uncertainty (k = 2) was Ur,c(η) = (0.20 to 0.41)%. - Abstract: The viscosity of carbon dioxide was measured over the temperature range T = (253.15 to 473.15) K with pressures up to 1.2 MPa utilizing a new rotating-body viscometer. The relative expanded combined uncertainty (k = 2) in viscosity (including uncertainties of temperature and pressure) was (0.20 to 0.41)%. The instrument was specifically designed for measurements at low gas densities and enables measurements of the dynamic viscosity at temperatures between T = 253.15 K and T = 473.15 K with pressures up to 2 MPa. For carbon dioxide, the fluid specific measuring range with regard to pressure was limited to 1.2 MPa due to the formation of disturbing vortices inside the measuring cell at higher pressures. The model function for the viscosity measurement was extended in such a way that the dynamic viscosity was measured relative to helium. Therefore, the influence of the geometry of the concentric cylindrical system inside the measuring cell became almost negligible. Moreover, a systematic offset resulting from a small but inevitable eccentricity of the cylindrical system was compensated for. The residual damping, usually measured in vacuum, was calibrated in the entire temperature range using viscosity values of helium, neon and argon calculated ab initio; at T = 298.15 K recommended reference values were used. A viscosity dependent offset of the measured viscosities, which was observed in previously published data, did not occur when using the calibrated residual damping. The new carbon dioxide results were compared to other experimental literature data

  17. Studies on naturally occurring infectious bursal disease viruses suggest that a single amino acid substitution at position 253 in VP2 increases pathogenicity.

    Science.gov (United States)

    Jackwood, D J; Sreedevi, B; LeFever, L J; Sommer-Wagner, S E

    2008-07-20

    Three classic IBDV strains were previously isolated from commercial layer chicken flocks and shown to be phylogenetically related to vaccine strains but pathogenic in susceptible chickens. In this study, their viral genomes were sequenced and compared to sequences of vaccines being used in those flocks. The vaccine strains examined were sequenced directly from the manufacturer and had identical genome segment B sequences. Compared to these vaccines, the GA-1, H-30 and CS-2-35 isolates each had one silent mutation in the gene that encodes VP1. Compared to the two vaccines used at the time CS-2-35 was isolated, the segment A sequence of CS-2-35 contained numerous nucleotide and amino acid mutations suggesting the CS-2-35 virus was not closely related to these vaccines. This virus however did have amino acid mutations in VP2 that are reported to be necessary for replication in cell culture and lacked two of the three amino acid mutations previously shown to be necessary for virulence. These data suggest that CS-2-35 was a descendant from an attenuated strain of IBDV. When the segment A genomic sequences of the GA-1 and H-30 viruses were compared to the vaccines being used in those flocks they were most closely related to the attenuated D78 vaccine strain. In genome segment A, three nucleotide mutations in GA-1 and four in H-30 were observed compared to the D78 classic vaccine. These nucleotide mutations caused one amino acid (H253N) change in the GA-1 virus and two amino acids (H253Q and G259D) were different in the H-30 virus. In addition, both the GA-1 and H-30 viruses had the amino acid G76 in VP2 that appears to be unique to the vaccine D78. The data suggest that GA-1 and H-30 are genetically related and have a common ancestor even though they were isolated from geographically distant flocks. The evidence also suggests that GA-1, H-30 and CS-2-35 could be reversions from attenuated vaccine viruses or by coincidence genetically resemble classic IBDV vaccines. It

  18. Interstitial deletion of 6q25.2–q25.3: a novel microdeletion syndrome associated with microcephaly, developmental delay, dysmorphic features and hearing loss

    Science.gov (United States)

    Nagamani, Sandesh Chakravarthy Sreenath; Erez, Ayelet; Eng, Christine; Ou, Zhishuo; Chinault, Craig; Workman, Laura; Coldwell, James; Stankiewicz, Pawel; Patel, Ankita; Lupski, James R; Cheung, Sau Wai

    2009-01-01

    Interstitial deletions of 6q are rare. We report a detailed clinical and molecular characterization of four patients with interstitial deletion involving 6q25. All of our patients presented with microcephaly, developmental delay, dysmorphic features and hearing loss, whereas two of them had agenesis of the corpus callosum. We determined the size, extent and genomic content of the deletions using high-density array-comparative genomic hybridization (a-CGH), and found that a common segment spanning 3.52 Mb within the 6q25.2–q25.3 region was deleted in all four cases. We hypothesize that a subset of genes in the commonly deleted region are dosage sensitive and that haploinsufficieny of these genes impairs normal development of the brain and hearing. PMID:19034313

  19. ALMA observations of 99 GHz free-free and H40$\\alpha$ line emission from star formation in the centre of NGC 253

    CERN Document Server

    Bendo, G J; D'Cruze, M J; Dickinson, C; Fuller, G A; Muxlow, T W B

    2015-01-01

    We present Atacama Large Millimeter/submillimeter Array observations of 99.02 GHz free-free and H40$\\alpha$ emission from the centre of the nearby starburst galaxy NGC 253. We calculate electron temperatures of 3700-4500 K for the photoionized gas, which agrees with previous measurements. We measure a photoionizing photon production rate of $(3.2\\pm0.2)\\times10^{53}$ s$^{-1}$ and a star formation rate of $1.73\\pm0.12$ M$_\\odot$ yr$^{-1}$ within the central 20$\\times$10 arcsec, which fall within the broad range of measurements from previous millimetre and radio observations but which are better constrained. We also demonstrate that the dust opacities are ~3 dex higher than inferred from previous near-infrared data, which illustrates the benefits of using millimetre star formation tracers in very dusty sources.

  20. Synthesis and Crystal Structure of (E)-Ethyl 2-(5-(3-methyl-2-butenyloxy)-2-(3-(4-(3-methyl2-butenyloxy)phenyl)acryloyl)phenoxy)acetate

    Institute of Scientific and Technical Information of China (English)

    WANG Jian-Guo; WU Lin; ZHONG Chan-Juan; QI Xiao-Yan; ZHOU Jin-Xia; YI De-Lian

    2011-01-01

    The title compound, (E)-ethyl 2-(5-(3-methyl-2-butenyloxy)-2-(3-(4-(3-methyl-2-butenyloxy)phenyl) acryloyl) phenoxy)acetate (1), has been synthesized and characterized by FT-IR and 1H-NMR spectroscopy, ESI-MS, and X-ray single-crystal diffraction.FT-IR, 1H-NMR and ESI-MS confirm the functional groups, particularly the ethyl groups in the ester moiety, of the compound.The single-crystal X-ray diffraction has revealed a monoclinic structure, space group P21/n with a = 14.6832(14), b = 7.7581(7), c = 23.075(2) (A), β = 101.670(2)°, V= 2574.2(4) (A)3, Z = 4,Dc = 1.235 g/cm3,μ = 0.085 mm-1, and F(000) = 1024.The skeleton of chalcone in the molecular structure is coplanar.

  1. DETECTION OF GAMMA-RAY EMISSION FROM THE STARBURST GALAXIES M82 AND NGC 253 WITH THE LARGE AREA TELESCOPE ON FERMI

    International Nuclear Information System (INIS)

    We report the detection of high-energy γ-ray emission from two starburst galaxies using data obtained with the Large Area Telescope on board the Fermi Gamma-ray Space Telescope. Steady point-like emission above 200 MeV has been detected at significance levels of 6.8σ and 4.8σ, respectively, from sources positionally coincident with locations of the starburst galaxies M82 and NGC 253. The total fluxes of the sources are consistent with γ-ray emission originating from the interaction of cosmic rays with local interstellar gas and radiation fields and constitute evidence for a link between massive star formation and γ-ray emission in star-forming galaxies.

  2. High Current Multi-finger InGaAs/InP Double Heterojunction Bipolar Transistor with the Maximum Oscillation Frequency 253 GHz

    International Nuclear Information System (INIS)

    A four-finger InGaAs/InP double heterojunction bipolar transistor is designed and fabricated successfully by using planarization technology. The emitter area of each finger is 1 × 15μm2. The breakdown voltage is more than 7 V, the maximum collector current could be more than 100 mA. The current gain cutoff frequency is as high as 155 GHz and the maximum oscillation frequency reaches 253 GHz. The heterostructure bipolar transistor can offer more than 70mW class-A maximum output power at W band and the maximum power density can be as high as 1.2W/mm. (cross-disciplinary physics and related areas of science and technology)

  3. Co-regulation analysis of closely linked genes identifies a highly recurrent gain on chromosome 17q25.3 in prostate cancer

    International Nuclear Information System (INIS)

    Transcriptional profiling of prostate cancer (PC) has unveiled new markers of neoplasia and allowed insights into mechanisms underlying this disease. Genomewide analyses have also identified new chromosomal abnormalities associated with PC. The combination of both classes of data for the same sample cohort might provide better criteria for identifying relevant factors involved in neoplasia. Here we describe transcriptional signatures identifying distinct normal and tumoral prostate tissue compartments, and the inference and demonstration of a new, highly recurrent copy number gain on chromosome 17q25.3. We have applied transcriptional profiling to tumoral and non-tumoral prostate samples with relatively homogeneous epithelial representations as well as pure stromal tissue from peripheral prostate and cultured cell lines, followed by quantitative RT-PCR validations and immunohistochemical analysis. In addition, we have performed in silico colocalization analysis of co-regulated genes and validation by fluorescent in situ hybridization (FISH). The transcriptomic analysis has allowed us to identify signatures corresponding to non-tumoral luminal and tumoral epithelium, basal epithelial cells, and prostate stromal tissue. In addition, in silico analysis of co-regulated expression of physically linked genes has allowed us to predict the occurrence of a copy number gain at chromosomal region 17q25.3. This computational inference was validated by fluorescent in situ hybridization, which showed gains in this region in over 65% of primary and metastatic tumoral samples. Our approach permits to directly link gene copy number variations with transcript co-regulation in association with neoplastic states. Therefore, transcriptomic studies of carefully selected samples can unveil new diagnostic markers and transcriptional signatures highly specific of PC, and lead to the discovery of novel genomic abnormalities that may provide additional insights into the causes and mechanisms

  4. Spatially resolving a starburst galaxy at hard X-ray energies: NuSTAR, CHANDRA, AND VLBA observations of NGC 253

    DEFF Research Database (Denmark)

    Wik, D. R.; Lehmer, B. D.; Hornschemeier, A. E.;

    2014-01-01

    intermediate state black hole X-ray binaries. The global X-ray emission of the galaxy-dominated by the off-nuclear ULX and nuclear sources, which are also likely ULXs-falls steeply (photon index ≳ 3) above 10 keV, consistent with other NuSTAR-observed ULXs, and no significant excess above the background is...... the first time. As a follow up to our initial study of its nuclear region, we present the first results concerning the full galaxy from simultaneous NuSTAR, Chandra, and Very Long Baseline Array monitoring of the local starburst galaxy NGC 253. Above ~10 keV, nearly all the emission is concentrated...... within 100" of the galactic center, produced almost exclusively by three nuclear sources, an off-nuclear ultraluminous X-ray source (ULX), and a pulsar candidate that we identify for the first time in these observations. We detect 21 distinct sources in energy bands up to 25 keV, mostly consisting of...

  5. Measurement of 14N(n,p)14C cross section for kT=25.3 keV Maxwellian neutrons using gridded ionization chamber

    International Nuclear Information System (INIS)

    We measured the 14N(n,p)14C reaction cross section for neutrons with a quasi-Maxwellian distribution of kT=25.3 keV which is one of the key parameters for the s-process nucleosynthesis in astrophysics. Protons were detected with high efficiency using a gridded ionization chamber. We employed a thick Li target and a 1.912 MeV proton beam for neutron production, and a vacuum-evaporated melamine (C3H6N6) film as a 14N sample. The absolute cross section was determined relatively to the 6Li(n,t)α cross section by measuring the triton yield from a 6LiF film in place of melamine. Our result (1.70±0.08 mb) is approximately a factor 2 larger than the value reported in an earlier direct measurement for the same Maxwellian neutron spectrum; it is consistent with results deduced from monoenergetic neutrons or inverse reaction. (orig.)

  6. Patients with high-bone-mass phenotype owing to Lrp5-T253I mutation have low plasma levels of serotonin

    DEFF Research Database (Denmark)

    Frost, Morten; Andersen, Tom E.; Yadav, Vijay;

    2010-01-01

    The Lrp5 gene is a major determinant of bone mass accrual. It has been demonstrated recently to achieve this function by hampering the synthesis of gut-derived serotonin, which is a powerful inhibitor of bone formation. In this study we analyzed plasma serotonin levels in patients with a high......-bone-mass (HBM) phenotype owing to gain-of-function mutation of Lrp5 (T253I). A total of 9 HBM patients were compared with 18 sex- and age-matched controls. In HBM patients, the serotonin concentrations in platelet-poor plasma were significantly lower than in the controls (mean +/- SEM: 2.16 +/- 0.28 ng....../mL versus 3.51 +/- 0.49 ng/mL, respectively, p < .05). Our data support the hypothesis that circulating serotonin levels mediate the increased bone mass resulting from gain-of-function mutations in Lrp5 in humans. (c) 2010 American Society for Bone and Mineral Research....

  7. Cosmic rays and the magnetic field in the nearby starburst galaxy NGC253 III. Helical magnetic fields in the nuclear outflow

    CERN Document Server

    Heesen, Volker; Krause, Marita; Dettmar, Ralf-Jürgen

    2011-01-01

    Magnetic fields are a good tracer for gas compression by shock waves, which can be caused by interaction of star-formation driven outflows from individual star formation sites as described in the chimney model. We study the magnetic field structure in the central part of the nuclear starburst galaxy NGC 253 with spatial resolutions between 40 and 150 pc to detect any filamentary emission associated with the nuclear outflow. New VLA observations at 3 cm with 7.5" resolution were combined with archive data at 20 and 6 cm. We find filamentary radio continuum emission in a geometrical distribution that we interpret as the boundary of the northwestern nuclear outflow cone. The scaleheight of the continuum emission is 150+/-20 pc, regardless of the observing frequency. The equipartition magnetic field strength is 46+/-10 microG for the total field and 21+/-5 microG for the regular field in the filaments. The ordered magnetic field is aligned along the filaments, in agreement with amplification due to compression. T...

  8. Kinetics of the gas-phase reactions of chlorine atoms with CH2F2, CH3CCl3 and CF3CFH2 over the temperature range 253 – 551 K

    DEFF Research Database (Denmark)

    Nilsson, Elna Johanna Kristina; Johnson, Matthew Stanley; Nielsen, Ole John;

    2009-01-01

    Relative rate techniques were used to study the title reactions in 930–1200 mbar of N2 diluent. The reaction rate coefficients measured in the present work are summarized by the expressions k(Cl+CH2F2) = 1.19×10-17 T 2 exp(-1023/T ) cm3 molecule-1 s-1 (253– 553 K), k(Cl+CH3CCl3) = 2.41×10-12 exp(...

  9. Erratum to "Solar Sources and Geospace Consequences of Interplanetary Magnetic Clouds Observed During Solar Cycle 23-Paper 1" [J. Atmos. Sol.-Terr. Phys. 70(2-4) (2008) 245-253

    Science.gov (United States)

    Gopalswamy, N.; Akiyama, S.; Yashiro, S.; Michalek, G.; Lepping, R. P.

    2009-01-01

    One of the figures (Fig. 4) in "Solar sources and geospace consequences of interplanetary magnetic Clouds observed during solar cycle 23 -- Paper 1" by Gopalswamy et al. (2008, JASTP, Vol. 70, Issues 2-4, February 2008, pp. 245-253) is incorrect because of a software error in t he routine that was used to make the plot. The source positions of various magnetic cloud (MC) types are therefore not plotted correctly.

  10. X-ray observations of the starburst galaxy NGC 253 --- II. Extended emission from hot gas in the nuclear area, disk, and halo

    Science.gov (United States)

    Pietsch, W.; Vogler, A.; Klein, U.; Zinnecker, H.

    2000-08-01

    Spatial and spectral analysis of deep ROSAT HRI and PSPC observations of the near edge-on starburst galaxy NGC 253 reveal diffuse soft X-ray emission, which contributes 80% to its total X-ray luminosity (LX = 5 1039 erg s-1, corrected for foreground absorption). The nuclear area, disk, and halo contribution to the luminosity is about equal. The starburst nucleus itself is highly absorbed and not visible in the ROSAT band. The emission from the nuclear area stems from a heavily absorbed source with an extent of 250 pc (FWHM) about 100 pc above the nucleus along the SE minor axis ("nuclear source", X34), and the "X-ray plume". The nuclear source is best described as having a thermal bremsstrahlung spectrum with a temperature of T = 1.2 keV (NH = 3 1021 cm-2) and LXexgal = 3 1038 erg s-1 (corrected for Galactic foreground absorption). The spectrum of the hollow-cone shaped plume (opening angle of 32̂ and extent of ~ 700 pc along the SE minor axis) is best modeled by a composite of a thermal bremsstrahlung (NH = 3 1020 cm-2, T = 1.2 keV, LXexgal = 4.6 1038 erg s-1) and a thin thermal plasma (Galactic foreground absorption, T = 0.33 keV, LXexgal = 4 1038 erg s-1). The diffuse nuclear emission components trace interactions between the galactic super-wind emitted by the starburst nucleus, and the dense interstellar medium of the disk. Diffuse emission from the disk is heavily absorbed and follows the spiral structure. It can be described by a thin thermal plasma spectrum (T = 0.7 keV, intrinsic luminosity LXintr = 1.2 1039 erg s-1), and most likely reflects a mixture of sources (X-ray binaries, supernova remnants, and emission from H II regions) and the hot interstellar medium. The surface brightness profile reveals a bright inner and a fainter outer component along the major axis with extents of ∓3.4 kpc and ∓7.5 kpc. We analysed the total halo emission separated into two geometrical areas; the "corona" (scale height ~ 1 kpc) and the "outer halo". The coronal

  11. Survey of potential markets for devices using Californium-252

    International Nuclear Information System (INIS)

    Potential applications for devices or systems containing 252Cf in the years from 1975 to 1980 are estimated. The estimated number of devices and associated business value were derived from a survey of 46 industrial, educational and governmental organizations conducted from Jan. to May, 1975. Applications for devices and systems based on 252Cf are expected to increase by a factor of 7 in the 6-y period from 1975 to 1980. The annual business value of 252Cf devices should increase from 1.5 million dollars in 1975 to 10.8 million dollars in 1980. The potential European market should be several times as large as the US market, based on actual sales of 252Cf, which have been two to four times greater in Europe than in the US

  12. The protective cell petrus for the production of californium 252

    International Nuclear Information System (INIS)

    The alpha, beta, gamma, neutron cell which is described in the present paper is devoted to the transplutonium element production and study. It is located at the CEN in Fontenay-aux-Roses (France). The 4 feet ordinary concrete shielding made of stacked blocs allows the manipulation of radioactive sources as high as 1000 curies of 1 MeV gamma rays and with a fast neutrons flux of 109 n.cm-2.s-1. The airtight alpha containment box is equipped with two transfer systems, one consists of a parallelepiped shaped airtight box located in a turntable, the other uses standard cylindrical containers made of polyethylene. The general equipment and the main setting up are also described. (authors)

  13. Californium-252 neutron activation facility at the Savannah River Laboratory

    International Nuclear Information System (INIS)

    A neutron irradiation facility has been established to develop new analytical methods and for the support of research programs. A major component of this facility is a 252Cf source which provides both fission spectrum and thermal neutrons. (U.S.)

  14. Californium-252 brachytherapy for anal and ano-rectal carcinoma

    International Nuclear Information System (INIS)

    Surgery has historically been the standard treatment for anal, ano-rectal and rectal carcinoma but is prone to local or regional failure. Over the past 15 years there has been increasing interest in and success with radiation therapy and combined chemoradiotherapy for treatment of anal and ano-rectal cancers. Cf-252 brachytherapy combined with external beam teletherapy has been investigated for anal and ano-rectal lesions at the Univ. of Kentucky with encouraging results

  15. Mobile equipment for neutron radiography using a californium-252 source

    International Nuclear Information System (INIS)

    The basic requirements for successful neutron radiography are first summarised and the use of 252Cf is placed in perspective by comparing its properties with those of sources based on the Be (γ, n) and Be (α, n) reactions which have a broadly similar range of applications. The more essential design features of mobile neutron radiography equipment are next examined in some detail, to show how the often conflicting requirements of optimum beam production and adequate shielding may be reconciled. An assembly with a maximum dimension around 1 m with a source of 1 mg is used as an example. The design data used are reproduced in graphical form to permit designs to be scaled to suit the source available and the requirements. The selection of suitable image recorders for 252Cf radiography is discussed with the conclusion that the gadolinium foil-film combinations are likely to remain the normal choice. Demonstration radiographs are presented with particular reference to the location of residual casting sand in gas-cooled turbine blades. Finally, it is suggested that other applications for mobile 252Cf-based neutron radiography equipment will be found in the ordnance, aero-space, chemical and nuclear fuel manufacturing industries. (author)

  16. Automated absolute activation analysis with californium-252 sources

    Energy Technology Data Exchange (ETDEWEB)

    MacMurdo, K.W.; Bowman, W.W.

    1978-09-01

    A 100-mg /sup 252/Cf neutron activation analysis facility is used routinely at the Savannah River Laboratory for multielement analysis of many solid and liquid samples. An absolute analysis technique converts counting data directly to elemental concentration without the use of classical comparative standards and flux monitors. With the totally automated pneumatic sample transfer system, cyclic irradiation-decay-count regimes can be pre-selected for up to 40 samples, and samples can be analyzed with the facility unattended. An automatic data control system starts and stops a high-resolution gamma-ray spectrometer and/or a delayed-neutron detector; the system also stores data and controls output modes. Gamma ray data are reduced by three main programs in the IBM 360/195 computer: the 4096-channel spectrum and pertinent experimental timing, counting, and sample data are stored on magnetic tape; the spectrum is then reduced to a list of significant photopeak energies, integrated areas, and their associated statistical errors; and the third program assigns gamma ray photopeaks to the appropriate neutron activation product(s) by comparing photopeak energies to tabulated gamma ray energies. Photopeak areas are then converted to elemental concentration by using experimental timing and sample data, calculated elemental neutron capture rates, absolute detector efficiencies, and absolute spectroscopic decay data. Calculational procedures have been developed so that fissile material can be analyzed by cyclic neutron activation and delayed-neutron counting procedures. These calculations are based on a 6 half-life group model of delayed neutron emission; calculations include corrections for delayed neutron interference from /sup 17/O. Detection sensitivities of < or = 400 ppB for natural uranium and 8 ppB (< or = 0.5 (nCi/g)) for /sup 239/Pu were demonstrated with 15-g samples at a throughput of up to 140 per day. Over 40 elements can be detected at the sub-ppM level.

  17. Californium-based neutron radiography for corrosion detection in aircraft

    International Nuclear Information System (INIS)

    In support of an overall program aimed at minimizing disassembly and reducing inspection time during aircraft maintenance, a series of projects has been carried out to determine the feasibility of applying neutron radiographic techniques to the nondestructive (NDT) inspection of aircraft and aircraft components. These investigations have clearly demonstrated the superiority of neutron radiography over all other NDT techniques in its ability to detect surface and subsurface corrosion in aircraft structure. This capability is particularly significant where the corrosion is hidden behind thick metallic structural members. The neutron radiographic technique has been applied successfully to detect corrosion in the wing tank of E-2C, C-130, and DC-9 aircraft; rear stabilators of F-4 and F-111 aircraft; aft spar, starboard and port wing, and rudder of the F-8; fuselage skin of the 727; rotary blades of AH-1 and SH-3 helicopters; rotary tail flaps of the UH-2 helicopter; and nose landing gear of A-7 aircraft

  18. Automated absolute activation analysis with californium-252 sources

    International Nuclear Information System (INIS)

    A 100-mg 252Cf neutron activation analysis facility is used routinely at the Savannah River Laboratory for multielement analysis of many solid and liquid samples. An absolute analysis technique converts counting data directly to elemental concentration without the use of classical comparative standards and flux monitors. With the totally automated pneumatic sample transfer system, cyclic irradiation-decay-count regimes can be pre-selected for up to 40 samples, and samples can be analyzed with the facility unattended. An automatic data control system starts and stops a high-resolution gamma-ray spectrometer and/or a delayed-neutron detector; the system also stores data and controls output modes. Gamma ray data are reduced by three main programs in the IBM 360/195 computer: the 4096-channel spectrum and pertinent experimental timing, counting, and sample data are stored on magnetic tape; the spectrum is then reduced to a list of significant photopeak energies, integrated areas, and their associated statistical errors; and the third program assigns gamma ray photopeaks to the appropriate neutron activation product(s) by comparing photopeak energies to tabulated gamma ray energies. Photopeak areas are then converted to elemental concentration by using experimental timing and sample data, calculated elemental neutron capture rates, absolute detector efficiencies, and absolute spectroscopic decay data. Calculational procedures have been developed so that fissile material can be analyzed by cyclic neutron activation and delayed-neutron counting procedures. These calculations are based on a 6 half-life group model of delayed neutron emission; calculations include corrections for delayed neutron interference from 17O. Detection sensitivities of 239Pu were demonstrated with 15-g samples at a throughput of up to 140 per day. Over 40 elements can be detected at the sub-ppM level

  19. NuSTAR AND CHANDRA INSIGHT INTO THE NATURE OF THE 3-40 keV NUCLEAR EMISSION IN NGC 253

    Energy Technology Data Exchange (ETDEWEB)

    Lehmer, B. D. [Johns Hopkins University, Homewood Campus, Baltimore, MD 21218 (United States); Wik, D. R.; Hornschemeier, A. E.; Ptak, A.; Leyder, J.-C.; Venters, T.; Zhang, W. W. [NASA Goddard Space Flight Center, Code 662, Greenbelt, MD 20771 (United States); Antoniou, V. [Department of Physics and Astronomy, Iowa State University, 12 Physics Hall, Ames, IA 50011 (United States); Argo, M. K. [ASTRON, the Netherlands Institute for Radio Astronomy, Postbus 2, 7990 AA, Dwingeloo (Netherlands); Bechtol, K. [Kavli Institute for Cosmological Physics, Chicago, IL 60637 (United States); Boggs, S.; Craig, W. W.; Krivonos, R. [Space Sciences Laboratory, University of California, Berkeley, CA 94720 (United States); Christensen, F. E. [DTU Space-National Space Institute, Technical University of Denmark, Elektrovej 327, DK-2800 Lyngby (Denmark); Hailey, C. J. [Columbia Astrophysics Laboratory, Columbia University, New York, NY 10027 (United States); Harrison, F. A. [Caltech Division of Physics, Mathematics and Astronomy, Pasadena, CA 91125 (United States); Maccarone, T. J. [School of Physics and Astronomy, University of Southampton, Highfield SO17 IBJ (United Kingdom); Stern, D. [Jet Propulsion Laboratory, California Institute of Technology, Pasadena, CA 91109 (United States); Zezas, A. [Physics Department, University of Crete, Heraklion (Greece)

    2013-07-10

    We present results from three nearly simultaneous Nuclear Spectroscopic Telescope Array (NuSTAR) and Chandra monitoring observations between 2012 September 2 and 2012 November 16 of the local star-forming galaxy NGC 253. The 3-40 keV intensity of the inner {approx}20 arcsec ({approx}400 pc) nuclear region, as measured by NuSTAR, varied by a factor of {approx}2 across the three monitoring observations. The Chandra data reveal that the nuclear region contains three bright X-ray sources, including a luminous (L{sub 2-10{sub keV}} {approx} few Multiplication-Sign 10{sup 39} erg s{sup -1}) point source located {approx}1 arcsec from the dynamical center of the galaxy (within the 3{sigma} positional uncertainty of the dynamical center); this source drives the overall variability of the nuclear region at energies {approx}>3 keV. We make use of the variability to measure the spectra of this single hard X-ray source when it was in bright states. The spectra are well described by an absorbed (N{sub H} Almost-Equal-To 1.6 Multiplication-Sign 10{sup 23} cm{sup -2}) broken power-law model with spectral slopes and break energies that are typical of ultraluminous X-ray sources (ULXs), but not active galactic nuclei (AGNs). A previous Chandra observation in 2003 showed a hard X-ray point source of similar luminosity to the 2012 source that was also near the dynamical center ({theta} Almost-Equal-To 0.4 arcsec); however, this source was offset from the 2012 source position by Almost-Equal-To 1 arcsec. We show that the probability of the 2003 and 2012 hard X-ray sources being unrelated is >>99.99% based on the Chandra spatial localizations. Interestingly, the Chandra spectrum of the 2003 source (3-8 keV) is shallower in slope than that of the 2012 hard X-ray source. Its proximity to the dynamical center and harder Chandra spectrum indicate that the 2003 source is a better AGN candidate than any of the sources detected in our 2012 campaign; however, we were unable to rule out a ULX

  20. NuSTAR AND CHANDRA INSIGHT INTO THE NATURE OF THE 3-40 keV NUCLEAR EMISSION IN NGC 253

    International Nuclear Information System (INIS)

    We present results from three nearly simultaneous Nuclear Spectroscopic Telescope Array (NuSTAR) and Chandra monitoring observations between 2012 September 2 and 2012 November 16 of the local star-forming galaxy NGC 253. The 3-40 keV intensity of the inner ∼20 arcsec (∼400 pc) nuclear region, as measured by NuSTAR, varied by a factor of ∼2 across the three monitoring observations. The Chandra data reveal that the nuclear region contains three bright X-ray sources, including a luminous (L2-10keV ∼ few × 1039 erg s–1) point source located ∼1 arcsec from the dynamical center of the galaxy (within the 3σ positional uncertainty of the dynamical center); this source drives the overall variability of the nuclear region at energies ∼>3 keV. We make use of the variability to measure the spectra of this single hard X-ray source when it was in bright states. The spectra are well described by an absorbed (NH ≈ 1.6 × 1023 cm–2) broken power-law model with spectral slopes and break energies that are typical of ultraluminous X-ray sources (ULXs), but not active galactic nuclei (AGNs). A previous Chandra observation in 2003 showed a hard X-ray point source of similar luminosity to the 2012 source that was also near the dynamical center (θ ≈ 0.4 arcsec); however, this source was offset from the 2012 source position by ≈1 arcsec. We show that the probability of the 2003 and 2012 hard X-ray sources being unrelated is >>99.99% based on the Chandra spatial localizations. Interestingly, the Chandra spectrum of the 2003 source (3-8 keV) is shallower in slope than that of the 2012 hard X-ray source. Its proximity to the dynamical center and harder Chandra spectrum indicate that the 2003 source is a better AGN candidate than any of the sources detected in our 2012 campaign; however, we were unable to rule out a ULX nature for this source. Future NuSTAR and Chandra monitoring would be well equipped to break the degeneracy between the AGN and ULX nature of the 2003

