WorldWideScience

Sample records for californium 249

  1. Metabolism and toxicity of californium

    International Nuclear Information System (INIS)

    Metabolism of californium can be compared with that of other transplutonium elements. The most important points are as follows: a fast blood clearance and fast bone uptake more important than liver uptake, a relatively high urinary excretion and kidney retention. Blood clearance of californium can be compared with that of americium. Distribution of californium 252 nitrate after intramuscular injection in rats was studied. There are very few experimental data on acute or long term toxicity of californium. (28 references)

  2. Magnetism in californium

    International Nuclear Information System (INIS)

    A SQUID-based magnetic susceptometer has been constructed for studying small radioactive samples at temperatures below 350 K and in magnetic fields up to 50 kilogauss. The device has been used to study californium (element 98) in a number of solid-state forms: the dhcp metal, several oxides (Cf2O3 in both the bcc and monoclinic structures, Cf7O12, CfO2 and BaCfO3), several monopnictides (CfN, CfAs and CfSb) and the trichloride (in both the hexagonal and orthorhombic structures). All of these materials were studied in polycrystalline form, and hexagonal CfCl3 was studied in single-crystal form as well. The susceptometer has the sensitivity to measure samples containing less than 10 micrograms of californium. The magnetic susceptibilities of all of the californium materials at temperatures above about 100 K are described well by the Curie-Weiss relationship. This behavior is consistent with the assumption that the magnetic 5f electrons are localized and that the paramagnetic behavior can be interpreted in terms of the properties of the free ion. The measured values of the effective paramagnetic moment, μ/sub eff/, for all the californium materials that were studied are reasonably consistent with theoretical values based on intermediate coupling models. All of the californium materials showed some indications of cooperative magnetic effects. The dhcp metal was observed to order ferromagnetically at 52 K, and all of the californium compounds studied showed signs of antiferromagnetic ordering, mostly at temperatures below 25 K. 91 refs., 50 figs., 19 tabs

  3. Californium Multiplier (CFX)

    International Nuclear Information System (INIS)

    The availability of 252Cf as an economical high-intensity neutron source has made it possible to construct compact neutron irradiation devices with widespread applications. The simplest such device consists of a single 252Cf source within a moderating and shielding medium. Higher neutron flux levels can be attained either through the use of more 252Cf or through source multiplication by means of a subcritical uranium assembly. Although the use of larger 252Cf sources to achieve higher neutron flux is technically straightforward, an economic penalty is paid as the source strength is increased. Larger californium sources imply larger initial investments to cover the cost of source material and larger operating costs resulting from the decay of the 252Cf source. A Californium Multiplier, the CFX, which produces a flux enhancement of 30 when compared to a conventional moderated 252Cf system has been designed, licensed, built, and tested by IRT Corporation. Such systems are now available on a commercial basis for both neutron radiography and neutron activation analysis. The first commercial CFX system was installed at the Research Laboratories of Eastman Kodak Company in Rochester, NY, in March 1975. This device, using 1 mg of 252Cf, is very stable and the neutron flux generated by the CFX is very reproducible. The performance characteristics of this system are summarized

  4. Californium--palladium metal neutron source material

    Science.gov (United States)

    Dahlen, B.L.; Mosly, W.C. Jr.; Smith, P.K.; Albenesius, E.L.

    1974-01-22

    Californium, as metal or oxide, is uniformly dispersed throughout a noble metal matrix, provided in compact, rod or wire form. A solution of californium values is added to palladium metal powder, dried, blended and pressed into a compact having a uni-form distribution of californium. The californium values are decomposed to californium oxide or metal by heating in an inert or reducing atmosphere. Sintering the compact to a high density closes the matrix around the dispersed californium. The sintered compact is then mechanically shaped into an elongated rod or wire form. (4 claims, no drawings) (Official Gazette)

  5. Californium-252 Neutron Sources for Medical Applications

    International Nuclear Information System (INIS)

    Californium-252 neutron sources are being prepared to investigate the value of this radionuclide in diagnosing and treating diseases. A source resembling a cell-loaded radium needle was developed for neutron therapy. Since therapy needles are normally implanted in the body, very conservative design criteria were established to prevent leakage of radioactive. Methods are being developed to prepare very intense californium sources that could be used eventually for neutron radiography and for diagnosis by neutron activation analysis. This paper discusses these methods

  6. Production of extra pure curium and californium preparations

    International Nuclear Information System (INIS)

    Preparations of curium-244,245,248 and californium-249,252 are used for the production of ionizing radiation sources for different applications and fundamental nuclear-physical investigations, placing high requirements on the radiochemical and chemical purity of the preparations. Extraction chromatography using di-(2-ethylhexyl)phosphoric acid (D2EHPA) as extractant was chosen to prepare extra pure curium and californium preparations. In order to identify the optimal conditions of Cm-Cf separation and to remove impurities from them (reagent and other impurities), investigations were performed into the effect of impurities (Na+, Ca2+, Al3+, Fe2+, Fe3+ taken as example), extractant and eluent concentration and solution flow rate on the efficiency of mutual purification of Cm and Cf. Both theoretical and experimental estimations were made of the maximum concentration at which the impurities do not affect the process. The conditions chosen allow mutual purification of milligram amounts of Cm and Cf from impurity elements at E(pur) =102 - 103 during a single chromatographic cycle (E(pur) =>103) using a column with 5 - 10 cm3 volume. In this case the production yield exceeds 98%. The purification of milligram amounts of curium and californium from fission products (lanthanides in general, cerium in particular) was performed in D2EHPA-decane-PbO2-HNO3 and D2EHPA-decane-DTPA-H3-Cit extraction chromatography systems. In order to establish the optimal conditions, the effect of [D2EHPA] and eluent on the mutual purification of Cm and Cf and on their purification from cerium and impurity elements was studied in the D2EHPA-decane-PbO2-HNO3 system. During a single chromatographic cycle the mutual purification factors of TPE and of their purification from impurity cations achieve 102-103, from cerium - E(pur) > 10. In the D2EHPA-decane-DTPA-H3Cit system, the effect of concentration of extractant and eluent pH on the efficiency of Cm and Cf purification from lanthanides was

  7. NTC 249 Course Tutorial/ Indigohelp

    OpenAIRE

    raju

    2015-01-01

    For more classes visit www.indigohelp.com   NTC 249 Week 1 DQ 1   NTC 249 Week 1 DQ 2   NTC 249 Week 1 DQ 3   NTC 249 Week 1 Summary   NTC 249 Week 2 DQ 1   NTC 249 Week 2 DQ 2   NTC 249 Week 2 DQ 3   NTC 249 Week 2 Summary   NTC 249 Week 2 Team Assignment Network Design for Acme Manufacturing Network Draft   NTC 249 Week 2 Individual Assignment OSI Model Paper...

  8. Californium Electrodepositions at Oak Ridge National Laboratory

    Energy Technology Data Exchange (ETDEWEB)

    Boll, Rose Ann [ORNL

    2015-01-01

    Electrodepositions of californium isotopes were successfully performed at Oak Ridge National Laboratory (ORNL) during the past year involving two different types of deposition solutions, ammonium acetate (NH4C2H3O2) and isobutanol ((CH3)2CHCH2OH). A californium product that was decay enriched in 251Cf was recovered for use in super-heavy element (SHE) research. This neutron-rich isotope, 251Cf, provides target material for SHE research for the potential discovery of heavier isotopes of Z=118. The californium material was recovered from aged 252Cf neutron sources in storage at ORNL. These sources have decayed for over 30 years, thus providing material with a very high 251Cf-to-252Cf ratio. After the source capsules were opened, the californium was purified and then electrodeposited using the isobutanol method onto thin titanium foils for use in an accelerator at the Joint Institute for Nuclear Research in Dubna, Russia. Another deposition method, ammonium acetate, was used to produce a deposition containing 1.7 0.1 Ci of 252Cf onto a stainless steel substrate. This was the largest single electrodeposition of 252Cf ever prepared. The 252Cf material was initially purified using traditional ion exchange media, such as AG50-AHIB and AG50-HCl, and further purified using a TEVA-NH4SCN system to remove any lanthanides, resulting in the recovery of 3.6 0.1 mg of purified 252Cf. The ammonium acetate deposition was run with a current of 1.0 amp, resulting in a 91.5% deposition yield. Purification and handling of the highly radioactive californium material created additional challenges in the production of these sources.

  9. Historical review of californium-252 discovery and development

    International Nuclear Information System (INIS)

    This paper discusses the discovery and history of californium 252. This isotope may be synthesized by irradiating plutonium 239, plutonium 242, americium 243, or curium 244 with neutrons in a nuclear reactor. Various experiments and inventions involving 252Cf conducted at the Savannah River Plant are discussed. The evolution of radiotherapy using californium 252 is reviewed

  10. Spontaneous Partitioning of Californium from Curium: Curious Cases from the Crystallization of Curium Coordination Complexes

    Energy Technology Data Exchange (ETDEWEB)

    Cary, Samantha K.; Silver, Mark A.; Liu, Guokui; Wang, Jamie C.; Bogart, Justin A.; Stritzinger, Jared T.; Arico, Alexandra A.; Hanson, Kenneth; Schelter, Eric J.; Albrecht-Schmitt, Thomas E.

    2015-12-07

    The reaction of 248CmCl3 with excess 2,6-pyridinedicarboxylic acid (DPA) under mild solvothermal conditions results in crystallization of the tris-chelate complex Cm(HDPA)3·H2O. Approximately half of the curium remains in solution at the end of this process, and evaporation of the mother liquor results in crystallization of the bis-chelate complex [Cm(HDPA)- (H2DPA)(H2O)2Cl]Cl·2H2O. 248Cm is the daughter of the α decay of 252Cf and is extracted in high purity from this parent. However, trace amounts of 249,250,251Cf are still present in all samples of 248Cm. During the crystallization of Cm(HDPA)3·H2O and [Cm(HDPA)(H2DPA)(H2O)2Cl]Cl·2H2O, californium(III) spontaneously separates itself from the curium complexes and is found doped within crystals of DPA in the form of Cf(HDPA)3. These results add to the growing body of evidence that the chemistry of californium is fundamentally different from that of earlier actinides.

  11. Californium-252: a remarkable versatile radioisotope

    Energy Technology Data Exchange (ETDEWEB)

    Osborne-Lee, I.W.; Alexander, C.W.

    1995-10-10

    A product of the nuclear age, Californium-252 ({sup 252}Cf) has found many applications in medicine, scientific research, industry, and nuclear science education. Californium-252 is unique as a neutron source in that it provides a highly concentrated flux and extremely reliable neutron spectrum from a very small assembly. During the past 40 years, {sup 252}Cf has been applied with great success to cancer therapy, neutron radiography of objects ranging from flowers to entire aircraft, startup sources for nuclear reactors, fission activation for quality analysis of all commercial nuclear fuel, and many other beneficial uses, some of which are now ready for further growth. Californium-252 is produced in the High Flux Isotope Reactor (HFIR) and processed in the Radiochemical Engineering Development Center (REDC), both of which are located at the Oak Ridge National Laboratory (ORNL) in Oak Ridge, Tennessee. The REDC/HFIR facility is virtually the sole supplier of {sup 252}Cf in the western world and is the major supplier worldwide. Extensive exploitation of this product was made possible through the {sup 252}Cf Market Evaluation Program, sponsored by the United States Department of Energy (DOE) [then the Atomic Energy Commission (AEC) and later the Energy Research and Development Administration (ERDA)]. This program included training series, demonstration centers, seminars, and a liberal loan policy for fabricated sources. The Market Evaluation Program was instituted, in part, to determine if large-quantity production capability was required at the Savannah River Laboratory (SRL). Because of the nature of the product and the means by which it is produced, {sup 252}Cf can be produced only in government-owned facilities. It is evident at this time that the Oak Ridge research facility can meet present and projected near-term requirements. The production, shipment, and sales history of {sup 252}Cf from ORNL is summarized herein.

  12. Californium-252: a remarkable versatile radioisotope

    International Nuclear Information System (INIS)

    A product of the nuclear age, Californium-252 (252Cf) has found many applications in medicine, scientific research, industry, and nuclear science education. Californium-252 is unique as a neutron source in that it provides a highly concentrated flux and extremely reliable neutron spectrum from a very small assembly. During the past 40 years, 252Cf has been applied with great success to cancer therapy, neutron radiography of objects ranging from flowers to entire aircraft, startup sources for nuclear reactors, fission activation for quality analysis of all commercial nuclear fuel, and many other beneficial uses, some of which are now ready for further growth. Californium-252 is produced in the High Flux Isotope Reactor (HFIR) and processed in the Radiochemical Engineering Development Center (REDC), both of which are located at the Oak Ridge National Laboratory (ORNL) in Oak Ridge, Tennessee. The REDC/HFIR facility is virtually the sole supplier of 252Cf in the western world and is the major supplier worldwide. Extensive exploitation of this product was made possible through the 252Cf Market Evaluation Program, sponsored by the United States Department of Energy (DOE) [then the Atomic Energy Commission (AEC) and later the Energy Research and Development Administration (ERDA)]. This program included training series, demonstration centers, seminars, and a liberal loan policy for fabricated sources. The Market Evaluation Program was instituted, in part, to determine if large-quantity production capability was required at the Savannah River Laboratory (SRL). Because of the nature of the product and the means by which it is produced, 252Cf can be produced only in government-owned facilities. It is evident at this time that the Oak Ridge research facility can meet present and projected near-term requirements. The production, shipment, and sales history of 252Cf from ORNL is summarized herein

  13. Californium-252 Neutron Therapy in China

    International Nuclear Information System (INIS)

    Californium-252 brachytherapy, believed to be the most successful source for neutron therapy, gives most of the cures as well as long-term and complication-free survivals. Chinese radiation oncologists were interested in californium neutron therapy (Cf-NT) in the early 1980s, but 252Cf sources for medical use were not available in China until 1992 when a californium joint venture was established by the China Institute of Atomic Energy (Beijing) and the Research Institute for Nuclear Reactors (Dimitrovgrad) of Russia. In 1995, 25 seeds of 252Cf with a strength of 3 μg each were sent to China for preclinical investigation. Three years later, a high dose rate (HDR) 252Cf source was imported and transferred into a home-made remote after-loader for intracavitary treatment in Chongqing, and a clinical trail was started in February 1999. This is the first time that Cf-NT was performed for cancer patients in China. Since then, Cf-NT in China has developed rapidly. It is estimated that one-tenth of those radiation oncology centers with brachytherapy practice will be equipped with californium units in 5 yr. That means more than 30 units will be in use in hospitals. That is significant compared with other countries, but it is just one, on average, for each province or one per 40 million people in China. Progress also has been achieved in the 252Cf treatment delivery equipment. Preliminary clinical trails showed complete response observed in all cases treated, with a rapid clearance of tumors and mild reactions in normal tissues. The short-term results are quite encouraging. To deal with problems due to the demand for Cf-NT in China, attention should be paid to the following particulars: (1) A high-strength miniature source is needed for HDR/MDR interstitial therapy to extend the Cf-NT coverage. (2) Basic work on radiophysics and radiobiology needs to be done, including source calibration, clinical dosimetry, clinical RBE determination, and Cf-NT quality assurance

  14. Californium-252 sales and loans at Oak Ridge National Laboratory

    International Nuclear Information System (INIS)

    The production and distribution in the United States of 252Cf has recently been consolidated at the Oak Ridge National Laboratory (ORNL). The 252Cf Industrial Sales/Loan Program and the 252Cf University Load Program, which were formerly located at the Savannah River Plant (SRP), have been combined with the californium production and distribution activities of the Transuranium Element Production Program at ORNL. Californium-252 is sold to commercial users in the form of bulk californium oxide, palladium-californium alloy pellets, or alloy wires. Neutron source capsules, which are fabricated for loans to DOE or other US government agencies, are still available in all forms previously available. The consolidation of all 252Cf distribution activities at the production site is expected to result in better service to users. In particular, customers for neutrons sources will be ale to select from a wider range of neutron source forms, including custom designs, through a single contact point

  15. Californium-252 encapsulation at the Savannah River Laboratory

    International Nuclear Information System (INIS)

    More than 1 g of the neutron-emitting isotope californium-252 has been encapsulated at SRL for worldwide medical, industrial, and research uses. Bulk sales packages have been prepared for the USDOE sales program since 1971. Doubly-encapsulated sources have been prepared for USDOE's market evaluation program since 1968. Californium-252 sources for loan and sales packages satisfy the criteria for Special Form Radioactive Material. Encapsulation is performed in special neutron-shielded containment facilities at SRL. Development of improved source and shipping package designs and processes is continuing. 17 figures

  16. Production, distribution and applications of californium-252 neutron sources

    International Nuclear Information System (INIS)

    The radioisotope 252Cf is routinely encapsulated into compact, portable, intense neutron sources with a 2.6-yr half-life. A source the size of a person's little finger can emit up to 1011 neutrons s-1. Californium-252 is used commercially as a reliable, cost-effective neutron source for prompt gamma neutron activation analysis (PGNAA) of coal, cement and minerals, as well as for detection and identification of explosives, land mines and unexploded military ordnance. Other uses are neutron radiography, nuclear waste assays, reactor start-up sources, calibration standards and cancer therapy. The inherent safety of source encapsulations is demonstrated by 30 yr of experience and by US Bureau of Mines tests of source survivability during explosions. The production and distribution center for the US Department of Energy (DOE) Californium Program is the Radiochemical Engineering Development Center (REDC) at Oak Ridge National Laboratory (ORNL). DOE sells 252Cf to commercial reencapsulators domestically and internationally. Sealed 252Cf sources are also available for loan to agencies and subcontractors of the US government and to universities for educational, research and medical applications. The REDC has established the Californium User Facility (CUF) for Neutron Science to make its large inventory of 252Cf sources available to researchers for irradiations inside uncontaminated hot cells. Experiments at the CUF include a land mine detection system, neutron damage testing of solid-state detectors, irradiation of human cancer cells for boron neutron capture therapy experiments and irradiation of rice to induce genetic mutations

  17. Production, distribution and applications of californium-252 neutron sources.

    Science.gov (United States)

    Martin, R C; Knauer, J B; Balo, P A

    2000-01-01

    The radioisotope 252Cf is routinely encapsulated into compact, portable, intense neutron sources with a 2.6-yr half-life. A source the size of a person's little finger can emit up to 10(11) neutrons s(-1). Californium-252 is used commercially as a reliable, cost-effective neutron source for prompt gamma neutron activation analysis (PGNAA) of coal, cement and minerals, as well as for detection and identification of explosives, land mines and unexploded military ordinance. Other uses are neutron radiography, nuclear waste assays, reactor start-up sources, calibration standards and cancer therapy. The inherent safety of source encapsulations is demonstrated by 30 yr of experience and by US Bureau of Mines tests of source survivability during explosions. The production and distribution center for the US Department of Energy (DOE) Californium Program is the Radiochemical Engineering Development Center (REDC) at Oak Ridge National Laboratory (ORNL). DOE sells 252Cf to commercial reencapsulators domestically and internationally. Sealed 252Cf sources are also available for loan to agencies and subcontractors of the US government and to universities for educational, research and medical applications. The REDC has established the Californium User Facility (CUF) for Neutron Science to make its large inventory of 252Cf sources available to researchers for irradiations inside uncontaminated hot cells. Experiments at the CUF include a land mine detection system, neutron damage testing of solid-state detectors, irradiation of human cancer cells for boron neutron capture therapy experiments and irradiation of rice to induce genetic mutations. PMID:11003521

  18. Production, Distribution, and Applications of Californium-252 Neutron Sources

    Energy Technology Data Exchange (ETDEWEB)

    Balo, P.A.; Knauer, J.B.; Martin, R.C.

    1999-10-03

    The radioisotope {sup 252}Cf is routinely encapsulated into compact, portable, intense neutron sources with a 2.6-year half-life. A source the size of a person's little finger can emit up to 10{sup 11} neutrons/s. Californium-252 is used commercially as a reliable, cost-effective neutron source for prompt gamma neutron activation analysis (PGNAA) of coal, cement, and minerals, as well as for detection and identification of explosives, laud mines, and unexploded military ordnance. Other uses are neutron radiography, nuclear waste assays, reactor start-up sources, calibration standards, and cancer therapy. The inherent safety of source encapsulations is demonstrated by 30 years of experience and by U.S. Bureau of Mines tests of source survivability during explosions. The production and distribution center for the U. S Department of Energy (DOE) Californium Program is the Radiochemical Engineering Development Center (REDC) at Oak Ridge National Laboratory (ORNL). DOE sells The radioisotope {sup 252}Cf is routinely encapsulated into compact, portable, intense neutron sources with a 2.6- year half-life. A source the size of a person's little finger can emit up to 10 neutrons/s. Californium-252 is used commercially as a reliable, cost-effective neutron source for prompt gamma neutron activation analysis (PGNAA) of coal, cement, and minerals, as well as for detection and identification of explosives, laud mines, and unexploded military ordnance. Other uses are neutron radiography, nuclear waste assays, reactor start-up sources, calibration standards, and cancer therapy. The inherent safety of source encapsulations is demonstrated by 30 years of experience and by U.S. Bureau of Mines tests of source survivability during explosions. The production and distribution center for the U. S Department of Energy (DOE) Californium Program is the Radiochemical Engineering Development Center (REDC) at Oak Ridge National Laboratory(ORNL). DOE sells {sup 252}Cf to commercial

  19. 32 CFR 249.4 - Policy.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false Policy. 249.4 Section 249.4 National Defense... OF DoD-RELATED SCIENTIFIC AND TECHNICAL PAPERS AT MEETINGS § 249.4 Policy. It is DoD policy to: (a... understanding in accordance with foreign disclosure policies of the Department of Defense. Presentation of...

  20. 32 CFR 249.6 - Responsibilities.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false Responsibilities. 249.6 Section 249.6 National Defense Department of Defense (Continued) OFFICE OF THE SECRETARY OF DEFENSE (CONTINUED) MISCELLANEOUS PRESENTATION OF DoD-RELATED SCIENTIFIC AND TECHNICAL PAPERS AT MEETINGS § 249.6 Responsibilities. (a) The...

  1. 46 CFR 249.4 - Eligibility.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 8 2010-10-01 2010-10-01 false Eligibility. 249.4 Section 249.4 Shipping MARITIME ADMINISTRATION, DEPARTMENT OF TRANSPORTATION REGULATIONS AFFECTING SUBSIDIZED VESSELS AND OPERATORS APPROVAL OF UNDERWRITERS FOR MARINE HULL INSURANCE § 249.4 Eligibility. In General. All required marine hull insurance...

  2. 46 CFR 249.12 - Waivers.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 8 2010-10-01 2010-10-01 false Waivers. 249.12 Section 249.12 Shipping MARITIME ADMINISTRATION, DEPARTMENT OF TRANSPORTATION REGULATIONS AFFECTING SUBSIDIZED VESSELS AND OPERATORS APPROVAL OF UNDERWRITERS FOR MARINE HULL INSURANCE § 249.12 Waivers. The provision of this part may be waived in...

  3. 46 CFR 249.11 - Confidentiality.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 8 2010-10-01 2010-10-01 false Confidentiality. 249.11 Section 249.11 Shipping MARITIME ADMINISTRATION, DEPARTMENT OF TRANSPORTATION REGULATIONS AFFECTING SUBSIDIZED VESSELS AND OPERATORS APPROVAL OF UNDERWRITERS FOR MARINE HULL INSURANCE § 249.11 Confidentiality. (a) If the data submitted under this...

  4. Prompt neutron spectrum of the spontaneous fission of californium-252

    International Nuclear Information System (INIS)

    The californium-252 spontaneous fission neutron spectrum was measured in the energy range of 0.01 to 10 MeV by the time-of-flight technique using various neutron detectors. The measurements of 252Cf neutron spectrum at energies of 0.01 to 5 MeV were performed as a function of fission fragment kinetic energy. The mean neutron spectrum energy in the range of 0.7 to 10 MeV was found from the results of measurements. The irregularity in the 252Cf neutron spectrum in the neutron energy range of less than 0.7 MeV compared to theoretical values is discussed. The mechanism of 252Cf neutron emission is also discussed on the basis of neutron yield angle measurements. 12 references

  5. Dicty_cDB: SLB249 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLB249 (Link to dictyBase) - - - Contig-U16455-1 SLB249Z (Link... to Original site) - - SLB249Z 727 - - - - Show SLB249 Library SL (Link to library) Clone ID SLB249 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLB2-C/SLB249Q.Seq.d/ Representative seq. ID SLB24...9Z (Link to Original site) Representative DNA sequence >SLB249 (SLB249Q) /CSM/SL/SLB2-C/SLB249Q.Seq.d/ XXXXX...NA Score E Sequences producing significant alignments: (bits) Value SLB249 (SLB249Q) /CSM/SL/SLB2-C/SLB249Q.

  6. 7 CFR 249.13 - Program income.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Program income. 249.13 Section 249.13 Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE.... Fines, penalties or assessments paid by local agencies or farmers, farmers' markets, roadside...

  7. 7 CFR 249.19 - Investigations.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Investigations. 249.19 Section 249.19 Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE... appropriate, a review of pertinent practices and policies of any State and local agency, the...

  8. 46 CFR 249.6 - Application procedures.

    Science.gov (United States)

    2010-10-01

    ... OPERATORS APPROVAL OF UNDERWRITERS FOR MARINE HULL INSURANCE § 249.6 Application procedures. (a) MARAD may grant specific approval for underwriters described in § 249.5(c) to participate in the writing of marine hull insurance on MARAD program vessels, only in advance of any actual placement. (b) Only...

  9. 7 CFR 249.9 - Nutrition education.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Nutrition education. 249.9 Section 249.9 Agriculture... Nutrition education. (a) Goal. Nutrition education shall emphasize the relationship of proper nutrition to... agency shall integrate nutrition education into SFMNP operations and may satisfy nutrition...

  10. Separation of californium from actinides and lanthanides in aqueous solution by electrochemical formation of amalgams

    International Nuclear Information System (INIS)

    The electrochemical reduction of transneptunium elements (Pu to Cf) and rare earths (Eu, Tm) from aqueous complexing solutions to amalgams was studied over a wide range of cathodic potentials in order to achieve optimal separation of californium. The reduction in acetate media (pH 4.5-4.6) at potentials around -1.7 to -1.9 V1 leads to a quantitative extraction of californium into the mercury phase, while more negative potentials are required for the reduction of the lighter transuranium elements and of the lanthanides. Hence, the optimal conditions for the separation of californium from the investigated actinides and lanthanides were determined. Separation factors α between 25 and 90 were found except in the case of Cf/Eu, where poor values (α varying from 7 to 12) were observed. More negative cathodic potentials decrease the selectivity of the reduction process. A similar study with lithium citrate solutions (pH ∝6) shows that satisfactory separation of californium from lighter and heavier actinides is achievable. A separation factor of 88 is obtained for Cf/Am at -1.98 V. The anodic stripping of mixed amalgams (Pu, Am, Cm, Bk, Tm and Cf) Hg in nitric and acetic acid soultions at potentials ranging from +0.1 to -0.7 V proceeds slowly and proved to be ineffective for the separation of californium from light actinides under conditions described. (orig.)

  11. On-line slurry analyses by californium-252

    International Nuclear Information System (INIS)

    In chemical processing technology on-line activation methods gain an increasing importance for process monitoring and control. A method is described according to which the different fluorspar contents at various strategic points of a flotation plant are determined through neutron activation by 100 μg californium-252. A continuous analytical system for onstream process control of slurries was designed and constructed. A compact facility, called SUSAC, allows continuous application of the method on an industrial scale. The main components of the SUSAC facility are the irradiation and measurement cells. The cells are equipped with multistage countercurrent stirrers ensuring a proper radial and vertical distribution of the sample. The hollow shaft of the stirrer of the irradiation cell houses the Cf-source. The NaI-detector has been installed in a recess in the bottom of the measuring cell. The volumes are 9 dm3 for the irradiation cell, 7.5 dm3 for the measuring cell, 1/2 dm3 for the vonnection line and 4 dm3 for feed and drainage lines including the pump. Investigations on the following topics are discussed: selection of stirrers, residence time, flow rate, pulp density, calibration measurements. (T.G.)

  12. Biomedical neutron research at the Californium User Facility for neutron science

    International Nuclear Information System (INIS)

    The Californium User Facility for Neutron Science has been established at Oak Ridge National Laboratory (ORNL). The Californium User Facility (CUF) is a part of the larger Californium Facility, which fabricates and stores compact 252Cf neutron sources for worldwide distribution. The CUF can provide a cost-effective option for research with 252Cf sources. Three projects at the CUF that demonstrate the versatility of 252Cf for biological and biomedical neutron-based research are described: future establishment of a 252Cf-based neutron activation analysis system, ongoing work to produce miniature high-intensity, remotely afterloaded 252Cf sources for tumor therapy, and a recent experiment that irradiated living human lung cancer cells impregnated with experimental boron compounds to test their effectiveness for boron neutron capture therapy

  13. Biomedical neutron research at the Californium User Facility for neutron science

    Energy Technology Data Exchange (ETDEWEB)

    Martin, R.C. [Oak Ridge National Lab., TN (United States); Byrne, T.E. [Roane State Community College, Harriman, TN (United States); Miller, L.F. [Univ. of Tennessee, Knoxville, TN (United States)

    1997-04-01

    The Californium User Facility for Neutron Science has been established at Oak Ridge National Laboratory (ORNL). The Californium User Facility (CUF) is a part of the larger Californium Facility, which fabricates and stores compact {sup 252}Cf neutron sources for worldwide distribution. The CUF can provide a cost-effective option for research with {sup 252}Cf sources. Three projects at the CUF that demonstrate the versatility of {sup 252}Cf for biological and biomedical neutron-based research are described: future establishment of a {sup 252}Cf-based neutron activation analysis system, ongoing work to produce miniature high-intensity, remotely afterloaded {sup 252}Cf sources for tumor therapy, and a recent experiment that irradiated living human lung cancer cells impregnated with experimental boron compounds to test their effectiveness for boron neutron capture therapy.