  1. Cloning, Prokaryotic Expression, and Functional Testing of a γ-Gliadin Gene from Wheat Cultivar Shaan 253%小麦品种陕253γ-醇溶蛋白基因的克隆、原核表达与功能鉴定

    Institute of Scientific and Technical Information of China (English)

    王明霞; 高翔; 陈其皎; 董剑; 赵万春; 李艳亮; 李敏

    2011-01-01

    The γ-gliadin gene (GenBank accession No.GQ857626) was isolated from a wheat (Triticum aestivum) cultivar with a hight quality Shaan 253, using inductuion a set of genome specific primers.The deduced amino acid sequence of GQ857626 exhibited an additional cysteine residue in the region Ⅱ of mature γ-gliadin subunits compared to the previous report.A prokaryotic expression vector was constructed to express GQ857626 in the host bacterium Escherichia coli Rosetta-gami B (DE3).The SDS-PAGE and Western blot analysis confirmed that the fusion protein was expressed by induction of 0.1 mmol L-1 isopropyl-β-D-thiogalactoside (IPTG), and its actual molecular weight was about 50 kD nearly equal to the predicted.After separation and purification using HisTrap HP affinity chromatography, the function of fusion protein was tested by means of micro 4 g farinograph.When the subunit of GQ857626 was integrated into the control flour through oxidation-reduction reaction, many important farinograph parameters changed drastically, such as development time, dough stabilizing time, degree of softening.Although the gluten strength of the control flour could be improved in some degree, the subunit of GQ857626 showed a negative effect on the rheological properties of wheat flour.%利用设计合成的特异γ-醇溶蛋白基因引物,采用PCR方法从小麦品种陕253克隆获得一个γ-醇溶蛋白基因(GenBank登录号为GQ857626).序列分析表明,该基因编码产物的Ⅱ区由于碱基转换产生一个额外的半胱氨酸残基.构建了GQ857626的原核表达载体并转入表达菌株E.coli Rosetta gami B(DE3),IPTG诱导其成功表达.使用HisTrap HP组氨酸标记亲和层析柱纯化该基因的表达产物,并使用4 g粉质仪分析其功能.结果显示,将此纯化蛋白通过氧化还原反应整合到基础面粉后,面团的形成时间缩短,稳定时间减少,弱化度增加,导致主要的粉质指数明显下降,说明该亚基对

  2. 乌鲁木齐市253例孕妇叶酸、锌相关知识认知度及服用情况调查%Survey of nutrition knowledge and usage of folic acid and zinc in 253 pregnant women from Urumqi

    Institute of Scientific and Technical Information of China (English)

    马晶; 吐尔逊江·买买提明; 阿依加玛丽·王; 王晓军; 迪丽霍玛尔·吾尔开希

    2015-01-01

    Objective To investigate pregnant women′s knowledge and usage of folic acid and zinc in Uru-mqi area,and to find out the possible influencing factors.Methods 253 pregnant women in Maternal and Child Health Hospital of Urumqi were investigated by questionnaire survey.The collected data were ana-lyzed the rate of awareness and usage by univariate analysis method and we made a comparison between the differences in age,education level,household income and occupation.Results The average rate of nutri-tion awareness of folic acid and zinc was 83.4% and 58.1%.The intake rate was 80.2% and 23.3%;the fo-lic acid knowledge and usage were significant different in different ages,educational levels,occupation (P<0.05).The awareness and usage of folic acid and zinc was lower in pregnant women from low-income, poor education backgrounds than that in those from high-income,good education environment (P <0.05). One of the main sources of pregnant women′s folic acid and zinc knowledge comes from doctors′guidance, accounting for 42.5% and 42.2%;next from the media,accounting for 27.6% and 27.7%;medical books accounting for 21% and 22.5%;birth planning workers and expert lectures accounted for the least,8.8%and 7.7%.Conclusion The rates of awareness and intake of folic acid has incresed in pregnant women in Urumqi.However,the rates of awareness and intake of zinc was very low.Therefore,we should increase the efforts in the education of nutrition knowledge of folic acid,zinc among the pregnant women of low ed-ucation level, low age and low-income so as to promote maternal and child health and reduce maternal complications.%目的:了解乌鲁木齐市孕妇叶酸及锌相关知识的认知度和服用情况,探讨其可能的影响因素,为加强孕妇营养及进行健康教育提供科学依据。方法采用自行编制的问卷对新疆维吾尔自治区妇幼保健中心就诊的253名孕妇进行调查。对孕妇叶酸、锌相关知识的知晓及服用情况进

  3. 关中地区'陕253'品质与氮、磷、钾配比间关系的研究%Relationship of the Quality with Nitrogen, Phosphorous and Potassium Ratio in the Wheat Variety 'Shaan 253'

    Institute of Scientific and Technical Information of China (English)

    裴阿卫; 张睿; 刘党校; 赵永; 王新中

    2006-01-01

    选用强筋小麦品种'陕253',在关中东、西和中部采取不同的氮(N)、磷(P)、钾(K)肥配比处理,用GGE Biplot叠图软件分析肥料配比对不同地区籽粒品质性状的效应.研究结果表明:不同N、P、K配比对强筋小麦品质性状的效应与生态区有关.关中西部蛋白质含量、容重、硬度、稳定时间之间呈显著正相关,蛋白质含量、容重和硬度的最优N、P、K配比是N 135 kg/hm2、P2O5 225 kg/hm2、K2O 120 kg/hm2,降落值、出粉率、湿面筋含量和稳定时间是N 225 kg/hm2、P2O5 225 kg/hm2、K2O 120 kg/hm2;关中中部蛋白质含量、稳定时间、沉淀值、容重之间呈显著正相关,其最优N、P、K配比为N 225 kg/hm2、P2O5 225 kg/hm2、K2O 120 kg/hm2,降落值和吸水率最优N、P、K配比为N 135 kg/hm2、P2O5 225 kg/hm2、K2O 180 kg/hm2;关中东部籽粒蛋白质含量与吸水率之间显著正相关,其最优N、P、K配比为N 225 kg/hm2、P2O5 225 kg/hm2、K2O 180 kg/hm2,湿面筋含量、降落值、沉淀值、容重、出粉率和硬度间表现极限著的正相关关系,最优N、P、K配比是N 135 kg/hm2、P2O5 120 kg/hm2、K2O 120 kg/hm2.

  4. Interstitial deletion of chromosome 1q [del(1)(q24q25.3)] identified by fluorescence in situ hybridization and gene dosage analysis of apolipoprotein A-II, coagulation factor V, and antithrombin III

    Energy Technology Data Exchange (ETDEWEB)

    Takano, Takako; Yamanouchi, Yasuko; Mori, Yosuke [Teikyo Univ. School of Medicine, Tokyo (Japan)] [and others

    1997-01-20

    We report on a 12-month-old Japanese boy with an interstitial deletion of the long-arm of chromosome 1 and meningomyelocele, hydrocephalus, anal atresia, atrial septal defect, left renal agenesis, bilateral cryptorchidism, talipes equinovarus, low birth weight, growth/developmental retardation, and many minor anomalies. By conventional GTG-banding, his karyotype was first interpreted as 46,XY,de1(1)(q23q24), but it was corrected as 46,XY.ish del(1)(q24q25.3) by fluorescence in situ hybridization using 11 known cosmid clones as probes. His serum levels of apolipoprotein A-II (gene symbol: APOA2, previously assigned to 1q21-q23) and coagulation factor V (F5, 1q21-q25) were normal, while serum concentration and activity of antithrombin III (AT3, 1q23-q25.1) was low. The results indicated that localization of APOA2 and F5 are proximal to the deleted region and AT3 is located within the deletion extent in the patient. 16 refs., 4 figs.

  5. A conservative assessment of the major genetic causes of idiopathic chronic pancreatitis: data from a comprehensive analysis of PRSS1, SPINK1, CTRC and CFTR genes in 253 young French patients.

    Directory of Open Access Journals (Sweden)

    Emmanuelle Masson

    Full Text Available Idiopathic chronic pancreatitis (ICP has traditionally been defined as chronic pancreatitis in the absence of any obvious precipitating factors (e.g. alcohol abuse and family history of the disease. Studies over the past 15 years have revealed that ICP has a highly complex genetic architecture involving multiple gene loci. Here, we have attempted to provide a conservative assessment of the major genetic causes of ICP in a sample of 253 young French ICP patients. For the first time, conventional types of mutation (comprising coding sequence variants and variants at intron/exon boundaries and gross genomic rearrangements were screened for in all four major pancreatitis genes, PRSS1, SPINK1, CTRC and CFTR. For the purposes of the study, synonymous, intronic and 5'- or 3'-untranslated region variants were excluded from the analysis except where there was persuasive evidence of functional consequences. The remaining sequence variants/genotypes were classified into causative, contributory or neutral categories by consideration of (i their allele frequencies in patient and normal control populations, (ii their presumed or experimentally confirmed functional effects, (iii the relative importance of their associated genes in the pathogenesis of chronic pancreatitis and (iv gene-gene interactions wherever applicable. Adoption of this strategy allowed us to assess the pathogenic relevance of specific variants/genotypes to their respective carriers to an unprecedented degree. The genetic cause of ICP could be assigned in 23.7% of individuals in the study group. A strong genetic susceptibility factor was also present in an additional 24.5% of cases. Taken together, up to 48.2% of the studied ICP patients were found to display evidence of a genetic basis for their pancreatitis. Whereas these particular proportions may not be extrapolable to all ICP patients, the approach employed should serve as a useful framework for acquiring a better understanding of the

  6. 50 CFR 253.22 - State projects.

    Science.gov (United States)

    2010-10-01

    ... project, which may be multiyear. Proposals must describe the full scope of work, specifications, and cost... project, unless: (1) The state has adopted an interstate fishery management plan for the fishery resource... determined are consistent with any Federal fishery management plan for the species to which the...

  7. 42 CFR 447.253 - Other requirements.

    Science.gov (United States)

    2010-10-01

    ... agency determines appropriate, of payment rates. (f) Uniform cost reporting. The Medicaid agency must... Medicaid agency must provide for periodic audits of the financial and statistical records of participating... intermediate care services) under conditions similar to those described in section 1861(v)(1)(G) of the...

  8. 50 CFR 253.10 - Definitions.

    Science.gov (United States)

    2010-10-01

    .... Fishery facility means land, land structures, water craft that do not fish, and equipment used for..., land structures, water structures, water craft built in the U.S., and equipment for hatching, caring... exports; helping develop an underutilized fishery; or enhancing financial stability, financial...

  9. 8 CFR 253.1 - Parole.

    Science.gov (United States)

    2010-01-01

    ... opinion, or because of fear of torture is eligible to apply for asylum or withholding of removal under 8 CFR part 208. Service officers shall take particular care to ensure that the provisions of § 208.5(b... 235(c) alleging persecution or torture. Any alien crewman, stowaway, or alien removable under...

  10. 6 CFR 25.3 - Delegation.

    Science.gov (United States)

    2010-01-01

    ... under the SAFETY Act, except the authority to declare that an act is an Act of Terrorism for purposes of section 865(2) of the SAFETY Act, may be exercised by the Under Secretary for Science and Technology of... DEPARTMENT OF HOMELAND SECURITY, OFFICE OF THE SECRETARY REGULATIONS TO SUPPORT ANTI-TERRORISM BY...

  11. Associations of chromosomes 17q22, 10q25.3 and ABCA4 gene polymorphisms with non-syndromic cleft lip/palate in Ningxia Hui and Han population%宁夏回汉族人群中染色体17q22、10q25.3和ABCA4基因多态性与非综合征型唇腭裂的关联

    Institute of Scientific and Technical Information of China (English)

    周忠伟; 杨雄; 万应彪; 信燕华; 翟堃; 马坚; 黄永清; 姜敏; 王怡瑞

    2013-01-01

    目的 研究中国宁夏地区回汉族人群染色体17q22(rs227731)、ABCA4(rs560426)和10q25.3(7078160)位点单核苷酸多态性与非综合征型唇腭裂的相关性.方法 研究对象包括非综合征型唇腭裂患儿415例,其中汉族191例,回族224例;患儿父亲205例,母亲240例;其中完整3人核心家系158个.将他们分为单纯唇裂组、单纯腭裂组、唇腭裂组,单纯唇裂组与唇腭裂组合并为唇裂伴或不伴腭裂组;对照组为健康大学生385例,其中汉族281例,回族104例.采用TaqMan基因型鉴定技术检测3个单核苷酸多态位点的基因型,进行病例对照分析、传递不平衡检验、以家系为基础的相关性分析.结果 ①染色体17q22区段的rs227731位点在汉族单纯唇裂组等位基因频率与对照组比较存在统计学差异(P<0.05),在唇裂伴或不伴腭裂组中等位基因频率与对照组比较存在统计学差异(P<0.05).回汉族唇腭裂组等位基因频率和唇裂伴或不伴腭裂组基因型、等位基因频率比较均存在统计学差异(P=0.04,P=0.04,P=0.01);②ABCA4基因的rs560426位点在汉族单纯唇裂组基因型与等位基因频率与对照组比较存在统计学差异(P<0.05),在唇裂伴或不伴腭裂组中基因型与等位基因频率与对照组比较存在统计学差异(P<0.05),回汉族单纯唇裂组基因型、等位基因比较存在统计学差异(P=0.04,P=0.01);③染色体10q25.3区段的rs7078160位点基因型与等位基因频率与对照组比较及回汉族相互比较均无统计学差异(P<0.05).结论 在宁夏汉族人群中染色体17q22区段的rs227731位点和ABCA4基因的rs560426位点单核苷酸多态性与非综合征型唇腭裂有统计学关联,染色体10q25.3区段的rs7078160位点与非综合征型唇腭裂无统计学关联.%Objective To explore if genetic variation in chromosome 17q22 (rs22731), ABCA4 (rs560426) and 10q25. 3(rs7078160)genes contributes to non-syndromic cleft lip

  12. Capture cross section measurement analysis in the Californium-252 spectrum with the Monte Carlo method

    International Nuclear Information System (INIS)

    Absolute average capture cross sections of gold, thorium, tantalum, molybdenum, copper and strontium in 252Cf spontaneous fission neutron spectrum were simulated for two types of experiment setups preformed by Z. Dezso and J. Csikai and by L. Green. The experiments were simulated with MCNP5 using cross section data from the ENDF/B-VII.0 library. The determination of neutron backscattering was calculated with the use of neutron flagging. Correction factors to experimentally measured values were determined to obtain average cross sections in a pure 252Cf spontaneous fission spectrum. Influence of concrete wall thickness, air moisture and room size on the average cross section was analyzed. Correction factors amounted to about 30%. Corrected values corresponding to average cross sections in a pure 252Cf spectrum were calculated for 197Au, 232Th, 181Ta, 98Mo, 65Cu and 84Sr. Average cross sections were also calculated with the RR-UNC software using IRDFF-v.1.05 and ENDF/B-VII.0 libraries. The revised average radiative capture cross sections are 75.5±0.1 mb for 197Au, 87.0±1.6 mb for 232Th , 98.0±4.5 mb for 181Ta, 21.2±0.5 mb for 98Mo, 10.3±0.3 mb for 63Cu, and 34.9±6.5 mb for 84Sr. - Highlights: • Average capture cross sections in 252Cf spontaneous fission spectrum were simulated. • Calculations were done using MCNP5 code and ENDF/B-VII.0 library. • Correction factors for self-shielding and room return effects were taken into account. • The revised average radiative capture cross sections for different materials are published

  13. Multi-element neutron activation analysis of sediment using a californium-252 source

    International Nuclear Information System (INIS)

    The application of a 252Cf source to the neutron activation analysis of several elements in small (approximately 1.5 in. in dia) cores was studied using high-resolution gamma ray spectroscopy and manual data reduction. (U.S.)

  14. OER of californium-252 at low dose rate for growth inhibition in Vicia faba

    International Nuclear Information System (INIS)

    OER of 252Cf, at low dose rate, has been determined for growth inhibition in Vicia faba roots. A new strain ''BelB'' was used; it was found to be more resistant to prolonged anoxia. Two sets of linear 252Cf sources were used (linear activity 0.31 and 0.47 (μg.cm-1)) in somewhat different geometrical arrangements. The (n+γ) 252Cf dose rates at the level of the root tips were 0.11 and 0.13 Gy.h-1 respectively. The relative contribution of the γ component Dsub(γ) to the total absorbed dose Dsub(n+γ) at the level of the root tips was evaluated Dsub(γ)/Dsub(n+γ)=0.35 for the first source-geometry and 0.42 for the second source-geometry. The reference radiation was the γ emission of 192Ir, used in the same geometrical conditions and for similar irradiation times. Irradiations performed in aerobic and anoxic conditions were alternated. OER values of 1.4 +- 0.1 and 1.5 +- 0.1 were observed for the 252Cf emission with the first and second source-geometry respectively. The corresponding OER values for 192Ir were 2.3 +- 0.2 and 2.6 +- 0.1; the derived oxygen gain factors were then equal to 1.6 and 1.7 repectively

  15. Dicty_cDB: SHC253 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available yostelium discoideum strain QS... 262 4e-69 FJ374891_1( FJ374891 |pid:none) Dictyostelium discoideum stra...in QS... 261 6e-69 FJ374901_1( FJ374901 |pid:none) Dictyostelium discoideum strain QS...... 260 2e-68 FJ374918_1( FJ374918 |pid:none) Dictyostelium discoideum strain QS... 260 2e-68 FJ374915_1( FJ374915 |pid:none) Dict...yostelium discoideum strain QS... 259 2e-68 FJ374895_1( FJ374895 |pid:none) Dict...yostelium discoideum strain QS... 259 2e-68 FJ374893_1( FJ374893 |pid:none) Dictyostelium discoideum stra

  16. Dicty_cDB: SSL253 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available isqiikqht *lqrikakpvqfpqliadvahhqnqihnqvimfi*ckkiitff*kcklckkkiktifvvy lilnkkkk Frame B: *lyqfqkiiiiiitikndi...) Value N U29872 |U29872.1 Neocallimastix patriciarum cellobiohydrolase precursor....32 1 AL590083 |AL590083.8 Human DNA sequence from clone RP11-475D8 on chromosome X Contains a novel tran...script, the GPR23 gene for G protein-coupled receptor 23 and a pseudogene similar to ribosoma...sporter; 26 5.1 AF412111_1( AF412111 |pid:none) Arabidopsis thaliana AT4g12480/T1P... 32 5.4 protein

  17. Dicty_cDB: SFF253 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available rcklstnpsqlsirrkgwc*klpt*wfhgcqw*ww*rsklstklfrwsrats ricst*i*rlwfrcsstiqssk*rlcstr*fi*thv*rcqisfrl*fsrshvrch...82 8e-17 2 BX554380 |BX554380.1 Glossina morsitans morsitans (Tseatse fly) EST fr...om adult infected midgut library, clone Tse15b01_q1c. 74 2e-09 1 BX554266 |BX554266.1 Glossina morsitans morsitans (Tseats...20.1 Glossina morsitans morsitans (Tseatse fly) EST from adult infected midgut li...brary, clone Tse74e09_q1c. 74 2e-09 1 U40704 |U40704.1 Candida albicans catalase (Cat) gene, complete cds. 7

  18. 7 CFR 253.5 - State agency requirements.

    Science.gov (United States)

    2010-01-01

    ... Federal, State, or local laws, including, but not limited to, laws relating to taxation, welfare, and... advance of the meeting. FNS shall schedule and conduct the meeting and make a decision within 60 days...

  19. 50 CFR 253.14 - Economic and financial requirements.

    Science.gov (United States)

    2010-10-01

    ... protect the U.S. against the industry's cyclical economics and other risks of loss. (b) Working capital... capital, a guarantor with sufficient financial resources, etc.). (c) Audited financial statements....

  20. Dicty_cDB: SLA253 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available TTTATS*i*sknifyqvslq**f****yqkmilkipf fsl*fln*i*nk*kkkknl Translated Amino Acid s...GMPLQLGYGANGKNGDNGISVWLIYGYTIVDINCNIRPIITAA TIATTTAATTTATTTATTATTTATTTATS*i*sknifyqvslq**f****yqkmilkipf fsl

  1. 7 CFR 253.7 - Certification of households.

    Science.gov (United States)

    2010-01-01

    ... may also employ computer checks, address checks and telephone calls to prevent dual participation. The... pertaining to reporting changes for PA households shall be applied to GA households in project areas where GA... for inability to verify income include failure of the person or organization providing the income...

  2. 7 CFR 253.6 - Eligibility of households.

    Science.gov (United States)

    2010-01-01

    ..., for example payments made by the Department of Housing and Urban Development through the individual.... Nonmonetary or in-kind benefits, such as meals, clothing, public housing, or produce from a garden. (B)...

  3. 40 CFR 98.253 - Calculating GHG emissions.

    Science.gov (United States)

    2010-07-01

    ... required under 40 CFR part 63 subpart UUU, assume %CO to be zero. (iii) If you have a CO boiler that uses... treatment incinerator) must be reported under subpart C of this part (General Stationary Fuel Combustion... feed (including sour water stripper gas) to the sulfur recovery plant (scf/year). 44 = Molecular...

  4. Underground storage tank 253-D1U1 Closure Plan

    Energy Technology Data Exchange (ETDEWEB)

    Mancieri, S.; Giuntoli, N.

    1993-09-01

    This report is a closure plan for a diesel fuel tank at the Lawrence Livermore National Laboratory. Included are maps of the site, work plans, and personnel information regarding training and qualification.

  5. Dicty_cDB: VSK253 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available U976032 |pid:none) Zea mays clone 509150 periodic try... 155 4e-37 AC126012_7( AC126012 |pid:none) Medicago ...302 |BG128302.1 EST473948 tomato shoot/meristem Lycopersicon esculentum cDNA clone cTOF19N21 5' sequence, mR...NA sequence. 42 6.5 1 BF460048 |T05027, mRNA sequence. 42 6.5 1 AW441898 |AW441898.1 EST311294 tomato fruit red ripe, TAMU Lycoper... 6.5 1 BM411909 |BM411909.1 EST586236 tomato breaker fruit Lycopersicon esculentum cDNA clone cLEG58G18 5' e...ospora anserina genomic DNA ch... 148 6e-35 AP007151_719( AP007151 |pid:none) Asper

  6. 19 CFR 10.253 - Articles eligible for preferential treatment.

    Science.gov (United States)

    2010-04-01

    ...) Footwear not designated on December 4, 1991, as eligible articles for the purpose of the Generalized System... (iv) Handbags, luggage, flat goods, work gloves, and leather wearing apparel that were not...

  7. Dicty_cDB: CHJ253 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available dkeklakkaaeglknakntassyasgin askdqlnsnfknikenissnlnnakhtieenvhnaqrtgyppkvpapgsnkf...igflalgv fglfawkfyegkkykeneqklikqkh*kk--- ---slyy*fvfkkfikikiinfk*ikr*kkmtdnwdkeklakkaaeglknakntassyax ginaskdqlnsnfknike

  8. 48 CFR 253.209-1 - Responsible prospective contractors.

    Science.gov (United States)

    2010-10-01

    ... obtain needed facilities, equipment, materials, etc. (E) Accounting system and related internal controls... an accounting system review when soliciting and awarding cost-reimbursement or incentive type... contractor's key management personnel to determine if they have the basic technical knowledge,...

  9. Dicty_cDB: SFL253 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CAAAAATTCAAGACAAAGAAGGTA TNCCA sequence update 2001. 6. 1 Translated Amino Acid sequence ---*xxxsxkxrxppxxxvsfsxvxixkmxxlslipkskknxls...QIFVKTLTGKTITLEVEGSDNIENVKTKIQDKEGX P Translated Amino Acid sequence (All Frames) Frame A: ---*xxxsxkxrxppxxxvsfsxvxixkmxxls...e C: ---kxxfxkxkvspxsxxfifxgxhxknxgpfsdskiqkesxlhlssd*kvvckxlsxh* lvrpsllk*glr*y*kc*xkgsrqrryptrptkinfrw*tir...lipkskknxlstcpqikrwyanxcqxi nw*dhhx*SEGSDNIENVKXKVQDKEGIPPDQQRLIF

  10. Dicty_cDB: AFN253 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 3 Translated Amino Acid sequence fllyky*ihilffyil*HFIKKKKKKKFKXXPFXKKK--- ---GKXXLXNVKTXXQDKEGXPPDQQRXISLVNN*xmxxlslitiskknxls...ikfifyffiycnis*kkkkkknlkxxlfxkkk--- ---GKXXLXNVKTXXQDKEGXPPDQQRXISLVNN*xmxxlslitiskknxlstwssd*ex vckslskh*lv

  11. The determination of americium, curium and californium in biological samples by combined solvent extraction-liquid scintillation counting

    International Nuclear Information System (INIS)

    A method has been developed to extract Am, Cm and Cf from ashed biological samples dissolved in 8 M LiN03-10-2 M HN03 into a liquid/scintillation cocktail. This new method reduces tissue and instrument background and allows use of a larger sample for analysis than when using a commercial gelling cocktail. The extractant cocktail is 20% N,N,N-trioctyl-N-methylammonium chloride dissolved in toluene containing the scintillators p-terphenyl and 1,4-bis-2-(5-phenyl-oxazolyl)-benzene. Several different types of biological samples were analyzed and radionuclide recoveries greater than 90% were obtained in all cases. (author)

  12. Raman and absorption spectrophotometric studies of selected lanthanide, californium-doped lanthanide, and actinide trihalides in the solid state

    International Nuclear Information System (INIS)

    The solid-state absorption spectra of Cf(III) ions as a dopant in lanthanide trihalide hosts (LnCl3: Ln = Ce, Sm, and Y; LnBr3: Ln = Ce, Sm, Tb, and Y; LnI3: Ln = Ce and Y) have been recorded. The spectra of Cf(III) have been correlated with the various crystal structures. The phonon Raman spectra and solid-state absorption spectra of PmF3, PmCl3, PmBr3, and two crystal modifications of PmI3 have been recorded. Symmetry assignments have been made for the Raman-active bands for these trihalides and also the sesquioxide. The room-temperature absorption spectra have been correlated to crystal field effects. The symmetry assignments of the Raman-active phonon modes have been made based on polarized Raman spectra from single crystals of YF3-type orthorhombic TbF3 and PuBr3-type orthorhombic NdBr3. Raman spectra of other isostructural lanthanide compounds have been recorded and compared. Symmetry assignments for these compounds have been made by analogy to the single-crystal assignments. Raman spectra have been obtained and catalogued for a number of actinide compounds. Symmetry assignments have been made for the observed Raman-active phonon bands in this work based on the assignments made for isostructural lanthanide compounds. 29 figs., 22 tabs

  13. Optical Transitions in Highly Charged Californium Ions with High Sensitivity to Variation of the Fine-Structure Constant

    Science.gov (United States)

    Berengut, J. C.; Dzuba, V. A.; Flambaum, V. V.; Ong, A.

    2012-08-01

    We study electronic transitions in highly charged Cf ions that are within the frequency range of optical lasers and have very high sensitivity to potential variations in the fine-structure constant, α. The transitions are in the optical range despite the large ionization energies because they lie on the level crossing of the 5f and 6p valence orbitals in the thallium isoelectronic sequence. Cf16+ is a particularly rich ion, having several narrow lines with properties that minimize certain systematic effects. Cf16+ has very large nuclear charge and large ionization energy, resulting in the largest α sensitivity seen in atomic systems. The lines include positive and negative shifters.

  14. Optical transitions in highly-charged californium ions with high sensitivity to variation of the fine-structure constant

    CERN Document Server

    Berengut, J C; Flambaum, V V; Ong, A

    2012-01-01

    We study electronic transitions in highly-charged Cf ions that are within the frequency range of optical lasers and have very high sensitivity to potential variations in the fine-structure constant, alpha. The transitions are in the optical despite the large ionisation energies because they lie on the level-crossing of the 5f and 6p valence orbitals in the thallium isoelectronic sequence. Cf16+ is a particularly rich ion, having several narrow lines with properties that minimize certain systematic effects. Cf16+ has very large nuclear charge and large ionisation energy, resulting in the largest alpha-sensitivity seen in atomic systems. The lines include positive and negative shifters.

  15. AN INTEGRAL REACTOR PHYSICS EXPERIMENT TO INFER ACTINIDE CAPTURE CROSS-SECTIONS FROM THORIUM TO CALIFORNIUM WITH ACCELERATOR MASS SPECTROMETRY

    International Nuclear Information System (INIS)

    The principle of the proposed experiment is to irradiate very pure actinide samples in the Advanced Test Reactor (ATR) at INL and, after a given time, determine the amount of the different transmutation products. The determination of the nuclide densities before and after neutron irradiation will allow inference of effective neutron capture cross-sections. This approach has been used in the past and the novelty of this experiment is that the atom densities of the different transmutation products will be determined using the Accelerator Mass Spectroscopy (AMS) technique at the ATLAS facility located at ANL. It is currently planned to irradiate the following isotopes: 232Th, 235U, 236U, 238U, 237Np, 238Pu, 239Pu, 240Pu, 241Pu, 242Pu, 241Am, 243Am and 248Cm.

  16. Integral range, energy, residual range, and linear energy transfer distributions for Californium fission fragments in microelectronics materials

    International Nuclear Information System (INIS)

    This report discusses the advantages and limitations of using Cf-252 radiation sources for single event testing of microelectronics for space environments. Integral distributions for the range, energy, residual range, and linear energy transfer of Cf-252 fission fragments in absorber and microelectronic materials have been calculated. Techniques are suggested for determining when single event testing using Cf-252 is appropriate; also, techniques are given for estimating the saturation cross section and thresh old linear energy transfer from test data. 10 refs., 25 figs., 2 tabs

  17. Research and experimental work at Groote Schuur Hospital and the University of Cape Town using californium-252 sources

    International Nuclear Information System (INIS)

    Experiments have been undertaken to determine the high-LET and low-LET components of the absorbed dose from neutron beams. This is achieved by measuring the fluxes of the high-LET and low-LET radiations in a tissue-equivalent phantom individually and simultaneously using a scintillation probe fitted with a pulse shape discriminator. This system was successfully used with a 22 MeV neutron beam from the T(d,n) reaction and has been employed with 252Cf sources. Results obtained in the low-energy ranges (up to 3 MeV) indicate that the electron counts exceed the high-LET counts by a factor of 2 to 3. These results are related to the absorbed dose. Calculations have also been undertaken to establish whether the Paterson-Parker system could be used for the design of 252Cf treatments and the optimum needle activities to yield the desired dose. Experiments are under way to determine the variation of RBE and OER for 252Cf radiations around the source. The inhibition of root growth in Vicia Faba is being used to determine any such effects. Dose rates comparable to that employed in interstitial radiotherapy are being aimed at. A study of dose fractionation effects is also being undertaken. (author)

  18. Accurate determination of Curium and Californium isotopic ratios by inductively coupled plasma quadrupole mass spectrometry (ICP-QMS) in 248Cm samples for transmutation studies

    International Nuclear Information System (INIS)

    The French Atomic Energy Commission has carried out several experiments including the mini-INCA (INcineration of Actinides) project for the study of minor-actinide transmutation processes in high intensity thermal neutron fluxes, in view of proposing solutions to reduce the radiotoxicity of long-lived nuclear wastes. In this context, a Cm sample enriched in 248Cm (∼97 %) was irradiated in thermal neutron flux at the High Flux Reactor (HFR) of the Laue-Langevin Institute (ILL). This work describes a quadrupole ICP-MS (ICP-QMS) analytical procedure for precise and accurate isotopic composition determination of Cm before sample irradiation and of Cm and Cf after sample irradiation. The factors that affect the accuracy and reproducibility of isotopic ratio measurements by ICP-QMS, such as peak centre correction, detector dead time, mass bias, abundance sensitivity and hydrides formation, instrumental background, and memory blank were carefully evaluated and corrected. Uncertainties of the isotopic ratios, taking into account internal precision of isotope ratio measurements, peak tailing, and hydrides formations ranged from 0.3% to 1.3%. This uncertainties range is quite acceptable for the nuclear data to be used in transmutation studies.

  19. MANTRA: An Integral Reactor Physics Experiment to Infer Actinide Capture Cross-sections from Thorium to Californium with Accelerator Mass Spectrometry

    Energy Technology Data Exchange (ETDEWEB)

    G. Youinou; C. McGrath; G. Imel; M. Paul; R. Pardo; F. Kondev; M. Salvatores; G. Palmiotti

    2011-08-01

    The principle of the proposed experiment is to irradiate very pure actinide samples in the Advanced Test Reactor at INL and, after a given time, determine the amount of the different transmutation products. The determination of the nuclide densities before and after neutron irradiation will allow inference of effective neutron capture cross-sections. This approach has been used in the past and the novelty of this experiment is that the atom densities of the different transmutation products will be determined using the Accelerator Mass Spectrometry technique at the ATLAS facility located at ANL. It is currently planned to irradiate the following isotopes: 232Th, 235U, 236U, 238U, 237Np, 238Pu, 239Pu, 240Pu, 241Pu, 242Pu, 241Am, 243Am, 244Cm and 248Cm.

  20. Radiological Characterization Technical Report on Californium-252 Sealed Source Transuranic Debris Waste for the Off-Site Source Recovery Project at Los Alamos National Laboratory

    Energy Technology Data Exchange (ETDEWEB)

    Feldman, Alexander [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2014-04-24

    This document describes the development and approach for the radiological characterization of Cf-252 sealed sources for shipment to the Waste Isolation Pilot Plant. The report combines information on the nuclear material content of each individual source (mass or activity and date of manufacture) with information and data on the radionuclide distributions within the originating nuclear material. This approach allows for complete and accurate characterization of the waste container without the need to take additional measurements. The radionuclide uncertainties, developed from acceptable knowledge (AK) information regarding the source material, are applied to the summed activities in the drum. The AK information used in the characterization of Cf-252 sealed sources has been qualified by the peer review process, which has been reviewed and accepted by the Environmental Protection Agency.

  1. The development and medical applications of a simple facility for partial body in vivo neutron activation analysis using californium-252 sources

    International Nuclear Information System (INIS)

    A simple and cheap facility for partial body neutron activation analysis has been designed, based on the use of two 100 μg 252Cf neutron sources. The results reported show that calcium can be measured in parts of the body such as the tibia with a precision as good as +- 1.6 % for a radiation dose of 2 rem. The uniformity of the thermal neutron flux density is better than +- 3 % over 10 cm. Some applications of this irradiation facility for studies of trace elements, in particular cadmium in liver and aluminium in liver or brain, have also been explored. However, the sensitivity attainable is not yet sufficient for the study of normal levels, but could be of interest in toxicological investigations

  2. Accurate determination of Curium and Californium isotopic ratios by inductively coupled plasma quadrupole mass spectrometry (ICP-QMS) in Cm-248 samples for transmutation studies

    International Nuclear Information System (INIS)

    The French Atomic Energy Commission has carried out several experiments including the mini-INCA (Incineration of Actinides) project for the study of minor-actinide transmutation processes in high intensity thermal neutron fluxes, in view of proposing solutions to reduce the radiotoxicity of long-lived nuclear wastes. In this context, a Cm sample enriched in 248Cm (similar to 97%) was irradiated in thermal neutron flux at the High Flux Reactor (HFR) of the Laue-Langevin Institute (ILL). This work describes a quadrupole ICP-MS (ICP-QMS) analytical procedure for precise and accurate isotopic composition determination of Cm before sample irradiation and of Cm and Cf after sample irradiation. The factors that affect the accuracy and reproducibility of isotopic ratio measurements by ICP-QMS, such as peak centre correction, detector dead time, mass bias, abundance sensitivity and hydrides formation, instrumental background, and memory blank were carefully evaluated and corrected. Uncertainties of the isotopic ratios, taking into account internal precision of isotope ratio measurements, peak tailing, and hydrides' formations ranged from 0. 3% to 1. 3%. This uncertainties' range is quite acceptable for the nuclear data to be used in transmutation studies. (authors)

  3. MANTRA: An Integral Reactor Physics Experiment to Infer Actinide Capture Cross-sections from Thorium to Californium with Accelerator Mass Spectrometry

    International Nuclear Information System (INIS)

    The principle of the proposed experiment is to irradiate very pure actinide samples in the Advanced Test Reactor at INL and, after a given time, determine the amount of the different transmutation products. The determination of the nuclide densities before and after neutron irradiation will allow inference of effective neutron capture cross-sections. This approach has been used in the past and the novelty of this experiment is that the atom densities of the different transmutation products will be determined using the Accelerator Mass Spectrometry technique at the ATLAS facility located at ANL. It is currently planned to irradiate the following isotopes: 232Th, 235U, 236U, 238U, 237Np, 238Pu, 239Pu, 240Pu, 241Pu, 242Pu, 241Am, 243Am, 244Cm and 248Cm.

  4. Las Tierras Indígenas en la Ley 19.253

    Directory of Open Access Journals (Sweden)

    Jaime López Allendes

    Full Text Available Desde el año 1993 rige en Chile una ley que reconoce a las étnias indígenas y señala que la tierra es para estas el fundamento principal de sus existencia y de su cultura. Tal declaración del legislador chileno es el basamento donde se levanta un régimen jurídico especial. Si bien con anterioridad se habían dictado varias leyes que regían las tierras indígenas, aquellas tuvieron por objeto, primero la radicación de los indígenas en comunidades, y luego la división para el ingreso de tales inmuebles al régimen común de propiedad prinvada, y más tarde al mercado. La mayor innovación de la ley en comento se refiere a que reconoce el valor de la tierra como hábitat cultural, y no como una nueva mercancía.

  5. 29 CFR 1910.253 - Oxygen-fuel gas welding and cutting.

    Science.gov (United States)

    2010-07-01

    ... accordance with the regulations of the U.S. Department of Transportation, 49 CFR parts 171-179. (ii...) of this section: (1) Pipe shall be at least Schedule 40 and fittings shall be at least standard... with the Standard Specification for Seamless Copper Water Tube, ASTM B88-66a, which is incorporated...

  6. 76 FR 253 - Airworthiness Directives; ROLLADEN-SCHNEIDER Flugzeugbau GmbH Model LS6 Gliders

    Science.gov (United States)

    2011-01-04

    ... . SUPPLEMENTARY INFORMATION: Discussion In 1986, we issued AD 86-25-07, Amendment 39-5487 (51 FR 44901, December... ``significant rule'' under DOT Regulatory Policies and Procedures (44 FR 11034, February 26, 1979), (3) Will not.... 39.13 by rescinding AD 86-25-07, Amendment 39- 5487 (51 FR 44901, December 15, 1986): 86-25-07...

  7. "ISTAMBUL KM. 4,253": attraverso il Mediterraneo di Pier Paolo Pasolini

    OpenAIRE

    Annovi, Gian Maria

    2010-01-01

    Pier Paolo Pasolini's work transcends the boundaries of the Italian peninsula. His analysis on Italian folk and subproletariat culture extends as far as considering similar situations in the so-called Third World, which Pasolini identifies with the Mediterranean area. This article provides a detailed mapping of Pasolini's peculiar Mediterranean geography, a mobile, unstable geography, defined in this article through a careful reading of his films, novels, essays, and letters. Beginning with a...

  8. SU-E-J-253: The Radiomics Toolbox in the Computational Environment for Radiological Research (CERR)

    International Nuclear Information System (INIS)

    Purpose: To present an open source and free platform to facilitate radiomics research — The “Radiomics toolbox” in CERR. Method: There is scarcity of open source tools that support end-to-end modeling of image features to predict patient outcomes. The “Radiomics toolbox” strives to fill the need for such a software platform. The platform supports (1) import of various kinds of image modalities like CT, PET, MR, SPECT, US. (2) Contouring tools to delineate structures of interest. (3) Extraction and storage of image based features like 1st order statistics, gray-scale co-occurrence and zonesize matrix based texture features and shape features and (4) Statistical Analysis. Statistical analysis of the extracted features is supported with basic functionality that includes univariate correlations, Kaplan-Meir curves and advanced functionality that includes feature reduction and multivariate modeling. The graphical user interface and the data management are performed with Matlab for the ease of development and readability of code and features for wide audience. Open-source software developed with other programming languages is integrated to enhance various components of this toolbox. For example: Java-based DCM4CHE for import of DICOM, R for statistical analysis. Results: The Radiomics toolbox will be distributed as an open source, GNU copyrighted software. The toolbox was prototyped for modeling Oropharyngeal PET dataset at MSKCC. The analysis will be presented in a separate paper. Conclusion: The Radiomics Toolbox provides an extensible platform for extracting and modeling image features. To emphasize new uses of CERR for radiomics and image-based research, we have changed the name from the “Computational Environment for Radiotherapy Research” to the “Computational Environment for Radiological Research”

  9. 7 CFR 2.53 - Administrator, Food Safety and Inspection Service.

    Science.gov (United States)

    2010-01-01

    ... of Agriculture contained in the Agricultural Marketing Act of 1946, as amended (7 U.S.C. 1621-1627...-601 of Executive Order 12088, 3 CFR, 1978 Comp., p. 243, to enter into an inter-agency agreement with... Act (42 U.S.C. 9604 (a), (b), and (c)(4)), with respect to removal and remedial actions in the...

  10. SU-E-J-253: The Radiomics Toolbox in the Computational Environment for Radiological Research (CERR)

    Energy Technology Data Exchange (ETDEWEB)

    Apte, A; Veeraraghavan, H; Oh, J; Kijewski, P; Deasy, J [Memorial Sloan Kettering Cancer Center, New York, NY (United States)

    2015-06-15

    Purpose: To present an open source and free platform to facilitate radiomics research — The “Radiomics toolbox” in CERR. Method: There is scarcity of open source tools that support end-to-end modeling of image features to predict patient outcomes. The “Radiomics toolbox” strives to fill the need for such a software platform. The platform supports (1) import of various kinds of image modalities like CT, PET, MR, SPECT, US. (2) Contouring tools to delineate structures of interest. (3) Extraction and storage of image based features like 1st order statistics, gray-scale co-occurrence and zonesize matrix based texture features and shape features and (4) Statistical Analysis. Statistical analysis of the extracted features is supported with basic functionality that includes univariate correlations, Kaplan-Meir curves and advanced functionality that includes feature reduction and multivariate modeling. The graphical user interface and the data management are performed with Matlab for the ease of development and readability of code and features for wide audience. Open-source software developed with other programming languages is integrated to enhance various components of this toolbox. For example: Java-based DCM4CHE for import of DICOM, R for statistical analysis. Results: The Radiomics toolbox will be distributed as an open source, GNU copyrighted software. The toolbox was prototyped for modeling Oropharyngeal PET dataset at MSKCC. The analysis will be presented in a separate paper. Conclusion: The Radiomics Toolbox provides an extensible platform for extracting and modeling image features. To emphasize new uses of CERR for radiomics and image-based research, we have changed the name from the “Computational Environment for Radiotherapy Research” to the “Computational Environment for Radiological Research”.

  11. 40 CFR 52.253 - Metal surface coating thinner and reducer.

    Science.gov (United States)

    2010-07-01

    ... described in 40 CFR part 81, dated July 1, 1979, except as follows: (1) In the following portions of the... 40 Protection of Environment 3 2010-07-01 2010-07-01 false Metal surface coating thinner and... coating thinner and reducer. (a) All terms defined in § 52.254 are used herein with the meanings...

  12. Sorveglianza e terapia chirurgica nei tumori cistici del pancreas. Analisi dei risultati su 253 casi.

    OpenAIRE

    Ricci, Claudio

    2013-01-01

    Background: In clinical practice, the number of observed pancreatic cystic lesions is increased in the last years. At the same time, we also had assisted to a better definition of their natural history and to a wide spread of CWRM or EUS as fiable preoperative diagnostic instruments. In fact, even if current guidelines for the management of pancreatic cystic neoplasms are based on the presence of symptoms and radiologic pattern, a certain degree of overlap between different lesions exists, a...

  13. People and things. CERN Courier, Apr 1985, v.25(3)

    International Nuclear Information System (INIS)

    The article reports on achievements of various people, staff changes and position opportunities within the CERN organization and contains news updates on upcoming or past events. To commemorate the 25th anniversary of Austria's joining CERN and the forming of the first high energy physics group in the country, a celebration took place last November in the Auditorium of the old University of Vienna. From 25-28 February next year, another (the fourth) Vienna Wire Chamber Conference will take place. The fifth US Summer School on High Energy Particle Accelerators is to be held at the Stanford Linear Accelerator Center from 15-26 July

  14. 253例青少年腰椎骨密度分析%Analysis of the bone mineral density of the lumbar vertebrae in adolescents:a report of 253 cases

    Institute of Scientific and Technical Information of China (English)

    周莉; 秦建平; 邹丽华; 肖新华

    2014-01-01

    目的:了解青少年骨骼健康状况,探讨腰椎( L2-4)骨密度与性别、血清25-( OH) D3、体重指数、饮食习惯、体育锻炼、性发育早晚的关系。方法双能X线仪测定腰椎( L2-4)骨密度,应用Z值,半自动酶标法测定血清25-( OH) D3,饮食习惯、体育锻炼、性发育早晚均采用调查法,并分组,作方差及组间统计分析。结果 Z值≤-2.0者百分比为6%,男女组BMD及Z值无显著差异(P>0.05),Z值≤-2.0组的25-(OH)D3、体重指数较其他组低(P<0.01),素食厌食组的Z值较其他组低(P<0.01),有效运动量及性发育早晚不同的各组间Z值均有显著差异(P<0.01)。结论双能X线测定腰椎(L2-4)骨密度适合于评估青少年骨骼健康状况,骨密度Z值水平与血清25-( OH) D3、体重指数、饮食习惯、体育锻炼、性发育早晚等有关。%Objective To learn the bone health status in adolescents, and to explore the relationship between the bone mineral density (BMD) of the lumbar vertebrae (L2-4) and gender, serum 25-(OH)D3, body mass index (BMI), diet habit, physical exercise, and sexual developmental.Methods BMD of L2-4 was detected using dual energy X-ray absorptiometry (DEXA), and Z value was obtained.The serum concentration of 25-( OH) D3 was determined using semi-automatic enzyme immunoassay. The data of diet habit, physical exercise, and sexual developmental were acquired using survey method.Then all the subjects were divided into different groups.The difference between groups was statistical analyzed.Results Among all the subjects, 6%had a Z value≤--2.0.No significant difference of BMD and Z value between men and women was observed (P>0.05).The serum 25-(OH)D3 concentration and BMI in the group with Z value≤ -2.0 were lower than those in other groups (P<0.01).The Z value in vegetarian anorexia group was lower than that in other groups ( P<0.01 ) .The Z value in effective exercise amount and different sexual development groups showed significant difference (P<0.01).Conclusion The detection of L2-4 BMD using DEXA is suitable for the evaluation of bone health in adolescents.The Z value of BMD is correlated with the serum 25-( OH) D3 concentration, BMI, diet habit, physical exercise, and sexual development.

  15. SU-E-T-253: Open-Source Automatic Software for Quantifying Biological Assays of Radiation Effects

    International Nuclear Information System (INIS)

    Purpose: Clonogenic cell survival is a common assay for quantifying the effect of drugs and radiation. Manual counting of surviving colonies can take 30–90seconds per plate, a major limitation for large studies. Currently available automatic counting tools are not easily modified for radiation oncology research. Our goal is to provide an open-source toolkit for precise, accurate and fast analysis of biological assays in radiation oncology. Methods: As an example analysis, we used HeLa cells incubated with gadolinium nanoparticles prior to irradiation. After treatment, the cells are grown for 14days to allow for colony formation. To analyze the colony growth, we capture images of each dish for archiving and automatic computer-based analysis. A FujifilmX20 camera is placed at the top of a box setup, 20cm above the sample, which is backlit by a LED lamp placed at the bottom of the box. We use a Gaussian filter (width=1.3mm) and color threshold (19–255). The minimum size for a colony to be counted is 1mm. For this example, 20 dishes with a large range of colonies were analyzed. Each dish was counted 3 times manually by 3 different users and then compared to our counter. Results: Automatic counting of cell colonies takes an average of 7seconds, enabling the analysis process to be accelerated 4–12 times. The average precision of the automatic counter was 1.7%. The Student t-test demonstrated the non-significant differences between the two counting methods (p=0.64). The ICC demonstrated the reliability of each method with ICC>0.999 (automatic) and ICC=0.95 (manual). Conclusion: We developed an open-source automatic toolkit for the analysis of biological assays in radiation oncology and demonstrated the accuracy, precision and effort savings for clonogenic cell survival quantification. This toolkit is currently being used in two laboratories for routine experimental analysis and will be made freely available on our departmental website

  16. 30 CFR 253.24 - When I submit audited annual financial statements to verify my net worth, what standards must...

    Science.gov (United States)

    2010-07-01

    ... (GAAS) of the United States, or other international auditing standards that MMS determines to be equivalent. (c) The financial information you submit must be expressed in U.S. dollars. If this information... statements to verify my net worth, what standards must they meet? (a) Your audited annual...

  17. The TREK2 Channel Is Involved in the Proliferation of 253J Cell, a Human Bladder Carcinoma Cell

    OpenAIRE

    Park, Kyung-Sun; Han, Min Ho; Jang, Hee Kyung; Kim, Kyung-A; Cha, Eun-Jong; Kim, Wun-Jae; Choi, Yung Hyun; Kim, Yangmi

    2013-01-01

    Bladder cancer is the seventh most common cancer in men that smoke, and the incidence of disease increases with age. The mechanism of occurrence has not yet been established. Potassium channels have been linked with cell proliferation. Some two-pore domain K+ channels (K2P), such as TASK3 and TREK1, have recently been shown to be overexpressed in cancer cells. Here we focused on the relationship between cell growth and the mechanosensitive K2P channel, TREK2, in the human bladder cancer cell ...

  18. The importance of education in the promotion of organ donation - doi: 10.5020/18061230.2012.p253

    OpenAIRE

    Taise Ribeiro Morais; Maricelma Ribeiro Morais

    2012-01-01

    Transplantation and human organ donation are controversial issues that have generated much interest and discussion. The lack of clarification and the sensationalist news about organ trafficking contribute to raise questions and render the myths and prejudices permanent.The donation of organs and tissues is seen by society in general, as an act of solidarity and love from the family. However, it requires decision-making at a time of extreme pain and distress, caused by the impact of breaking ...

  19. The importance of education in the promotion of organ donation - doi: 10.5020/18061230.2012.p253

    Directory of Open Access Journals (Sweden)

    Taise Ribeiro Morais

    2012-11-01

    Full Text Available Transplantation and human organ donation are controversial issues that have generated much interest and discussion. The lack of clarification and the sensationalist news about organ trafficking contribute to raise questions and render the myths and prejudices permanent.The donation of organs and tissues is seen by society in general, as an act of solidarity and love from the family. However, it requires decision-making at a time of extreme pain and distress, caused by the impact of breaking news of death, the feeling of loss and the unexpected interruption of a life course(1.As the criteria of death are modified, the concept of brain death arises, along with the possibility of using donor organs and tissues. When there is not a good understanding of the organ donation process, the relatives of potential donors feel apprehensive, doubtful and undecided at the time of occurrence, because it is a subject about which there hasn’t been much clarification(1.Brazil has the largest public transplants program in the world, since the government finances 92% of procedures done in the country. However, when we consider the rate of post mortem transplant into the population, Brazil’s results are little expressive(2.Family refusal is a major obstacle to the realization of transplants, and is also identified as major cause for the shortage of organs and tissues for transplantation. Families who understand well the diagnosis of brain death are more favorable to organ donation, compared to families who believe that death only occurs after the heart stops. Therefore, the poor level of information, either by the quality of information concerning brain death, either by not having exceeded the barrier of stigmatized fear of organ trading, propagated by the media, drastically reduces the number of patients who are benefited from receiving an organ(3.Although all people are responsible for disseminating information, we must also educate health professionals, since they interfere directly in the likely donor’s family decision. Perhaps, they lack the study of Thanatology. These professionals deal directly with death but do not investigate death, mourning. The family situation at the time of mourning, hardened by the difficult decision of donating the organs of their beloved one, should form a strong synergistic relationship, as it comes into question the shock of death and the decision to save other people’s lives. It has also been disclosed that religion is considered one of the reasons to refuse the donation of organs and tissues for transplantation. It is, thus, necessary to give greater attention to people’s religious beliefs and values by the time of the loss of their relatives. The literature is rich in references demonstrating that the mass media, despite their high national and global spreading power, are not best suited to provide sufficient explanation on such contentious issues as it is, among others, the organ donation. Instead, the means, the symbology and the repertoire often used by mass media cause more confusion than clarification(4.A study in Spain found that a lot of information spread in the media could be an alternative to the clarification of doubts, however, it sometimes reproduce misinformation, superficial and prejudice-based ideas, being unable to modify negative behavior related to organ donation.A research conducted with people attending health centers in Spain showed that only 7% of the respondents received information about transplantation from primary care professionals. Although the negative information has been quite absorbed, the study indicates that, even in small proportion, the positive information has generated a new way of interpreting organ donation(6We here emphasize the importance of discussing the issue “organ donation” with friends and family, because people, being well educated, are capable of promoting discussions, which that can be understood as promotion of donation.The profile of the opponent to organ donation is: man or woman over the age of 45 years, with low schooling, who does not know the concept of brain death and has a partner also against organ donation, is not conducive to blood donation and fears the manipulation of the body after death. The main reasons for not accepting the donation is the lack of knowledge of how to become a donor and the fear of misdiagnosis of death(7.Facing this reality, health professionals should act as educators, to modify public opinion regarding the misconceptions. However, unfavorable beliefs can be modified only if educators are well prepared for that, so that the population is prompted to participate in debates on organ transplants and legislation.Modifying the existing reality means developing programs planned and evaluated in an ongoing educational process, supported by theoretical background and scientifically recognized models, for all segments of the community, along with incorporating the knowledge of thanatology in the formation of health professionals, with better appreciation of religious principles, to avoid making an aggressive approach to the families of potential donors. The preparation of families should be taken into consideration, to prevent the false idea that death is being expected in order to save others’ lives, because every family wants their patient to have the opportunity to live. Therefore, the government is to be exhorted to realize that the lack of support to the practice of organ donation is a real problem, and to include educational activities regarding transplants in priority governmental programs and in public policies of health care.Since organ donation in Brazil depends exclusively on the family permission, campaigns that seek to increase the understanding of the concept of brain death among the population, and, most of all, to encourage people to express their desire to be a donor and to discuss their decision with family are important strategies to tackle this problem.With a performance based on ethics and responsibility, the relationships and public policies contribute to the interests of society and organizations being achieved and established through dialogue. On the issue of transplantation, this contribution stands out because, through information and the establishment of relations with the public segments, the activity aims to reduce the suffering of many people awaiting in queues, as well as to alleviate the suffering of donor’s relatives and friends.It is also extremely valuable to include contents related to the theme of transplants / organ donation in undergraduate courses in the health area, so that professionals can act accordingly to the needs of their clientele, safely and efficiently, improving quality of life population.

  20. Freeze drying method for preparing radiation source material

    International Nuclear Information System (INIS)

    Fabrication of a neutron source is specifically claimed. A palladium/californium solution is freeze dried to form a powder which, through conventional powder metallurgy, is shaped into a source containing the californium evenly distributed through a palladium metal matrix. (E.C.B.)

  1. Review of RBE and OER values for Cf-neutrons

    International Nuclear Information System (INIS)

    Californium-252, an isotope emitting neutrons, gamma photons and alpha particles, is being investigated for its practical use in intracavitary and interstitial brachytherapy. A review of published RBE and OER values for californium neutrons as a function of dose rate for a variety of biological endpoints is given. (Auth.)

  2. Interstitial deletion of 6q25.2–q25.3: a novel microdeletion syndrome associated with microcephaly, developmental delay, dysmorphic features and hearing loss

    OpenAIRE

    Nagamani, Sandesh Chakravarthy Sreenath; Erez, Ayelet; Eng, Christine; Ou, Zhishuo; Chinault, Craig; Workman, Laura; Coldwell, James; Stankiewicz, Pawel; Patel, Ankita; Lupski, James R; Cheung, Sau Wai

    2008-01-01

    Interstitial deletions of 6q are rare. We report a detailed clinical and molecular characterization of four patients with interstitial deletion involving 6q25. All of our patients presented with microcephaly, developmental delay, dysmorphic features and hearing loss, whereas two of them had agenesis of the corpus callosum. We determined the size, extent and genomic content of the deletions using high-density array-comparative genomic hybridization (a-CGH), and found that a common segment span...

  3. Perspectives on design creativity and innovation research - Advocating for a systemic view of innovation in company ecosystems (Chapter 2.5.3)

    OpenAIRE

    Yannou, Bernard

    2013-01-01

    The aim of this extended editorial is to offer a perspective on design creativity and innovation research on the occasion of launching the International Journal of Design Creativity and Innovation. Thirty six members of the editorial board present their expectations, views, or opinions on the topics of the journal. All of these articles are presented in Section 2. In Section 3, summaries of the 36 articles are consolidated. This editorial also analyzes keywords from each of the articles, and ...

  4. 47 CFR 25.253 - Special requirements for ancillary terrestrial components operating in the 1626.5-1660.5 MHz/1525...

    Science.gov (United States)

    2010-10-01

    ... commercial mobile radio service (CMRS) base stations that make use of Global Positioning System (GPS) time... intermodulation product of these base stations falls on an L-band MSS band coordinated for use by another...

  5. EXECUTIVE LEADERSHIP AND DEVELOPMENT (IN INDUSTRIAL PSYCHOLOGY BY B. VONHALLER GILMER AND OTHERS. NEW YORK, MCGRAW-HILL, 1966/ 228-253).

    Science.gov (United States)

    HILTON, THOMAS L.

    THIS CHAPTER FROM A LARGER WORK ON INDUSTRIAL PSYCHOLOGY DISCUSSES LEADERSHIP STEREOTYPES AND CONCEPTIONS, EMPIRICAL EVIDENCE OF ACTUAL LEADERSHIP FUNCTIONS, THE SELECTION OF POTENTIAL EXECUTIVES, AND METHODS OF EXECUTIVE DEVELOPMENT. THE MAJOR PROBLEM OF LEADERSHIP IS TO CREATE SITUATIONS IN WHICH FOLLOWERS WILLINGLY ACCEPT THE LEADER AS THEIR…

  6. Konference o srovnávacím výzkumu bydlení, Delft, Nizozemsko, 24.3. – 25.3. 2010

    Czech Academy of Sciences Publication Activity Database

    Sládek, Jan

    2010-01-01

    Roč. 8, č. 5 (2010), s. 9. ISSN 1214-1720 R&D Projects: GA ČR GA403/09/1915 Institutional research plan: CEZ:AV0Z70280505 Keywords : methodology * city * theory Subject RIV: AO - Sociology, Demography http://www.socioweb.cz/upl/editorial/download/179_soc.web._05-2010%20final!.pdf

  7. SU-E-J-253: Evaluation of 4DCT Images with Correlation of RPM Signals to Tumor Motion for Respiratory-Gated Radiotherapy

    International Nuclear Information System (INIS)

    Purpose: The amplitudes of lung tumor target motion and RPM signals are different from each other. Also, RPM system does not have in-depth RPM signal analysis tool. We have developed an algorithm that analyzes RPM signals for its stability as well as correlativity to the tumor motion. Methods: We used a Philips Big Bore CT scanner with a Varian Real-Time Position Management™ (RPM) system attached. 4DCT images were reviewed and tumor motion amplitudes of full breathing in superior-inferior, anterior-posterior, and left-right directions were measured. RPM signals were analyzed with the algorithm developed with Matlab. Average signal period, amplitude and statistical stability of the full breathing pattern as well as the pattern around full expiration were calculated. RPM signal amplitudes were normalized to measured tumor motion amplitudes so that selected gating phases (30%–70% or 40%–60%) allow tumor motion under 5.0mm. Results: Twelve patient cases were analyzed in this study with GTV sizes ranged from 1.0cm to 3.0cm diameter. The periods and amplitudes of RPM signal ranged from 3.1seconds to 6.5seconds and from 0.2cm to 1.7cm, respectively. RPM signals were most stable at full expiration. The standard deviation of the RPM signal peaks at full expiration was <0.11cm, and that of gated amplitudes was <0.25cm. Tumor motion amplitudes were primary in superior-inferior direction and minor (<=0.2cm) in other directions on all analyzed cases, ranged from 0.2cm to 2.5cm. The amplitudes increases with the tumor located toward the diaphragm. The gated phases were selected so that the average gated tumor motion amplitude as well as that plus deviation became under 0.5cm in superior-inferior direction. Conclusion: We were able to determine the respiratory-gated phases in RPM signals employing measured tumor motion amplitudes as well as developed RPM signal analyzer through correlation process. The RPM signal amplitudes do not represent tumor motion because of its location

  8. Concomitant NSAID use during antipsychotic treatment and risk of 2-year relapse - a population-based study of 16,253 incident patients with schizophrenia

    DEFF Research Database (Denmark)

    Köhler, Karl Ole; Petersen, Liselotte; Benros, Michael Eriksen; Mors, Ole; Gasse, Christiane

    OBJECTIVE: Clinical trials have indicated antipsychotic effects of non-steroidal anti-inflammatory drugs (NSAIDs) among incident patients with schizophrenia. We aimed to study, in a population-based setting, whether concomitant use of NSAIDs or paracetamol, changed 2-year relapse risk for...... schizophrenia. METHODS: We identified all incident patients with schizophrenia in Denmark diagnosed 1996-2012 initiating antipsychotic treatment within the year after diagnosis. We calculated concomitant treatment intervals for antipsychotic and NSAID or paracetamol use. Hazard rate ratios (HRR) were estimated...... using Cox regression adjusted for important covariates. MAIN OUTCOME MEASURES: 2-year relapse, i.e. (re)-hospitalizations with schizophrenia. RESULTS: Among 16,235 incident patients with schizophrenia using antipsychotics, 1480 (9.1%) used NSAIDs and 767 (4.7%) paracetamol. Concomitant use of NSAIDs was...