  14. Proposed Californium-252 User Facility for Neutron Science at Oak Ridge National Laboratory

    International Nuclear Information System (INIS)

    The Radiochemical Engineering Development Center (REDC) at ORNL has petitioned to establish a Californium-252 User Facility for Neutron Science for academic, industrial, and governmental researchers. The REDC Californium Facility (CF) stores the national inventory of sealed 252Cf neutron source for university and research loans. Within the CF, the 252Cf storage pool and two uncontaminated hot cells currently in service for the Californium Program will form the physical basis for the User Facility. Relevant applications include dosimetry and experiments for neutron tumor therapy; fast and thermal neutron activation analysis of materials; experimental configurations for prompt gamma neutron activation analysis; neutron shielding and material damage studies; and hardness testing of radiation detectors, cameras, and electronics. A formal User Facility simplifies working arrangements and agreements between US DOE facilities, academia, and commercial interests

  15. Emergence of californium as the second transitional element in the actinide series.

    Science.gov (United States)

    Cary, Samantha K; Vasiliu, Monica; Baumbach, Ryan E; Stritzinger, Jared T; Green, Thomas D; Diefenbach, Kariem; Cross, Justin N; Knappenberger, Kenneth L; Liu, Guokui; Silver, Mark A; DePrince, A Eugene; Polinski, Matthew J; Van Cleve, Shelley M; House, Jane H; Kikugawa, Naoki; Gallagher, Andrew; Arico, Alexandra A; Dixon, David A; Albrecht-Schmitt, Thomas E

    2015-01-01

    A break in periodicity occurs in the actinide series between plutonium and americium as the result of the localization of 5f electrons. The subsequent chemistry of later actinides is thought to closely parallel lanthanides in that bonding is expected to be ionic and complexation should not substantially alter the electronic structure of the metal ions. Here we demonstrate that ligation of californium(III) by a pyridine derivative results in significant deviations in the properties of the resultant complex with respect to that predicted for the free ion. We expand on this by characterizing the americium and curium analogues for comparison, and show that these pronounced effects result from a second transition in periodicity in the actinide series that occurs, in part, because of the stabilization of the divalent oxidation state. The metastability of californium(II) is responsible for many of the unusual properties of californium including the green photoluminescence. PMID:25880116

  16. Dicty_cDB: SSA249 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available utative transporter protein SSA662 (ssa662) mRNA, complete cds. 40 9e-04 2 AC1155...SS (Link to library) SSA249 (Link to dictyBase) - - - Contig-U07966-1 - (Link to Original site) SSA...249F 236 - - - - - - Show SSA249 Library SS (Link to library) Clone ID SSA249 (Link to dicty...iol.tsukuba.ac.jp/CSM/SS/SSA2-C/SSA249Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >SSA249 (SSA249Q) /CSM/SS/SSA2-C/SSA249Q.Seq.d/ ACTTATCGTCACAATTC

  17. Dicty_cDB: CHR249 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHR249 (Link to dictyBase) - - - Contig-U16497-1 - (Link to Original site) - - CHR...249Z 694 - - - - Show CHR249 Library CH (Link to library) Clone ID CHR249 (Link to dicty...iol.tsukuba.ac.jp/CSM/CH/CHR2-C/CHR249Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >CHR249 (CHR249Q) /CSM/CH/CHR2-C/CHR249Q.Seq.d/ XXXXXXXXXXAAATGGT...xxixknqemfnsvvqiiihfmnkiq Frame C: ---w*yfphtn*qmfrlydl*ssfw*l*firxrlprw**myyqcl*ik**cpwcmyklns *mrcyqh**mypill**shr

  18. Fissile analysis of Hanford waste using Californium Multiplier/Delayed Neutron Counter system

    International Nuclear Information System (INIS)

    Measurement of low-level (10 ng/g or lower) fissile material (mainly plutonium) in Hanford waste and process samples is becoming increasingly important. A system has been designed consisting of a Californium Multiplier (CFX) and a Delayed Neutron Counter (DNC) to characterize these samples. This report describes hardware and analytical capability of the CFX/DNC system

  19. Study of the shielding for spontaneous fission sources of Californium-252

    International Nuclear Information System (INIS)

    A shielding study is made to attenuate, until maximum permissible levels, the neutrons radiation and photons emitted by spontaneous fission coming from a source of Californium-252. The compound package by a database (Library DLC-23) and the ANISNW code is used, in it version for personal computer. (Author)

  20. 7 CFR 249.3 - Administration.

    Science.gov (United States)

    2010-01-01

    ... identify and certify eligible SFMNP participants, provide program information and nutrition education to... CHILD NUTRITION PROGRAMS SENIOR FARMERS' MARKET NUTRITION PROGRAM (SFMNP) General § 249.3 Administration...' Market Nutrition Program (FMNP), one consolidated State Plan may be submitted for both programs,...

  1. 46 CFR 249.2 - Policy.

    Science.gov (United States)

    2010-10-01

    ... UNDERWRITERS FOR MARINE HULL INSURANCE § 249.2 Policy. (a) It is the policy of the Maritime Administration (MARAD) that companies subject to requirements for the placement of marine hull insurance shall be... vessels with ODS or Title XI obligation guarantees to allow the American marine insurance market...

  2. 46 CFR 249.1 - Purpose.

    Science.gov (United States)

    2010-10-01

    ... UNDERWRITERS FOR MARINE HULL INSURANCE § 249.1 Purpose. This part prescribes certain regulations governing the placement of marine hull insurance on vessels built or operated with subsidy or covered by vessel obligation guarantees issued pursuant to Title XI of the Merchant Marine Act, 1936, as amended (Act). (46 U.S.C....

  3. 46 CFR 249.7 - Approval.

    Science.gov (United States)

    2010-10-01

    ... UNDERWRITERS FOR MARINE HULL INSURANCE § 249.7 Approval. (a) Approval of the applicant will be based upon an.... hull insurance market, if U.S. insurers are denied similar access to the hull insurance market in the... to MARAD's attention any discriminatory laws or practices relating to the placement of marine...

  4. 46 CFR 249.5 - Eligibility criteria.

    Science.gov (United States)

    2010-10-01

    ... OPERATORS APPROVAL OF UNDERWRITERS FOR MARINE HULL INSURANCE § 249.5 Eligibility criteria. (a) U.S...'s Insurance Reports, and the amount of insurance does not exceed the limitation on risk prescribed... paragraphs (b) (1) and (2) of this section, may also be eligible to participate in the writing of marine...

  5. Californium (252Cf) and its use as neutron source in science medicine and technology

    International Nuclear Information System (INIS)

    The application of radionuclides in science and nuclear techniques basically is related to unstable isotopes, which are produced from stable elements in nuclear reactor. Their specifications are various from view point of application . Using of physical and chemical properties of radionuclides in chemistry, for with marking the organic compounds we can exactly explain the mechanism of chemical reactions in medical, biology and bio-chemistry. In these cases the behaviour of radionuclides is very important and the selection of the suitable radionuclides is determined between the elements for investigation aims. The special specification of radio-nuclides analysis such as, half-life, kind of ray and energy should be considered with an special accuracy as well as the laws security regulations from view point of ray-protection should be completely observed mean time working these radio-nuclides. It should be considered that application of radio-isotopes is very important from their special specifications point of view. Applying the radionuclides from technology point of view in sciences and nuclear techniques aren't only limited to three analyses of α, β, and γ, but we can use the share of neutron which are produced from spli ting of heavy nucleus such as Californium252 as a neutron source in the depths of the sea and also determining the concentration of low quantity elements on moon and other spheres. The radioisotope of Californium252 is a neutron useful radiator for investigation in nuclear medical and technology because of automatically rapid split to 3.2% Californium252 radiates 1.34 * 109N/m in each mil/GH which suitable replacement for neutron sources based on (a, n) reaction, for example, Radium-Brellium or Amersium-Brellium. The energy distribution of radiated neutrons from analyzing of Californium252 like the spectrum of neutron which is produced from splitting of U235, Pu239 nucleus has the maximum energy in quantity, En=1 MeV in the range of 1.5 MeV. The

  6. Contribution to clinical dosimetry of californium 252 sources used at Gustave Roussy institute

    International Nuclear Information System (INIS)

    The main characteristics of californium 252 sources are presented in the first part of the report. Dose measurements around Californium sources were performed with a pair of ionization multiplication chambers: the first one has an Aluminium wall and is filled with Argon, the second one a plastic tissue-equivalent gas. A set of experiments was performed in order to investigate the relative influence of beta rays on the response of both chambers. Besides the experimental work a computer program was written to calculate the dose distribution around the actual sources made of a series of small active sources placed in catheters. Theoretical data around small sources can be found in the litterature. The comparison between experimental results and theoretical ones has shown a good agreement. The computer program will be included as a sub-routine in the more general computer program used for patients treated with interstitial therapy

  7. Safety Analysis Report for Packaging (SARP) of the Oak Ridge National Laboratory TRU Californium Shipping Container

    International Nuclear Information System (INIS)

    An analytical evaluation of the Oak Ridge National Laboratory TRU Californium Shipping Container was made in order to demonstrate its compliance with the regulations governing off-site shipment of packages that contain radioactive material. The evaluation encompassed five primary categories: structural integrity, thermal resistance, radiation shielding, nuclear criticality safety, and quality assurance. The results of this evaluation demonstrate that the container complies with the applicable regulations

  8. Emergence of californium as the second transitional element in the actinide series

    OpenAIRE

    Cary, Samantha K.; Vasiliu, Monica; Baumbach, Ryan E.; Stritzinger, Jared T.; GREEN, THOMAS D.; Diefenbach, Kariem; Cross, Justin N.; Knappenberger, Kenneth L.; Liu, Guokui; Silver, Mark A.; DePrince, A. Eugene; Polinski, Matthew J.; Van Cleve, Shelley M.; House, Jane H.; Kikugawa, Naoki

    2015-01-01

    A break in periodicity occurs in the actinide series between plutonium and americium as the result of the localization of 5f electrons. The subsequent chemistry of later actinides is thought to closely parallel lanthanides in that bonding is expected to be ionic and complexation should not substantially alter the electronic structure of the metal ions. Here we demonstrate that ligation of californium(III) by a pyridine derivative results in significant deviations in the properties of the resu...

  9. 7 CFR 58.249 - Instant nonfat dry milk.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Instant nonfat dry milk. 58.249 Section 58.249... Products Bearing Usda Official Identification § 58.249 Instant nonfat dry milk. (a) Only instant nonfat dry milk manufactured and packaged in accordance with the requirements of this part and with the...

  10. 7 CFR 249.11 - Financial management system.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Financial management system. 249.11 Section 249.11... § 249.11 Financial management system. (a) Disclosure of expenditures. The State agency must maintain a financial management system that provides accurate, current and complete disclosure of the financial...

  11. 12 CFR 303.249 - Management official interlocks.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 4 2010-01-01 2010-01-01 false Management official interlocks. 303.249 Section 303.249 Banks and Banking FEDERAL DEPOSIT INSURANCE CORPORATION PROCEDURE AND RULES OF PRACTICE FILING PROCEDURES Other Filings § 303.249 Management official interlocks. (a) Scope. This section contains the procedures to be followed by an...

  12. 46 CFR 249.3 - Amounts of insurance.

    Science.gov (United States)

    2010-10-01

    ... OPERATORS APPROVAL OF UNDERWRITERS FOR MARINE HULL INSURANCE § 249.3 Amounts of insurance. MARAD will inform... 46 Shipping 8 2010-10-01 2010-10-01 false Amounts of insurance. 249.3 Section 249.3 Shipping... initial placement and at least annually thereafter, of the minimum amount of insurance required to...

  13. 46 CFR 249.8 - Limitation on risk.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 8 2010-10-01 2010-10-01 false Limitation on risk. 249.8 Section 249.8 Shipping MARITIME ADMINISTRATION, DEPARTMENT OF TRANSPORTATION REGULATIONS AFFECTING SUBSIDIZED VESSELS AND OPERATORS APPROVAL OF UNDERWRITERS FOR MARINE HULL INSURANCE § 249.8 Limitation on risk. (a)...

  14. 46 CFR 249.10 - Non-discrimination policy.

    Science.gov (United States)

    2010-10-01

    ... OPERATORS APPROVAL OF UNDERWRITERS FOR MARINE HULL INSURANCE § 249.10 Non-discrimination policy. To... described in §§ 249.6(b)(3) and 249.7(a), MARAD seeks the assistance of the American marine insurance...) concerning the existence of any discriminatory laws or practices in the marine hull insurance market...

  15. Measurements of integral cross sections in the californium-252 fission neutron spectrum

    International Nuclear Information System (INIS)

    In a low-scattering arrangement cross sections averaged over the californium-252 spontaneous fission neutron spectrum were measured. The reactions 27Al(n,α)46Ti, 47Ti, 48Ti(n,p), 54Fe,56Fe(n,p), 58Ni(n,p), 64Zn(n,p), 115In(n,n') were studied in order to obtain a consistent set of threshold detectors used in fast neutron flux density measurements. Overall uncertainties between 2 and 2.5% could be achieved; corrections due to neutron scattering in source and samples are discussed

  16. Measurement of californium-252 gamma photons depth dose distribution in tissue equivalent material. Vol. 4

    International Nuclear Information System (INIS)

    Phantom of tissue equivalent material with and without bone was used measuring depth dose distribution of gamma-rays from californium-252 source. The source was positioned at center of perspex walled phantom. Depth dose measurements were recorded for X, Y and Z planes at different distances from source. TLD 700 was used for measuring the dose distribution. Results indicate that implantation of bone in tissue equivalent medium cause changes in the gamma depth dose distribution which varies according to variation in bone geometry. 9 figs

  17. 42 CFR 24.9 - Removal from the Service.

    Science.gov (United States)

    2010-10-01

    ... in making such answer; and (4) A written decision on the proposal. (c) The decision may be made by an... 42 Public Health 1 2010-10-01 2010-10-01 false Removal from the Service. 24.9 Section 24.9 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES PERSONNEL SENIOR...

  18. Dicty_cDB: CHP249 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHP249 (Link to dictyBase) - - - Contig-U14444-1 - (Link to Original site) ... XXXXKIFFLKK--- Translated Amino Acid sequence (All Frames ) Frame A: KKXKKKKKKKKKKKKKKKKKKKKKKKKKKKXKKKKXXXXX ...

  19. 75 FR 69870 - Delegation of Authority Under 18 U.S.C. 249

    Science.gov (United States)

    2010-11-16

    ... Part 0 Delegation of Authority Under 18 U.S.C. 249 AGENCY: Department of Justice. ACTION: Final rule... 18 U.S.C. 249, relating to hate crimes, to the Assistant Attorney General for the Civil Rights....S.C. 249. The Shepard-Byrd Act expressly provides that no prosecution under section 249 may...

  20. Fast and efficient charge breeding of the Californium rare isotope breeder upgrade electron beam ion source

    Energy Technology Data Exchange (ETDEWEB)

    Ostroumov, P. N., E-mail: ostroumov@anl.gov; Barcikowski, A.; Dickerson, C. A.; Perry, A.; Sharamentov, S. I.; Vondrasek, R. C.; Zinkann, G. P. [Argonne National Laboratory, Argonne, Illinois 60439 (United States); Pikin, A. I. [Brookhaven National Laboratory, Upton, New York 11973 (United States)

    2015-08-15

    The Electron Beam Ion Source (EBIS), developed to breed Californium Rare Isotope Breeder Upgrade (CARIBU) radioactive beams at Argonne Tandem Linac Accelerator System (ATLAS), is being tested off-line. A unique property of the EBIS is a combination of short breeding times, high repetition rates, and a large acceptance. Overall, we have implemented many innovative features during the design and construction of the CARIBU EBIS as compared to the existing EBIS breeders. The off-line charge breeding tests are being performed using a surface ionization source that produces singly charged cesium ions. The main goal of the off-line commissioning is to demonstrate stable operation of the EBIS at a 10 Hz repetition rate and a breeding efficiency into single charge state higher than 15%. These goals have been successfully achieved and exceeded. We have measured (20% ± 0.7%) breeding efficiency into the single charge state of 28+ cesium ions with the breeding time of 28 ms. In general, the current CARIBU EBIS operational parameters can provide charge breeding of any ions in the full mass range of periodic table with high efficiency, short breeding times, and sufficiently low charge-to-mass ratio, 1/6.3 for the heaviest masses, for further acceleration in ATLAS. In this paper, we discuss the parameters of the EBIS and the charge breeding results in a pulsed injection mode with repetition rates up to 10 Hz.