  9. A new shipping container for an intense neutron emitter

    International Nuclear Information System (INIS)

    Californium-252 is an intense neutron emitter (2.34 x 1012 n/s·g) used in medicine, research, and industry. The western world's sole source of this rare radioisotope is the Californium Facility at Oak Ridge National Laboratory's Radiochemical Engineering Development Center (REDC). A project has been initiated at the REDC to design a new Type B Californium Shipping Container. This effort is essential for future transportation of californium to meet the needs of users all over the world. The shipping container must meet all requirements for transport by motor freight, air, vessel, and rail, both domestic and foreign. There are unique problems in the design, fabrication, and licensing of a new Type B shipping container that will accommodate up to 60 milligrams of californium-252. One of the first challenges in the design phase of the project is the selection of a material to shield the high neutron flux. The more stringent safety precautions of today's world impel us to consider more exotic materials for such a purpose. The candidate materials must be examined not just for their neutron shielding properties, but also in conjunction with other properties such as thermal and structural requirements to withstand the hypothetical accident conditions. The design and building of such a container is a formidable task requiring much planning. The licensing process, with the complex, interactive federal codes, is a special challenge and may be the biggest on the project in terms of time and money

  10. Application of Cf for the quantitative measurement of nuclear reactor fuel materials

    International Nuclear Information System (INIS)

    Sensitive and rapid measurements of the quantity and geometric distribution of nuclear reactor fuel materials can be made using neutrons from californium. The neutron-induced fission rate in these materials may be measured by detection of either prompt radiations from fission or delayed radiations from radioactive fission products. A number of californium-based instruments are presently in use by the nuclear industry for purposes of process control, quality control, nuclear materials safeguards, and environmentl assessment. An Automated Fuel Rod Scanner (AFRS) is used for high-speed measurement of the uniformity of loading and total fissile content of reactor fuel rods. The fuel rods are moved first through an irradiator containing about 1 mg of californium, and subsequently through high-efficiency detectors for the measurement of fission-product gamma-rays. Multiple detectors on each of two irradiation channels are used to reduce the californium source strength requirement. The fuel loading of each 15-mm-long pellet is tested to +-10% on 100% of the plant throughput. By summing the response over length, the total fissile material content of the fuel rod is measured to better than 0.5%. An on-line computer for data processing allows the instrument to measure about 150 rods per hour with a single operator. The same activation concept is used with a 25-μg californium source in a Small Sample Assay System (SSAS) which measures the fissile content of fuel pellet sized samples with a precision of 0.5%

  11. Report on the behalf of the Parliamentary Office for the Assessment of Scientific and Technological Choices on hydrogen: a vector for energy transition? - National Assembly Nr 1672, Senate Nr 253

    International Nuclear Information System (INIS)

    In its first part, this report describes the role and use hydrogen may have as a possible sustainable energy vector: description of its remarkable properties, description of various production modalities and processes, issues related to storage, transport and distribution. The second part proposes an overview of applications: fuel cells, hydrogen in transports, power-to-gas, co-generation, energy autonomy, mobile devices. The third part describes and discusses the role hydrogen may have in energy transition, notably for the integration of renewable energies, and in the substitution to fossil energies. The last chapter discusses the governance for a hydrogen energy sector in France: a sector with a high potential, a needed intervention by the State, the unavoidable role of territories, the issue of regulation. A description of the situation in foreign countries is provided in appendix

  12. "Requestioning" AIDS: An Ethical Reflection From 1993 to Today. Reflections on Claude Vandevyer's "Homosexuals and AIDS: A New Approach to the Illness" from Journal of Homosexuality 25(3).

    Science.gov (United States)

    Lau, Travis

    2016-01-01

    This article serves as one of the supplementary pieces of this special issue on "Mapping Queer Bioethics," in which we take a solipsistic turn to "map" the Journal of Homosexuality itself. Here, the author examines the first feature-length article to address the relationship between HIV status and homosexuality. Lingering on both the temporal gap between the dawn of AIDS in American discourse and its inclusion in this journal, the author asks us to consider (in hindsight) such a delay bearing in mind queer theoretical projects of the present such as gay shame, stigma, and queer biopolitics. PMID:26642922

  13. Ethyl 2-{5-[(3-oxo-3,4-dihydro-2H-1,4-benzothiazin-4-ylmethyl]-1H-1,2,3-triazol-1-yl}acetate

    Directory of Open Access Journals (Sweden)

    Nada Kheira Sebbar

    2014-02-01

    Full Text Available In the title compound, C15H16N4O3S, the six-membered heterocycle of the benzothiazine fragment exhibits a screw boat conformation. The dihedral angle between the planes through the triazole ring and the benzene ring fused to the 1,4-thiazine ring is 62.98 (11°. The mean plane formed by the atoms belonging to the acetate group is nearly perpendicular to the triazole ring [dihedral angle = 74.65 (12°]. In the crystal, molecules are linked by pairs of C—H...O interactions, forming dimeric aggregates.

  14. A Response to Ages Past. Commentary on Harris, R. M., Michell, B.G. & Cooley. C. (1985) The Gender Gap in Library Education. (Journal of Education for Library and Information Science, 25(3), 167-176)

    Science.gov (United States)

    Wellstead, Peta

    2015-01-01

    Much has changed in the information environment since the years of Harris' review. It is important to mention the significance of the impact of technology that has rendered the work of librarians and information workers almost unknowable to those teaching in the period 1965-1983. As a result of these reviews and technological changes, many…

  15. Molecular cytogenetic analyses of HIG, a novel human cell line carrying t(1;3)(p36.3;q25.3) established from a patient with chronic myelogenous leukemia in blastic crisis.

    Science.gov (United States)

    Hosoya, Noriko; Ogawa, Seishi; Motokura, Tohru; Hangaishi, Akira; Wang, Lili; Qiao, Ying; Nannya, Yasuhito; Kogi, Mieko; Hirai, Hisamaru

    2003-12-01

    Chromosomal abnormalities involving 1p36, 3q21, and/or 3q26 have been reported in a subset of myeloid neoplasms having characteristic dysmegakaryopoiesis, and the overexpression of EVI1 on 3q26 or of MEL1 on 1p36 has been implicated in their pathogenesis. We describe molecular cytogenetic analyses of a novel human cell line, HIG, established from a unique case in which a novel translocation t(1;3)(p36;q26) appeared as the sole additional chromosomal abnormality at the time of blastic transformation of chronic myelogenous leukemia. The patient displayed clinical features resembling those of the 3q21q26 syndrome. The HIG cell line retained der(1)t(1;3)(p36;q26) but lost t(9;22)(q34;q11). To identify the relevant gene that would be deregulated by this translocation, we molecularly cloned the translocation's breakpoints. They were distant from the breakpoint cluster regions of the 3q21q26 syndrome or t(1;3)(p36;q21), and neither the EVI1 nor the MEL1 transcript was detected in the HIG cell line. None of the genes located within 150 kilobase pairs of the breakpoints were aberrantly expressed, suggesting that in this case other gene(s) more distant from the breakpoints are deregulated by possible remote effects. Further analyses of the deregulated genes in the HIG cell line should provide important insight into the mechanisms involved in these types of leukemias. PMID:14704036

  16. Evaluations of the 253U/238U Isotope Ratio through Thick-Walled Containers using the 185.7 keV and 1001.0 keV Gamma Rays

    Energy Technology Data Exchange (ETDEWEB)

    Lanier, R G; Hayden, C F; Clark, D; Parker, W E

    2001-04-13

    The non-destructive determination of isotope ratios (NDA) present in plutonium- and uranium-bearing materials is best accomplished with a MultiGroup Analysis methodology on spectral data obtained with high-resolution germanium detector systems. This methodology is currently employed in codes such as MGA, MGAU or U235. The MGA code, for example, works well on Pu samples and employs a number of isolated spectral lines in the analysis. The algorithm uses Gaussian and Lorentzian peak shapes that are empirically modified to account for various physical and instrumental effects. Additional effects due to external absorbers, sample self-attenuation and detector relative efficiency are also included. Uranium samples are analyzed with MGAU and U235 using a simpler but similar algorithm in the narrow energy range between 85- and 100-keV. Although the details can be complex, the problem described above is ultimately reduced to evaluating a simple ratio. Applied to uranium, for example, one evaluates where the subscripts A and B refer to quantities associated with {sup 235}U and {sup 238}U, respectively. Specifically, N{sub 235U}/N{sub 238U} is the isotope ratio {sup 235}U/{sup 238}U, I is the measured gamma-ray peak intensity, and E is the counting efficiency, BR is the appropriate branching ratio, t is the appropriate half-life, {alpha}{sup Ab} is an external absorber correction (such as cadmium, iron, etc.) and {beta}{sup U} is a correction for sample self absorption. Indications of other isotopes can, of course, be determined from different ratios evaluated with data from other characteristic gamma rays that may be present in the spectrum.

  17. Osteoclasts from patients with autosomal dominant osteopetrosis type I caused by a T253I mutation in low-density lipoprotein receptor-related protein 5 are normal in vitro, but have decreased resorption capacity in vivo

    DEFF Research Database (Denmark)

    Henriksen, Kim; Gram, Jeppe; Høegh-Andersen, Pernille; Jemtland, Rune; Ueland, Thor; Dziegiel, Morten Hanefeld; Schaller, Sophie; Bollerslev, Jens; Karsdal, Morten A

    2005-01-01

    found attenuated resorptive response to T3 stimulation, despite a normal bone formation response, in alignment with the reduced number of osteoclasts in vivo. These data demonstrate that ADOI osteoclasts are normal with respect to all aspects investigated in vitro. We speculate that the mutations...

  18. Discovery of a Perseus-like cloud in the early Universe: HI-to-H2 transition, carbon monoxide and small dust grains at zabs=2.53 towards the quasar J0000+0048

    CERN Document Server

    Noterdaeme, P; Balashev, S; Ge, J; Gupta, N; Krühler, T; Ledoux, C; Murphy, M T; Pâris, I; Petitjean, P; Rahmani, H; Srianand, R; Ubachs, W

    2016-01-01

    We present the discovery of a molecular cloud at zabs=2.5255 along the line of sight to the quasar J0000+0048. We perform a detailed analysis of the absorption lines from ionic, neutral atomic and molecular species in different excitation levels, as well as the broad-band dust extinction. We find that the absorber classifies as a Damped Lyman-alpha system (DLA) with logN(HI)(cm^-2)=20.8+/-0.1. The DLA has super-Solar metallicity with a depletion pattern typical of cold gas and an overall molecular fraction ~50%. This is the highest f-value observed to date in a high-z intervening system. Most of the molecular hydrogen arises from a clearly identified narrow (b~0.7 km/s), cold component in which CO molecules are also found, with logN(CO)~15. We study the chemical and physical conditions in the cold gas. We find that the line of sight probes the gas deep after the HI-to-H2 transition in a ~4-5 pc-size cloud with volumic density nH~80 cm^-3 and temperature of only 50 K. Our model suggests that the presence of sm...

  19. Fauna parasitária de peixes oriundos de “pesque-pague” do município de Guariba, São Paulo, Brasil - DOI: 10.4025/actascibiolsci.v28i3.253 Parasitic fauna of cultivated fishes in fee fishing farm of Guariba, São Paulo State, Brazil - DOI: 10.4025/actascibiolsci.v28i3.253

    Directory of Open Access Journals (Sweden)

    Julieta Rodini Engracia de Moraes

    2007-11-01

    Full Text Available Este trabalho descreve a ocorrência e a sazonalidade de parasitos em peixes de “pesque-pague” do município de Guariba, Estado de São Paulo, Brasil (21º15`22``S, 48º18`58``W e 595 m de altitude, durante o período de agosto de 2001 a julho de 2002. A presença de parasitos foi pesquisada em pacu Piaractus mesopotamicus (Characidae, carpa comum Cyprinus carpio (Cyprinidae, tilápia-do-Nilo Oreochromis niloticus (Cichlidae, híbrido tambacu (macho de P. mesopotamicus x fêmea de tambaqui-Colossoma macropomum e piraputanga Brycon hillari (Characidae. Os resultados demonstram que dos 100 peixes examinados, 15% estavam parasitados por pelo menos um dos seguintes parasitos: Trichodina sp.; helmintos monogenóides; copepoditos de Lernaea cyprinacea; L. cyprinacea adulta ou Dolops carvalhoi. Por ordem decrescente, o grau de suscetibilidade dos hospedeiros foi C. carpio, P. mesopotamicus, B. hillari, híbrido tambacu e O. niloticus. Por ordem decrescente, os parasitos encontrados foram helmintos monogenóides, Dolops carvalhoi, Trichodina sp., Lernaea cyprinacea adultas e suas formas jovens.This study describes the occurrence and the seasonality of parasites of cultivated fish from a fee fishing farm located in Guariba, São Paulo State, Brazil (21º15`22`` S, 48º18`58`` W and 595 m of altitude, from August, 2001 to July, 2002. The presence of parasites was researched in pacu Piaractus mesopotamicus (Characidae, common carp Cyprinus carpio (Cyprinidae, nile-tilapia Oreochromis niloticus (Cichlidae, tambacu hybrid (male of P. mesopotamicus x female of tambaqui-Colossoma macropomum and piraputanga Brycon hillari (Characidae. Results demonstrate that out of 100 fish examined, 15% were sponged for at least one of the following parasites: Trichodina sp.; monogenean helminths; copepodits of Lernaea cyprinacea; adults of L. cyprinacea; or Dolops carvalhoi. In decreasing order, the susceptibility degree of the hosts was C. carpio, P. mesopotamicus, B. hillari, tambacu hybrid and O. niloticus. In decreasing order the reported parasites were monogenean helminths, Dolops carvalhoi, Trichodina sp., adults of Lernaea cyprinacea and their young shapes.

  20. Application of PGNAA to preincineration assay of combustible waste for chlorine

    Energy Technology Data Exchange (ETDEWEB)

    Gehrke, R.J.; Pawelko, R.J.; Greenwood, R.C. [Idaho National Engineering Lab., Idaho Falls, ID (United States)

    1995-12-31

    A prompt gamma neutron activation analysis method is being developed for on-stream pre-incineration assay of low level radioactive combustible waste for it`s chlorine content. The assay system consists of three californium 252 sources and a germanium or scintillation gamma-ray spectrometer.

  1. Magnetic measurements of the transuranium elements. Progress report, January 1, 1984-December 31, 1984

    International Nuclear Information System (INIS)

    Measurements of the magnetic properties of dhcp californium-249 metal indicated the presence of three regions of differing magnetic character. Additional measurements are also reported. Magnetic moments and valence states of terbium in TbF3, BaTbO3, and TbO18 are discussed. Progress on high-field operation of the micro-magnetic susceptometer is reported

  2. Source storage and transfer cask: Users Guide

    International Nuclear Information System (INIS)

    The storage and shield cask for the dual californium source is designed to shield and transport up to 3.7 mg (2 Ci) of 252Cf. the cask meets Department of Transportation (DOT) license requirements for Type A materials (DOT-7A). The cask is designed to transfer sources to and from the Flourinel and Fuel Storage (FAST) facility delayed-neutron interrogator. Californium sources placed in the cask must be encapsulated in the SR-CF-100 package and attached to Teleflex cables. The cask contains two source locations. Each location contains a gear box that allows a Teleflex cable to be remotely moved by a hand crank into and out of the cask. This transfer procedure permits sources to be easily removed and inserted into the delayed-neutron interrogator and reduces personnel radiation exposure during transfer. The radiation dose rate with the maximum allowable quantity of californium (3.7 mg) in the cask is 30 mR/h at the surface and less than 2 mR/h 1 m from the cask surface. This manual contains information about the cask, californium sources, describes the method to ship the cask, and how to insert and remove sources from the cask. 28 figs

  3. Discovery of Isotopes of the Transuranium Elements with 93 <= Z <= 98

    OpenAIRE

    Fry, C; Thoennessen, M

    2012-01-01

    One hundred and five isotopes of the transuranium elements neptunium, plutonium, americium, curium, berkelium and californium have so far been observed; the discovery of these isotopes is discussed. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  4. Oxidation of microquantities of transplutonium elements to tetravalent state in mineral acid solutions and their stability

    International Nuclear Information System (INIS)

    Kinetics of americium(3) microquantity oxidation and stability of forming americium(4), as well as possibility of curium and californium oxidation to tetravalent state in solutions of sulfuric and nitric acids depending on the concentration of mineral acid, potassium tungstophosphate and ammonium persulfate are studied by the extraction method. It is shown that curium(3) and californium(3) in solutions of 0.05-2.5 mol/l H2SO4 and HNO3 containing 10-3 mol/l potassium tungstophosphate is not practically oxidized by the mixture of silver nitrate and ammonium persulfate. Americium(3) is oxidized to the utmost to Am(4) for 2-3 min at room temperature, but stability of Am(4) depends on the concentration of sulfuric acid and potassium tungstophosphate

  5. Characterization of berkelium(III) dipicolinate and borate compounds in solution and the solid state.

    Science.gov (United States)

    Silver, Mark A; Cary, Samantha K; Johnson, Jason A; Baumbach, Ryan E; Arico, Alexandra A; Luckey, Morgan; Urban, Matthew; Wang, Jamie C; Polinski, Matthew J; Chemey, Alexander; Liu, Guokui; Chen, Kuan-Wen; Van Cleve, Shelley M; Marsh, Matthew L; Eaton, Teresa M; van de Burgt, Lambertus J; Gray, Ashley L; Hobart, David E; Hanson, Kenneth; Maron, Laurent; Gendron, Frédéric; Autschbach, Jochen; Speldrich, Manfred; Kögerler, Paul; Yang, Ping; Braley, Jenifer; Albrecht-Schmitt, Thomas E

    2016-08-26

    Berkelium is positioned at a crucial location in the actinide series between the inherently stable half-filled 5f(7) configuration of curium and the abrupt transition in chemical behavior created by the onset of a metastable divalent state that starts at californium. However, the mere 320-day half-life of berkelium's only available isotope, (249)Bk, has hindered in-depth studies of the element's coordination chemistry. Herein, we report the synthesis and detailed solid-state and solution-phase characterization of a berkelium coordination complex, Bk(III)tris(dipicolinate), as well as a chemically distinct Bk(III) borate material for comparison. We demonstrate that berkelium's complexation is analogous to that of californium. However, from a range of spectroscopic techniques and quantum mechanical calculations, it is clear that spin-orbit coupling contributes significantly to berkelium's multiconfigurational ground state. PMID:27563098

  6. Neutron activation determination of gold in technogenic raw materials with different mineral composition

    OpenAIRE

    Yudakov Aleksandr A.; Ivannikov Sergey I.; Zheleznov Veniamin V.; Taskin Andrei V.; Tsybulskaya Oksana N.

    2015-01-01

    The methods used to determine the gold content in the technogenic objects of gold mining were analyzed regarding their non-homogeneity and complexity of chemical and mineral compositions. A possible application of the neutron activation analysis with the use of the californium source of neutrons for determining the content of fine-grained and extra-fine-grained gold in the technogenic objects, including the bottom-ash waste of energy providers, is considere...

  7. Jak bylo objeveno spontánní štěpení

    Czech Academy of Sciences Publication Activity Database

    Vobecký, Miloslav

    Praha: Spektroskopická společnost J.M. Marci, 2010 - (Vobecký, M.), s. 5-10 ISBN 978-80-904539-0-6. [Seminář Radioanalytické metody IAA 10. Praha (CZ), 30.06.2010-01.07.2010] Institutional research plan: CEZ:AV0Z40310501 Keywords : spontaneous fission * fission -track dating method * californium 252 neutron source Subject RIV: CB - Analytical Chemistry, Separation

  8. Study of heavy particle decay from superheavy elements by SK model

    International Nuclear Information System (INIS)

    Heavy nuclei usually decay by alpha decay or spontaneous fission. These two decay modes are generally the most probable competing processes. Another less probable decay process is cluster radioactivity in which nuclei from carbon to silicon are emitted from Radium to Californium leading to the most stable daughter nucleus, lead. This work reports such a study using the cubic plus Yukawa plus exponential model of Shanmugam and Kamalaharan (SK)

  9. Measurement of the energy spectra of fission fragments using nuclear track detectors and digital image processing

    International Nuclear Information System (INIS)

    Energy spectra of fission fragments were determined using a Nuclear Track Methodology (NTM) supported by digital image analysis and numerical data processing using a standard personal computer. The analysis of a californium (252Cf) spectrum with this approach shows improvement compared with the values reported previously using the standard procedure, in terms of resolution and accuracy. This new method adds full automation to the technical advantages and cost effectiveness of an NTM.

  10. Heavy ion tests on programmable VLSI

    International Nuclear Information System (INIS)

    The radiation from space environment induces operation damages in onboard computers systems. The definition of a strategy, for the Very Large Scale Integrated Circuitry (VLSI) qualification and choice, is needed. The 'upset' phenomena is known to be the most critical integrated circuit radiation effect. The strategies for testing integrated circuits are reviewed. A method and a test device were developed and applied to space applications candidate circuits. Cyclotron, synchrotron and Californium source experiments were carried out

  11. Properties of neutron sources

    International Nuclear Information System (INIS)

    The Conference presentations were divided into sessions devoted to the following topics: white neutron sources, primarily pulsed (6 papers); fast neutron fields (5 papers); Californium-252 prompt fission neutron spectra (14 papers); monoenergetic sources and filtered beams (11 papers); 14 MeV neutron sources (10 papers); selected special application (one paper); and a general interest session (4 papers). Individual abstracts were prepared separately for the papers

  12. Neutron multiplicities for the transplutonium nuclides

    International Nuclear Information System (INIS)

    This paper continues, with respect to the transplutonium nuclides, earlier efforts to collate and evaluate data from the scientific literature on the prompt neutron multiplicity distribution from fission and its first moment = ΣnuPnu. The isotopes considered here for which P/sub nu/ and or data (or both) were found in the literature are of americium (Am), curium (Cm), berkelium (Bk), californium (Cf), einsteinium (Es), fermium (Fm), and nobelium (No)

  13. Decision of the Constitutional Review Division of the National Court of The Republic of Estonia : 30 September 1994 : review of the constitutionality of § 25(3) of the Property Law Enforcement Act to the extent that it sought to repeal § 30(2) of t

    Index Scriptorium Estoniae

    1995-01-01

    Riigikohtu lahendi III-4/A-5/94 (Asjaõigusseaduse rakendamise seaduse § 25 lg. 3 Põhiseadusele vastavuse läbivaatamine Eesti NSV taluseaduse § 30 lg. 2 kehtetuks tunnistamise osas) tekst inglise keeles

  14. Comment on Spracklandus Hoser, 2009 (Reptilia, Serpentes, ELAPIDAE): request for confirmation of availability of the generic name and for the nomenclatural validation of the journal in which it was published (Case 3601; BZN 70:234–237; 71:30–38; 133-135,181-182 ,252-253)

    Science.gov (United States)

    Rhodin, Anders G.J.; Kaiser, Hinrich; van Dijk, Peter Paul; Wüster, Wolfgang; O’Shea, Mark; Archer, Michael; Auliya, Mark; Boitani, Luigi; Bour, Roger; Clausnitzer, Viola; Contreras-MacBeath, Topiltzin; Crother, Brian I.; Daza, Juan M.; Driscoll, Carlos A.; Flores-Villela, Oscar; Frazier, Jack; Fritz, Uwe; Gardner, Alfred L.; Gascon, Claude; Georges, Arthur; Glaw, Frank; Grazziotin, Felipe G.; Groves, Colin P.; Haszprunar, Gerhard; Havaš, Peter; Hero, Jean-Marc; Hoffmann, Michael; Hoogmoed, Marinus S.; Horne, Brian D.; Iverson, John B.; Jäch, Manfred; Jenkins, Christopher L.; Jenkins, Richard K.B.; Kiester, A. Ross; Keogh, J. Scott; Lacher, Thomas E., Jr.; Lovich, Jeffrey E.; Luiselli, Luca; Mahler, D. Luke; Mallon, David P.; Mast, Roderic; McDiarmid, Roy W.; Measey, John; Mittermeier, Russell A.; Molur, Sanjay; Mosbrugger, Volker; Murphy, Robert W.; Naish, Darren; Niekisch, Manfred; Ota, Hidetoshi; Parham, James F.; Parr, Michael J.; Pilcher, Nicolas J.; Pine, Ronald H.; Rylands, Anthony B.; Sanderson, James G.; Savage, Jay M.; Schleip, Wulf; Scrocchi, Gustavo J.; Shaffer, H. Bradley; Smith, Eric N.; Sprackland, Robert; Stuart, Simon N.; Vetter, Holger; Vitt, Laurie J.; Waller, Tomás; Webb, Grahame; Wilson, Edward O.; Zaher, Hussam; Thomson, Scott

    2015-01-01

    In Case 3601 Raymond Hoser has asked the Commission to validate for the purposes of nomenclature the name Spracklandus Hoser, 2009, and ‘the journal in which it was published,’ issue 7 of the Australasian Journal of Herpetology (AJH). We note that the entire run of AJH has been written, edited, and published solely by Hoser. Although his requests to the Commission were presented as narrow and, in his words, ‘routine matters,’ we are convinced that they represent an important tipping-point with broad implications of major concern for zoological taxonomy and nomenclature as a whole and, by extension, the greater scientific community. Since Hoser’s actions and works have failed to follow scientific best practices (e.g. Turtle Taxonomy Working Group, 2007, 2014; Kaiser et al., 2013; Kaiser, 2014) and both the Commission’s general Recommendations and Code of Ethics in Appendix A, the global herpetological community has widely rejected his taxonomic decisions and resultant nomenclature. This has unfortunately caused a confusing dual nomenclature to develop in the herpetological community, with most boycotting or ignoring Hoser’s 700+ new names coined in the AJH, while he and a few personal followers actively promote their usage. We believe that suppression of the name Spracklandus, and all issues of AJH, is the only effective way to bring this contentious and confusing issue to resolution. The plenary power available under Article 81.1 of the Code exist specifically to allow the Commission to make rulings in individual cases that disturb stability and cause confusion, whether the works are Code-compliant or not. We maintain that it is in the interest of nomenclatural stability, not only for herpetology, but for all of zoological taxonomy, that the plenary power be invoked to declare the works in AJH unavailable, regardless of any narrow interpretation of their technical Code-compliance. We present our arguments for rejection of the validity of AJH in the following commentary. In view of the wide-reaching implications of this case for all of zoology, and reflecting the deep and broad-based community concern over these issues, our contributing authors include 70 global scientific leaders and accomplished amateurs from a wide variety of zoological disciplines.

  15. Choosing the Right Book: Factors that Affect Children’s Reading. A Review of: Maynard, S., Mackay, S., & Smyth, F. (2008. A survey of young people’s reading in England: Borrowing and choosing books. Journal of Librarianship and Information Science, 40(4, 239-253.

    Directory of Open Access Journals (Sweden)

    Gayle Bogel

    2011-03-01

    Full Text Available Objective – To analyze factors affecting book choice: reading recommendations, reasons for choosing series books, book reviews, and school libraries.Design – This secondary analysis of data is based on a selection of findings from a larger 2005 survey that monitored trends in youth reading habits. The large scale 2005 study was designed as a follow up to a 1996 survey. The 2005 survey used online questionnaires and formal statistical analysis to compare gender and age groups. The data on factors affecting book choice were derived from the original questions, responses, and analyses.Setting – Questionnaires were administered in22 primary and 24 secondary schools in the UK with access to computers and internet.Subjects – Almost 4,200 students from 4 to 16 years of age.Methods – Study authors invited approximately 150 schools to participate in the survey. Forty-six schools (31% responded. A total of 22 primary and 24 secondary schools participated in the original study between April and June 2005.This study used comparative analysis to examine factors affecting book choice between gender and age groups. Statistical significance was defined as one percent. Other demographic information was collected, such as ethnicity, language spoken at home, and religion, but was deemed insufficient for any meaningful analysis.There were 4,182 responses to the survey, separated into three age groups: ages 4 to 7 (KS1, ages 7 to 11 (KS2, and ages 11 to 16 (KS3&4.Students were asked to describe themselves as readers by responding to multiple choice questions, and then to provide specific information on the places or people most frequently used as book borrowing sources. Participants were considered “enthusiastic” readers if they “read a lot with pleasure” and “average” readers if they “read an ordinary amount”. Participants responded to additional multiple choice questions on specific factors related to borrowing books and book choices, the process of choosing series, fiction, and nonfiction books.Main Results – Readers: The number of children who described themselves as “enthusiastic” readers decreased with age, and approximately half of the children between 7 and 16 years of age described themselves as “average” readers, average rating increasing slightly through this age group. Investigators found a marked difference in gender within the 4 to 7 year olds: 49.7% percent of girls in this age group considered themselves “enthusiastic,” compared to 37.3% of boys. Only 18.5% of girls considered themselves “reluctant” readers, compared to 28.1% of boys.The longitudinal comparison to the earlier 1996 study found that although the percentage of boys from ages 7 to 16 who described themselves as reluctant readers stayed about the same, the percentage of girls who described themselves as reluctant increased. There was also a dramatic drop in the number of girls who described themselves as enthusiastic; from 51% in 1996 to 17% in 2005.Borrowing Books: Libraries of all types (school, classroom and public were the prime sources for borrowing books. Girls borrowed more books from schools than boys, and girls also borrowed more books from non-library sources (family members and friends than boys. Both boys and girls increasingly reported borrowing more books from friends than from libraries as they grew older.Over half of each age group rated the school library or classroom book corner as having “enough” books. The perception of “too many books” decreased with age. The perception of quality of the classroom or school library also decreased with age. The number of students in the younger age groups who rated the quality of books in the classroom or school library as “very good” was significantly higher than students in the older age groups. The number of student who rated the quality as “okay” doubled from the lower to the higher age group.Choosing Books: Children were asked six questions related to whether the physical book itself provided motivation to read, and six questions related to other factors for book recommendation. Younger readers were more likely to choose a book for its visual appeal, although this factor (interesting cover or illustrations inside was more consistent for boys of all age groups than girls. The author’s name and book blurb were stronger factors for girls in the 7 to 16 age group than for boys.The study authors sought to explore the idea of “shared reading” and asked children in the 7 to 11 and 11 to 16 age groups how often they chose a book based on a recommendation from a friend or family member, a public or school librarian, or other adults. Friends were the strongest recommendation source (43.2% for 7 to 11 year olds and 38.4% for 11to 16 year olds. Recommendations from school or public librarians rated only three to six percent for both age groups.All age groups were asked about choosing series books, and the questions were simplified for the younger age group. All students reported that appealing factors were the consistency of characters, familiar storylines, and familiar writing styles. Some students also noted that the availability of series books positively affected their choices.Print or online book reviews were used “hardly ever or never” by over 40% of the 7 to16 year old age groups, while television or magazine reviews or recommendations were highly rated by over 50% of respondents in the same age groups. Participants chose informational or non-fiction books because of personal interests, hobbies, or recommendations from friends, while they selected fiction or poetry for the blurb, title, or appearance and design of the cover. Celebrity recommendations and books about celebrities were popular reasons for choosing books.When asked who helped them choose books, 53.2% in the 7 to11 age group and 66.1% in the 11to 16 age group stated that no one ever helps them. Of the students who had help choosing books, “family members” was the most common response. Local librarians were not used as a source for recommendations.