  1. Fast and efficient charge breeding of the Californium rare isotope breeder upgrade electron beam ion source

    International Nuclear Information System (INIS)

    The Electron Beam Ion Source (EBIS), developed to breed Californium Rare Isotope Breeder Upgrade (CARIBU) radioactive beams at Argonne Tandem Linac Accelerator System (ATLAS), is being tested off-line. A unique property of the EBIS is a combination of short breeding times, high repetition rates, and a large acceptance. Overall, we have implemented many innovative features during the design and construction of the CARIBU EBIS as compared to the existing EBIS breeders. The off-line charge breeding tests are being performed using a surface ionization source that produces singly charged cesium ions. The main goal of the off-line commissioning is to demonstrate stable operation of the EBIS at a 10 Hz repetition rate and a breeding efficiency into single charge state higher than 15%. These goals have been successfully achieved and exceeded. We have measured (20% ± 0.7%) breeding efficiency into the single charge state of 28+ cesium ions with the breeding time of 28 ms. In general, the current CARIBU EBIS operational parameters can provide charge breeding of any ions in the full mass range of periodic table with high efficiency, short breeding times, and sufficiently low charge-to-mass ratio, 1/6.3 for the heaviest masses, for further acceleration in ATLAS. In this paper, we discuss the parameters of the EBIS and the charge breeding results in a pulsed injection mode with repetition rates up to 10 Hz

  2. Design of a homogeneous subcritical nuclear reactor based on thorium with a source of californium 252

    International Nuclear Information System (INIS)

    Full text: One of the energy alternatives to fossil fuels which do not produce greenhouse gases is the nuclear energy. One of the drawbacks of this alternative is the generation of radioactive wastes of long half-life and its relation to the generation of nuclear materials to produce weapons of mass destruction. An option to these drawbacks of nuclear energy is to use Thorium as part of the nuclear fuel which it becomes in U233 when capturing neutrons, that is a fissile material. In this paper Monte Carlo methods were used to design a homogeneous subcritical reactor based on thorium. As neutron reflector graphite was used. The reactor core is homogeneous and is formed of 70% light water as moderator, 12% of enriched uranium UO2(NO3)4 and 18% of thorium Th(NO3)4 as fuel. To start the nuclear fission chain reaction an isotopic source of californium 252 was used with an intensity of 4.6 x 107 s-1. In the design the value of the effective multiplication factor, whose value turned out keff <1 was calculated. Also, the neutron spectra at different distances from the source and the total fluence were calculated, as well as the values of the ambient dose equivalent in the periphery of the reactor. (Author)

  3. Fast and efficient charge breeding of the Californium rare isotope breeder upgrade electron beam ion source.

    Science.gov (United States)

    Ostroumov, P N; Barcikowski, A; Dickerson, C A; Perry, A; Pikin, A I; Sharamentov, S I; Vondrasek, R C; Zinkann, G P

    2015-08-01

    The Electron Beam Ion Source (EBIS), developed to breed Californium Rare Isotope Breeder Upgrade (CARIBU) radioactive beams at Argonne Tandem Linac Accelerator System (ATLAS), is being tested off-line. A unique property of the EBIS is a combination of short breeding times, high repetition rates, and a large acceptance. Overall, we have implemented many innovative features during the design and construction of the CARIBU EBIS as compared to the existing EBIS breeders. The off-line charge breeding tests are being performed using a surface ionization source that produces singly charged cesium ions. The main goal of the off-line commissioning is to demonstrate stable operation of the EBIS at a 10 Hz repetition rate and a breeding efficiency into single charge state higher than 15%. These goals have been successfully achieved and exceeded. We have measured (20% ± 0.7%) breeding efficiency into the single charge state of 28+ cesium ions with the breeding time of 28 ms. In general, the current CARIBU EBIS operational parameters can provide charge breeding of any ions in the full mass range of periodic table with high efficiency, short breeding times, and sufficiently low charge-to-mass ratio, 1/6.3 for the heaviest masses, for further acceleration in ATLAS. In this paper, we discuss the parameters of the EBIS and the charge breeding results in a pulsed injection mode with repetition rates up to 10 Hz. PMID:26329185

  4. Neutron activation analysis at the Californium User Facility for Neutron Science

    International Nuclear Information System (INIS)

    The Californium User Facility (CUF) for Neutron Science has been established to provide 252Cf-based neutron irradiation services and research capabilities including neutron activation analysis (NAA). A major advantage of the CUF is its accessibility and controlled experimental conditions compared with those of a reactor environment The CUF maintains the world's largest inventory of compact 252Cf neutron sources. Neutron source intensities of ≤ 1011 neutrons/s are available for irradiations within a contamination-free hot cell, capable of providing thermal and fast neutron fluxes exceeding 108 cm-2 s-1 at the sample. Total flux of ≥109 cm-2 s-1 is feasible for large-volume irradiation rabbits within the 252Cf storage pool. Neutron and gamma transport calculations have been performed using the Monte Carlo transport code MCNP to estimate irradiation fluxes available for sample activation within the hot cell and storage pool and to design and optimize a prompt gamma NAA (PGNAA) configuration for large sample volumes. Confirmatory NAA irradiations have been performed within the pool. Gamma spectroscopy capabilities including PGNAA are being established within the CUF for sample analysis

  5. Long-term effects of an intracavitary treatment with californium-252 on normal tissue

    International Nuclear Information System (INIS)

    About one hundred fifty swine were exposed to either radium-226 or californium-252 sources in the uterine cervix to determine an RBE for both acute and long-term effects. That value for early changes in the tissues at risk in the treatment of cervical cancer was between 6.2 and 6.8. The incidence of complications increased with time after exposure, especially among animals treated with 252Cf. Analysis of rectal injury showed that ulceration occurred frequently within a year postexposure at doses between 1600 and 2400 rad calculated at 2 cm lateral to the source midline. Fat necrosis and smooth muscle atrophy, resulting in a local rectal stricture, were delayed changes observed in some animals. The lower ureter was the site for a greater frequency of complications than the GI tract. Ureteral stricture often occurred at doses of 1200 rad from 252Cf and 7000 rad from 226Ra. Observation of delayed effects in the uterine-cervix in animals held up to 4 years postexposure indicate that the RBE for 252Cf may be increased to a value as high as 18, while repair may have even decreased it to about 5.6 in the rectum. Fifty swine are still being observed for long-term effects after doses above 800 rad from 252Cf and 5000 rad from 226Ra

  6. Manganese determination om minerals by activation analysis, using the californium-252 as a neutron source

    International Nuclear Information System (INIS)

    Neutron Activation Analysis, using a Californium-252 neutron source, has been applied for the determination of manganese in ores such as pyrolusite, rodonite (manganese silicate)' and blending used in dry-batteries The favorable nuclear properties of manganese, such as high thermal neutron cross-section for the reaction 55Mn (n.gamma)56 Mn, high concentration of manganese in the matrix and short half - life of 56Mn, are an ideal combination for non-destructive analysis of manganese in ores. Samples and standards of manganese dioxide were irradiated for about 20 minutes, followed by a 4 to 15 minutes decay and counted in a single channel pulse-height discrimination using a NaI(Tl) scintillation detector. Counting time was equal to 10 minutes. The interference of nuclear reactions 56Fe(n,p)56Mn and 59 Co (n, α)56 were studied, as well as problems in connection with neutron shadowing during irradiation, gamma-rays attenuation during counting and influence of granulometry of samples. One sample,was also analysed by wet-chemical method (sodium bismuthate) in order to compare results. As a whole, i t was shown that the analytical method of neutron activation for manganese in ores and blending, is a method simple, rapid and with good precision and accuracy. (author)

  7. Five-year cure of cervical cancer treated using californium-252 neutron brachytherapy

    International Nuclear Information System (INIS)

    Female pelvic carcinoma is one of the common malignancies seen at the University of Kentucky Medical Center and often presents in an advanced stage. In 1976, the authors began to test californium-252 neutron brachytherapy (NT) for its efficacy for control of primary and recurrent advanced uterine, cervix, and vaginal cancers. The first protocol used was 5000-5500 rad of whole pelvis irradiation followed by 1-2 Cf-252 insertions using a single tandem placed in the utero-cervico-vaginal region. Of 27 patients with primary carcinomas treated, 10 are alive and well 5 year later (37%). Two of two recurrent tumors were locally controlled but failed later. These patients had advanced cervical, vaginal, or endometrial carcinomas. In 1977, a transitional year, treatment of only unfavorable stages and presentations with NT was initiated. Similar results were obtained with NT as compared to conventional photon therapy (PT). Further improvement in treatment results can be anticipated as NT brachytherapy is used for advanced cancer therapy by more effective treatment schedules and radiation doses. Cf-252 can be used as a radium substitute and achieved similar rates of tumor control and 5-year survivals. 21 references, 2 tables

  8. Uptake and distribution of californium-252 chloride administered intraperitoneally, intravenously or intratracheally and the effect of in vivo DTPA chelation on intratracheal instillation in the rat

    International Nuclear Information System (INIS)

    The first phase of this investigation, comprising of three groups of animals, was designed to study the fate of californium-252 chloride administered intraperitoneally, intravenously or intratracheally. The second phase, which consisted of two groups of animals, was designed to examine the effectiveness of DTPA chelation therapy in accelerating the excretion and preventing the deposition of californium-252 chloride instilled into the lungs of rats. Immediately following the dose administration of 2 uCi of californium-252 chloride which was dissolved in 0.2 ml of 0.9% NaCl at pH 3.5, each rat was placed in a metabolism cage. Each rat in the first group of phase II was given intraperitoneal injection of CaNa3 DTPA (50 mg/kg) and each rat in the second group was given intraperitoneal injections of 0.9% NaCl. Injections of the DTPA or the NaCl sham were initiated immediately after the intratracheal administration of californium-252 chloride and were continued every three days until sacrifice. Following intraperitoneal, intravenous or intratracheal administration, the whole body retention of californium as a function of time was described by a three component exponential equation. For each mode of administration the short term component exhibited a biological half-life of between 5 and 10 hours; the intermediate component between 4 and 6 days; and the long term component between 200 and 300 days. The organ data obtained following intraperitoneal and intravenous administration were indistinguishable. On day one, the liver retained about 9% of the administered dose and the kidneys retained 2.4%. Retention for these organs decreased to about 1% by day 32. The femurs maintained an almost constant level of 4.5% of the injected dose over the 32 days. The lungs, spleen, heart, and testes showed significant retention of californium

  9. Study of the high-j states in 249Cm

    International Nuclear Information System (INIS)

    The authors have performed the reaction 248Cm(4He, 3He) using 98.5-MeV alpha particles from the IUCF cyclotron to populate high-j states in 249Cm. A tentative assignment of the K17/2 component of the 1/2+[880] Nilsson state has been made

  10. 46 CFR 249.9 - American market participation.

    Science.gov (United States)

    2010-10-01

    ... OPERATORS APPROVAL OF UNDERWRITERS FOR MARINE HULL INSURANCE § 249.9 American market participation. (a... to the American marine insurance market the opportunity to compete for the placement of marine hull... less than 50 percent of the placement is made with the American marine insurance market, the owners,...

  11. 40 CFR 180.249 - Alachlor; tolerances for residues.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 23 2010-07-01 2010-07-01 false Alachlor; tolerances for residues. 180... PROGRAMS TOLERANCES AND EXEMPTIONS FOR PESTICIDE CHEMICAL RESIDUES IN FOOD Specific Tolerances § 180.249 Alachlor; tolerances for residues. (a) General. Tolerances are established for combined residues...

  12. ENEA results in the international comparison organized by BIPM for the measurament of neutron fluxes of a Californium source

    International Nuclear Information System (INIS)

    During the period between May 1978 and August 1984 under the auspices of Section III of CCEMRI of CIPM it has been carried out the international intercomparison of Californium neutron source emission rate. The previous intercomparison was based on Ra-Be (α -n) source measuraments, which took place between 1959 and 1965, and the results showed a total spread of +- 3%. Owing to the better accuracy achived over the following decade the Ra-Be intercomparison was no longer representative of the state of the art, therefore it was decided to arrange the intercomparison based on Californium which in the meantime reached a wide use in the world. Contributions to the intercomparison were received from fourteen laboratories representative of twelve Nations plus the BIPM. The results put into evidence a considerable advance on accuracy in the neutron source emission rate measuraments. The standard deviation of the residuals obtained from least square fit of normalized data resulted +- 0,57%. In the present report it is widely described the Manganese bath method used at ENEA, CRE Casaccia in Roma, and the experimental procedure followed for its absolute calibration. All measuraments are reported and analysed, including those effectuated for corrective factors determination. The final results obtained at ENEA for the circulated Californium source is (3,457 +- 0,013) 10*H7 neutron/s. The analysis of data from all partecipantes has been effectuated and concluded by J. Axton in March 1986 and the conclusions which have been showed in the present report put in evidence the satisfactory results achived by the ENEA

  13. Feasibility and market potential of protein determination of wheat using californium-252

    International Nuclear Information System (INIS)

    To evaluate the feasibility of protein determination by capture gamma-ray analysis using californium-252 neutrons, an in-situ protein analysis system for use by grain handlers has been examined. Three 227 kilogram (approximately) lots of wheat were used to determine the amount of nitrogen present. Protein analyses by the Kjeldahl method were obtained from samples taken before and after the capture gamma-ray analyses. The 5.267-MeV gamma-ray was selected for use in this study as a compromise between efficiency and interference from other elements. The associated counting equipment was a multichannel analyzer with pulse shaping electronic and analysis computing equipment. A linear regression program was used to compare the regions of interest to the Kjeldahl protein averages. The counts composing each peak were summed and normalized using the total count of the hydrogen peak. The normalized nitrogen percentages indicate a significant correlation between the spectral regions and the Kjeldahl analyses. To a first approximation, the value of wheat is the wheat protein. At the present time, protein testing of wheat is destructive, cumbersome, and time-consuming as compared to the potential for capture gamma-ray analysis testing. Assuming that such a protein analysis unit can analyze 42 tonne of wheat per hour, over 120 units would be needed to monitor one-half the U.S. annual wheat production. A 0.5% improvement in processor realizations and grain throughput value of $167.00 per tonne will result in a projected savings of $150,000 per year per unit

  14. Oxygen enhancement ratio (OER) and therapeutic gain factor (GF) for californium-252 at low dose rate

    International Nuclear Information System (INIS)

    The potential benefit of the introduction of californium-252 in interstitial and intracavitary therapy is related to the greater efficiency of its neutron emission against anoxic cancer cells. In that respect, the oxygen enhancement ratio (OER) of the 252Cf emission has been determined for a continuous low dose rate irradiation. The biological system is growth inhibition in Vicia faba bean roots. A new Vicia faba ''BelB'' strain has been used, which better tolerates long periods (up to about 10 hours) of anoxia. In a first series of experiments, for a 252Cf (Dsub(n+γ)) dose rate of 0.11 Gy.h-1, an OER of 1.4+-0.1 was observed (the γ contribution Dγ to the total absorbed dose Dsub(n+γ) was 0.35 at the position of the root tips). In a second series of experiments, in somewhat different geometrical conditions with a 252Cf (Dsub(n+γ)) dose rate of 0.13 Gy.h-1, an OER of 1.5+-0.1 was observed (Dγ/Dsub(n+γ)=0.42). The OER values observed for similar irradiation times, with iridium-192 γ-rays, were 2.3+-0.2 and 2.6+-0.1 respectively, which leads to therapeutic gain factors (GF) of 1.6 and 1.7 respectively. These GF values are slightly lower than those previously obtained (GF=1.8) on the same system, with d(50)-Be p(75)-Be and 15 MeV neutron beams

  15. Application of TSH bioindicator for studying the biological efficiency of neutrons from californium-252 source

    International Nuclear Information System (INIS)

    The effectiveness of neutrons from a Californium-252 source in the induction of various abnormalities in the Tradescantia clone 4430 stamen hair cells (TSH-assay) was studied. The special attention was paid to check whether any enhancement in effects caused by process of boron neutron capture is visible in the cells enriched with boron ions. Two chemicals (borax and BSH) were applied to introduce boron-10 ions into cells. Inflorescence, normal or pretreated with chemicals containing boron, were irradiated in the air with neutrons from a Cf-252 source at KAERI, Taejon, Korea. To estimate the relative biological effectiveness (RBE) in the induction of gene mutations of the neutron beam under the study, Tradescantia inflorescences, without any chemical pretreatment, were irradiated with various doses of X-rays. The ranges of radiation doses used were 0-0.1 Gy in neutrons and 0-0.5 Gy in X-rays. After the time needed to complete the postirradiation repair Tradescantia cuttings were transferred to Cracow, where screening of gene and lethal; mutations, cell cycle alterations in somatic cells have been done, and dose response relationships were figured. The maximal RBE values were estimated in the range of 4.6-6.8. Alterations of RBE value were observed; from 6.8 to 7.8 in the case of plants pretreated with 240 ppm of B-10 from borax, and 4.6 to 6.1 in the case of 400 ppm of B-10 from BSH. Results showed a slight, although statistically insignificant increase in biological efficacy of radiation from the Cf-252 source in samples pretreated with boron containing chemicals. (author)

  16. Divalent and trivalent gas-phase coordination complexes of californium: evaluating the stability of Cf(ii).

    Science.gov (United States)

    Dau, Phuong D; Shuh, David K; Sturzbecher-Hoehne, Manuel; Abergel, Rebecca J; Gibson, John K

    2016-08-01

    The divalent oxidation state is increasingly stable relative to the trivalent state for the later actinide elements, with californium the first actinide to exhibit divalent chemistry under moderate conditions. Although there is evidence for divalent Cf in solution and solid compounds, there are no reports of discrete complexes in which Cf(II) is coordinated by anionic ligands. Described here is the divalent Cf methanesulfinate coordination complex, Cf(II)(CH3SO2)3(-), prepared in the gas phase by reductive elimination of CH3SO2 from Cf(III)(CH3SO2)4(-). Comparison with synthesis of the corresponding Sm and Cm complexes reveals reduction of Cf(III) and Sm(III), and no evidence for reduction of Cm(III). This reflects the comparative 3+/2+ reduction potentials: Cf(3+) (-1.60 V) ≈ Sm(3+) (-1.55 V) ≫ Cm(3+) (-3.7 V). Association of O2 to the divalent complexes is attributed to formation of superoxides, with recovery of the trivalent oxidation state. The new gas-phase chemistry of californium, now the heaviest element to have been studied in this manner, provides evidence for Cf(II) coordination complexes and similar chemistry of Cf and Sm. PMID:27424652

  17. Hypoxic versus normoxic external-beam irradiation of cervical carcinoma combined with californium-252 neutron brachytherapy. Comparative treatment results of a 5-year randomized study

    Czech Academy of Sciences Publication Activity Database

    Tačev, T.; Vacek, Antonín; Ptáčková, B.; Strnad, V.

    2005-01-01

    Roč. 181, č. 5 (2005), s. 273-284. ISSN 0179-7158 Institutional research plan: CEZ:AV0Z50040507 Keywords : cervical carcinoma * hypoxyradiotherapy * californium-252 Subject RIV: BO - Biophysics Impact factor: 3.490, year: 2005

  18. 48 CFR 52.249-4 - Termination for Convenience of the Government (Services) (Short Form).

    Science.gov (United States)

    2010-10-01

    ... Convenience of the Government (Services) (Short Form). 52.249-4 Section 52.249-4 Federal Acquisition... termination: Termination for Convenience of the Government (Services) (Short Form) (APR 1984) The Contracting... CONTRACT CLAUSES Text of Provisions and Clauses 52.249-4 Termination for Convenience of the...

  19. 17 CFR 249.331 - Form N-CSR, certified shareholder report.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Form N-CSR, certified shareholder report. 249.331 Section 249.331 Commodity and Securities Exchanges SECURITIES AND EXCHANGE... Required Under Sections 13 and 15(d) of the Securities Exchange Act of 1934 § 249.331 Form N-CSR,...

  20. Solving the Hydration Structure of the Heaviest Actinide Aqua Ion Known: The Californium(III) Case

    Energy Technology Data Exchange (ETDEWEB)

    Den Auwer, Ch.; Guillaumont, D. [CEA Marcoule, Nucl Energy Div, Radiochem Proc Dept, SCPS LILA, 30 (France); Galbis, E.; Pappalardo, Rafael R.; Marcos Sanchez, E. [Univ Seville, Dept Quim Fis, E-41012 Seville (Spain); Hernandez-Cobos, J. [Inst Ciencias Fis, Cuernavaca 62251, Morelos (Mexico); Le Naour, C.; Simoni, E. [Univ Paris Sud, Inst Phys Nucl Orsay, Paris (France)

    2010-07-01

    In summary, the first MC simulation of the trivalent cation of californium, based on an exchangeable hydrated ion-water intermolecular potential, has been shown to extend and improve the hydrated ion model. Likewise, the CfL{sub III}-edge EXAFS spectrum of an acidic 1 mm Cf(ClO{sub 4}){sub 3} aqueous solution recorded under optimized experimental conditions has greatly improved the signal/noise ratio of the only previously recorded spectrum. The comparison of the experimental EXAFS spectrum with the two computed ones, obtained from two different intermolecular potentials that predict eight (BP86) or nine (MP2) water molecules in the first coordination shell, leads to the conclusion that the lowest hydration number is preferred. Then, as Cf{sup III} is the heaviest actinide aqua ion for which there is experimental information, the actinide contraction is supported by the present study. (For U{sup III}, R{sub U-O}=2.56 Angstroms, and CN=9{+-}1; for Pu{sup III}, R{sub Pu-O}=2.51 Angstroms and CN=9{+-}1; for Cm{sup III}, R{sub Cm-O}=2.47 Angstroms and CN=9{+-}1). The role of the second hydration shell is important in defining the structure and dynamics of the Cf{sup III} aqua ion, but the contribution of second-shell water molecules to the EXAFS signal as back-scatters is marginal. Finally, this work gives an illustrative example of the benefits which can be achieved from the combination of experimental X-ray absorption spectroscopy and computer simulations. The usefulness of the simultaneous analysis of the results as well as the importance of the structural statistical average has been clearly demonstrated herein. Each technique independently was not adequate. We believe that this study traces out a still poorly explored combined methodology which may be extremely useful for many other complexes and chemical problems. A systematic theoretical and experimental examination of the other known actinide cations on the same basis should be undertaken to confirm the

  1. Design, construction, and characterization of a facility for neutron capture gamma ray analysis of sulfur in coal using californium-252

    International Nuclear Information System (INIS)

    A study of neutron capture gamma ray analysis of sulfur in coal using californium-252 as a neutron source is reported. Both internal and external target geometries are investigated. The facility designed for and used in this study is described. The external target geometry is found to be inappropriate because of the low thermal neutron flux at the sample location, which must be outside the biological shielding. The internal target geometry is found to have a sufficient thermal neutron flux, but an excessive gamma ray background. A water filled plastic facility, rather than the paraffin filled steel one used in this study, is suggested as a means of increasing flexibility and decreasing the beackground in the internal target geometry

  2. Actinide production in 136Xe bombardments of 249Cf

    International Nuclear Information System (INIS)

    The production cross sections for the actinide products from 136Xe bombardments of 249Cf at energies 1.02, 1.09, and 1.16 times the Coulomb barrier were determined. Fractions of the individual actinide elements were chemically separated from recoil catcher foils. The production cross sections of the actinide products were determined by measuring the radiations emitted from the nuclides within the chemical fractions. The chemical separation techniques used in this work are described in detail, and a description of the data analysis procedure is included. The actinide production cross section distributions from these 136Xe + 249Cf bombardments are compared with the production cross section distributions from other heavy ion bombardments of actinide targets, with emphasis on the comparison with the 136Xe + 248Cm reaction. A technique for modeling the final actinide cross section distributions has been developed and is presented. In this model, the initial (before deexcitation) cross section distribution with respect to the separation energy of a dinuclear complex and with respect to the Z of the target-like fragment is given by an empirical procedure. It is then assumed that the N/Z equilibration in the dinuclear complex occurs by the transfer of neutrons between the two participants in the dinuclear complex. The neutrons and the excitation energy are statistically distributed between the two fragments using a simple Fermi gas level density formalism. The resulting target-like fragment initial cross section distribution with respect to Z, N, and excitation energy is then allowed to deexcite by emission of neutrons in competition with fission. The result is a final cross section distribution with respect to Z and N for the actinide products. 68 refs., 33 figs., 6 tabs

  3. Fusion and quasifission dynamics in the reactions $^{48}$Ca+$^{249}$Bk and $^{50}$Ti+$^{249}$Bk using TDHF

    CERN Document Server

    Umar, A S; Simenel, C

    2016-01-01

    Background: Synthesis of superheavy elements (SHE) with fusion-evaporation reactions is strongly hindered by the quasifission (QF) mechanism which prevents the formation of an equilibrated compound nucleus and which depends on the structure of the reactants. New SHE have been recently produced with doubly-magic $^{48}$Ca beams. However, SHE synthesis experiments with single-magic $^{50}$Ti beams have so far been unsuccessful. Purpose: In connection with experimental searches for $Z=117,119$ superheavy elements, we perform a theoretical study of fusion and quasifission mechanisms in $^{48}$Ca,$^{50}$Ti+$^{249}$Bk reactions in order to investigate possible differences in reaction mechanisms induced by these two projectiles. Methods: The collision dynamics and the outcome of the reactions are studied using unrestricted time-dependent Hartree-Fock (TDHF) calculations as well as the density-constrained TDHF method to extract the nucleus-nucleus potentials and the excitation energy in each fragment. Results: Nucleu...

  4. 7 CFR 249.22 - Nonprocurement debarment/suspension, drug-free workplace, and lobbying restrictions.

    Science.gov (United States)

    2010-01-01

    ... workplace, and lobbying restrictions. 249.22 Section 249.22 Agriculture Regulations of the Department of.../suspension, drug-free workplace, and lobbying restrictions. The State agency must ensure compliance with the... lobbying (part 3018 of this title), where applicable....

  5. 14 CFR 249.8 - Premature loss or destruction of records.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Premature loss or destruction of records. 249.8 Section 249.8 Aeronautics and Space OFFICE OF THE SECRETARY, DEPARTMENT OF TRANSPORTATION... Premature loss or destruction of records. If records are destroyed or lost before the expiration of...

  6. Operational experience with the Argonne National Laboratory Californium Rare Ion Breeder Upgrade facility and electron cyclotron resonance charge breeder

    Science.gov (United States)

    Vondrasek, R.; Clark, J.; Levand, A.; Palchan, T.; Pardo, R.; Savard, G.; Scott, R.

    2014-02-01

    The Californium Rare Ion Breeder Upgrade (CARIBU) of the Argonne National Laboratory Argonne Tandem Linac Accelerator System (ATLAS) facility provides low-energy and accelerated neutron-rich radioactive beams to address key nuclear physics and astrophysics questions. A 350 mCi 252Cf source produces fission fragments which are thermalized and collected by a helium gas catcher into a low-energy particle beam with a charge of 1+ or 2+. An electron cyclotron resonance (ECR) ion source functions as a charge breeder in order to raise the ion charge sufficiently for acceleration in the ATLAS linac. The ECR charge breeder has achieved stable beam charge breeding efficiencies of 10.1% for 23Na7+, 17.9% for 39K10+, 15.6% for 84Kr17+, and 12.4% for 133Cs27+. For the radioactive beams, a charge breeding efficiency of 11.7% has been achieved for 143Cs27+ and 14.7% for 143Ba27+. The typical breeding times are 10 ms/charge state, but the source can be tuned such that this value increases to 100 ms/charge state with the best breeding efficiency corresponding to the longest breeding times—the variation of efficiencies with breeding time will be discussed. Efforts have been made to characterize and reduce the background contaminants present in the ion beam through judicious choice of q/m combinations. Methods of background reduction are being investigated based upon plasma chamber cleaning and vacuum practices.

  7. Long-term effects of an intracavitary treatment with californium-252 on normal tissue. [Swine, /sup 226/Ra

    Energy Technology Data Exchange (ETDEWEB)

    Sullivan, M.F.; Beamer, J.L.; Mahony, T.D.; Cross, F.T.; Lund, J.E.; Endres, G.W.R.

    1976-01-01

    About one hundred fifty swine were exposed to either radium-226 or californium-252 sources in the uterine cervix to determine an RBE for both acute and long-term effects. That value for early changes in the tissues at risk in the treatment of cervical cancer was between 6.2 and 6.8. The incidence of complications increased with time after exposure, especially among animals treated with /sup 252/Cf. Analysis of rectal injury showed that ulceration occurred frequently within a year postexposure at doses between 1600 and 2400 rad calculated at 2 cm lateral to the source midline. Fat necrosis and smooth muscle atrophy, resulting in a local rectal stricture, were delayed changes observed in some animals. The lower ureter was the site for a greater frequency of complications than the GI tract. Ureteral stricture often occurred at doses of 1200 rad from /sup 252/Cf and 7000 rad from /sup 226/Ra. Observation of delayed effects in the uterine-cervix in animals held up to 4 years postexposure indicate that the RBE for /sup 252/Cf may be increased to a value as high as 18, while repair may have even decreased it to about 5.6 in the rectum. Fifty swine are still being observed for long-term effects after doses above 800 rad from /sup 252/Cf and 5000 rad from /sup 226/Ra.

  8. 17 CFR 249.1200 - Form X-17F-1A-Report for missing, lost, stolen or counterfeit securities.

    Science.gov (United States)

    2010-04-01

    ... Register citations affecting Form X-17F-1A, see the List of CFR Sections Affected, which appears in the... missing, lost, stolen or counterfeit securities. 249.1200 Section 249.1200 Commodity and Securities... Reporting and Inquiry With Respect to Missing, Lost, Stolen, or Counterfeit Securities § 249.1200 Form...

  9. 48 CFR 52.249-1 - Termination for Convenience of the Government (Fixed-Price) (Short Form).

    Science.gov (United States)

    2010-10-01

    ... Convenience of the Government (Fixed-Price) (Short Form). 52.249-1 Section 52.249-1 Federal Acquisition... Convenience of the Government (Fixed-Price) (Short Form) (APR 1984) The Contracting Officer, by written notice... CONTRACT CLAUSES Text of Provisions and Clauses 52.249-1 Termination for Convenience of the...

  10. 17 CFR 249.332 - Form N-Q, quarterly schedule of portfolio holdings of registered management investment company.

    Science.gov (United States)

    2010-04-01

    ... of portfolio holdings of registered management investment company. 249.332 Section 249.332 Commodity... Securities Exchange Act of 1934 § 249.332 Form N-Q, quarterly schedule of portfolio holdings of registered management investment company. This form shall be used by registered management investment companies,...

  11. Results with the electron cyclotron resonance charge breeder for the 252Cf fission source project (Californium Rare Ion Breeder Upgrade) at Argonne Tandem Linac Accelerator System

    International Nuclear Information System (INIS)

    The construction of the Californium Rare Ion Breeder Upgrade, a new radioactive beam facility for the Argonne Tandem Linac Accelerator System (ATLAS), is nearing completion. The facility will use fission fragments from a 1 Ci 252Cf source; thermalized and collected into a low-energy particle beam by a helium gas catcher. In order to reaccelerate these beams, an existing ATLAS electron cyclotron resonance (ECR) ion source was redesigned to function as an ECR charge breeder. Thus far, the charge breeder has been tested with stable beams of rubidium and cesium achieving charge breeding efficiencies of 9.7% into 85Rb17+ and 2.9% into 133Cs20+.

  12. 17 CFR 249.322 - Form 12b-25-Notification of late filing.

    Science.gov (United States)

    2010-04-01

    ... CFR Sections Affected, which appears in the Finding Aids section of the printed volume and on GPO...-annual, annual, or transition report on Form N-SAR (§§ 249.330; 274.101) or Form N-CSR (§§ 249.331; 274... to electronic difficulties should comply with either Rule 201 or Rule 202 of Regulation S-T (§...

  13. Bk and Cf chromatographic separation and 249Bk/248Cm and 249Cf/248Cm elemental ratios determination by inductively coupled plasma quadrupole mass spectrometry

    International Nuclear Information System (INIS)

    The French Atomic Energy Commission has carried out several experiments for the study of minor-actinide transmutation processes in high intensity thermal neutron flux. In this context a Cm sample enriched in 248Cm (97%) was irradiated in a thermal neutron flux at the High Flux Reactor (HFR) of the Laue-Langevin Institute (ILL). The precise and accurate determination of Cf isotope ratios and of 249Bk/248Cm and 249Cf/248Cm elemental ratios in the 248Cm irradiated sample is crucial for the calculation of actinide neutron capture cross-sections.This work describes an analytical procedure for the separation and the isotope ratio measurement of Bk and Cf in the irradiated sample.The Bk and Cf separation is based on a lanthanides separation protocol previously developed by the laboratory. Well-defined retention times for Bk and Cf were obtained by coupling the Ionic Chromatography (IC) with an ICP-QMS. All conditions of element separation by IC and the different steps of the analytical protocol in order to obtain the isotopic and elemental ratios are presented. Relative uncertainties of Cf isotopic ratios range from 0.3% to 0.5% and the uncertainty of the 249Bk/248Cm and 249Cf/248Cm elemental ratios are respectively 6.1% and 3.2%.This level of uncertainty for both isotopic and elemental ratios is in perfect agreement with the requirement for transmutation studies. (authors)

  14. Ab initio full-potential study of mechanical properties and magnetic phase stability of californium monopnictides (CfN and CfP)

    Science.gov (United States)

    Amari, S.; Bouhafs, B.