  16. Questions Remain about Whether EBM Competencies Learned in Medical School are Retained in Residency. A review of: Dorsch, Josephine L., Meenakshy K. Aiyer, Krishna Gumidyala and Lynne E. Myer. “Retention of EBM Competencies.” Medical Reference Services Quarterly 25.3 (Fall 2006): 45‐57.

    OpenAIRE

    Suzanne Lewis

    2007-01-01

    Objective – To assess medical graduates’ use of evidence based medicine (EBM) in residency, self‐perception of EBM skills, attitudes toward EBM, and the impact of a formal EBM curriculum in their third undergraduate year.Design – A longitudinal follow‐up study by self‐administered questionnaire.Setting – Internal medicine residency programs in US hospitals.Subjects – A convenience sample of 2001 and 2002 graduates of the University of Illinois College of Medicine at Peoria (UICOM‐P) (n=78), a...

  17. Questions Remain about Whether EBM Competencies Learned in Medical School are Retained in Residency. A review of: Dorsch, Josephine L., Meenakshy K. Aiyer, Krishna Gumidyala and Lynne E. Myer. “Retention of EBM Competencies.” Medical Reference Services Quarterly 25.3 (Fall 2006: 45‐57.

    Directory of Open Access Journals (Sweden)

    Suzanne Lewis

    2007-09-01

    Full Text Available Objective – To assess medical graduates’ use of evidence based medicine (EBM in residency, self‐perception of EBM skills, attitudes toward EBM, and the impact of a formal EBM curriculum in their third undergraduate year.Design – A longitudinal follow‐up study by self‐administered questionnaire.Setting – Internal medicine residency programs in US hospitals.Subjects – A convenience sample of 2001 and 2002 graduates of the University of Illinois College of Medicine at Peoria (UICOM‐P (n=78, and their respective residency program directors (n=72.Methods – A student graduate questionnaire (SGQ was sent to all members of UICOM‐P’s 2001 and 2002 graduating classes who had completed the EBM course during their M‐3 Internal Medicine clerkship. A program director questionnaire (PDQ, similar to the SGQ, was sent to the graduates’ residency program directors. The research instrument was tested with a pilot group prior to use, but not validated. The questionnaires consisted of 4 main sections. The first section examined formal and informal EBM programs in the graduates’ residency curriculum. The second section consisted of a self‐assessment of EBM skills by the residents and an assessment of those skills by their program directors. The third section asked graduates to compare their EBM skills to those of their fellow residents who had not been students at UICOM‐P. Similarly, in the third section of the PDQ, program directors were asked to compare the EBM skills of UICOM‐P graduates and non‐UICOM‐P graduates participating in the residency program. The last section concerned professional and demographic characteristics. Copies of the surveys were mailed out to non‐responders after 6 weeks. Results were collated but statistical analysis was not applied.Main results – The response rate was 32% for residents and 35% for program directors. The number of incomplete surveys was not reported. Forty‐four percent of all respondents reported having a formal EBM curriculum for residents, and 76% reported an informal curriculum. For both formal and informal programs, the most commonteaching formats were journal clubs, followed by lectures, teaching rounds, morning reports, bedside consultations, ambulatory clinics and seminars. In section two of the questionnaires, both residentsand program directors rated the residents’ EBM skills similarly. However, the residents rated their skills in searching the literatureand application of findings to clinical practice higher than the program directors. Program directors also rated the residents’ skills in understanding statistics and tests higher than the residents themselves. Twenty‐four percent of both residents and program directors rated the UICOM‐P graduates as “very competent” or“extremely competent” in EBM skills (50. Only 35% of program directors and 27% of residents rated the UICOM‐P graduates’ EBM skills as “usually better” or “always better” than their peers who were not UICOM‐P graduates (50.Conclusion ‐ The authors of this study conclude that, for UICOM‐P graduates, “it might be implied from these results that the EBM skills gained during medical school were retained through their medical school graduation and into their residency training” (51. However, this study has methodological weaknesses which make itdifficult to draw any definite conclusions from the results.

  18. Choosing the Right Book: Factors that Affect Children’s Reading. A Review of: Maynard, S., Mackay, S., & Smyth, F. (2008). A survey of young people’s reading in England: Borrowing and choosing books. Journal of Librarianship and Information Science, 40(4), 239-253.

    OpenAIRE

    Gayle Bogel

    2011-01-01

    Objective – To analyze factors affecting book choice: reading recommendations, reasons for choosing series books, book reviews, and school libraries.Design – This secondary analysis of data is based on a selection of findings from a larger 2005 survey that monitored trends in youth reading habits. The large scale 2005 study was designed as a follow up to a 1996 survey. The 2005 survey used online questionnaires and formal statistical analysis to compare gender and age groups. The data on fact...

  19. Dependence of metal partition coefficients in D2EHPA capacity on extraction from acid solutions

    International Nuclear Information System (INIS)

    In devising solvent-extraction schemes for extracting the transplutonium elements (TPE), one usually employs the partition coefficients K/sub p/ for trace amounts; when the results are transferred to weighable amounts of the elements, there are difficulties because one lacks capacity characteristics for the extractants under the conditions used. They have determined the capacity of D2EHPA over a wide range in acidity (0.001-2 mole/liter) in relation to dysprosium (the analog of californium) in the system formed by D2EHPA with nitric acid by saturating a set volume of the extractant with dysprosium in nitric acid containing the necessary amount of free acid

  20. TOWARD AN IMPROVED UNDERSTANDING OF STRUCTURE AND MAGNETISM IN NEPTUNIUM AND PLUTONIUM PHOSPHONATES AND SULFONATES

    Energy Technology Data Exchange (ETDEWEB)

    Albrecht-Schmitt, Thomas

    2012-03-01

    This grant supported the exploratory synthesis of new actinide materials with all of the actinides from thorium to californium with the exceptions of protactinium and berkelium. We developed detailed structure-property relationships that allowed for the identification of novel materials with selective ion-exchange, selective oxidation, and long-range magnetic ordering. We found novel bonding motifs and identified periodic trends across the actinide series. We identified structural building units that would lead to desired structural features and novel topologies. We also characterized many different spectroscopic trends across the actinide series. The grant support the preparation of approximately 1200 new compounds all of which were structurally characterized.

  1. NONDESTRUCTIVE IDENTIFICATION OF CHEMICAL WARFARE AGENTS AND EXPLOSIVES BY NEUTRON GENERATOR-DRIVEN PGNAA

    International Nuclear Information System (INIS)

    Prompt gamma-ray neutron activation analysis (PGNAA) is now a proven method for the identification of chemical warfare agents and explosives in military projectiles and storage containers. Idaho National Laboratory is developing a next-generation PGNAA instrument based on the new Ortec Detective mechanically-cooled HPGe detector and a neutron generator. In this paper we review PGNAA analysis of suspect chemical warfare munitions, and we discuss the advantages and disadvantages of replacing the californium-252 radioisotopic neutron source with a compact accelerator neutron generator

  2. NONDESTRUCTIVE IDENTIFICATION OF CHEMICAL WARFARE AGENTS AND EXPLOSIVES BY NEUTRON GENERATOR-DRIVEN PGNAA

    Energy Technology Data Exchange (ETDEWEB)

    T. R. Twomey; A. J. Caffrey; D. L. Chichester

    2007-02-01

    Prompt gamma-ray neutron activation analysis (PGNAA) is now a proven method for the identification of chemical warfare agents and explosives in military projectiles and storage containers. Idaho National Laboratory is developing a next-generation PGNAA instrument based on the new Ortec Detective mechanically-cooled HPGe detector and a neutron generator. In this paper we review PGNAA analysis of suspect chemical warfare munitions, and we discuss the advantages and disadvantages of replacing the californium-252 radioisotopic neutron source with a compact accelerator neutron generator.

  3. Composition containing transuranic elements for use in the homeopathic treatment of aids

    International Nuclear Information System (INIS)

    A homeopathic remedy consisting of a composition containing one or more transuranic elements, particularly plutonium, for preventing and treating acquired immunodeficiency syndrome (AIDS) in humans, as well as seropositivity for human immunodeficiency virus (HIV). Said composition is characterized in that it uses any chemical or isotopic form of one or more transuranic elements (neptunium, plutonium, americium, curium, berkelium, californium or einsteinium), particularly plutonium, said form being diluted and dynamized according to conventional homeopathic methods, particularly the so-called Hahnemann and Korsakov methods, and provided preferably but not exclusively in the form of lactose and/or saccharose globules or granules impregnated with the active principle of said composition. (author)

  4. Neutron nondestructive essay of the plutonium metal parts

    International Nuclear Information System (INIS)

    Based on the principle of neutron multiplicity and data unfolding mathematics, this paper developed the software which can execute the neutron multiplicity analysis, neutron attenuation analysis, parameter calibration, Pu mass solution with the neutron pulse sequence acquisition method. The measurement system consisted of detector,nuclear electronic apparatus, pulsed sequence acquisition and analysis software was tested and calibrated by californium source. Three mental plutonium components with different mass were used for experimental assay and validation, which showed that the assay bias was within 15% against the nominal value of the samples. (authors)

  5. Physical-chemical studies of transuranium elements. Progress report, April 1, 1982-March 31, 1983

    International Nuclear Information System (INIS)

    Progress is reported on the following topics: electrochemical and spectroscopic studies of less-stable higher oxidation states of transuranium elements in complexing aqueous media; spectroscopic and electrochemical studies of selected lanthanides and actinides in molten dimethyl sulfone; spectroelectronchemical studies of the Ce(IV)/Ce(III) couple in aqueous carbonate solutions; characterization of actinide orthophosphates by Raman and absorption spectrophotometries and by x-ray diffraction; relativistic multiple scattering calculations on transuranium element compounds; Raman spectroscopic studies of natural minerals containing the uranyl ion; and solution calorimetry of californium metal

  6. Transuranium element production. II. Chemical processing of targets

    International Nuclear Information System (INIS)

    The chemical processing described concerns small experimental targets irradiated in OSIRIS or EL-III and industrial targets irradiated in the CELESTIN reactors. In view of the difficulties encountered when processing highly irradiated targets (760MWd.kg-1) by liquid-liquid extraction (interface sludges leading to stable emulsion) the new processes developed are based on inverse phase chromatography. This technique applied to targets of americium 241, plutonium 239 and a plutonium mixture rich in isotope 242 has given tens of milligrams of curium 242, grams of americium 243 and curium 244 and micrograms of californium 252

  7. Detection of rare earth elements in Powder River Basin sub-bituminous coal ash using laser-induced breakdown spectroscopy (LIBS)

    Energy Technology Data Exchange (ETDEWEB)

    Tran, Phuoc [National Energy Technology Lab. (NETL), Pittsburgh, PA, (United State; Mcintyre, Dustin [National Energy Technology Lab. (NETL), Pittsburgh, PA, (United State

    2015-10-01

    We reported our preliminary results on the use of laser-induced breakdown spectroscopy to analyze the rare earth elements contained in ash samples from Powder River Basin sub-bituminous coal (PRB-coal). We have identified many elements in the lanthanide series (cerium, europium, holmium, lanthanum, lutetium, praseodymium, promethium, samarium, terbium, ytterbium) and some elements in the actinide series (actinium, thorium, uranium, plutonium, berkelium, californium) in the ash samples. In addition, various metals were also seen to present in the ash samples

  8. Radiation protection data sheet. Radiation protection data sheets for the use of radionuclides in unsealed sources

    International Nuclear Information System (INIS)

    These radiation protection data sheet are devoted to responsible persons and employees of various laboratories or medical, pharmaceutical, university and industrial departments where radionuclides are handled as well as all the persons who attend to satisfy in this field. They contain the essential radiation protection data for the use of unsealed sources: physical characteristics, risk assessment, administrative procedures, recommendations, regulations and bibliography. This new series includes the following radionuclides: californium 252, curium 244, gallium 67, indium 113m, plutonium 238, plutonium 239, polonium 210, potassium 42, radium 226, thorium 232, uranium 238 and zinc 65. (O.M.)

  9. Study by thermochromatography of fluorides of transuranium elements

    International Nuclear Information System (INIS)

    Thermochromatography was made suitable for fluoride study. So, an investigation of actinide tetrafluorides was accomplished from uranium to californium. Pentavalent and hexavalent fluorospecies of uranium, neptunium, plutonium and ruthenium were studied. Some new compounds have been identified in gaseous phase, whose: PuF5, PuOF3 and PaOF3. Furthermore, some presomptions as for the existence in gaseous phase of EsF4 and of an heptavalent fluorospecies of plutonium have been established. An important analogy between plutonium and ruthenium behaviour with fluorine have been shown, these results could explain the difficulties encountered in the fluoride-volatility processes

  10. PROCEEDINGS OF THE SYMPOSIUM COMMEMORATING THE 25th ANNIVERSARY OF ELEMENTS 97 and 98 HELD ON JAN. 20, 1975

    Energy Technology Data Exchange (ETDEWEB)

    Seaborg, Glenn T.; Street Jr., Kenneth; Thompson, Stanley G.; Ghiorso, Albert

    1976-07-01

    This volume includes the talks given on January 20, 1975, at a symposium in Berkeley on the occasion of the celebration of the 25th anniversary of the discovery of berkelium and californium. Talks were given at this symposium by the four people involved in the discovery of these elements and by a number of people who have made significant contributions in the intervening years to the investigation of their nuclear and chemical properties. The papers are being published here, without editing, in the form in which they were submitted by the authors in the months following the anniversary symposium, and they reflect rather faithfully the remarks made on that occasion.

  11. Method for measuring multiple scattering corrections between liquid scintillators

    Science.gov (United States)

    Verbeke, J. M.; Glenn, A. M.; Keefer, G. J.; Wurtz, R. E.

    2016-07-01

    A time-of-flight method is proposed to experimentally quantify the fractions of neutrons scattering between scintillators. An array of scintillators is characterized in terms of crosstalk with this method by measuring a californium source, for different neutron energy thresholds. The spectral information recorded by the scintillators can be used to estimate the fractions of neutrons multiple scattering. With the help of a correction to Feynman's point model theory to account for multiple scattering, these fractions can in turn improve the mass reconstruction of fissile materials under investigation.

  12. Surface fission tracks in diamond

    International Nuclear Information System (INIS)

    Scanning Probe Microscope (SPM) images reveal important fingerprint features of latent tracks induced in diamond by fission fragments from a californium source. Collimated fission fragments with a binary distribution of the predominant energies of 79.4 and 103.8 MeV, are assumed. Cavities, reticular formations around these cavities, and black spots of graphite were found. A brief discussion on the possible track formation mechanism is given on the basis of the explosion spike theory; an attempt to determine latent track core and halo parameters is included

  13. Use of trioctylphosphine oxide for transplutonium element extraction and purification

    International Nuclear Information System (INIS)

    Investigated was extraction of tri-valent curium, berkelium, californium, einsteinium as well as cerium and europium with trioctylphosphin oxide from lactic acid solutions, containing DTPA and aluminium nitrate depending on the aluminium nitrate and TOPO concentrations and nitric acid solutions of variable concentration as well. Under optimum conditions of extraction chromatography of berkelium studied was the distribution of cobalt, nickel, chromium, iron, aluminium, titanium, zirconium and niobium ions, and the coefficients of berkelium purification from cations investigated were determined. The effect of weight quantities of cation impurities on extraction chromatographic yield of berkelium has been investigated. Examples of practice application of the extraction chromatography with the use of TOPO are given

  14. Dicty_cDB: Contig-U09091-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 53 Score = 180 bits (91), Expect = 1e-45 Identities = 253/253 (100%) Strand = Plus / Plus Query: 234 tcccnat...ntanactaccnctggncaaantaaaactggtttngcnccnantgcaancggnt 293 |||||||||||||||||||||||...||||||||||||||||||||||||||||||||||||| Sbjct: 234 tcccnatntanactaccnctggncaaantaaaactggtttngcnccnantgcaancggn...acncgncnttggangnattgga 413 Query: 414 aancngnccttttaggggcnggnttancnggntttgcccnaaa...nttanttggnaannattggacncgncnttgg 152 Query: 404 angnattggaaancngnccttttaggggcnggnttancnggntttgcccna

  15. 78 FR 55728 - Society of Clinical Research Associates-Food and Drug Administration: Food and Drug...

    Science.gov (United States)

    2013-09-11

    ... HUMAN SERVICES Food and Drug Administration Society of Clinical Research Associates-Food and Drug... ``Educational Conference Co-Sponsored With the Society of Clinical Research Associates (SoCRA).'' The public... Administration, 60 Eighth Street NE., Atlanta, GA 30309, voicemail: 404-253-1272, FAX: 404-253-1202, or...

  16. Drug: D05623 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D05623 Drug Prolintane hydrochloride (USAN) C15H23N. HCl 253.1597 253.8108 D05623.gif Antidepres ... OANALEPTICS N06B PSYCHOSTIMULANTS, AGENTS USED FOR ADHD ... AND NOOTROPICS N06BX Other psychostimulants and no ...

  17. Numbers of the Week

    Institute of Scientific and Technical Information of China (English)

    2011-01-01

    25.3 % China’s industrial enterprises with annual sales revenue of more than 20 million yuan ($3.2 million) saw their profits increase 25.3 percent year on year in the first 10 months of 2011, said the National Bureau of Statistics.

  18. Inflation expectations in the Czech interbank market

    Czech Academy of Sciences Publication Activity Database

    Fukač, Martin

    -, č. 253 (2005), s. 1-30. ISSN 1211-3298 Institutional research plan: CEZ:AV0Z70850503 Keywords : inflation expectations * nominal interest rate * Fisher rule Subject RIV: AH - Economics http://www.cerge-ei.cz/pdf/wp/Wp253.pdf

  19. Thin-sheet flow between coalescing bubbles

    OpenAIRE

    Munro, James?P.; Anthony, Christopher?R.; Basaran, Osman A.; Lister, John R.

    2015-01-01

    This is the accepted manuscript of a paper published in the Journal of Fluid Mechanics (Munro JP, Anthony CR, Basaran OA, Lister JR, Journal of Fluid Mechanics, 2015, 773, doi:10.1017/jfm.2015.253). The final version is available at http://dx.doi.org/10.1017/jfm.2015.253

  20. 4-Chloro-N-(3,4,5-trimethoxybenzylidene)aniline

    Czech Academy of Sciences Publication Activity Database

    Khalaji, A.D.; Asghari, J.; Fejfarová, Karla; Dušek, Michal

    2009-01-01

    Roč. 65, - (2009), o253-o253. ISSN 1600-5368 R&D Projects: GA ČR GC202/07/J008 Institutional research plan: CEZ:AV0Z10100521 Keywords : X-ray diffraction * Jana 2006 Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.411, year: 2009

  1. Drug: D07196 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D07196 Drug Tolpropamine (INN) C18H23N 253.1831 253.3819 D07196.gif ATC code: D04AA12 Anatomical ... ANTIPRURITICS, INCL. ANTIHISTAMINES, ANESTHETICS, ETC . D04A ANTIPRURITICS, INCL. ANTIHISTAMINES, ANESTHE ... TICS, ETC . D04AA Antihistamines for topical use D04AA12 Tolp ...

  2. O sistemah stihhoslozhenija (preimushtshestvenno na materjale estonskogo i russkogo stihha") / Mihhail Lotman

    Index Scriptorium Estoniae

    Lotman, Mihhail, 1952-

    1998-01-01

    Bibl. lk. 250-253. Kokkuvõte inglise k. "On systems of versification (mostly in russian and Estonian poetry), lk. 253-254. Kokkuvõte eesti k. "Värsisüsteemidest (peamiselt eesti ja värsi näitel). Eesti k. ilmunud: Akadeemia, 1998, nr. 9 ja 10

  3. Body dimensions and coloration of the winter pelage of a Moravian population of sika deer, Cervus nippon

    Czech Academy of Sciences Publication Activity Database

    Heroldová, Marta; Zejda, J.

    2002-01-01

    Roč. 51, č. 3 (2002), s. 253-256. ISSN 0139-7893 R&D Projects: GA AV ČR IBS6093003 Institutional research plan: CEZ:AV0Z6093917 Keywords : sika deer * body dimensions * coloration Subject RIV: EG - Zoology Impact factor: 0.234, year: 2002 http://www.ivb.cz/folia/51/3/253-256.pdf

  4. Different Markers of Central Obesity as Predictors of Insulin Resistance and Inflammatory Status in Middle-Aged Wome

    Czech Academy of Sciences Publication Activity Database

    Žecová, S.; Lejsková, M.; Valenta, Zdeněk; Stávek, P.; Poledne, R.; Piťha, J.

    Elsevier. Roč. 9, č. 1 (2008), s. 253-253. ISSN 1567-5688. [Congress of the European Atherosclerosis Society /77./. 26.04.2008-29.04.2008, Istanbul] R&D Projects: GA MŠk(CZ) 1M0510 Institutional research plan: CEZ:AV0Z10300504 Keywords : reproduction status * smoking * carotid intima-media thickness * preclinical atherosclerosis

  5. 75 FR 43115 - National Oil and Hazardous Substances Pollution Contingency Plan; National Priorities List...

    Science.gov (United States)

    2010-07-23

    ... AGENCY 40 CFR Part 300 National Oil and Hazardous Substances Pollution Contingency Plan; National..., and Liability Act (CERCLA) of 1980, as amended, is an appendix of the National Oil and Hazardous... partial deletion pertains to the soil and groundwater of parcels 24, 27, 28, 2-53, 2-53L, 2-54, 2-54L,...

  6. Seasonality of the links between weather and cardiovascular mortality and morbidity

    Czech Academy of Sciences Publication Activity Database

    Davídkovová, Hana; Kyselý, Jan

    Vídeň: European Geosciences Union, 2015. EGU2015-253. ISSN 1607-7962. [EGU General Assembly 2015. 12.04.2015-17.04.2015, Vídeň] Institutional support: RVO:68378289 Subject RIV: DG - Athmosphere Sciences, Meteorology http://meetingorganizer.copernicus.org/EGU2015/EGU2015-253.pdf

  7. Monte Carlo aided enhanced design of an neutron scatterometer

    International Nuclear Information System (INIS)

    This paper will present a particular example for the use of the Monte Carlo Method to enhance the performance of a neutron scatterometer, currently employed to detect the void fraction in fast-transient high-pressure water-vapour flow in a rod-bundle channel. The scatterometer relies on measuring the slowing-down of californium-252 neutrons by the hydrogen in the water to determine the liquid, hence vapour (void) content. However, californium-252 is a relatively fast-decaying source and alternative isotopic sources are typically too energetic to provide sufficient moderation given the small amount of liquid in the channel. Monte Carlo simulation were utilized to examine various design enhancement possibilities, including: filtering out unthermalized fast neutrons, amplifying by a fissionable material the amount of detected thermal neutrons, adding a dissolvable contrast material to the liquid phase, or relying on the scattering of fast neutrons by oxygen in water. In addition, methods to determine the distribution of the pattern of liquid-vapour phase in the channel are devised

  8. Structures of BmrR-Drug Complexes Reveal a Rigid Multidrug Binding Pocket And Transcription Activation Through Tyrosine Expulsion

    Energy Technology Data Exchange (ETDEWEB)

    Newberry, K.J.; Huffman, J.L.; Miller, M.C.; Vazquez-Laslop, N.; Neyfakh, A.A.; Brennan, R.G.

    2009-05-22

    BmrR is a member of the MerR family and a multidrug binding transcription factor that up-regulates the expression of the bmr multidrug efflux transporter gene in response to myriad lipophilic cationic compounds. The structural mechanism by which BmrR binds these chemically and structurally different drugs and subsequently activates transcription is poorly understood. Here, we describe the crystal structures of BmrR bound to rhodamine 6G (R6G) or berberine (Ber) and cognate DNA. These structures reveal each drug stacks against multiple aromatic residues with their positive charges most proximal to the carboxylate group of Glu-253 and that, unlike other multidrug binding pockets, that of BmrR is rigid. Substitution of Glu-253 with either alanine (E253A) or glutamine (E253Q) results in unpredictable binding affinities for R6G, Ber, and tetraphenylphosphonium. Moreover, these drug binding studies reveal that the negative charge of Glu-253 is not important for high affinity binding to Ber and tetraphenylphosphonium but plays a more significant, but unpredictable, role in R6G binding. In vitro transcription data show that E253A and E253Q are constitutively active, and structures of the drug-free E253A-DNA and E253Q-DNA complexes support a transcription activation mechanism requiring the expulsion of Tyr-152 from the multidrug binding pocket. In sum, these data delineate the mechanism by which BmrR binds lipophilic, monovalent cationic compounds and suggest the importance of the redundant negative electrostatic nature of this rigid drug binding pocket that can be used to discriminate against molecules that are not substrates of the Bmr multidrug efflux pump.

  9. Determination of Auxin Transport Parameters on the Cellular Level

    Czech Academy of Sciences Publication Activity Database

    Petrášek, Jan; Laňková, Martina; Zažímalová, Eva

    Totowa: Humana Press, 2014 - (Hicks, G.; Robert, S.), s. 241-253. (Methods in Molecular Biology). ISBN 978-1-62703-591-0 Institutional support: RVO:61389030 Keywords : Auxin transport assay * Plant cell cultures * Auxin influx Subject RIV: ED - Physiology

  10. Anthropological perspectives on democratic citizenship education and globalization

    Czech Academy of Sciences Publication Activity Database

    Červinková, Hana

    2013-01-01

    Roč. 2013, č. 27 (2013), s. 253-262. ISSN 1233-6688 Institutional support: RVO:68378076 Keywords : citizenship education * anthropology of education * action research * youth * participation * globalization Subject RIV: AC - Archeology, Anthropology, Ethnology

  11. Violence and Secularization

    Czech Academy of Sciences Publication Activity Database

    Matuštík, Martin Beck

    Bloomington: Indiana University Press, 2005 - (Schrift, A.), s. 39-50 ISBN 0-253-34550-2 Institutional research plan: CEZ:AV0Z90090514 Keywords : modernity * secularization Subject RIV: AA - Philosophy ; Religion

  12. The Czech transition: the importance of microeconomic fundamentals

    Czech Academy of Sciences Publication Activity Database

    Švejnar, Jan; Uvalic, M.

    Oxford: Oxford University Press, 2013 - (Fosu, A.), s. 231-253 ISBN 978-0-19-966070-4 Institutional support: RVO:67985998 Keywords : economic transition * Czech Republic * economic development Subject RIV: AH - Economic s

  13. The Czech transition: the importance of microeconomic fundamentals

    Czech Academy of Sciences Publication Activity Database

    Švejnar, Jan; Uvalic, M.

    Oxford: Oxford University Press, 2013 - (Fosu, A.), s. 231-253 ISBN 978-0-19-966070-4 Institutional support: PRVOUK-P23 Keywords : economic transition * Czech Republic * economic development Subject RIV: AH - Economic s

  14. Dicty_cDB: Contig-U10492-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available d = Plus / Plus Query: 14 aaaacncttggtttnaacatgcttcaaangccnttcatcatttatccnttcannnnnnna 7...gccnttcatcatttatccnttcattttntta 73 Query: 74 cgtcaattaagnggnganacaaatntactcgttgangntggngccctttggnttaana...at 133 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 74 cgtcaattaagnggnganacaaatntactcgttgan...ggccgatccntattatattttaccnttagnatnttcaattttccaanatggn 193 Query: 194 tccgttngtttntcaangnctgatganactagnccaatgatgaaaacna...gnctgatganactagnccaatgatgaaaacnattangncttcn 253 Query: 254 ttttgntttttacccttagnttttac

  15. TAA1-Mediated Auxin Biosynthesis Is Essential for Hormone Crosstalk and Plant Development

    Czech Academy of Sciences Publication Activity Database

    Stepanova, A.N.; Robertson-Hoyt, J.; Yun, J.; Benavente, L.M.; Xie, D.Y.; Doležal, Karel; Schlereth, A.; Jürgens, G.; Alonso, J.M.

    2008-01-01

    Roč. 133, č. 1 (2008), s. 177-191. ISSN 0092-8674 Institutional research plan: CEZ:AV0Z50380511 Keywords : CELLBIO * SIGNALING * DEVBIO Subject RIV: CE - Biochemistry Impact factor: 31.253, year: 2008

  16. Evoluční teorie poznání a transcendentální argumenty

    Czech Academy of Sciences Publication Activity Database

    Nosek, Jiří

    Praha: Filosofia, 2011, s. 209-253. ISBN 978-80-7007-358-2 Institutional research plan: CEZ:AV0Z90090514 Keywords : evolution * knowledge * transcendental deduction * explanation * signification Subject RIV: AA - Philosophy ; Religion

  17. Ecotoxicity and genotoxicity assessment of cytotoxic antineoplastic drugs and their metabolites

    Czech Academy of Sciences Publication Activity Database

    Zounková, R.; Kovalová, L.; Bláha, Luděk; Dott, W.

    2010-01-01

    Roč. 81, č. 2 (2010), s. 253-260. ISSN 0045-6535 Institutional research plan: CEZ:AV0Z60050516 Keywords : cytotoxic drugs * ecotoxicity * metabolite Subject RIV: EF - Botanics Impact factor: 3.155, year: 2010

  18. QTL Information Table: 620 [Q-TARO

    Lifescience Database Archive (English)

    Full Text Available qHD6 Physiological trait Flowering Heading date SSR C)Interval RIL Moritawase Koshihikari B RM81 ... sicochemical Properties in Japonica Rice. Breeding Science ... 56, 253-260. ...

  19. QTL Information Table: 621 [Q-TARO

    Lifescience Database Archive (English)

    Full Text Available qPC9 Physiological trait Eating quality Protein content SSR C)Interval RIL Moritawase Koshihikar ... sicochemical Properties in Japonica Rice. Breeding Science ... 56, 253-260. ...

  20. QTL Information Table: 622 [Q-TARO

    Lifescience Database Archive (English)

    Full Text Available qAC9 Physiological trait Eating quality Amylose content SSR C)Interval RIL Moritawase Koshihikar ... sicochemical Properties in Japonica Rice. Breeding Science ... 56, 253-260. ...