    2016-09-01

    Based on the first-principles methods, the structural, elastic, electronic, properties and magnetic ordering of californium monopnictides CfX (X = P) have been studied using the full-potential augmented plane wave plus local orbitals (FP-L/APW + lo) method within the framework of density functional theory (DFT). The electronic exchange correlation energy is described by generalized gradient approximation GGA and GGA+U (U is the Hubbard correction). The GGA+U method is applied to the rare-earth 5f states. We have calculated the lattice parameters, bulk modulii and the first pressure derivatives of the bulk modulii. The elastic properties of the studied compounds are only investigated in the most stable calculated phase. In order to gain further information, we have calculated Young's modulus, shear modulus, anisotropy factor and Kleinman parameter by the aid of the calculated elastic constants. The results mainly show that californium monopnictides CfX (X = P) have an antiferromagnetic spin ordering. Density of states (DOS) and charge densities for both compounds are also computed in the NaCl (B1) structure.

  15. 249 TP53 mutation has high prevalence and is correlated with larger and poorly differentiated HCC in Brazilian patients

    Directory of Open Access Journals (Sweden)

    Paranaguá-Vezozzo Denise C

    2009-06-01

    Full Text Available Abstract Background Ser-249 TP53 mutation (249Ser is a molecular evidence for aflatoxin-related carcinogenesis in Hepatocellular Carcinoma (HCC and it is frequent in some African and Asian regions, but it is unusual in Western countries. HBV has been claimed to add a synergic effect on genesis of this particular mutation with aflatoxin. The aim of this study was to investigate the frequency of 249Ser mutation in HCC from patients in Brazil. Methods We studied 74 HCC formalin fixed paraffin blocks samples of patients whom underwent surgical resection in Brazil. 249Ser mutation was analyzed by RFLP and DNA sequencing. HBV DNA presence was determined by Real-Time PCR. Results 249Ser mutation was found in 21/74 (28% samples while HBV DNA was detected in 13/74 (16%. 249Ser mutation was detected in 21/74 samples by RFLP assay, of which 14 were confirmed by 249Ser mutant-specific PCR, and 12 by nucleic acid sequencing. All HCC cases with p53-249ser mutation displayed also wild-type p53 sequences. Poorly differentiated HCC was more likely to have 249Ser mutation (OR = 2.415, 95% CI = 1.001 – 5.824, p = 0.05. The mean size of 249Ser HCC tumor was 9.4 cm versus 5.5 cm on wild type HCC (p = 0.012. HBV DNA detection was not related to 249Ser mutation. Conclusion Our results indicate that 249Ser mutation is a HCC important factor of carcinogenesis in Brazil and it is associated to large and poorly differentiated tumors.

  16. Fusion and quasifission dynamics in the reactions 48Ca+249Bk and 50Ti+249Bk using a time-dependent Hartree-Fock approach

    Science.gov (United States)

    Umar, A. S.; Oberacker, V. E.; Simenel, C.

    2016-08-01

    Background: Synthesis of superheavy elements (SHEs) with fusion-evaporation reactions is strongly hindered by the quasifission (QF) mechanism which prevents the formation of an equilibrated compound nucleus and which depends on the structure of the reactants. New SHEs have been recently produced with doubly-magic 48Ca beams. However, SHE synthesis experiments with single-magic 50Ti beams have so far been unsuccessful. Purpose: In connection with experimental searches for Z =117 ,119 superheavy elements, we perform a theoretical study of fusion and quasifission mechanisms in 48Ca,50Ti+249Bk reactions in order to investigate possible differences in reaction mechanisms induced by these two projectiles. Methods: The collision dynamics and the outcome of the reactions are studied using unrestricted time-dependent Hartree-Fock (TDHF) calculations as well as the density-constrained TDHF method to extract the nucleus-nucleus potentials and the excitation energy in each fragment. Results: Nucleus-nucleus potentials, nuclear contact times, masses and charges of the fragments, as well as their kinetic and excitation energies strongly depend on the orientation of the prolate 249Bk nucleus. Long contact times associated with fusion are observed in collisions of both projectiles with the side of the 249Bk nucleus, but not on collisions with its tip. The energy and impact parameter dependencies of the fragment properties, as well as their mass-angle and mass-total kinetic energy correlations are investigated. Conclusions: Entrance channel reaction dynamics are similar with both 48Ca and 50Ti projectiles. Both are expected to lead to the formation of a compound nucleus by fusion if they have enough energy to get in contact with the side of the 249Bk target.

  17. Oxidation-reduction properties of americium, curium, berkelium, californium, einsteinium and fermium, and thermodynamic consequences for the 5f series

    International Nuclear Information System (INIS)

    The amalgamation of 5f elements from Am to Fm has been studied by using 241Am, 244Cm, 249Bk, 249Cf, 252Cf, 253Es, 254Es, 252Fm and 255Fm with two electrochemical methods, radiocoulometry and radiopolarography, perfectly adapted to investigate extremely diluted solutions when the concentration of electroactive species is as low as 10-16M. The theory of radiocoulometry has been developed in the general cases of reversible and irreversible electrode process. It has been used to interpret the experimental data on the kinetic curves of amalgamation, and to estimate the standard rate constant of the electrode process in complexing medium (citric). On the other hand the radiopolarographic method has been applied to study the mechanism of reduction at the dropping mercury electrode of cations M3+ in aqueous medium to the metal M with formation of amalgam. The results are exploited into two directions: 1- Acquisition of some data concerning the oxidation-reduction properties of elements from Am to Fm. Therefore the standard electrode E0 [M(III-0)] potentials for Bk, Cf and Es, and the standard electrode E0 [M(II-0)] potential for Fm are estimated and the relative stability of each oxidation state (from II to VII) of 5f elements is discussed; 2- Acquisition of unknown thermodynamic data on transcalifornium elements. Correlations between 4f and 5f elements are precised and some divergences appear for the second half of 4f and 5f series (i.e. for 65<=Z<=71 and 97<=Z<=103)

  18. Anatomy of a controversy: Application of the Langevin technique to the analysis of the Californium-252 Source-Driven Noise Analysis method for subcriticality determination

    International Nuclear Information System (INIS)

    The expressions for the power spectral density of the noise equivalent sources have been calculated explicitly for the (a) stochastic transport equation, (b) the one-speed transport equaton, (c) the one-speed P1 equations, (d) the one-speed diffusion equation and (e) the point kinetic equation. The stochastic nature of Fick's law in (d) has been emphasized. The Langevin technique has been applied at various levels of approximation to the interpretation of the Californium-252 Source-Driven Noise Analysis (CSDNA) experiment for determining the reactivity in subcritical media. The origin of the controversy surrounding this method has been explained. The foundations of the CSDNA method as a viable experimental technique to infer subcriticality from a measured ratio of power spectral densities of the outputs of two neutron detectors and a third external source detector has been examined by solving the one-speed stochastic diffusion equation for a point external Californium-252 source and two detectors in an infinite medium. The expression relating reactivity to the measured ratio of PSDs was found to depend implicitly on k itself. Through a numerical analysis fo this expression, the authors have demonstrated that for a colinear detector-source-detector configuration for neutron detectors far from the source, the expression for the subcritical multiplication factor becomes essentially insensitive to k, hence, demonstrating some possibility for the viability of this technique. However, under more realistic experimental conditions, i.e., for finite systems in which diffusion theroy is not applicable, the measurement of the subcritical multiplication factor from a single measured ratio of PSDs, without extensive transport calculations, remains doubtful

  19. Application of SCGE assay, classical cytogenetics and FISH for studying in vitro californium-252 neutrons irradiations and BSH pretreatment on human lymphocytes

    International Nuclear Information System (INIS)

    Recently, there has been observed a tendency to apply various energy neutrons for tumor therapy and particularly low energy neutrons from various sources, including californium-252 source, for cancer radiotherapy based on the neutron capture. In this study peripheral blood lymphocytes were used as a model for human cells and three methods were applied to assess the effectiveness of californium-252 neutrons irradiations in vitro in normal cells or pre-treated with compound enriched in B-10 ion. Human blood samples or isolated lymphocytes were irradiated with neutrons from isotopic 252Cf source at the Faculty of Nuclear Physics and Technics at University of Mining and Metallurgy (both neutron source and samples were placed in polyethylene block). Chemical pretreatment with BSH (Na210B12H11SH) was done to introduce boron-10 ion into cells in order to check any enhancement effect due to the process of boron neutron capture. Comet assay was done to investigate the DNA damage. Classical cytogenetics was applied to assess the frequencies of unstable aberrations (dicentrics and rings). Fluorescence in situ hybridization (FISH) with probes for chromosomes 1, 4 (14.3% of whole genome) and pancentromeric probe was performed to evaluate the frequencies of stable aberrations. Linear (or close to linear) increase of DNA damage and aberration frequency was observed with dose of radiation both for lymphocytes untreated or pre-treated with BSH. Very little differences (statistically insignificant) due to radiation dose and BSH pretreatment were observed in the frequencies of SCEs detected in the second mitosis. There is no significant difference between boron pre-treated and not treated cells, and even slightly higher effects were observed in case of the highest dose without BSH pretreatment. The level of translocations observed is comparable with the frequencies of dicentrics and rings. (author)

  20. 17 CFR 249.218 - Form 18, for foreign governments and political subdivisions thereof.

    Science.gov (United States)

    2010-04-01

    ... Federal Register citations affecting Form 18, see the List of CFR Sections Affected, which appears in the... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Form 18, for foreign... for Registration of Securities on National Securities Exchanges and Similar Matters § 249.218 Form...

  1. Californium-252 neutron sources

    International Nuclear Information System (INIS)

    Major production programs for the Savannah River reactors and the High Flux Isotopes Reactor at Oak Ridge have made 252Cf one of the most available and, at the USAEC's sales price of $10/μg, one of the least-expensive isotopic neutron sources. Reactor production has totaled approximately 2 g, and, based on expected demand, an additional 10 g will be produced in the next decade. The approximately 800 mg chemically separated to date has been used to prepare over 600 neutron sources. Most, about 500, have been medical sources containing 1 to 5 μg of 252Cf plated in needles for experimental cancer therapy studies. The remainder have generally been point sources containing 10 μg to 12 mg of oxide for activation, well logging, or radiography uses. Bulk sources have also been supplied to the commercial encapsulators. The latest development has been the production of 252Cf cermet wire which can be cut into almost contamination-free lengths of the desired 252Cf content. Casks are available for transport of sources up to 50 mg. Subcritical assemblies have been developed to multiply the source neutrons by a factor of 10 to 40, and collimators and thermalizers have also been extensively developed to shape the neutron flux and energy distributions for special applications. (U.S.)

  2. Calculations of Nuclear Astrophysics and Californium Fission Neutron Spectrum Averaged Cross Section Uncertainties Using ENDF/B-VII.1, JEFF-3.1.2, JENDL-4.0 and Low-fidelity Covariances

    International Nuclear Information System (INIS)

    Nuclear astrophysics and californium fission neutron spectrum averaged cross sections and their uncertainties for ENDF materials have been calculated. Absolute values were deduced with Maxwellian and Mannhart spectra, while uncertainties are based on ENDF/B-VII.1, JEFF-3.1.2, JENDL-4.0 and Low-Fidelity covariances. These quantities are compared with available data, independent benchmarks, EXFOR library, and analyzed for a wide range of cases. Recommendations for neutron cross section covariances are given and implications are discussed

  3. Antibiotic Allergic Analysis on 249 Griess Test Negatives%249株革兰阴性杆菌抗生素敏感性分析

    Institute of Scientific and Technical Information of China (English)

    张月明; 刘新焕; 卢立新; 路向东; 步金慧

    2003-01-01

    @@ 随着新的抗生素不断使用,细菌对抗生素的敏感性也发生变化.为了解临床革兰阴性杆菌对抗生素的敏感性,将2000年1月~2001年7月分离的249株革兰阴性杆菌进行抗生素敏感性分析,现报告如下.

  4. In vitro and in vivo cytotoxic effects of PRIMA-1 on hepatocellular carcinoma cells expressing mutant p53ser249.

    Science.gov (United States)

    Shi, Hong; Lambert, Jeremy M R; Hautefeuille, Agnes; Bykov, Vladimir J N; Wiman, Klas G; Hainaut, Pierre; Caron de Fromentel, Claude

    2008-07-01

    Hepatocellular carcinoma (HCC) is highly lethal due to limited curative options. In high-incidence regions, such as parts of Africa and Southeastern Asia, >50% of cases carry an AGG to AGT mutation at codon 249 of the TP53 gene, considered as a 'signature' of mutagenesis by aflatoxins. The protein product, p53ser249, may represent a therapeutic target for HCC. The small molecule p53 reactivation and induction of massive apoptosis (PRIMA)-1 has been shown to induce apoptosis in tumour cells by reactivating the transactivation capacity of some p53 mutants. In this study, we have investigated the cytotoxic effects of PRIMA-1 on HCC cells expressing p53ser249. In p53-null Hep3B cells, over-expression of p53ser249 or p53gln248 by stable transfection increased the cytotoxicity of PRIMA-1 at 50 muM. Furthermore, PRIMA-1 treatment delayed the growth of p53ser249-expressing Hep3B cells xenografted in severe combined immunodeficiency mice. However, PRIMA-1 did not restore wild-type DNA binding and transactivation activities to p53ser249 or to p53gln248 in Hep3B cells. Moreover, in PLC/PRF/5, a HCC cell line constitutively expressing p53ser249, small interfering RNA (siRNA) silencing of the mutant increased the cytotoxic effect of PRIMA-1. These apparently contradictory effects can be reconciled by proposing that p53ser249 exerts a gain-of-function effect, which favours the survival of HCC cells. Thus, both inhibition of this effect by PRIMA-1 and removal of the mutant by siRNA can lead to the decrease of survival capacity of HCC cells. PMID:18048389

  5. Californium interrogation prompt neutron (CIPN) instrument for non-destructive assay of spent nuclear fuel-Design concept and experimental demonstration

    Science.gov (United States)

    Henzlova, D.; Menlove, H. O.; Rael, C. D.; Trellue, H. R.; Tobin, S. J.; Park, Se-Hwan; Oh, Jong-Myeong; Lee, Seung-Kyu; Ahn, Seong-Kyu; Kwon, In-Chan; Kim, Ho-Dong

    2016-01-01

    This paper presents results of the first experimental demonstration of the Californium Interrogation Prompt Neutron (CIPN) instrument developed within a multi-year effort launched by the Next Generation Safeguards Initiative Spent Fuel Project of the United States Department of Energy. The goals of this project focused on developing viable non-destructive assay techniques with capabilities to improve an independent verification of spent fuel assembly characteristics. For this purpose, the CIPN instrument combines active and passive neutron interrogation, along with passive gamma-ray measurements, to provide three independent observables. This paper describes the initial feasibility demonstration of the CIPN instrument, which involved measurements of four pressurized-water-reactor spent fuel assemblies with different levels of burnup and two initial enrichments. The measurements were performed at the Post-Irradiation Examination Facility at the Korea Atomic Energy Institute in the Republic of Korea. The key aim of the demonstration was to evaluate CIPN instrument performance under realistic deployment conditions, with the focus on a detailed assessment of systematic uncertainties that are best evaluated experimentally. The measurements revealed good positioning reproducibility, as well as a high degree of insensitivity of the CIPN instrument's response to irregularities in a radial burnup profile. Systematic uncertainty of individual CIPN instrument signals due to assembly rotation was found to be orientation in the instrument.