  1. Experiment list: SRX337965 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available ODENDROCYTES in the CENTRAL NERVOUS SYSTEM. Malignant peripheral nerve sheath tumors, NEUROFIBROMA, and NEUR...ILEMMOMA are relatively common tumors in this category. 9918784,96.3,19.7,253 GSM

  2. Microcellular open porous monoliths for cell growth by thiol-ene polymerization of low-toxicity monomers in high internal phase emulsions

    Czech Academy of Sciences Publication Activity Database

    Sušec, M.; Liska, R.; Russmüller, G.; Kotek, Jiří; Krajnc, P.

    2015-01-01

    Roč. 15, č. 2 (2015), s. 253-261. ISSN 1616-5187 Institutional support: RVO:61389013 Keywords : divinyl adipate * polyHIPE * porous polymers Subject RIV: CD - Macromolecular Chemistry Impact factor: 3.851, year: 2014

  3. A Character Assassination Attempt: The Case of Václav Havel

    Czech Academy of Sciences Publication Activity Database

    Klicperová-Baker, Martina

    London: Palgrave Macmillan, 2014 - (Shiraev, E.; Icks, M.), 253-269 ISBN 9781137397867 Institutional support: RVO:68081740 Keywords : Vaclav Havel * character assassination * post-communist mentality Subject RIV: AN - Psychology

  4. Die Kunstkammer Rudolfs II. - Entstehung, Niedergang, Wiederentdeckung

    Czech Academy of Sciences Publication Activity Database

    Bukovinská, Beket

    Wien: Holzhausen, 2015 - (Haag, S.; Kirchweger, F.; Rainer, P.), s. 229-253. (Schriften des Kunsthistorischen Museums. 15). ISBN 978-3-902976-65-9 Institutional support: RVO:68378033 Keywords : Rudolf II * kunstkammer Subject RIV: AL - Art, Architecture, Cultural Heritage

  5. Drug: D04713 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D04713 Drug Levocarnitine propionate hydrochloride (USAN); Dromos (TN) C10H20NO4. Cl 253.1081 25 ... 3.7231 D04713.gif Source of energy ... substrate in the Krebs cycle [anaplerotic action] ...

  6. RELATIONSHIP BETWEEN SORE VASITIS NODE,EPIDIDYMAL STASIS AND ANTISPERM ANTIBODY AFTER VASECTOMY

    Institute of Scientific and Technical Information of China (English)

    HUANGMing-Kong; MATian-Gen

    1989-01-01

    253 cases without any complcation and 20 cases with sore vasitis node and epididymal stasis were selected at random among those who had reccived vasectomy in an epidcmiological study on the safety of vasectomy. 319 married men having offsprings

  7. The Czech Metalworkers´ Federation/ Odborový svaz KOVO (OS KOVO) in Domestic and European Arenas

    Czech Academy of Sciences Publication Activity Database

    Mansfeldová, Zdenka

    Stuttgart: ibidem-Verlag, 2015 - (Landgraf, C.; Pleines, H.), s. 237-253 ISBN 978-3-8382-0734-6 Institutional support: RVO:68378025 Keywords : Metalworkers´ trade union * European cooperation Subject RIV: AD - Politology ; Political Sciences

  8. Geochemical background in polluted river sediments: How to separate the effects of sediment provenance and grain size with statistical rigour?

    Czech Academy of Sciences Publication Activity Database

    Bábek, O.; Matys Grygar, Tomáš; Faměra, M.; Hron, K.; Nováková, Tereza; Sedláček, J.

    2015-01-01

    Roč. 135, DEC (2015), s. 240-253. ISSN 0341-8162 Institutional support: RVO:61388980 Keywords : Anthropogenic contamination * Geochemical background * Fluvial sediments Subject RIV: DD - Geochemistry Impact factor: 2.820, year: 2014

  9. AcEST: BP915124 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000066_G08 467 Adiantum capillus-veneris mRNA. clone: YMU001_000066_G08. BP915124 - Show ... DVDNNRCYMLVHQAKRLNSPCLLVTNHDSSVFPNL----------------VTT ... 253 Query: 280 LYADAKSTAGNEERGIVFDRILCDVPCSGDGTIRK ...

  10. Archeologický výzkum zaniklého těžebního areálu u kostela sv. Václava v Pněvicích (okr. Kutná Hora)

    Czech Academy of Sciences Publication Activity Database

    Končelová, Markéta; Velímský, Filip

    2012-01-01

    Roč. 12, prosinec (2012), s. 253-256. ISSN 1801-5972 Institutional research plan: CEZ:AV0Z80020508 Keywords : Kutná Hora * archaeology * Middle Ages * silver mining Subject RIV: AC - Archeology, Anthropology, Ethnology

  11. Fears for the Future

    Institute of Scientific and Technical Information of China (English)

    XU FEIBIAO

    2010-01-01

    @@ The foiled bid to blow Northwest Airlines Flight 253 from the skies above Detroit on December 25, 2009, was very nearly the second most serious incident in the United States associated with AI Qaeda since 9/11.

  12. Personal neutron dosemeter of the Czech Republic: Review of basic properties, results of recent tests

    Czech Academy of Sciences Publication Activity Database

    Trousil, J.; Spurný, František; Plichta, J.

    2006-01-01

    Roč. 14, 7/8 (2006), s. 246-253. ISSN 1210-7085 Institutional research plan: CEZ:AV0Z10480505 Keywords : detectors * dosemeters * personal dosimetry Subject RIV: DN - Health Impact of the Environment Quality

  13. Osteomalacia

    Science.gov (United States)

    ... Disorders of vitamin D metabolism Kidney failure and acidosis Lack of enough phosphates in the diet Liver ... PA: Saunders Elsevier; 2011:chap 253. Read More Acidosis Acute kidney failure Lactose intolerance Malabsorption Rickets Seizures ...

  14. Comparative analysis of antimicrobial and proteolytic activity of lactic acid bacteria isolated from Zlatar cheese

    OpenAIRE

    Topisirović Ljubiša; Veljović Katarina; Terzić-Vidojević Amarela; Strahinić Ivana; Kojić Milan

    2007-01-01

    Traditional artisan Zlatar cheese belongs to the group of white, semi hard home-made cheeses, which are produced from no pasteurized cow's milk, without addition of any known bacterial starter culture. In total, 253 Gram-positive and catalase negative lactic acid bacteria (LAB) were isolated. Results showed that 70 out of 253 analyzed isolates produced antimicrobial compounds known as bacteriocins. Most isolates from genera Lactococcus and Enterococcus, and isolates belonging to ...

  15. Study of the effect of moisture content and bending rate on the fracture toughness of rocks

    Czech Academy of Sciences Publication Activity Database

    Vavro, Leona; Souček, Kamil

    2013-01-01

    Roč. 10, č. 2 (2013), s. 247-253. ISSN 1214-9705 R&D Projects: GA MŠk ED2.1.00/03.0082 Institutional support: RVO:68145535 Keywords : fracture toughness * bending rate * tensile strength Subject RIV: DB - Geology ; Mineralogy Impact factor: 0.667, year: 2013 http://www.irsm.cas.cz/materialy/acta_content/2013_02/acta_170_14_Vavro_Soucek_247-253.pdf

  16. 数字解读(英文)

    Institute of Scientific and Technical Information of China (English)

    2008-01-01

    253 Million Internet Users vs 46.4 Percent of Women Netizens China Internet Network Information Center(CNNIC) recently issued its 22nd Statistical Survey Report on Internet Development in China. The report indicated China had 253 million Internet users by the end of June 2008, up 56.2 percent over the previous year.For the first time in China's history,the Internet

  17. Drug: D00447 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D00447 Drug Sulfamethoxazole (JP16/USP/INN); Gantanol (TN) C10H11N3O3S 253.0521 253... Intermediate-acting sulfonamides J01EC01 Sulfamethoxazole D00447 Sulfamethoxazole (JP16/USP/INN) Antiinfect...e synthase inhibitor [KO:K00796] Sulfonamides Sulfamethoxazole [ATC:J01EC01] D00447 Sulfamethoxazole (JP16/U

  18. Gclust Server: 98465 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available uence length 253 Representative annotation dehydrogenase with different specificities...98465 Pm4_PMT9312_1351 Cluster Sequences Related Sequences(192) 253 dehydrogenase with different specificiti...es 1 1.00e-99 0.0 0.0 4.0 0.0 0.0 0.0 Show 98465 Cluster ID 98465 Sequence ID Pm4_P

  19. Concentration of bright quasars in the Sculptor Group

    International Nuclear Information System (INIS)

    Recent objective prism searches for quasars confirm the grouping of bright quasars in the direction of the Sculptor Group of galaxies. The density of such quasars with V -2. The concentration in the NGC 55, NGC 300 and NGC 253 areas is 0.65 deg-2. Around NGC 253 the density is over 20 times the average and has a chance of -4 of being accidental. (author)

  20. Neutron radiography for nondestructive testing

    International Nuclear Information System (INIS)

    Neutron radiography is similar to X-ray inspection in that both depend upon use of radiation that penetrates some materials and is absorbed by others to provide a contrast image of conditions not readily available for visual inspection. X-rays are absorbed by dense materials, such as metals, whereas neutrons readily penetrate metals, but are absorbed by materials containing hydrogen. The neutron radiography has been successfully applied to a number of inspection situations. These include the inspection of explosives, advanced composites, adhesively bonded structures and a number of aircraft engine components. With the availability of Californium-252, it has become feasible to construct mobile neutron radiography systems suitable for field use. Such systems have been used for in-situ inspection of flight line aircraft, particularly to locate and measure hidden corrosion

  1. Preparation of actinide targets by electrodeposition

    Science.gov (United States)

    Trautmann, N.; Folger, H.

    1989-10-01

    Actinide targets with varying thicknesses on different substrates have been prepared by electrodeposition either from aqueous solutions or from solutions of their nitrates in isopropyl alcohol. With these techniques the actinides can be deposited almost quantitatively on various backing materials within 15 to 30 min. Targets of thorium, uranium, neptunium, plutonium, americium, curium and californium with areal densities from almost carrier-free up to 1.4 mg/cm 2 on thin beryllium, carbon, titanium, tantalum and platinum foils have been prepared. In most cases, prior to the deposition, the actinides had to be purified chemically and for some of them, due to the limited amount of material available, recycling procedures were required. Applications of actinide targets in heavy-ion reactions are briefly discussed.

  2. An atomic beam source for actinide elements: concept and realization

    International Nuclear Information System (INIS)

    For ultratrace analysis of actinide elements and studies of their atomic properties with resonance ionization mass spectroscopy (RIMS), efficient and stable sources of actinide atomic beams are required. The thermodynamics and kinetics of the evaporation of actinide elements and oxides from a variety of metals were considered, including diffusion, desorption, and associative desorption. On this basis various sandwich-type filaments were studied. The most promising system was found to consist of tantalum as the backing material, an electrolytically deposited actinide hydroxide as the source of the element, and a titanium covering layer for its reduction to the metal. Such sandwich sources were experimentally proven to be well suited for the production of atomic beams of plutonium, curium, berkelium and californium at relatively low operating temperatures and with high and reproducible yields. (orig.)

  3. Environmental assessment of the thermal neutron activation explosive detection system for concourse use at US airports

    International Nuclear Information System (INIS)

    This document is an environmental assessment of a system designed to detect the presence of explosives in checked airline baggage or cargo. The system is meant to be installed at the concourse or lobby ticketing areas of US commercial airports and uses a sealed radioactive source of californium-252 to irradiate baggage items. The major impact of the use of this system arises from direct exposure of the public to scattered or leakage radiation from the source and to induced radioactivity in baggage items. Under normal operation and the most likely accident scenarios, the environmental impacts that would be created by the proposed licensing action would not be significant. 44 refs., 19 figs., 18 tabs

  4. A comparative study of bulk etch rate measurement methods in polycarbonate detectors

    International Nuclear Information System (INIS)

    The response of a plastic detector to an incoming charged particle is given by the ratio of track etch rate vt to bulk etch rate vg along its path. Although the accurate determination of vt offers no difficulty as cone length can be comfortably measured, there seems to be a certain ambiguity as how to measure vg. Several LEXAN and TUFFAK polycarbonate plates have been exposed to normally incident Californium-252 fission fragments, etched in a stirred aqueous NaOH solution saturated with etch products and with a 0.05% of Dowfax surfactant, for different etching times, concentrations and temperatures. We have used three methods to measure vg and we obtain consistent results in agreement with those published in the literature. Surface quality and, consequently, ellipses neatness, are far superior in TUFFAK than in LEXAN. (author)

  5. A Novel Approach to β-delayed Neutron Spectroscopy Using the Beta-decay Paul Trap

    International Nuclear Information System (INIS)

    A new approach to β-delayed neutron spectroscopy has been demonstrated that circumvents the many limitations associated with neutron detection by instead inferring the decay branching ratios and energy spectra of the emitted neutrons by studying the nuclear recoil. Using the Beta-decay Paul Trap, fission-product ions were trapped and confined to within a 1-mm3 volume under vacuum using only electric fields. Results from recent measurements of 137I+ and plans for development of a dedicated ion trap for future experiments using the intense fission fragment beams from the Californium Rare Isotope Breeder Upgrade (CARIBU) facility at Argonne National Laboratory are summarized. The improved nuclear data that can be collected is needed in many fields of basic and applied science such as nuclear energy, nuclear astrophysics, and stockpile stewardship

  6. Devices for rapid protein determination in grain products and mixed feeds by the neutron method

    International Nuclear Information System (INIS)

    Protein determination should be carried out using rapid techniques so that each truckful of grain can be checked for protein while mixed feeds can be checked for protein directly in the product flow lines with automatic correction of their work. The existing methods of protein determination do not meet the above requirements. In this connection, the Azot analyzer has beem developed based on the reaction of capture of thermal neutrons by the nuclei of the nitrogen present in the analyzed product and the registration of the resulting gamma-quanta emission of 10.8 Mev. Readings of the nitrogen will be converted to those of protein with the help of standard conversion coefficients. Alongside with protein content, the Azot can measure the test weight of the grain by absorbing californium 252 neutrons

  7. Probe for the exploration of deposits

    International Nuclear Information System (INIS)

    The exploration probes work by means of a prompt (n,γ) analysis, activation analysis or X-ray fluorescence analysis. The neutrons or gamma radiation are provided by a californium-252 source or a cobalt-57 source which are placed in the probe. The probe is in the form of a pipe consisting of single modules. Each module contains a part of the whole radiation producing, shielding, detector, detector cooling and detector electronic system. They can be screwed onto one another and can be exchanged for other parts. A melt cryostatat or a compressor is used as cooling device, a germanium-(Li) detector as detector, and bismuth and heavy water as shielding. All measuring process can thus be carried out in situ in a relatively short measuring time. (DG)

  8. Robotics and remote systems applications

    International Nuclear Information System (INIS)

    This article is a review of numerous remote inspection techniques in use at the Savannah River (and other) facilities. These include: (1) reactor tank inspection robot, (2) californium waste removal robot, (3) fuel rod lubrication robot, (4) cesium source manipulation robot, (5) tank 13 survey and decontamination robots, (6) hot gang valve corridor decontamination and junction box removal robots, (7) lead removal from deionizer vessels robot, (8) HB line cleanup robot, (9) remote operation of a front end loader at WIPP, (10) remote overhead video extendible robot, (11) semi-intelligent mobile observing navigator, (12) remote camera systems in the SRS canyons, (13) cameras and borescope for the DWPF, (14) Hanford waste tank camera system, (15) in-tank precipitation camera system, (16) F-area retention basin pipe crawler, (17) waste tank wall crawler and annulus camera, (18) duct inspection, and (19) deionizer resin sampling

  9. Utilization of radiation facilities at TNRC for shielding researches and related topics

    International Nuclear Information System (INIS)

    This paper presents the running shielding research activities at Tajura Nuclear research center. The main area of researches are concentrated on the investigation of different types of concrete made from local materials such as conventional concrete, Magnetite-Limonite concrete, and heat resistant concrete. The measuring techniques used were neutron-gamma spectrometry, and activation foils. The measurements were performed using collimated beam of reactor neutrons emitted from one of the horizontal channels, as well as from californium-252 neutron source. The transmitted neutron spectra through concrete barriers of different thicknesses were measured by a scintillation spectrometer with NE-213 liquid organic scintillator. A non-destructive testing of some reactor materials were also carried out using neutron and gamma ray computerized tomography technique (CT). Some experiments were also carried out related to measurements of neutron depth dose distributions inside tissue equivalent materials. 10 figs

  10. Nuclear fission and the transuranium elements

    International Nuclear Information System (INIS)

    Many of the transuranium elements are produced and isolated in large quantities through the use of neutrons furnished by nuclear fission reactions: plutonium (atomic number 94) in ton quantities; neptunium (93), americium (95), and curium (96) in kilogram quantities; berkelium (97) in 100 milligram quantities; californium (98) in gram quantities; and einsteinium (99) in milligram quantities. Transuranium isotopes have found many practical applications---as nuclear fuel for the large-scale generation of electricity, as compact, long-lived power sources for use in space exploration, as means for diagnosis and treatment in the medical area, and as tools in numerous industrial processes. Of particular interest is the unusual chemistry and impact of these heaviest elements on the periodic table. This account will feature these aspects. 9 refs., 5 figs

  11. Potential nuclear safeguards applications for neutron generators

    International Nuclear Information System (INIS)

    Many nuclear safeguards inspection instruments use neutron sources to interrogate the fissile material (commonly 235U and 239Pu) to be measured. The neutron sources currently used in these instruments are isotopics such as Californium-252, Americium-Lithium, etc. It is becoming increasingly more difficult to transport isotopic sources from one measurement location to another. This represents a significant problem for the International Atomic Energy Agency (IAEA) safeguards inspectors because they must take their safeguards instruments with them to each nuclear installation to make an independent measurement. Purpose of this paper is to review the possibility of replacing isotopic neutron sources now used in IAEA safeguards instruments with electric neutron sources such as deuterium-tritium (D-T, 14-MeV neutrons) or deuterium-deuterium (D-D, 2-MeV neutrons). The potential for neutron generators to interrogate spent-light water reactor fuel assemblies in storage pools is also reviewed

  12. Reliability of semiconductor and gas-filled diodes for over-voltage protection exposed to ionizing radiation

    Directory of Open Access Journals (Sweden)

    Stanković Koviljka

    2009-01-01

    Full Text Available The wide-spread use of semiconductor and gas-filled diodes for non-linear over-voltage protection results in a variety of possible working conditions. It is therefore essential to have a thorough insight into their reliability in exploitation environments which imply exposure to ionizing radiation. The aim of this paper is to investigate the influence of irradiation on over-voltage diode characteristics by exposing the diodes to californium-252 combined neutron/gamma radiation field. The irradiation of semiconductor over-voltage diodes causes severe degradation of their protection characteristics. On the other hand, gas-filled over-voltage diodes exhibit a temporal improvement of performance. The results are presented with the accompanying theoretical interpretations of the observed changes in over-voltage diode behaviour, based on the interaction of radiation with materials constituting the diodes.

  13. Measurements of the neutron capture cross sections and incineration potentials of minor-actinides in high thermal neutron fluxes: Impact on the transmutation of nuclear wastes

    International Nuclear Information System (INIS)

    This thesis comes within the framework of minor-actinide nuclear transmutation studies. First of all, we have evaluated the impact of minor actinide nuclear data uncertainties within the cases of 241Am and 237Np incineration in three different reactor spectra: EFR (fast), GT-MHR (epithermal) and HI-HWR (thermal). The nuclear parameters which give the highest uncertainties were thus highlighted. As a result of fact, we have tried to reduce data uncertainties, in the thermal energy region, for one part of them through experimental campaigns in the moderated high intensity neutron fluxes of ILL reactor (Grenoble). These measurements were focused onto the incineration and transmutation of the americium-241, the curium-244 and the californium-249 isotopes. Finally, the values of 12 different cross sections and the 241Am isomeric branching ratio were precisely measured at thermal energy point. (author)

  14. Multi-purpose neutron radiography system

    International Nuclear Information System (INIS)

    A conceptual design is given for a low cost, multipurpose radiography system suited for the needs of the Los Alamos National Laboratory (LANL). The proposed neutron source is californium-252. One purpose is to provide an in-house capability for occasional, reactor quality, neutron radiography thus replacing the recently closed Omega-West Reactor. A second purpose is to provide a highly reliable standby transportable neutron radiography system. A third purpose is to provide for transportable neutron probe gamma spectroscopy techniques. The cost is minimized by shared use of an existing x-ray facility, and by use of an existing transport cask. The achievable neutron radiography and radioscopy performance characteristics have been verified. The demonstrated image qualities range from high resolution gadolinium - SR film, with L:D = 100:1, to radioscopy using a LIXI image with L:D = 30:1 and neutron fluence 3.4 x 105 n/cm2

  15. Measurements of the neutron capture cross sections and incineration potentials of minor-actinides in high thermal neutron fluxes: Impact on the transmutation of nuclear wastes; Mesures des sections efficaces de capture et potentiels d'incineration des actinides mineurs dans les hauts flux de neutrons: Impact sur la transmutation des dechets

    Energy Technology Data Exchange (ETDEWEB)

    Bringer, O

    2007-10-15

    This thesis comes within the framework of minor-actinide nuclear transmutation studies. First of all, we have evaluated the impact of minor actinide nuclear data uncertainties within the cases of {sup 241}Am and {sup 237}Np incineration in three different reactor spectra: EFR (fast), GT-MHR (epithermal) and HI-HWR (thermal). The nuclear parameters which give the highest uncertainties were thus highlighted. As a result of fact, we have tried to reduce data uncertainties, in the thermal energy region, for one part of them through experimental campaigns in the moderated high intensity neutron fluxes of ILL reactor (Grenoble). These measurements were focused onto the incineration and transmutation of the americium-241, the curium-244 and the californium-249 isotopes. Finally, the values of 12 different cross sections and the {sup 241}Am isomeric branching ratio were precisely measured at thermal energy point. (author)

  16. Triton and alpha-particle contribution from LiF converter for neutron dosimeter

    CERN Document Server

    Camacho, M E; Balcazar, M

    1999-01-01

    A personnel neutron dosimeter prototype based on chemical and electrochemical etched CR-39 detector, combined with LiF converter, has been calibrated using an ICRP-like phantom, under a heavy-water moderated Californium source neutron spectra; A conversion factor of 1.052+-126 spots cm sup - sup 2 mSv sup - sup 1 was obtained. The sealing properties of the detector holder showed a ten-fold reduction in radon background when it was tested in a high radon atmosphere. A convenient mechanical shock resistance was achieved in LiF converters by sintering to 11 tons pressure LiF powder at 650 deg. C, during one hour.

  17. Nuclear fission and the transuranium elements

    Energy Technology Data Exchange (ETDEWEB)

    Seaborg, G.T.

    1989-02-01

    Many of the transuranium elements are produced and isolated in large quantities through the use of neutrons furnished by nuclear fission reactions: plutonium (atomic number 94) in ton quantities; neptunium (93), americium (95), and curium (96) in kilogram quantities; berkelium (97) in 100 milligram quantities; californium (98) in gram quantities; and einsteinium (99) in milligram quantities. Transuranium isotopes have found many practical applications---as nuclear fuel for the large-scale generation of electricity, as compact, long-lived power sources for use in space exploration, as means for diagnosis and treatment in the medical area, and as tools in numerous industrial processes. Of particular interest is the unusual chemistry and impact of these heaviest elements on the periodic table. This account will feature these aspects. 9 refs., 5 figs.

  18. General purpose nuclear irradiation chamber

    International Nuclear Information System (INIS)

    Nuclear technology has found a great need for use in medicine, industry, and research. Smoke detectors in our homes, medical treatments and new varieties of plants by irradiating its seeds are just a few examples of the benefits of nuclear technology. Portable neutron source such as Californium-252, available at Industrial Technology Division (BTI/ PAT), Malaysian Nuclear Agency, has a 2.645 year half-life. However, 252Cf is known to emit gamma radiation from the source. Thus, this chamber aims to provide a proper gamma shielding for samples to distinguish the use of mixed neutron with gamma-rays or pure neutron radiation. The chamber is compatible to be used with other portable neutron sources such as 241Am-Be as well as the reactor TRIGA PUSPATI for higher neutron dose. This chamber was designed through a collaborative effort of Kulliyyah Engineering, IIUM with the Industrial Technology Division (BTI) team, Malaysian Nuclear Agency. (Author)

  19. Experimental survey of the potential energy surfaces associated with fission

    International Nuclear Information System (INIS)

    Progress in the experimental determination of the properties of the potential energy surface associated with fission is reviewed. The importance of nuclear symmetry effects on the calculation of fission widths is demonstrated. Evidence is presented for the fragmentation of the mass-asymmetric second barrier in the thorium region and the axial asymmetric first barrier in the californium region. Detailed analyses of experimental data suggest the presence of two parallel second barriers; the normal mass-asymmetric, axial-symmetric barrier and a slightly higher mass-symmetric, axial-asymmetric barrier. Experimental barrier parameters are determined systematically and compared with calculations from various theoretical models. Techniques for expanding fission probability measurements to higher energies are discussed. (author)

  20. Separation of 248Cm (III) from 252Cf (III) and its use in time resolved fluorescence spectroscopic (TRFS) studies

    International Nuclear Information System (INIS)

    The present report gives a description of the methodology for the separation of 248Cm(III) from decayed 252Cf (III) waste solution. The waste solution was first assayed for 252Cf content by neutron counting using a neutron well coincidence counter. The sample was subjected to the chemical separation of 248Cm (III) from 252Cf (III) following anion and cation exchange chromatography. The alpha spectrum of the separated curium fraction showed peaks due to 246Cm and 248Cm while the corresponding alpha spectrum of californium fraction showed 249,250,251,252Cf. The gamma ray abundances of 249Cf were determined with respect to its gamma rays of 387 keV and the data agreed well with that in literature. Separated Cm(III) was further characterized by recording its time resolved fluorescence spectrum (TRFS) in aqueous medium. (author)

  1. Effects of 252Cf neutrons, transmitted through an iron block on human lymphocyte chromosome

    International Nuclear Information System (INIS)

    Chromosome aberration of human peripheral blood lymphocytes exposed to californium-252 (252Cf) neutrons transmitted through a 15 cm thick iron block was analysed. The spectrum of the filtered neutrons ranged from 0.1 to 2MeV with a peak at 0.7 MeV, simulating the Hiroshima atomic bomb neutron spectrum as shown in the Dosimetry System 1986 (DS86). Chromosome aberration frequencies after exposure to filtered and unfiltered 252Cf radiation were compared. Acentric ring chromosomes were significantly increased (p 0.1). The relative biological effectiveness (RBE) of the neutrons with respect to the formation of dicentrics and centric rings was 10.9 and 12.3 in the filtered and unfiltered conditions respectively, but the difference was not statistically significant. These results provide useful information for the re-evaluation of the biological effect of the Hiroshima atomic bomb radiations. (Author)

  2. Test and evaluation results of the 252Cf shuffler at the Savannah River Plant

    International Nuclear Information System (INIS)

    The 252Cf Shuffler, a nondestructive assay instrument employing californium neutron source irradiation and delayed-neutron counting, was developed for measuring 235U content of scrap and waste items generated at the Savannah River Plant (SRP) reactor fuel fabrication facility. The scrap and waste items include high-purity uranium-aluminum alloy ingots as well as pieces of castings, saw and lathe chips from machining operations, low-purity items such as oxides of uranium or uranium intermixed with flux materials found in recovery operations, and materials not recoverable at SRP such as floor sweepings or residues from the uranium scrap recovery operation. The uranium contains about 60% 235U with the remaining isotopes being 236U, 238U, and 234U in descending order. The test and evaluation at SRP concluded that the accuracy, safety, reliability, and ease of use made the 252Cf Shuffler a suitable instrument for routine use in an industrial, production-oriented plant

  3. Highly charged ions for atomic clocks and search for variation of the fine structure constant

    CERN Document Server

    Dzuba, V A

    2015-01-01

    We review a number of highly charged ions which have optical transitions suitable for building extremely accurate atomic clocks. This includes ions from Hf$^{12+}$ to U$^{34+}$, which have the $4f^{12}$ configuration of valence electrons, the Ir$^{17+}$ ion, which has a hole in almost filled $4f$ subshell, the Ho$^{14+}$, Cf$^{15+}$, Es$^{17+}$ and Es$^{16+}$ ions. Clock transitions in most of these ions are sensitive to variation of the fine structure constant, $\\alpha$ ($\\alpha = e^2/\\hbar c$). E.g., californium and einsteinium ions have largest known sensitivity to $\\alpha$-variation while holmium ion looks as the most suitable ion for experimental study. We study the spectra of the ions and their features relevant to the use as frequency standards.

  4. The CARIBU EBIS control and synchronization system

    Science.gov (United States)

    Dickerson, Clayton; Peters, Christopher

    2015-01-01

    The Californium Rare Isotope Breeder Upgrade (CARIBU) Electron Beam Ion Source (EBIS) charge breeder has been built and tested. The bases of the CARIBU EBIS electrical system are four voltage platforms on which both DC and pulsed high voltage outputs are controlled. The high voltage output pulses are created with either a combination of a function generator and a high voltage amplifier, or two high voltage DC power supplies and a high voltage solid state switch. Proper synchronization of the pulsed voltages, fundamental to optimizing the charge breeding performance, is achieved with triggering from a digital delay pulse generator. The control system is based on National Instruments realtime controllers and LabVIEW software implementing Functional Global Variables (FGV) to store and access instrument parameters. Fiber optic converters enable network communication and triggering across the platforms.

  5. Neutrons in cancer therapy

    Science.gov (United States)

    Allen, Barry J.

    1995-03-01

    The role of neutrons in the management of cancer has a long history. However, it is only in recent years that neutrons are beginning to find an accepted place as an efficacious radiation modality. Fast neutron therapy is already well established for the treatment of certain cancers, and clinical trials are ongoing. Californium neutron sources are being used in brachytherapy. Boron neutron capture therapy has been well tested with thermal neutrons and epithermal neutron dose escalation studies are about to commence in the USA and Europe. Possibilities of neutron induced auger electron therapy are also discussed. With respect to chemotherapy, prompt neutron capture analysis is being used to study the dose optimization of chemotherapy in the management of breast cancer. The rationales behind these applications of neutrons in the management of cancer are examined.

  6. 1α,25(OH)2D3 differentially regulates miRNA expression in human bladder cancer cells.

    Science.gov (United States)

    Ma, Yingyu; Hu, Qiang; Luo, Wei; Pratt, Rachel N; Glenn, Sean T; Liu, Song; Trump, Donald L; Johnson, Candace S

    2015-04-01

    Bladder cancer is the fourth most commonly diagnosed cancer in men and eighth leading cause of cancer-related death in the US. Epidemiological and experimental studies strongly suggest a role for 1α,25(OH)2D3 in cancer prevention and treatment. The antitumor activities of 1α,25(OH)2D3 are mediated by the induction of cell cycle arrest, apoptosis, differentiation and the inhibition of angiogenesis and metastasis. miRNAs play important regulatory roles in cancer development and progression. However, the role of 1α,25(OH)2D3 in the regulation of miRNA expression and the potential impact in bladder cancer has not been investigated. Therefore, we studied 1α,25(OH)2D3-regulated miRNA expression profiles in human bladder cancer cell line 253J and the highly tumorigenic and metastatic derivative line 253J-BV by miRNA qPCR panels. 253J and 253J-BV cells express endogenous vitamin D receptor (VDR), which can be further induced by 1α,25(OH)2D3. VDR target gene 24-hydroxylase was induced by 1α,25(OH)2D3 in both cell lines, indicating functional 1α,25(OH)2D3 signaling. The miRNA qPCR panel assay results showed that 253J and 253J-BV cells have distinct miRNA expression profiles. Further, 1α,25(OH)2D3 differentially regulated miRNA expression profiles in 253J and 253J-BV cells in a dynamic manner. Pathway analysis of the miRNA target genes revealed distinct patterns of contribution to the molecular functions and biological processes in the two cell lines. In conclusion, 1α,25(OH)2D3 differentially regulates the expression of miRNAs, which may contribute to distinct biological functions, in human bladder 253J and 253J-BV cells. This article is part of a Special Issue entitled '17th Vitamin D Workshop'. PMID:25263658

  7. Study of reproducibility of measurements with the spectrometer of Bonner multispheres

    Energy Technology Data Exchange (ETDEWEB)

    Azevedo, G.A.; Pereira, W.W.; Patrao, K.C.S.; Fonseca, E.S., E-mail: geisadeazevedo@gmail.com, E-mail: walsan@ird.gov.br, E-mail: karla@ird.gov.br, E-mail: evaldo@ird.gov.br [Instituto de Radionprotecao e Dosimetria (IRD/CNEN-RJ), Rio de Janeiro, RJ (Brazil)

    2013-07-01

    This work aims to study the metrological behavior of the Bonner Multisphere Spectrometer (BMS) of the LN / LNMRI / IRD - Laboratorio Metrologia de Neutrons / Laboratorio Nacional de Metrologia e Radiacao Ionizante / Instituto de Radioprotecao e Dosimetria, for measurements in repeatability and reproducibility conditions. Initially, a simulation was done by applying the Monte Carlo method, using the MCNP code and respecting the ISO 8529-1 (2001), using the sources of Californium ({sup 252} Cf), Americium-Beryllium ({sup 241} AmBe) and californium in heavy water (Cf + D{sub 2}O), all located at a distance of 100 cm from the neutron detector ({sup 6}Li (Eu) - crystal scintillator). In this program, the counting of neutrons that are captured by the detector was made. The source is located in the center of a sphere of radius 300 cm. Analyzes the impact of these neutrons in a point of the sphere wall, which in this case acted as a neutron detector and from there, it is estimated the number of neutrons that collide in the whole sphere. The purpose is to obtain the neutron count for different energy bands in a solid field of neutrons, since they have a spectrum ranging from a low to a high energy that can also vary within a particular environment. Wishes to obtain new fields with different sources and moderators materials to be used as new reference fields. Measurements are being conducted for these fields, with the aim of analyzing the variability conditions of the measurement (repeatability and reproducibility) in LEN - Laboratorio de Espectrometria de Neutrons of the LN/LMNRI/IRD. Thus, the spectrometer will be used to improve both the knowledge of the spectrum as the standard of neutrons of the lab, proving that a spectrometry is essential for correct measurement.

  8. An Exponential Stability Result of a Timoshenko System with Thermoelasticity with Second Sound and in the Presence of Delay

    International Nuclear Information System (INIS)

    In this paper, we consider a one-dimensional linear thermoelastic system of Timoshenko type with a delay, where the heat flux is given by Cattaneo’s law. We prove an exponential decay result under a smallness condition on the delay and a stability number introduced first in Santos et al. (J Diff Eqs 253:2715–2733, 2012), using a method different from that of Santos et al. (J Diff Eqs 253:2715–2733, 2012). We also reproduce the polynomial decay of Santos et al. (J Diff Eqs 253:2715–2733, 2012) using the multiplier method in the case of absence of delay. The polynomial decay issue in the presence of a small delay is an open question

  9. SDS-PAGE analysis of high molecular weight glutenin subunits in SP3 from spaceflight carried wheat

    International Nuclear Information System (INIS)

    The compositions of high molecular weight glutenin subunits (HMW-GS) of the third generation (SP3) of two wheat varieties spaceflight carried were analyzed by SDS-PAGE. The quality score of Glu-1 of each site was calculated according to the quality rating system. The results showed that the space flight carried could result in a higher frequency of HMW-GS gene mutation. The variance frequency of HMW-GS in SP3 of Shaan253 and Xinong1043 were 27.08% and 27.45%, and the quality score in SP3 of Shaan253 and Xinong1043 were 7 and 6, respectively. Shaan253 SP3 generation mutants were considered as high-quality wheat. (authors)

  10. A human β-III-spectrin spinocerebellar ataxia type 5 mutation causes high-affinity F-actin binding.

    Science.gov (United States)

    Avery, Adam W; Crain, Jonathan; Thomas, David D; Hays, Thomas S

    2016-01-01

    Spinocerebellar ataxia type 5 (SCA5) is a human neurodegenerative disease that stems from mutations in the SPTBN2 gene encoding the protein β-III-spectrin. Here we investigated the molecular consequence of a SCA5 missense mutation that results in a L253P substitution in the actin-binding domain (ABD) of β-III-spectrin. We report that the L253P substitution in the isolated β-III-spectrin ABD causes strikingly high F-actin binding affinity (Kd = 75.5 nM) compared to the weak F-actin binding affinity of the wild-type ABD (Kd = 75.8 μM). The mutation also causes decreased thermal stability (Tm = 44.6 °C vs 59.5 °C). Structural analyses indicate that leucine 253 is in a loop at the interface of the tandem calponin homology (CH) domains comprising the ABD. Leucine 253 is predicted to form hydrophobic contacts that bridge the CH domains. The decreased stability of the mutant indicates that these bridging interactions are probably disrupted, suggesting that the high F-actin binding affinity of the mutant is due to opening of the CH domain interface. These results support a fundamental role for leucine 253 in regulating opening of the CH domain interface and binding of the ABD to F-actin. This study indicates that high-affinity actin binding of L253P β-III-spectrin is a likely driver of neurodegeneration. PMID:26883385

  11. Drug: D05407 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D05407 Drug Penciclovir (USAN/INN); Denavir (TN) C10H15N5O3 253.1175 253.2578 D0540...TICS FOR TOPICAL USE D06BB Antivirals D06BB06 Penciclovir D05407 Penciclovir (USAN/INN) J ANTIINFECTIVES FOR...s excl. reverse transcriptase inhibitors J05AB13 Penciclovir D05407 Penciclovir (...USAN/INN) USP drug classification [BR:br08302] Antivirals Antiherpetic Agents Penciclovir D05407 Penciclovir... (USAN/INN) Antiinfectives [BR:br08307] Antivirals Anti-HSV agent DNA polymerase inhibitor Purine analogue Penciclov

  12. AcEST: DK963462 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST39A01NGRL0016_J17 547 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0016_J17. 5' end seq ... TYIVEPGDTCYAISQAYGISLSDFQSWNAGINCSILQIGQSVCISVPTASSPSG ----S 387 +TY V+ GDT + ISQ YGIS++ QS N + +I+ IGQ + ... 253 YAISQAYGISLSDFQS------WNAGINCSILQIGQSVCISVPTASSPSG STCRTDTIQF 414 YA +YG SL+ S ++ + G S ++ +S + S+ T T ... TYIVEPGDTCYAISQAYGISLSDFQSWNAGINCSILQIGQSVCISVPTASSPSG ----S 387 +TY V+ GDT + ISQ YGIS++ QS N + +I+ IGQ + ... 253 YAISQAYGISLSDFQS------WNAGINCSILQIGQSVCISVPTASSPSG STCRTDTIQF 414 YA +YG SL+ S ++ + G S + +S + S+ T T+ ...

  13. On the 57-us isomer in 93Rb

    Energy Technology Data Exchange (ETDEWEB)

    Miernik, Krzysztof A [ORNL; Gross, Carl J [ORNL; Grzywacz, Robert Kazimierz [ORNL; Madurga, M [University of Tennessee, Knoxville (UTK); Mendez, II, Anthony J [ORNL; Rykaczewski, Krzysztof Piotr [ORNL; Stracener, Daniel W [ORNL; Zganjar, E. F. [Louisiana State University

    2014-01-01

    The 253.3 keV isomeric state located in 93Rb was studied at the HRIBF in Oak Ridge. The state in question was populated in the decay of 93Kr produced by proton induced fission of 238U and separated using the isotope separation on line technique. We report that the 253.3 keV level does not reveal isomerism and the upper limit of the half life from our measurement is 4 ns. Our findings are supported by previously reported results that were not taken into account in the latest nuclear databases.

  14. No Evidence of Isomerism for the First Excited State of {sup 93}Rb

    Energy Technology Data Exchange (ETDEWEB)

    Miernik, K., E-mail: kmiernik@fuw.edu.pl [Physics Division, Oak Ridge National Laboratory, Oak Ridge Tennessee 37830 (United States); Gross, C.J. [Physics Division, Oak Ridge National Laboratory, Oak Ridge Tennessee 37830 (United States); Grzywacz, R. [Dept. of Physics and Astronomy, University of Tennessee, Knoxville, TN 37996 (United States); Physics Division, Oak Ridge National Laboratory, Oak Ridge Tennessee 37830 (United States); Madurga, M. [Dept. of Physics and Astronomy, University of Tennessee, Knoxville, TN 37996 (United States); Mendez, A.J.; Rykaczewski, K.P.; Stracener, D.W. [Physics Division, Oak Ridge National Laboratory, Oak Ridge Tennessee 37830 (United States); Zganjar, E.F. [Dept. of Physics and Astronomy, Louisiana State University, Baton Rouge, LA 70803 (United States)

    2014-06-15

    The 253.3–keV excited state located in {sup 93}Rb was studied at the Holifield Radioactive Ion Beam Facility in Oak Ridge. This state, described as isomeric in databases, was populated in the decay of {sup 93}Kr produced by proton–induced fission of {sup 238}U and isolated using the isotope separation on–line technique. We report that the 253.3–keV level does not reveal isomerism and the upper limit of the half-life from our measurement is 4 ns. Our findings are supported by previously reported results that were not taken into account in the latest nuclear databases.

  15. Characteristics of the shark fisheries of Fiji

    OpenAIRE

    Glaus, Kerstin B. J.; Irene Adrian-Kalchhauser; Patricia Burkhardt-Holm; White, William T.; Juerg M. Brunnschweiler

    2015-01-01

    Limited information is available on artisanal and subsistence shark fisheries across the Pacific. The aim of this study was to investigate Fiji’s inshore fisheries which catch sharks. In January and February 2013, 253 semi-directive interviews were conducted in 117 villages and at local harbours on Viti Levu, Vanua Levu, Taveuni, Ovalau and a number of islands of the Mamanuca and Yasawa archipelagos. Of the 253 interviewees, 81.4% reported to presently catch sharks, and 17.4% declared that th...

  16. Dicty_cDB: Contig-U10804-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available a strain CBS138 c... 173 2e-41 AE016816_102( AE016816 |pid:none) Ashbya gossypii (= Eremotheci...so... 159 2e-37 AE016819_958( AE016819 |pid:none) Ashbya gossypii (= Eremothecium ... 159...e number (1..6, M) 1 Chromosome length 4919822 Start point 3435302 End point 3437040 Strand (PLUS/MINUS) PLUS Number of clones... Xenopus laevis p21 GTPase-associat... 253 2e-65 AF169794_1( AF169794 |pid:none) ...Xenopus laevis p21 GTPase-associat... 253 2e-65 BC059992_1( BC059992 |pid:none) Xenopus laevis hypothetical

  17. Evaluation of Material Parameters of Multiphase Materials Using Drift Distortion Corrected SEM Imaging

    Czech Academy of Sciences Publication Activity Database

    Petráňová, Veronika; Koudelka_ml., Petr; Kytýř, Daniel; Doktor, Tomáš; Valach, Jaroslav

    Vol. 662. Durnten: Trans Tech Publications, 2015 - (Kovalčíková, A.; Lofaj, F.), s. 253-256 ISBN 978-3-03835-555-7. ISSN 1013-9826. [International Conference on Local Mechanical Properties. Tatranská Lomnice (SK), 12.11.2014-14.11.2014] R&D Projects: GA ČR(CZ) GBP105/12/G059 Institutional support: RVO:68378297 Keywords : drift distortion * SEM * microstructure * digital image correlation * qBSE Subject RIV: JJ - Other Materials http://www.scientific.net/KEM.662.253

  18. Complexes of membrane-associated gamma-tubulin with Fyn kinase and phosphoinositide 3-kinase in differentiating cells

    Czech Academy of Sciences Publication Activity Database

    Sulimenko, Vadym; Macůrek, Libor; Dráberová, Eduarda; Richterová, Věra; Sulimenko, Tetyana; Dráberová, Lubica; Marková, Vladimíra; Dráber, Pavel

    2009-01-01

    Roč. 276, č. 1 (2009), s. 253-253. ISSN 1742-464X. [FEBS Congress /34/. 04.07.2009-09.07.2009, Praha] R&D Projects: GA MŠk 1M0506; GA MŠk LC545; GA ČR GA204/05/2375; GA ČR GA304/04/1273 Institutional research plan: CEZ:AV0Z50520514 Keywords : detergent-resistant membrane * Fyn * PI3K gamma-tubulin Subject RIV: EB - Genetics ; Molecular Biology

  19. AcEST: BP915034 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000065_G02 383 Adiantum capillus-veneris mRNA. clone: YMU001_000065_G02. BP915034 CL3621C ... e = -3 Query: 378 SPVQWETTLKTILGKGLQNGYELGPGKVIAGLVKRI ... 271 +PVQW +++ I +G+++ YE+GPGKV+ GL KRI ... Sbjct: 253 ... NPVQWTKSVEFIAAQGVEHLYEVGPGKVLTGLTKRI ... 288 >sp|P0AAI9|FABD_ECOLI Malonyl CoA-acyl carrier ... e = -3 Query: 378 SPVQWETTLKTILGKGLQNGYELGPGKVIAGLVKRI ... 271 +PVQW +++ + +G+++ YE+GPGKV+ GL KRI ... Sbjct: 253 ... NPVQWTKSVEYMAAQGVEHLYEVGPGKVLTGLTKRI ... 288 >sp|P0AAJ0|FABD_ECOL6 Malonyl CoA-acyl carrier ...

  20. In vitro activity of U-76,252 (CS-807), a new oral cephalosporin.

    OpenAIRE

    Fass, R J; Helsel, V L

    1988-01-01

    U-76,252 is the prodrug of U-76,253. MICs of U-76,253 were 0.015 to 0.06 microgram/ml for greater than or equal to 90% of the strains of Streptococcus spp., Haemophilus influenzae, and Proteus mirabilis; 0.25 to 1 microgram/ml for Branhamella catarrhalis, Escherichia coli, Klebsiella spp., and Citrobacter diversus; 1 to 8 micrograms/ml for Staphylococcus spp.; and 2 to greater than 16 micrograms/ml for other members of the family Enterobacteriaceae and Aeromonas hydrophila; for 72% of the lat...

  1. AcEST: DK955825 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST39A01NGRL0024_C03 569 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0024_C03. 5' end seq ... Gaps = 2/106 (1%) Frame = +1 Query: 253 KPGVR-TLNCRAE L-EWLDHLMLAVGVGLPCTVMECGDVVYRSTLPRSNALNITPPGVLL 426 ... Gaps = 9/113 (7%) Frame = +1 Query: 253 KPGVRT-LNCRAE LEWLDHLMLAVG------VGLPCTVMECGDVVYRSTLPRS--NALNI 405 ... +PG R + RA E ++D L V + PC VM+CGD+VYRSTL S N Sbjct: 33 RPGQRRGVP ... SSNPCKNYERLRRLAKSWVEGEGVSLRKAVDSKAYETLHGVMKPGVRTLNCRAE LE 294 +R++ P +YE LRR A W E EG A + T G +PGV RAE ... E S ...

  2. Dicty_cDB: Contig-U14622-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available n: 2 Number of Hits to DB: 410 Number of Sequences: 6905 Number of extensions: 410 Number of success...: 92845959 Number of Hits to DB: 56,291,095 Number of extensions: 3421517 Number of successful extensions...: 3236559 Number of Hits to DB: 51,072,651 Number of extensions: 216021 Number of successful extensions: 253 Number of sequences... better than 10.0: 0 Number of HSP's gapped: 253 Number of HSP's successfully gapped: ...ful extensions: 112 Number of sequences better than 10.0: 37 len

  3. A new type-B cask design for transporting 252Cf

    International Nuclear Information System (INIS)

    A project to design, certify, and build a new US Department of Energy (DOE) Type B container for transporting >5 mg of 252Cf is more than halfway to completion. This project was necessitated by the fact that the existing Oak Ridge National Laboratory (ORNL) Type B containers were designed and built many years ago and thus do not have the records and supporting data that current regulations require. Once the new cask is available, it will replace the existing Type B containers. The cask design is driven by the unique properties of 252Cf, which is a very intense spontaneous fission neutron source and necessitates a large amount of neutron shielding. The cask is designed to contain up to 60 mg of 252Cf in the form of californium oxide or californium oxysulfate, in pellet, wire, or sintered material forms that are sealed inside small special-form capsules. The new cask will be capable of all modes of transport (land, sea, and air). The ORNL team, composed of technical and purchasing personnel and using rigorous selection criteria, chose NAC, International (NAC), as the subcontractor for the project. In January 1997, NAC started work on developing the conceptual design and performing the analyses. The original design concept was for a tungsten alloy gamma shield surrounded by two concentric shells of NS-4-FR neutron shield material. A visit to US Nuclear Regulatory Commission (NRC) regulators in November 1997 to present the conceptual design for their comments resulted in a design modification when the question of potential straight-line cracking in the NS-4-FR neutron shield material arose. NAC's modified design includes offset, wedgelike segments of the neutron shield material. The new geometry eliminates concerns about straight-line cracking but increases the weight of the packaging and makes the fabrication more complex. NAC has now completed the cask design and performed the analyses (shielding, structural, thermal, etc.) necessary to certify the cask. The cask

  4. The Development of Neutron Radiography and Tomography on a SLOWPOKE-2 Reactor

    Science.gov (United States)

    Bennett, L. G. I.; Lewis, W. J.; Hungler, P. C.

    Development of neutron radiography at the Royal Military College of Canada (RMC) started by trying to interest the Royal Canadian Air Force (RCAF) in this new non-destructive testing (NDT) technique. A Californium-252 based device was ordered and then installed at RMC for development of applicable techniques for aircraft by the first author. A second and transportable device was then designed, modified and used in trials at RCAF Bases and other locations for one year. This activity was the only foreign loan of the U.S. Californium Loan Program. Around this time, SLOWPOKE-2 reactors were being installed at four Canadian universities, while a new science and engineering building was being built at RMC. A reactor pool was incorporated and efforts to procure a reactor succeeded a decade later with a SLOWPOKE-2 reactor being installed at RMC. The only modification by the vendor for RMC was a thermal column replacing an irradiation site inside the reactor container for a later installation of a neutron beam tube (NBT). Development of a working NBT took several years, starting with the second author. A demonstration of the actual worth of neutron radiography took place with a CF-18 Hornet aircraft being neutron and X-radiographed at McClellan Air Force Base, Sacramento, CA. This inspection was followed by one of the rudders that had indications of water ingress being radiographed successfully at RMC just after the NBT became functional. The next step was to develop a neutron radioscopy system (NRS), initially employing film and then digital imaging, and is in use today for all flight control surfaces (FCS). With the third author, a technique capable of removing water from affected FCS was developed at RMC. Heating equipment and a vacuum system were utilized to carefully remove the water. This technique was proven using a sequence of near real time neutron images obtained during the drying process. The results of the drying process were correlated with a relative humidity

  5. Factors Affecting the Job Satisfaction of Latino/a Immigrants in the Midwest

    Science.gov (United States)

    Valdivia, Corinne; Flores, Lisa Y.

    2012-01-01

    This study examined the job satisfaction of 253 Latino/a newcomers in three rural communities in the Midwest. Specifically, the authors explored the effects of ethnic identity, Anglo acculturation, Latino/a acculturation, perceptions of the community (social relations, discrimination/racism, and language pressures), job tenure, work hours, and…

  6. Dicty_cDB: Contig-U13159-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ntities = 254/254 (100%) Strand = Plus / Plus Query: 13 aaaaagggacttgngagtttgntgatttngatccnaaaccnttnntttgnaa...aactgntg 72 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 13 aaaaagggacttgngagtttgntgatttngatccna...ttttggtggnaaaaaaggttntgnctactggaaancaagtcaaggngntncna 192 Query: 193 nggccncntnaaangccna...||||| Sbjct: 193 nggccncntnaaangccnatcccctttangaaancnatccntcaggnggngaaaanncna 252 Query: 253 tttntnctagcccc .../235 (97%) Strand = Plus / Plus Query: 13 aaaaagggacttgngagtttgntgatttngatccnaaaccnttnntttgnaaaactgntg 72 ||

  7. Dicty_cDB: Contig-U12608-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ore = 216 bits (109), Expect = 1e-56 Identities = 248/253 (98%) Strand = Plus / Plus Query: 4 aaaatgctncgagcatgncccagtnaaccnagctaaccn...||||||||||||||||||||||||||||| Sbjct: 4 aaaatgctncgagcatgncccagtnaaccnagctaaccnanaacctgaaagnattgnatt 63 Query...atgatggcgataaaaanananaggatcnaaaatcnactgcttcaaccccccnaggcna 183 ||||||||||||||||||...|||||||||||||||||||||||||||||||||||||||||| Sbjct: 124 ttatgatggcgataaaaanananaggatcnaaaatcnactgcttcaaccccccna...xpect = 2e-05 Identities = 83/105 (79%) Strand = Plus / Plus Query: 150 atcnaaaatcnactgcttcaaccccccnaggcnang

  8. Dicty_cDB: Contig-U10401-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ntantccntcna 253 Query: 254 tcnatgttangaaccnattagngaattcnttnaattnnnnnnnnaagatcnat...tganttc 313 |||||||||||||||||||||||||||||||||||| |||||||||||||||| Sbjct: 254 tcnatgttangaaccnattagngaattcntt...tatcaatctattccttcaa 932 Query: 254 tcnatgttangaaccnattagngaattcnttnaatt 289 || |||||| ||||| ||||| ||||| || |...ancaatntantccntcna 105 Query: 254 tcnatgttangaaccnattagngaattcnttnaatt 289 |||||||||||||||||||||||||||||||||...||| Sbjct: 104 tcnatgttangaaccnattagngaattcnttnaatt 69 Lambda K H 1.37 0.711 1.31 Matrix: blastn matrix:1 -3

  9. Whole-Genome Sequence of "Candidatus Liberibacter asiaticus" from a Huanglongbing-Affected Citrus Tree in Central Florida.

    Science.gov (United States)

    Zheng, Z; Sun, X; Deng, X; Chen, J

    2015-01-01

    Here, we report the draft genome sequence of "Candidatus Liberibacter asiaticus" strain FL17, isolated from a huanglongbing (HLB)-affected citrus tree in central Florida. The FL17 genome comprised 1,227,253 bp, with a G+C content of 36.5%, 1,175 predicted open reading frames, and 53 RNA genes. PMID:25792067

  10. Whole-Genome Sequence of “Candidatus Liberibacter asiaticus” from a Huanglongbing-Affected Citrus Tree in Central Florida

    OpenAIRE

    Z. Zheng; X. Sun; Deng, X.; J. Chen

    2015-01-01

    Here, we report the draft genome sequence of “Candidatus Liberibacter asiaticus” strain FL17, isolated from a huanglongbing (HLB)-affected citrus tree in central Florida. The FL17 genome comprised 1,227,253 bp, with a G+C content of 36.5%, 1,175 predicted open reading frames, and 53 RNA genes.

  11. Puerto Lápice eucrite fall: Strewn field, physical description, probable fireball trajectory, and orbit

    Czech Academy of Sciences Publication Activity Database

    Trigo-Rodríguez, J.M.; Borovička, Jiří; Llorca, J.; Madiedo, J.M.; Zamorano, J.; Izquierdo, J.

    2009-01-01

    Roč. 44, č. 2 (2009), s. 175-186. ISSN 1086-9379 Institutional research plan: CEZ:AV0Z10030501 Keywords : meteor * meteorite Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 3.253, year: 2009

  12. Sensitivity analysis of an inverse procedure for determination of elastic coefficients for strong anisotropy

    Czech Academy of Sciences Publication Activity Database

    Seiner, Hanuš; Landa, Michal

    2004-01-01

    Roč. 43, č. 4 (2004), s. 253-263. ISSN 0041-624X Institutional research plan: CEZ:AV0Z2076919 Keywords : elastic anisotropy * group velocity * non-destructive evaluation Subject RIV: JJ - Other Materials Impact factor: 1.175, year: 2004

  13. EST Table: FS853720 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available FS853720 E_FL_fner_47C14_F_0 10/09/28 43 %/253 aa ref|XP_001866947.1| thyroid ... receptor interacti ... ng protein [Culex quinquefasciatus] gb|EDS44216.1| thyroid ... receptor interacting protein [Culex quinquefasciat ...

  14. Whole-Genome Sequence of “Candidatus Liberibacter asiaticus” from a Huanglongbing-Affected Citrus Tree in Central Florida

    Science.gov (United States)

    Zheng, Z.; Sun, X.

    2015-01-01

    Here, we report the draft genome sequence of “Candidatus Liberibacter asiaticus” strain FL17, isolated from a huanglongbing (HLB)-affected citrus tree in central Florida. The FL17 genome comprised 1,227,253 bp, with a G+C content of 36.5%, 1,175 predicted open reading frames, and 53 RNA genes. PMID:25792067

  15. Factorial Structure of the New Ecological Paradigm Scale in Two French Samples

    Science.gov (United States)

    Fleury-Bahi, Ghozlane; Marcouyeux, Aurore; Renard, Elise; Roussiau, Nicolas

    2015-01-01

    The principal objective of this research is to test the factorial structure of the New Ecological Paradigm scale on a population of men and women residing in France. The tested model is a second-order factorial model. This factorial structure is evaluated on two separate samples to test the stability of the solution (a first sample of 253

  16. All cyano-bacteria may be suspicious of being toxin producers

    Czech Academy of Sciences Publication Activity Database

    Maršálek, Blahoslav

    Praha : International Association of Water Quality , 1997 - (Dolejš, P.; Kalousková, N.), s. 253-256 ISBN 80-0201-159-7. [Reservoir management and water supply - an integrated system . Praha (CZ), 19.05.1997-23.05.1997

  17. Surface pollen-vegetation relationships in the forest-steppe, taiga and tundra landscapes of the Russian Altai Mountains

    Czech Academy of Sciences Publication Activity Database

    Pelánková, Barbora; Chytrý, M.

    2009-01-01

    Roč. 157, 3-4 (2009), s. 253-265. ISSN 0034-6667 Institutional research plan: CEZ:AV0Z60050516 Keywords : modern pollen spectra * pollen deposition * southern Siberia Subject RIV: EF - Botanics Impact factor: 2.145, year: 2009

  18. 48 CFR 53.111 - Contract clause.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Contract clause. 53.111... AND FORMS FORMS General 53.111 Contract clause. Contracting officers shall insert the clause at 52.253-1, Computer Generated Forms, in solicitations and contracts that require the contractor to...

  19. A NEW FLAVONE GLYCOSIDE, 5-HYDROXY 7,3',4',5'-TETRA-METHOXYFLAVONE 5-O-β-D-XYLOPYRANOSYL (1 → 2)-α-L-RHAMNOPYRANOSIDE FROM BAUHINIA VARIEGATA LINN

    Institute of Scientific and Technical Information of China (English)

    R. N. YADAVA; V. M. S. REDDY

    2001-01-01

    A new flavone glycoside m.f. C3oH36O15, m.p. 252-253℃, [M]+ 636 (EIMS) was isolated from the acetone soluble fraction of the concentrated 95% ethanolic extract of the seeds of Bauhinia xylopyranosyl-(1→2)-α-L-rhamnopyranoside (1) by various colour reactions, chemical degradations and spectral techniques.

  20. Eine Aufführung der g-moll-Sinfonie KV 550 bei Baron van Swieten im Beisein Mozarts

    Czech Academy of Sciences Publication Activity Database

    Jonášová, Milada

    Tutzing: Hans Schneider , 2011 - (Schmid, M.), s. 253-268 ISBN 9783862960255 R&D Projects: GA ČR(CZ) GA408/09/2006 Institutional research plan: CEZ:AV0Z90580513 Keywords : Mozart * Sinfonie g moll * KV 550, * Gottfried van Swieten Subject RIV: AL - Art, Architecture, Cultural Heritage

  1. Andrzej Frycz Modrzewski - předchůdce Komenského?

    Czech Academy of Sciences Publication Activity Database

    Bečková, Marta

    Brno : L. Marek, 2004 - (Štěpán, J.), s. 253-264 [100. výročí narození J. B. Čapka. Praha (CZ), 05.11.2003] Institutional research plan: CEZ:AV0Z9009908 Keywords : A. F. Modrzewski * comparison * J. A. Comenius Subject RIV: AA - Philosophy ; Religion

  2. Vplyv postihnutia na copingové stratégie a osobnostnú štruktúru rannej adolescencie

    Czech Academy of Sciences Publication Activity Database

    Karaffová, Eva

    2009-01-01

    Roč. 44, č. 3 (2009), s. 253-268. ISSN 0555-5574 R&D Projects: GA ČR GA406/09/2096 Institutional research plan: CEZ:AV0Z70250504 Keywords : coping strategies * personality factors * physical disability * early adolescence Subject RIV: AN - Psychology

  3. Keplerův Novoroční dar krystalografii

    Czech Academy of Sciences Publication Activity Database

    Fábry, Jan

    2012-01-01

    Roč. 62, č. 4 (2012), s. 253-255. ISSN 0009-0700 Institutional research plan: CEZ:AV0Z10100520 Keywords : Johannes Kepler * Strena Seu de nive sexangula * six-cornered snow-flakes * close-packed arrangements of spheres Subject RIV: AB - History

  4. Vampirical Stick Pins, Deleuzian Folds, Noir Pastiches and other Wearability Conundrums: Fashion in Film

    DEFF Research Database (Denmark)

    Langkjær, Michael Alexander

    2012-01-01

    Anmeldelsesartikel (review article) overfjorten bidrag i antologien Fashion in Film, som belyser forskellige sider af forholdet mellem mode og film.Fashion in Film er redigeret af Adrienne Munich (Bloomington: Indiana University Press, 2011, 360 sider, ISBN 978-0-253-22299-2)....