  6. INTEGRAL and Swift observations of the hard X-ray transient MAXI J1828-249

    CERN Document Server

    Filippova, E; Ferrigno, C

    2014-01-01

    In this paper we report on the observations performed with INTEGRAL and Swift of the first outburst detected from the hard X-ray transient MAXI J1828-249. During the first about two days of the outburst, the source was observed by MAXI to undergo a very rapid transition from a hard to a softer spectral state. While the hard state was not efficiently monitored because the transition occurred so rapidly, the evolution of the source outburst in the softer state was covered quasi-simultaneously in a broad energy range (0.6-150 keV) by the instruments on-board INTEGRAL and Swift. During these observations, the spectra measured from the source displayed both a prominent thermal emission with temperature kT 0.7 keV and a power-law hard component with a photon index gamma 2.2 extending to 200 keV. The properties of the source in the X-ray domain are reminiscent of those displayed by black hole transients during the soft intermediate state, which supports the association of MAXI J1828-249 with this class of objects.

  7. Biological Efficiency of Californium-252 Source Evaluated by Comet Assay, Classical Cytogenetics and FISH in Human Lymphocytes Irradiated without and with BSH Pretreatment

    International Nuclear Information System (INIS)

    Biological effectiveness of californium-252 source was evaluated after irradiations in vitro of normal or pre-treated with compound enriched in B-10 ion cells. Peripheral blood lymphocytes were used as a model for human cells. DNA and chromosomal damage were studied to compare biological effectiveness of irradiation. Human blood samples or isolated lymphocytes were irradiated with the isotopic source of 252Cf, at the Faculty of Physics and Nuclear Techniques at the University of Mining and Metallurgy (both neutron source and samples were placed in ''infinite'' polyethylene block). Chemical pretreatment with Na210B12H11SH (BSH) was performed to introduce boron-10 ion into cells in order to check any enhancement effect due to the process of boron neutron capture. Single cell gel electrophoresis also known as the Comet assay was done to investigate the DNA damage. Classical cytogenetic analysis was applied to assess the frequencies of unstable aberrations (dicentrics, rings and a centric fragments). To evaluate the frequencies of stable aberrations the fluorescence in situ hybridisation (FISH) with probes for chromosomes 1, 4 (14.3% of the whole genome) was performed. Linear (or close to linear) increase with radiation dose were observed for the DNA damage and aberration frequencies in lymphocytes both untreated or pre-treated with BSH. Levels of translocations evaluated for the whole genome were comparable with the frequencies of dicentrics and rings. No significant differences were detected due to radiation dose in the frequencies of sister chromatid exchanges (SCE) detected in the second mitosis. No statistically significant differences were observed in various biological end-points between normal or boron pre-treated cells. (author)

  8. Actinide production in /sup 136/Xe bombardments of /sup 249/Cf

    Energy Technology Data Exchange (ETDEWEB)

    Gregorich, K.E.

    1985-08-01

    The production cross sections for the actinide products from /sup 136/Xe bombardments of /sup 249/Cf at energies 1.02, 1.09, and 1.16 times the Coulomb barrier were determined. Fractions of the individual actinide elements were chemically separated from recoil catcher foils. The production cross sections of the actinide products were determined by measuring the radiations emitted from the nuclides within the chemical fractions. The chemical separation techniques used in this work are described in detail, and a description of the data analysis procedure is included. The actinide production cross section distributions from these /sup 136/Xe + /sup 249/Cf bombardments are compared with the production cross section distributions from other heavy ion bombardments of actinide targets, with emphasis on the comparison with the /sup 136/Xe + /sup 248/Cm reaction. A technique for modeling the final actinide cross section distributions has been developed and is presented. In this model, the initial (before deexcitation) cross section distribution with respect to the separation energy of a dinuclear complex and with respect to the Z of the target-like fragment is given by an empirical procedure. It is then assumed that the N/Z equilibration in the dinuclear complex occurs by the transfer of neutrons between the two participants in the dinuclear complex. The neutrons and the excitation energy are statistically distributed between the two fragments using a simple Fermi gas level density formalism. The resulting target-like fragment initial cross section distribution with respect to Z, N, and excitation energy is then allowed to deexcite by emission of neutrons in competition with fission. The result is a final cross section distribution with respect to Z and N for the actinide products. 68 refs., 33 figs., 6 tabs.

  9. 75 FR 19880 - Safety Zone; BW PIONEER at Walker Ridge 249, Outer Continental Shelf FPSO, Gulf of Mexico

    Science.gov (United States)

    2010-04-16

    ... PIONEER at Walker Ridge 249, Outer Continental Shelf FPSO, Gulf of Mexico in the Federal Register (74 FR... recreational vessel. The deepwater area also includes an extensive system of fairways. Background Petrobras... facility and the environment. Petrobras America Inc. indicated that it is highly likely that any...

  10. 17 CFR 249.318 - Form 18-K, annual report for foreign governments and political subdivisions thereof.

    Science.gov (United States)

    2010-04-01

    .... Editorial Note: For Federal Register citations affecting Form 18-K, see the List of CFR Sections Affected... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Form 18-K, annual report for... of 1934 § 249.318 Form 18-K, annual report for foreign governments and political subdivisions...

  11. 17 CFR 249.1001 - Form SIP, for application for registration as a securities information processor or to amend such...

    Science.gov (United States)

    2010-04-01

    ... Note: For Federal Register citations affecting Form SIP, see the List of CFR Sections Affected, which... registration as a securities information processor or to amend such an application or registration. 249.1001..., SECURITIES EXCHANGE ACT OF 1934 Form for Registration of, and Reporting by Securities Information...

  12. 17 CFR 249.819 - Form 19b-4, for electronic filing with respect to proposed rule changes by all self-regulatory...

    Science.gov (United States)

    2010-04-01

    ... filing with respect to proposed rule changes by all self-regulatory organizations. 249.819 Section 249..., SECURITIES EXCHANGE ACT OF 1934 Forms for Self-Regulatory Organization Rule Changes and Forms for....819 Form 19b-4, for electronic filing with respect to proposed rule changes by all...

  13. Results from the First {sup 249}Cf + {sup 48}Ca Experiment

    Science.gov (United States)

    Oganessian, Y. T.; Utyonkov, V. K.; Lobanov, Y. V.; Abdullin, F. S.; Polyakov, A. N.; Shirokovsky, I. V.; Tsyganov, Y. S.; Mezentsev, A. N.; Iliev, S.; Subbotin, V. G.; Sukhov, A. M.; Ivanov, O. V.; Voinov, A. A.; Subotic, K.; Zagrebaev, V. I.; Itkis, M. G.; Moody, K. J.; Wild, J. F.; Stoyer, M. A.; Stoyer, N. J.; Laue, C. A.; Shaughnessy, D. A.; Patin, J. B.; Lougheed, R. W.

    2003-02-03

    The present paper reports the results of an attempt aimed at the synthesis of element 118 in the reaction {sup 249}Cf({sup 48}Ca,3n){sup 294}118. The experiment was performed employing the Dubna Gas-filled Recoil Separator and the U400 heavy-ion cyclotron at FLNR, JINR, Dubna. In the course of a 2300-hour irradiation of an enriched {sup 249}Cf target (0.23 mg/cm{sup 2}) with a beam of 245-MeV {sup 48}Ca ions, we accumulated a total beam dose of 2.5 x 10{sup 19} ions. We detected two events that may be attributed to the formation and decay of nuclei with Z=118. For one event, we observed a decay chain of two correlated {alpha}-decays with corresponding energies and correlation times of E{sub {alpha}1} = 11.65 {+-} 0.06 MeV, t{sub {alpha}1} = 2.55 ms and E{sub {alpha}2} = 10.71 {+-} 0.17 MeV, t{sub {alpha}2} = 42.1 ms and, finally, a spontaneous fission with the sum of the kinetic energies of the fission fragments E{sub tot} = 207 MeV (TKE {approx} 230 MeV) and t{sub SF} = 0.52 s. In the second event chain, the recoil nucleus decayed into two fission fragments with E{sub tot} = 223 MeV (TKE {approx} 245 MeV) 3.16 ms later, without intervening {alpha} decays. The probabilities that these events were caused by the chance correlations of unrelated signals are negligible. Both events were observed at an excitation energy of the compound nucleus {sup 297}118 of E* = 30.0 {+-} 2.4 MeV, close to the expected maximum of the 3n-evaporation channel. The relationship between the decay energy Q{sub {alpha}} and decay period T{sub {alpha}} shows that sequential {alpha}-transitions in the first event correspond to the decay chain with Z = 118{_}116{_}114. Decay characteristics of the newly observed nuclides are compared with radioactive decay properties of the even-even isotopes with Z = 116, 114 and 112 previously produced in the reactions {sup 244}Pu, {sup 248}Cm + {sup 48}Ca and calculations made in various nuclear models.

  14. Essentials and guidelines for clinical medical physics residency training programs: executive summary of AAPM Report Number 249.

    Science.gov (United States)

    Prisciandaro, Joann I; Willis, Charles E; Burmeister, Jay W; Clarke, Geoffrey D; Das, Rupak K; Esthappan, Jacqueline; Gerbi, Bruce J; Harkness, Beth A; Patton, James A; Peck, Donald J; Pizzutiello, Robert J; Sandison, George A; White, Sharon L; Wichman, Brian D; Ibbott, Geoffrey S; Both, Stefan

    2014-01-01

    There is a clear need for established standards for medical physics residency training. The complexity of techniques in imaging, nuclear medicine, and radiation oncology continues to increase with each passing year. It is therefore imperative that training requirements and competencies are routinely reviewed and updated to reflect the changing environment in hospitals and clinics across the country. In 2010, the AAPM Work Group on Periodic Review of Medical Physics Residency Training was formed and charged with updating AAPM Report Number 90. This work group includes AAPM members with extensive experience in clinical, professional, and educational aspects of medical physics. The resulting report, AAPM Report Number 249, concentrates on the clinical and professional knowledge needed to function independently as a practicing medical physicist in the areas of radiation oncology, imaging, and nuclear medicine, and constitutes a revision to AAPM Report Number 90. This manuscript presents an executive summary of AAPM Report Number 249. PMID:24892354

  15. Bilanzrecht und Ökonomische Theorie des Rechts - Ansatzpunkte und Überlegungen zum § 249 HGB -

    OpenAIRE

    Lange, Gloria

    1999-01-01

    Mit zunehmender Globalisierung wird es für deutsche Unternehmen als notwendig angesehen, deutsches Bilanzrecht zu Gunsten internationaler Regeln aufzugeben, um Zugang zu den internationalen Kapitalmärkten zu erhalten. Aber ist das deutsche Bilanzrecht tatsächlich schlechter als internationale Bilanzierungsstandards und sollte es demzufolge an diese ange-paßt werden? Zur Beantwortung dieser Fragen wird versucht, die Ökonomische Theorie des Rechts auf Bilanzierungsregeln anzuwenden, wobei § 249...

  16. Californium Recovery from Palladium Wire

    Energy Technology Data Exchange (ETDEWEB)

    Burns, Jon D. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States)

    2014-08-01

    The recovery of 252Cf from palladium-252Cf cermet wires was investigated to determine the feasibility of implementing it into the cermet wire production operation at Oak Ridge National Laboratory’s Radiochemical Engineering Development Center. The dissolution of Pd wire in 8 M HNO3 and trace amounts of HCl was studied at both ambient and elevated temperatures. These studies showed that it took days to dissolve the wire at ambient temperature and only 2 hours at 60°C. Adjusting the ratio of the volume of solvent to the mass of the wire segment showed little change in the kinetics of dissolution, which ranged from 0.176 mL/mg down to 0.019 mL/mg. A successful chromatographic separation of 153Gd, a surrogate for 252Cf, from Pd was demonstrated using AG 50x8 cation exchange resin with a bed volume of 0.5 mL and an internal diameter of 0.8 cm.

  17. Energy levels of 249Bk populated in the α decay of 99253Es and β- decay of 96249Cm

    International Nuclear Information System (INIS)

    The level structure of 249Bk has been investigated by measuring the γ-ray spectra of an extremely pure 253Es sample obtained by milking this nuclide from 253Cf source material produced in the High Flux Isotope Reactor at Oak Ridge National Laboratory. Additional information on the 249Bk levels was obtained from the β--decay study of 249Cm, produced by neutron irradiation of 248Cm. Using the results of the present study together with the data from previous 248Cm(α,t) and 248Cm(3He,d) reactions, the following single-particle states have been identified in 249Bk: 7/2+[633], 0.0 keV; 3/2-[521], 8.78 keV; 1/2+[400], 377.55 keV; 5/2+[642], 389.17 keV; 1/2-[530], 569.20 keV; 1/2-[521], 643.0 keV; 5/2-[523], 672.9 keV; and 9/2+[624], 1075.1 keV. Four vibrational bands were identified at 767.9, 932.2, 1150.7, and 1223.0 keV with tentative assignments of {7/2+ [633] x1-}9/2-, {7/2+ [633] x 0-}7/2-, {7/2+ [633] x 1-}5/2-, and {7/2+ [633] x 0+}7/2+, respectively. A band at 899.9 keV was observed in γ-γ coincidence measurements and given a tentative spin assignment of 3/2. It is possibly associated with a 2- phonon coupled to the ground state, with configuration {7/2+ [633] x 2-}3/2-. Three levels at 624.3, 703.5, and 769.1 keV were assigned spins of 5/2, 7/2, and 9/2, respectively. These could be the members of the 3/2+ [651] band, expected in this energy region

  18. Synthesis of the isotopes of elements 118 and 116 in the 249Cf and 245Cm+48Ca fusion reactions

    Energy Technology Data Exchange (ETDEWEB)

    Oganessian, Y T; Utyonkov, V K; Lobanov, Y V; Abdullin, F S; Polyakov, A N; Sagaidak, R N; Shirokovsky, I V; Tsyganov, Y S; Voinov, A A; Gulbekian, G G; Bogomolov, S L; Gikal, B N; Mezentsev, A N; Iliev, S; Subbotin, V G; Sukhov, A M; Subotic, K; Zagrebaev, V I; Vostokin, G K; Itkis, M G; Moody, K J; . Patin, J B; Shaughnessy, D A; Stoyer, M A; Stoyer, N J; Wilk, P A; Kenneally, J M; Landrum, J H; Wild, J F; Lougheed, R W

    2006-01-31

    The decay properties of {sup 290}116 and {sup 291}116, and the dependence of their production cross sections on the excitation energies of the compound nucleus, {sup 293}116, have been measured in the {sup 245}Cm({sup 48}Ca,xn){sup 293-x}116 reaction. These isotopes of element 116 are the decay daughters of element 118 isotopes, which are produced via the {sup 249}Cf+{sup 48}Ca reaction. They performed the element 118 experiment at two projectile energies, corresponding to {sup 297}118 compound nucleus excitation energies of E* = 29.2 {+-} 2.5 and 34.4 {+-} 2.3 MeV. During an irradiation with a total beam dose of 4.1 x 10{sup 19} {sup 48}Ca projectiles, three similar decay chains consisting of two or three consecutive {alpha} decays and terminated by a spontaneous fission (SF) with high total kinetic energy of about 230 MeV were observed. The three decay chains originated from the even-even isotope {sup 294}118 (E{sub {alpha}} = 11.65 {+-} 0.06 MeV, T{sub {alpha}} = 0.89{sub -0.31}{sup +1.07} ms) produced in the 3n-evaporation channel of the {sup 249}Cf+{sup 48}Ca reaction with a maximum cross section of 0.5{sub -0.3}{sup +1.6} pb.