  5. Pollution caused by ammunition manufacturing. 1964-July 1980 (citations from the NTIS data base). Report for 1964-July 1980

    Energy Technology Data Exchange (ETDEWEB)

    Cavagnaro, D.M.

    1980-08-01

    The bibliography covers air, water, and solid pollution produced by munition plants. The citations include monitoring, chemical analysis, cost analysis, pollution control techniques, equipment used, and toxicity studies. (This updated bibliography contains 253 citations, 17 of which are new entries to the previous edition.)

  6. Surface modification of cyclic olefin copolymers for osteochondral defect repair can increase pro-destructive potential of human chondrocytes in vitro

    Czech Academy of Sciences Publication Activity Database

    Polanská, M.; Hulejová, H.; Petrtýl, M.; Bastl, Zdeněk; Spirovová, Ilona; Kruliš, Zdeněk; Horák, Zdeněk; Veigl, D.; Šenolt, L.

    2010-01-01

    Roč. 59, č. 2 (2010), s. 247-253. ISSN 0862-8408 R&D Projects: GA ČR GA106/06/0761 Institutional research plan: CEZ:AV0Z40400503; CEZ:AV0Z40500505 Keywords : osteochondral defects * cycloolefin copolymer * chondrocytes * biocompatibility Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 1.646, year: 2010

  7. Danger in the reef

    DEFF Research Database (Denmark)

    Laustsen, Andreas Hougaard; Gutiérrez, José Maria; Redsted Rasmussen, Arne;

    2015-01-01

    (71.2%), three-finger toxins (3FTx; 25.3%), cysteine-rich secretory proteins (CRISP; 2.5%), and traces of a complement control module protein (CCM; 0.2%). Using a Toxicity Score, the most lethal components were determined to be short neurotoxins. Whole venom had an intravenous LD50 of 0.07 mg/kg in...

  8. Biohydrology research after Landau 2013 conference

    Czech Academy of Sciences Publication Activity Database

    Lichner, Ľ.; Cerdà, A.; Rajkai, K.; Tesař, Miroslav

    2014-01-01

    Roč. 62, č. 4 (2014), s. 253-257. ISSN 0042-790X Institutional support: RVO:67985874 Keywords : biohydrology * hydrological research * biological and hydrological systems * hydrological processes Subject RIV: DA - Hydrology ; Limnology Impact factor: 1.486, year: 2014

  9. Brno (k.ú. Bystrc, okr. Brno-město). Rokle. Neolit. Ojedinělý nález. Povrchový průzkum

    Czech Academy of Sciences Publication Activity Database

    Kirchner, Karel; Kuča, M.

    2009-01-01

    Roč. 50, 1-2 (2009), s. 253-254. ISSN 1211-7250 R&D Projects: GA ČR GA205/06/1024 Institutional research plan: CEZ:AV0Z30860518 Keywords : Brno Reservoir * neolithic * surface survey Subject RIV: AC - Archeology, Anthropology, Ethnology

  10. 77 FR 30312 - Montezuma National Wildlife Refuge, Cayuga, Seneca, and Wayne Counties, NY; Draft Comprehensive...

    Science.gov (United States)

    2012-05-22

    ... notice in the Federal Register (75 FR 25286; May 7, 2010). Montezuma NWR was established in 1938 to... Leader, 413-253-8575 (phone); northeastplanning@fws.gov (email). SUPPLEMENTARY INFORMATION: Introduction..., improving habitat connectivity, relationship with the community and local economy, refuge facilities...

  11. Interaction of plant amine oxidases with diaminoethers

    Czech Academy of Sciences Publication Activity Database

    Šebela, M.; Jarkovská, K.; Lenobel, René; Medda, R.; Padiglia, A.; Floris, G.; Peč, P.

    Part 7, - (2007), s. 222-232. ISSN 1424-6376 Institutional research plan: CEZ:AV0Z50380511 Keywords : diamine oxidase * diaminoether * inhibition Subject RIV: CE - Biochemistry Impact factor: 1.253, year: 2007 http://content.arkat-usa.org/ARKIVOC/JOURNAL_CONTENT/manuscripts/2007/UR-2149CP%20as%20published%20mainmanuscript.pdf

  12. Failure to Detect Deaf-Blindness in a Population of People with Intellectual Disability

    Science.gov (United States)

    Fellinger, J.; Holzinger, D.; Dirmhirn, A.; van Dijk, J.; Goldberg, D.

    2009-01-01

    Background: Early identification of deaf-blindness is essential to ensure appropriate management. Previous studies indicate that deaf-blindness is often missed. We aim to discover the extent to which deaf-blindness in people with intellectual disability (ID) is undiagnosed. Method: A survey was made of the 253 residents of an institute offering…

  13. Některé situační, strategické a textově typologické charakteristiky komunikace na www chatu

    Czech Academy of Sciences Publication Activity Database

    Hoffmannová, Jana; Müllerová, Olga

    Ostrava : Ostravská univerzita, 2006, s. 159-224 ISBN 80-7368-253-2 Grant ostatní: GA ČR(CZ) GA405/04/1035 Institutional research plan: CEZ:AV0Z90610518 Keywords : chat communication * strategies * text types Subject RIV: AI - Linguistics

  14. Zvířecí skelet z laténského objektu v Nových Dvorech, okr. Kutná Hora

    Czech Academy of Sciences Publication Activity Database

    Kyselý, René

    2011-01-01

    Roč. 63, č. 2 (2011), s. 253-255. ISSN 0323-1267 Institutional research plan: CEZ:AV0Z80020508 Keywords : ritual * La Tène period * osteology * Bos taurus * cattle Subject RIV: AC - Archeology, Anthropology, Ethnology

  15. Renewable energy sources and their contribution to the domestic energy production and consumption in Italy in the year 1995

    International Nuclear Information System (INIS)

    The overall electricity demand reached 261 TWh from 253.6 TWh, reflecting the 3.0 % growth of the gross domestic product recorded over the same period. The contribution of renewable energy sources (hydroelectricity, geothermal energy, biomass, solar, wind) to the national energy consumption in 1995 has been 12.8 Mtoe. It represented 7.4 % of the gross energy consumption

  16. AcEST: BP920679 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000140_B03 543 Adiantum capillus-veneris mRNA. clone: YMU001_000140_B03. BP920679 - Show ... Gaps = 2/53 (3%) Frame = -3 Query: 163 AHLGKAKPLKPLTSH --SLPSMKRQEATQEALSPEPLTKSAIQEEILEAIPKS 11 AH GKA P ... KP TSH ... + S+KR+ QE LS + AI E L++ PK+ Sbjct: 2 AHKGKAAPAKPP ...

  17. ABA and Diverse Cultural and Linguistic Environments: A Welsh Perspective

    Science.gov (United States)

    Jones, E. W.; Hoerger, M.; Hughes, J. C.; Williams, B. M.; Jones, B.; Moseley, Y.; Hughes, D. R.; Prys, D.

    2011-01-01

    Gwynedd Local Education Authority (LEA) in North West Wales, UK, is funding a small-scale autism-specific specialist education service using ABA methodology. The program is available through the medium of Welsh, English or bilingually, depending on the individual needs of the child (Jones and Hoerger in Eur J Behav Anal 10:249-253, "2009").…

  18. Research Intensity Synthesis of Propionic Acid and Vitamin B12 Propionibacteria

    Directory of Open Access Journals (Sweden)

    Kuznetsova Tatyana

    2015-10-01

    Full Text Available Conducted the selection and breeding of strains of Propionibacterium shermanii ability to synthesize vitamin B12 and propionic acid. Dedicated 9 propionibacteria strains synthesize vitamin B12 (180-1200 mcgr/ml and propionic acid (0,63- 2,53 g/l.

  19. Noble Metal/Ceramic Composites in Flame Processes

    DEFF Research Database (Denmark)

    Schultz, Heiko; Madler, Lutz; Strobel, Reto;

    . Figuéras, J. Mol. Catal., 79, (1993), 253. [2] M. Arai, Y. Takada, T. Ebina, M. Shirai, Appl. Catal. A: General, 183, (1999), 365. [3] R. Strobel, W. J. Stark, L. Mädler, S. E. Pratsinis, A. Baiker, J. Catal., 213, (2003) 296. [4] T. Johannessen, S. Koutsopoulos, J. Catal., 205, (2003) 404. [5] R. Strobel...

  20. Immigrants from Russia, Ukraine and the Caucasus Region: Differential Drug Use, Infectious Disease, and Related Outcomes

    Science.gov (United States)

    Isralowitz, Richard; Reznik, Alexander; Rawson, Richard A.; Hasson, Albert

    2009-01-01

    This study examined drug use patterns, HIV/AIDS, and related outcomes among former Soviet Union (FSU) immigrants from Russia, Ukraine and the Caucasus mountain region in Israel who reported heroin use. A total of 253 FSU heroin users were interviewed from 2002 to 2007 as part of a large drug use surveillance study in Israel. Individuals were…

  1. Factors affecting growth and viability of natural diatom populations in the meso-eutrophic Římov Reservoir (Czech Republic)

    Czech Academy of Sciences Publication Activity Database

    Znachor, Petr; Rychtecký, Pavel; Nedoma, Jiří; Visocká, Veronika

    2015-01-01

    Roč. 762, č. 1 (2015), s. 253-265. ISSN 0018-8158 R&D Projects: GA ČR(CZ) GAP504/11/2177; GA ČR(CZ) GAP504/11/2182 Institutional support: RVO:60077344 Keywords : diatom * growth rate * viability * PDMPO * SYTOX green * reservoir Subject RIV: DA - Hydrology ; Limnology Impact factor: 2.275, year: 2014

  2. Use of Crude Glycerol, a Biodiesel Co-product, in Diets for Lactating Sows

    Science.gov (United States)

    An experiment was conducted to evaluate the dietary effects of crude glycerol in lactating sow diets on sow and litter performance under heat stress conditions. Mixed parity (range = 0 to 13) sows (n = 345; 253 + 24 kg BW) were assigned randomly within gestation housing location and parity to 1 of 4...

  3. The Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Mansfeldová, Zdenka

    3. Cheltenham, Northampton : Edward Elgar, 2013 - (Berglund, S.; Ekman, J.; Deegan-Krause, K.; Knutsen, T.), s. 217-253 ISBN 978-0-85793-537-3 Institutional support: RVO:68378025 Keywords : cleavages * political change * Eastern Europe Subject RIV: AD - Politology ; Political Sciences

  4. ACTIVITY OF FUNGAL CULTURE FILTRATES AGAINST SOYBEAN CYST NEMATODE AND ROOT-KNOT NEMATODE EGG HATCH AND JUVENILE MOTILITY

    Science.gov (United States)

    Fungi were isolated from soybean cyst nematode (Heterodera glycines) eggs collected in China, and 253 isolates were assayed for production of compounds active against H. glycines and root-knot nematode (Meloidogyne incognita). Fungal isolates were grown for 3 and 7 days in potato dextrose broth (PD...

  5. Data ingestion and assimilation in ionospheric models

    Czech Academy of Sciences Publication Activity Database

    Burešová, Dalia; Nava, B.; Galkin, I.; Angling, M.; Stankov, S. M.; Coisson, P.

    2009-01-01

    Roč. 52, 3/4 (2009), s. 235-253. ISSN 1593-5213 R&D Projects: GA ČR GA205/08/1356; GA MŠk OC 091 Institutional research plan: CEZ:AV0Z30420517 Keywords : ionosphere * models * data assimilation * data ingestion Subject RIV: DG - Athmosphere Sciences, Meteorology Impact factor: 0.548, year: 2009

  6. Experience in the separation and purification of transplutonium elements in the transuranium processing plant at the Oak Ridge National Laboratory

    International Nuclear Information System (INIS)

    Since 1966, TRU has been the main center of production for transcurium elements in the US, producing 460 mg 249Bk, 4 g 252Cf, 18 mg 253Es, and 10 pg 257Fm. During the 14 years operation, 39 chemical processing campaigns were conducted to process 265 HFIR targets and 195 SRP production reactor targets

  7. Psychological Well-Being and Social Participation Assessment in Visually Impaired Subjects Playing Torball: A Controlled Study

    Science.gov (United States)

    Di Cagno, A.; Iuliano, E.; Aquino, G.; Fiorilli, G.; Battaglia, C.; Giombini, A.; Calcagno, G.

    2013-01-01

    The aim of this study was to evaluate the differences in psychological well-being, symptomatic psychological disorders and social participation, between blind Torball players and non-players. Thirty blind male participants were recruited, 17 Torball players (aged 36.27 plus or minus 3.46) and 13 non-players (aged 34.80 plus or minus 2.53), and…

  8. 48 CFR 6.302-1 - Only one responsible source and no other supplies or services will satisfy agency requirements.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Only one responsible... REQUIREMENTS Other Than Full and Open Competition 6.302-1 Only one responsible source and no other supplies or.... 253(c)(1). (2) When the supplies or services required by the agency are available from only...

  9. Substituted 2-hydroxy-N-(arylalkyl)benzamides induce apoptosis in cancer cell lines

    Czech Academy of Sciences Publication Activity Database

    Imramovský, A.; Jorda, Radek; Pauk, K.; Řezníčková, Eva; Dušek, J.; Hanousek, J.; Kryštof, Vladimír

    2013-01-01

    Roč. 68, č. 2013 (2013), s. 253-259. ISSN 0223-5234 R&D Projects: GA ČR GAP305/12/0783; GA ČR GA301/08/1649 Institutional research plan: CEZ:AV0Z50380511 Keywords : Diamides * Apoptosis * Cytotoxicity Subject RIV: CE - Biochemistry Impact factor: 3.432, year: 2013

  10. Accurate CO2 JouleůThomson Inversion Curve by Molecular Simulations

    Czech Academy of Sciences Publication Activity Database

    Colina, C. M.; Lísal, Martin; Siperstein, F. R.; Gubbins, K. E.

    2002-01-01

    Roč. 202, č. 2 (2002), s. 253-262. ISSN 0378-3812 R&D Projects: GA ČR GA203/02/0805 Grant ostatní: NSF(US) CHE 9876674 Keywords : carbon dioxide * Joule- Thomson inversion curve * molecular simulation Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 1.011, year: 2002

  11. Experimentální seizmické měření – vliv uchycení senzoru na kvalitu záznamu

    Czech Academy of Sciences Publication Activity Database

    Stolárik, Martin

    2009-01-01

    Roč. 9, č. 2 (2009), s. 253-262. ISSN 1213-1962 R&D Projects: GA ČR GA105/09/1415 Institutional research plan: CEZ:AV0Z30860518 Keywords : experimental seismic measurements * free-standing sensor Subject RIV: DC - Siesmology, Volcanology, Earth Structure

  12. Performance of Platinum and Gold Catalysts Supported on Ceria-Zirconia Mixed Oxide in the Oxidation of Chlorobenzene

    Czech Academy of Sciences Publication Activity Database

    Topka, Pavel; Delaigle, R.; Kaluža, Luděk; Gaigneaux, E.M.

    2015-01-01

    Roč. 253, SEP 15 (2015), s. 172-177. ISSN 0920-5861 R&D Projects: GA ČR GP13-24186P Institutional support: RVO:67985858 Keywords : oxidation * chlorobenzene * zirconia Subject RIV: CI - Industrial Chemistry, Chemical Engineering Impact factor: 3.893, year: 2014

  13. The Relationship between Organizational Support, Work-Family Conflict, and the Job-Life Satisfaction of University Coaches

    Science.gov (United States)

    Dixon, Marlene A.; Sagas, Michael

    2007-01-01

    This study examined the relationship between organizational support, work-family conflict, and job and life satisfaction among coaches. Data from collegiate head coaches with families (N = 253) were gathered through a mailed questionnaire. Results from a series of covariance structure models indicated that a partially mediated model was the best…

  14. Can We Rely on Predicted Basal Metabolic Rate in Patients With Intestinal Failure on Home Parenteral Nutrition?

    DEFF Research Database (Denmark)

    Andersen, Anders Skallerup; Pedersen, Louis Nygaard; Olesen, Søren Schou;

    2016-01-01

    (mean bias, 14 kcal/d [P = .28]; limits of agreement [LoA], -238 to 266 kcal/d) and the Johnstone equation (mean bias, -16 kcal/d [P = .24]; LoA, -285 to 253 kcal/d). For both equations, 67% of patients had a predicted BMR from 90%-110% All other equations demonstrated a statistically and clinically...

  15. MASSIVE PROTOPLANETARY DISKS IN ORION BEYOND THE TRAPEZIUM CLUSTER

    International Nuclear Information System (INIS)

    We present Submillimeter Array1The Submillimeter Array is a joint project between the Submillimeter Astrophysical Observatory and the Academica Sinica Institute of Astronomy and Astrophysics and is funded by the Smithsonian Institution and the Academica Sinica. observations of the 880 μm continuum emission from three circumstellar disks around young stars in Orion that lie several arcminutes (∼> 1 pc) north of the Trapezium cluster. Two of the three disks are in the binary system 253-1536. Silhouette disks 216-0939 and 253-1536a are found to be more massive than any previously observed Orion disks, with dust masses derived from their submillimeter emission of 0.045 M sun and 0.066 M sun, respectively. The existence of these massive disks reveals that the disk mass distribution in Orion does extend to high masses, and that the truncation observed in the central Trapezium cluster is a result of photoevaporation due to the proximity of O-stars. 253-1536b has a disk mass of 0.018 M sun, making the 253-1536 system the first optical binary in which each protoplanetary disk is massive enough to potentially form solar systems.

  16. Drug: D07435 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D07435 Mixture, Drug Papaveretum (BAN); Omnopon (TN) Morphine hydrochloride [DR:D02...271], Papaverine hydrochloride [DR:D02218], Codeine hydrochloride [DR:D07740] ATC code: N02AA10 A mixture of 253 parts of Morphine

  17. Koolera paneb Haiti valmiduse proovile / Hendrik Vosman

    Index Scriptorium Estoniae

    Vosman, Hendrik

    2010-01-01

    Haitis puhkenud koolerapuhang on nõudnud juba 253 inimelu, nakatunute arv ületab 3100 piiri, bakter võib sealsete ebahügieeniliste olude tõttu kaasa tuua teise humanitaarkatastroofi pärast 12. jaanuari maavärinat. Kaart

  18. Measuring Students' Perceptions of Personal and Social Responsibility and the Relationship to Intrinsic Motivation in Urban Physical Education

    Science.gov (United States)

    Li, Weidong; Wright, Paul M.; Rukavina, Paul Bernard; Pickering, Molly

    2008-01-01

    The purpose of the current study was to test the validity and reliability of a two-factor model of the Personal and Social Responsibility Questionnaire (PSRQ) and examine the relationships between perceptions of personal and social responsibility and intrinsic motivation in physical education. Participants were 253 middle school students who…

  19. Gclust Server: 201623 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available 201623 TET_44.m00181 Cluster Sequences - 253 hypothetical protein chr_0_8254555_44;... no annotation 1 1.00e-99 0.0 11.11 0.0 0.0 0.0 0.0 Show 201623 Cluster ID 201623 Sequence ID TET_44.m00181

  20. A new diarylethene and its application in optical storage

    Energy Technology Data Exchange (ETDEWEB)

    Liu Weijun; Jiang Duohua; Pu Shouzhi; Cui Shiqiang, E-mail: pushouzhi@tsinghua.org.cn [Jiangxi Key Laboratory of Organic Chemistry, Jiangxi Science and Technology Normal University, Nanchang 330013 (China)

    2011-02-01

    A new blue photochromic diarylethene compound, 1-[5-(3-methoxyphenyl)-2-methyl-3-thienyl]-2-[5-(3-cyanophenyl) -2-methyl-3-thienyl]perfluoroclopentene (1a), was synthesized and its photochemical properties were investigated in detail. The measurement results demonstrated that the compound has good photochromism in solution and in PMMA amorphous film, fluorescence and optical storage properties.

  1. A new diarylethene and its application in optical storage

    International Nuclear Information System (INIS)

    A new blue photochromic diarylethene compound, 1-[5-(3-methoxyphenyl)-2-methyl-3-thienyl]-2-[5-(3-cyanophenyl) -2-methyl-3-thienyl]perfluoroclopentene (1a), was synthesized and its photochemical properties were investigated in detail. The measurement results demonstrated that the compound has good photochromism in solution and in PMMA amorphous film, fluorescence and optical storage properties.

  2. Direct detection and quantification of malondialdehyde vapour in humid air using selected ion flow tube mass spectrometry supported by gas chromatography/mass spectrometry

    Czech Academy of Sciences Publication Activity Database

    Shestivska, Violetta; Antonowicz, S. S.; Dryahina, Kseniya; Kubišta, Jiří; Smith, D.; Španěl, Patrik

    2015-01-01

    Roč. 29, č. 11 (2015), s. 1069-1079. ISSN 0951-4198 R&D Projects: GA ČR(CZ) GP14-15771P Institutional support: RVO:61388955 Keywords : PERFORMANCE LIQUID-CHROMATOGRAPHY * SIFT-MS ANALYSIS * EXHALED BREATH Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.253, year: 2014

  3. Reactions of the selected ion flow tube mass spectrometry reagent ions H3O+ and NO+ with a series of volatile aldehydes of biogenic significance

    Czech Academy of Sciences Publication Activity Database

    Smith, D.; Chippendale, T. W. E.; Španěl, Patrik

    2014-01-01

    Roč. 28, č. 17 (2014), s. 1917-1928. ISSN 0951-4198 R&D Projects: GA ČR GA13-28882S Institutional support: RVO:61388955 Keywords : SOLID-PHASE MICROEXTRACTION * TRACE GAS-ANALYSIS * ON-FIBER-DERIVATIZATION Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.253, year: 2014

  4. Predicting Educational Outcomes and Psychological Well-Being in Adolescents Using Time Attitude Profiles

    Science.gov (United States)

    Andretta, James R.; Worrell, Frank C.; Mello, Zena R.

    2014-01-01

    Using cluster analysis of Adolescent Time Attitude Scale (ATAS) scores in a sample of 300 adolescents ("M" age = 16 years; "SD" = 1.25; 60% male; 41% European American; 25.3% Asian American; 11% African American; 10.3% Latino), the authors identified five time attitude profiles based on positive and negative attitudes toward…

  5. A systematic review of bevacizumab efficacy in breast cancer

    DEFF Research Database (Denmark)

    Kümler, Iben; Christiansen, Ole Grummedal; Nielsen, Dorte Lisbet

    2014-01-01

    feasible. Response rates (RR) varied from 0% to 76.5%, time to progression (TTP)/progression free survival (PFS) from 2.4 to 25.3 months and overall survival from 11.5 to more than 38 months. 14 phase III trials including more than 4400 patients with MBC unanimously showed increased RR and PFS, however, no...

  6. The effect of the regulation on trans fatty acid content in Danish food

    DEFF Research Database (Denmark)

    Leth, Torben; Jensen, Henrik G.; Mikkelsen, Aase Ærendahl;

    2006-01-01

    foods. A broader range of food was monitored with 253 samples in 2003 and 148 samples in 2005 after the Danish regulation was in effect. The investigations show that the TFA content has been reduced or removed from the products with high TFA content originally, like French fries, microwave oven popcorn...

  7. Counterterrorism On the Wrong Track

    Institute of Scientific and Technical Information of China (English)

    STEPHEN GALE; GREGORY MONTANARO

    2010-01-01

    @@ Umar Farouk Abdulmutallab's attempt at bombing Northwest Airlines Flight 253 on Christmas Day 2009 certainly rekindled Americans' interest in terrorism and security. Until recendy, security issues for many citi-zens seemed to focus on complaints about the endless lines and burdensome procedures at airports.

  8. The second activating glucokinase mutation (A456V)

    DEFF Research Database (Denmark)

    Christesen, Henrik B T; Jacobsen, Bendt B; Odili, Stella;

    2002-01-01

    .5) (the concentration of glucose needed to achieve the half-maximal rate of phosphorylation) from 8.04 (wild-type) to 2.53 mmol/l. The mutant's Hill coefficient was decreased, and its maximal specific activity k(cat) was increased. Mathematical modeling predicted a markedly lowered GSIR threshold of 1...

  9. Oversight on Current Status and Administration of Federal Student Assistance Programs. Hearings before the Subcommittee on Postsecondary Education of the Committee on Education and Labor, House of Representatives. Ninety-Seventh Congress, Second Session (January 27, 28 and February 2, 3, and 4, 1982).

    Science.gov (United States)

    Congress of the U.S., Washington, DC. House Committee on Education and Labor.

    The management and operations of federal student assistance programs are addressed in hearings before the Committee on Education and Labor. In fiscal year 1981, the Office of Inspector General (OIG), Department of Education (ED) issued 4,811 audit reports on postsecondary education programs. Costs disallowed or questioned amounted to $25.3

  10. Anna Mrskošová, agrárnická a komunistická politička

    Czech Academy of Sciences Publication Activity Database

    Pehr, Michal

    Praha : Masarykův ústav a Archiv AV ČR, 2014 - (Bahenská, M.; Malínská, J.), s. 242-253 ISBN 978-80-87782-24-8 Institutional support: RVO:67985921 Keywords : 20th century Czechoslovakia * Agrarianism * Czechoslovak Communist Party Subject RIV: AB - History

  11. Deposition of plutonium-238 injected intratracheally within different skeleton bones iron homeostasis being changed

    International Nuclear Information System (INIS)

    A study was made of the distribution of plutonium-239 injected intratracheally within different bones of the skeleton, the iron status in the blood being changed. The iron preparation caused 2.5-3-fold decrease in the plutonium loading onto cancellous bone tissue that displayed, in ordinary conditions, a higher tropism to the radionuclide than a cortical highly mineralized bone did

  12. Presidendi mõjukus avaliku arvamuse silmade läbi / Marti Taru

    Index Scriptorium Estoniae

    Taru, Marti, 1970-

    2002-01-01

    Uuringu tulemusena selgus, et avaliku arvamuse silmis eristub president teistest riigijuhtidest just riigimehelikkuse poolest - president peaks olema ametiisik, kes seisab kogu ühiskonna arengu ja heaolu eest, mitte aga ei tegutse kitsaste kildkondade huve esindades. Tabelid. Lisa: Valimi sotsiaal-demograafiline kirjeldus lk. 253-256

  13. Amino Group Functionalized N-Heterocyclic 1,2,4-Triazole-Derived Carbenes: Structural Diversity of Rhodium(I) Complexes

    Czech Academy of Sciences Publication Activity Database

    Turek, J.; Panov, I.; Horáček, Michal; Černošek, Z.; Padělková, Z.; Růžička, A.

    2013-01-01

    Roč. 32, č. 23 (2013), s. 7234-7240. ISSN 0276-7333 Institutional support: RVO:61388955 Keywords : TRANSITION-METAL COMPLEXES * BIFUNCTIONAL MECHANISM * TRANSFER HYDROGENATION Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 4.253, year: 2013

  14. QTL Information Table: 71 [Q-TARO

    Lifescience Database Archive (English)

    Full Text Available Ps-4 Others Others purple stigma SSR B)Fine F2 rdh Shuhui527 RM253 RM111 pha Han, L., Zhang, T., ... nalysis and gene mapping of purple stigma in rice. Yi ... Chuan Xue Bao 33, 642-646. ...

  15. Optimization of special inductor for induction pre-heating

    Czech Academy of Sciences Publication Activity Database

    Pánek, D.; Kotlan, V.; Doležel, Ivo

    2014-01-01

    Roč. 2014, č. 12 (2014), s. 253-256. ISSN 0033-2097 R&D Projects: GA ČR(CZ) GAP102/11/0498 Grant ostatní: GA TA ČR(CZ) TA03010354 Institutional support: RVO:61388998 Keywords : induction heating * shape optimization * hard-coupled formulation Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering

  16. Draft Genome Sequence of 16SrIII-J Phytoplasma, a Plant Pathogenic Bacterium with a Broad Spectrum of Hosts

    Science.gov (United States)

    Zamorano, Alan

    2016-01-01

    Phytoplasmas are bacterial plant pathogens that can affect different vegetal hosts. In South America, a phytoplasma belonging to ribosomal subgroup 16SrIII-J has been reported in many crops. Here we report its genomic draft sequence, showing a total length of 687,253 bp and a G+C content of 27.72%. PMID:27365349

  17. Cell cycle dependent expression of Plk 1 in synchronized porcine fetal fibroblasts

    Czech Academy of Sciences Publication Activity Database

    Anger, M.; Kues, W. A.; Klíma, J.; Mielenz, M.; Kubelka, M.; Motlík, J.; Ešner, M.; Dvořák, Petr; Carnwath, J. W.; Niemann, H.

    2003-01-01

    Roč. 65, - (2003), s. 245-253. ISSN 1040-452X R&D Projects: GA MŠk LN00A065 Institutional research plan: CEZ:AV0Z5039906 Keywords : serum deprivation Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.543, year: 2003

  18. Product ion distributions for the reactions of NO+ with some physiologically significant volatile organosulfur and organoselenium compounds obtained using a selective reagent ionization time-of-flight mass spectrometer

    Czech Academy of Sciences Publication Activity Database

    Mochalski, P.; Unterkofler, K.; Španěl, Patrik; Smith, D.; Amann, A.

    2014-01-01

    Roč. 28, č. 15 (2014), s. 1683-1690. ISSN 0951-4198 Institutional support: RVO:61388955 Keywords : TRACE GAS-ANALYSIS * ORGANIC-COMPOUNDS * EXHALED-BREATH Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.253, year: 2014

  19. Determination of residence times of ions in a resistive glass selected ion flow-drift tube using the Hadamard transformation

    Czech Academy of Sciences Publication Activity Database

    Spesyvyi, Anatolii; Španěl, Patrik

    2015-01-01

    Roč. 29, č. 17 (2015), s. 1563-1570. ISSN 0951-4198 R&D Projects: GA ČR GA13-28882S Institutional support: RVO:61388955 Keywords : mass-spectrometry * SIFT-MS * mobility spectrometry Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.253, year: 2014

  20. Desorption atmospheric pressure photoionization high-resolution mass spectrometry: a complementary approach for the chemical analysis of atmospheric aerosols

    Czech Academy of Sciences Publication Activity Database

    Parshintsev, J.; Vaikkinen, A.; Lipponen, K.; Vrkoslav, Vladimír; Cvačka, Josef; Kostiainen, R.; Kotiaho, T.; Hartonen, K.; Riekkola, M. L.; Kauppila, T. J.

    2015-01-01

    Roč. 29, č. 13 (2015), s. 1233-1241. ISSN 0951-4198 Grant ostatní: GA AV ČR(CZ) M200551204 Institutional support: RVO:61388963 Keywords : atmospheric aerosols * mass spectrometry * ambient ionization Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 2.253, year: 2014