  19. Design of a homogeneous subcritical nuclear reactor based on thorium with a source of californium 252; Diseno de un reactor nuclear subcritico homogeneo a base de Torio con una fuente de Californio 252

    Energy Technology Data Exchange (ETDEWEB)

    Delgado H, C. E.; Vega C, H. R. [Universidad Autonoma de Zacatecas, Unidad Academica de Estudios Nucleares, Cipres No. 10, Fracc. La Penuela, 98068 Zacatecas, Zac. (Mexico); Sajo B, L., E-mail: ce_delgado89@hotmail.com [Universidad Simon Bolivar, Laboratorio de Fisica Nuclear, Apdo. 89000, 1080A Caracas (Venezuela, Bolivarian Republic of)

    2015-10-15

    Full text: One of the energy alternatives to fossil fuels which do not produce greenhouse gases is the nuclear energy. One of the drawbacks of this alternative is the generation of radioactive wastes of long half-life and its relation to the generation of nuclear materials to produce weapons of mass destruction. An option to these drawbacks of nuclear energy is to use Thorium as part of the nuclear fuel which it becomes in U{sup 233} when capturing neutrons, that is a fissile material. In this paper Monte Carlo methods were used to design a homogeneous subcritical reactor based on thorium. As neutron reflector graphite was used. The reactor core is homogeneous and is formed of 70% light water as moderator, 12% of enriched uranium UO{sub 2}(NO{sub 3}){sub 4} and 18% of thorium Th(NO{sub 3}){sub 4} as fuel. To start the nuclear fission chain reaction an isotopic source of californium 252 was used with an intensity of 4.6 x 10{sup 7} s{sup -1}. In the design the value of the effective multiplication factor, whose value turned out k{sub eff} <1 was calculated. Also, the neutron spectra at different distances from the source and the total fluence were calculated, as well as the values of the ambient dose equivalent in the periphery of the reactor. (Author)

  20. Manganese determination om minerals by activation analysis, using the californium-252 as a neutron source; Determinacao de manganes em minerios, por analise por ativacao, usando californio-252 como fonte de neutrons

    Energy Technology Data Exchange (ETDEWEB)

    Cardoso, Antonio

    1976-07-01

    Neutron Activation Analysis, using a Californium-252 neutron source, has been applied for the determination of manganese in ores such as pyrolusite, rodonite (manganese silicate)' and blending used in dry-batteries The favorable nuclear properties of manganese, such as high thermal neutron cross-section for the reaction {sup 55}Mn (n.gamma){sup 56} Mn, high concentration of manganese in the matrix and short half - life of {sup 56}Mn, are an ideal combination for non-destructive analysis of manganese in ores. Samples and standards of manganese dioxide were irradiated for about 20 minutes, followed by a 4 to 15 minutes decay and counted in a single channel pulse-height discrimination using a NaI(Tl) scintillation detector. Counting time was equal to 10 minutes. The interference of nuclear reactions {sup 56}Fe(n,p){sup 56}Mn and {sup 59} Co (n, {alpha}){sup 56} were studied, as well as problems in connection with neutron shadowing during irradiation, gamma-rays attenuation during counting and influence of granulometry of samples. One sample,was also analysed by wet-chemical method (sodium bismuthate) in order to compare results. As a whole, i t was shown that the analytical method of neutron activation for manganese in ores and blending, is a method simple, rapid and with good precision and accuracy. (author)

  1. Detection of human papilloma virus in 249 cases of patients with genital warts%249例生殖器疣患者人乳头瘤病毒检测分析

    Institute of Scientific and Technical Information of China (English)

    李蕾; 邹先彪

    2016-01-01

    Objective To investigate the distribution of human papilloma virus (HPV) genotypes from outpatients with genital wart in Beijing.Method Flow cytometry HPV genotyping technique were used to detect and identify HPV genotypes from individual lesions. Result Among 249 cases of genital warts, 232 (93.17%) were DNA HPV positive. The positive rate of HPV single type was 63.86%, the positive rate of multiple type of HPV was 36.14%. The infection rate of low-risk HPV was 55.4%, in which HPV6 and HPV11 were the most popular genotypes. HPV16, HPV58, HPV18 were the most prevalent high-risk genotypes.Conclusion The peak of HPV infection concentrates in sexually active population younger than 40 years old. HPV6, HPV11 and HPV16 are the predominant genotypes for genital wart in Beijing.%目的:调查生殖器疣患者人乳头瘤病毒(human papilloma virus,HPV)感染特点,为HPV感染的预防和诊治提供理论依据。方法采用流式荧光HPV基因分型技术检测249例生殖器疣患者皮损组织中HPV的型别。结果249例生殖器疣患者中,232例(93.17%)HPV DNA阳性。单一型感染率为63.86%,复合型感染率为36.14%。低危型HPV阳性率为55.4%,其中以HPV6、HPV11最多;高危型中以HPV16最多,其次为HPV58、HPV18型。结论本地区生殖器HPV感染集中于40岁以下性活跃期的人群。以单一型感染为主,最常见HPV6、HPV11和HPV16型感染。

  2. 17 CFR 249.325 - Form 13F, report of institutional investment manager pursuant to section 13(f) of the Securities...

    Science.gov (United States)

    2010-04-01

    ...). Editorial Note: For Federal Register citations affecting Form 13F, see the List of CFR Sections Affected... institutional investment manager pursuant to section 13(f) of the Securities Exchange Act of 1934. 249.325... manager pursuant to section 13(f) of the Securities Exchange Act of 1934. This form shall be used...

  3. Analysis of high risk factors and head MRI in 249 children with spastic cerebral palsy%249例痉挛性脑瘫患儿高危因素与 MRI分析

    Institute of Scientific and Technical Information of China (English)

    廖小艳; 田新姿

    2014-01-01

    Objective:To sum up the common high risk factors of children with spastic cerebral palsy and different types of magnetic results. Methods:The clinical data of 249 children with spastic cerebral palsy were analyzed retrospectively. Results: The high risk factors of 80% children patients were multifactors. The common factors included:(1) prenatal:intrauterine distress, threat-ened abortion, cord around neck, medical history, and meconium contamination;(2) intrapartum:anoxia, premature birth, low body weight, premature rupture of placenta, and delayed delivery;and (3) postpartum:jaundice, intracranial hemorrhage, and pneumonia of newborn. The abnormal rate of head MRI result was 90. 7%, in which periventricular leukomalacia was the common type (50. 4%) . Conclusions: The common high risk factors of children with spastic cerebral palsy are anoxia, premature birth, low body weight, pathologic jaundice. The head MRI has a high probability to found the abnormal. Common risk factors for different types of magnetic results are different.%目的::总结痉挛型脑瘫患儿常见的高危因素及头颅MRI改变。方法:对249例痉挛型脑瘫患儿资料进行回顾性分析。结果:80%的患儿高危因素为多因素。最常见的有:①产前为胎儿宫内窘迫、先兆流产、脐带绕颈、用药史、胎粪污染;②产时依次为缺氧、早产、低体重、胎盘早破、产程延长;③产后为黄疸、颅内出血、新生儿肺炎。头颅MRI检查异常率为90.7%,其中脑室周围白质异常占50.4%。结论:痉挛型脑瘫患儿常见的高危因素为缺氧、早产、低体重、病理性黄疸,头颅MRI改变检出率高,且依致病因素不同而表现各异。

  4. Effects of the TP53 p.R249S mutant on proliferation and clonogenic properties in human hepatocellular carcinoma cell lines: interaction with hepatitis B virus X protein.

    Science.gov (United States)

    Gouas, Doriane A; Shi, Hong; Hautefeuille, Agnès H; Ortiz-Cuaran, Sandra L; Legros, Pénélope C; Szymanska, Katarzyna J; Galy, Olivier; Egevad, Lars A; Abedi-Ardekani, Behnoush; Wiman, Klas G; Hantz, Olivier; Caron de Fromentel, Claude; Chemin, Isabelle A; Hainaut, Pierre L

    2010-08-01

    Aflatoxin B(1) (AFB(1)) is a risk factor for hepatocellular carcinoma (HCC) in many low-resource countries. Although its metabolites bind at several positions in TP53, a mutation at codon 249 (AGG to AGT, arginine to serine, p.R249S) accounts for 90% of TP53 mutations in AFB(1)-related HCC. This specificity suggests that p.R249S confers a selective advantage during hepatocarcinogenesis. Using HCC cell lines, we show that p.R249S has lost the capacity to bind to p53 response elements and to transactivate p53 target genes. In p53-null Hep3B cells, stable transfection of p.R249S or of another mutant, p.R248Q, did not induce significant changes in cell proliferation and survival after cytotoxic stress. In contrast, in a cell line that constitutively expresses both p.R249S and the hepatitis B virus antigen HBx (PLC/PRF/5), silencing of either p.R249S or HBx by RNA interference slowed down proliferation, with no additive effects when both factors were silenced. Furthermore, the two proteins appear to form a complex. In human HCC samples, mutation at codon 249 did not correlate with p.R249S protein accumulation or HBx truncation status. We suggest that p.R249S may contribute to hepatocarcinogenesis through interaction with HBx, conferring a subtle growth advantage at early steps of the transformation process, but that this interaction is not required for progression to advanced HCC. PMID:20538734

  5. Expression of the benign HEXA mutations, Arg247Trp and Arg249Trp, associated with beta-hexosaminidase A pseudodeficiency

    Energy Technology Data Exchange (ETDEWEB)

    Cao, Z.; Petroulakis, E.; Salo, T. [Univ. of Manitoba (Canada)] [and others

    1994-09-01

    {beta}-Hexosaminidase (Hex A) is a heterodimer of {alpha} and {beta} subunits encoded by the HEXA and HEXB genes, respectively. Mutations in the HEXA gene typically cause Tay-Sachs disease or less severe forms of G{sub M2} gangliosidosis. However, two benign mutations (Arg247Trp and Arg249Trp) in the {alpha}-subunit of Hex A account for Hex A deficiency in {approximately}36% of non-Jewish enzyme-defined Tay-Sachs disease carriers. These mutations do not result in any apparent clinical phenotype in individuals who are genetic compounds with a second disease-causing mutation. We expressed the {alpha}-subunit harboring each of the benign mutations separately to study activity toward the synthetic substrate, 4-MUGS, for comparison to activity from enzymes containing mutations associated with other forms of G{sub M2} gangliosidosis. The C739T (Arg247Trp;benign), C745T (Arg 249Trp; benign), G805A (Gly269Ser; adult-onset), G749A (Gly250Asp; juvenile), and C508T (Arg170Trp; infantile) mutations were introduced into the {alpha}-subunit cDNA. These were transfected alone, or with the {beta}-subunit cDNA, to generate Hex S ({alpha}{alpha}) or Hex A ({alpha}{beta}), respectively. The activities were monitored using 4-MUGS, and the levels of {alpha}-subunit protein were assessed by Western blotting. Repeated experiments show that the benign mutations produce approximately 35% of normal Hex S and 40% of normal Hex A activity. This level is much higher than that of Hex A harbouring the Gly169Ser adult-onset mutation (12%). A sequential decrease in expressed Hex A activity is observed as mutations associated with more severe phenotypes are expressed. The benign mutations also result in lower levels of mature {alpha}-subunit protein compared to normal, and slightly reduced levels of {alpha}-subunit precursor protein. The Hex A deficiency resulting from benign mutations is not as great as that associated with disease-causing mutations.

  6. Recoil-range studies of heavy products of multinucleon transfer from 18O to 245Cm and 249Cf

    International Nuclear Information System (INIS)

    Recoil range distributions were measured for alpha and spontaneous fission activities made in the bombardment of 245Cm and 249Cf with 18O from 6.20 MeV/nucleon down to the interaction barrier. The shape of the distributions indicates tht transfers of up to four protons take place via a combination of quasi-elastic (QET) and deep inelastic (DIT) mechanisms, rather than complete fusion-de-excitation (CF) or massive transfer (MT). Angular distributions constructed from recoil range distributions, assuming QET/DIT, indicate that the QET component contributes more significantly to the heavy product residue cross section than the DIT, even though primary cross sections are expected to be higher for DIT than for QET. This may be explained qualitatively as a result of the high excitation energies associated with DIT; the very negative Q/sub gg/ of projectile stripping for these systems combined with the lower expected optimal Q/sub rxn/ of QET compared to DIT can give QET products comparatively low excitation

  7. X-ray nova MAXI J1828-249. Evolution of the broadband spectrum during its 2013-2014 outburst

    CERN Document Server

    Grebenev, S A; Burenin, R A; Krivonos, R A; Mescheryakov, A V

    2016-01-01

    Based on data from the SWIFT, INTEGRAL, MAXI/ISS orbital observatories, and the ground-based RTT-150 telescope, we have investigated the broadband (from the optical to the hard X-ray bands) spectrum of the X-ray nova MAXI J1828-249 and its evolution during the outburst of the source in 2013-2014. The optical and infrared emissions from the nova are shown to be largely determined by the extension of the power-law component responsible for the hard X-ray emission. The contribution from the outer cold regions of the accretion disk, even if the X-ray heating of its surface is taken into account, turns out to be moderate during the source's "high" state (when a soft blackbody emission component is observed in the X-ray spectrum) and is virtually absent during its "low" ("hard") state. This result suggests that much of the optical and infrared emissions from such systems originates in the same region of main energy release where their hard X-ray emission is formed. This can be the Compton or synchro-Compton radiati...

  8. Radiosensibility curve with 60 Co in guinea grass (Panicum maximum Jacq.) cv. 'K-249'

    International Nuclear Information System (INIS)

    In order to select the adequate radiosensibility criterion and useful dosis were studied the effects of gamma radiation on the embryogenic callus of guinea cv. K-249. The application dosages were 0, 10, 20, 40, 60, 80, 100, 150, 200, 250, 300 and 400 Gy and the measures evaluated were: increase of fresh mass of the callus in fresh medium, number of shoots, plantlets and total by callus and by gram of callus in regeneration medium. It was determined that the curves shaped with the number of shoots, plantlets and total by callus and by gram of callus were more radiosensible than that shoped with increase of fresh mass of the callus; as criterion of radiosensibility in this cultivar the total number of shoots and plantlets from gram of callus was selected for it's simplicity and veracity as much as in the evaluation and in the results. The useful dosis that determined one GR 10, 20, 50 and 70 percent were 16, 20, 29 and 160 Gy respectively. Albino shoots were also observed whose values were randomizely showed and it was observed albinism in 0 dosis. (author)

  9. Book review: Garden plots: the politics and poetics of gardens. By Shelley Saguaro. Aldershot, Hants and Burlington, VT: Ashgate Publishing Limited. 2006. xiii + 249 pp. #50.00 hardback. ISBN: 9780754637530

    OpenAIRE

    2008-01-01

    Book review: Garden plots: the politics and poetics of gardens. By Shelley Saguaro. Aldershot, Hants and Burlington, VT: Ashgate Publishing Limited. 2006. xiii + 249 pp. #50.00 hardback. ISBN: 9780754637530 Kingston University - (Preston, Rebecca)

  10. Evidence for association of D1S249 locus on human chromosome 1 with the susceptibility to essential hypertension in Han Chinese

    Institute of Scientific and Technical Information of China (English)

    2001-01-01

    Essential hypertension (EH) is thought to result from theinteraction of environmental and genetic factors. The molecular genetics of EH has witnessed considerable progress during the past few years. However, the number of genes involved, their chromosomal location and the magnitude of their effect on EH susceptibility are unknown. We conducted the present study to screen susceptibility genes to essential hypertension using a genome-wide scanning method in a group of Han people from Fangshan district located in the southwest of Beijing. A case-control study and affected sibpair were performed. Genotyping was carried out using a fluorescence-based semiautomated technique on automated DNA sequencer (ABI 377, PE). The basis for the genome-screen was the ABI prism linkage mapping sets of 400 microsatellite markers (version 2, PE, Co.). PCR for amplification of markers was carried out as multiplex reactions with Ampli Taq gold (PE, Co.) following protocols developed in our laboratory. Data were exported as a text file from genotyper for subsequent two-point affected sibpair linkage analysis. The data from case-control association study showed a linkage disequilibrium between EH and marker D1S249 locus (X2 = 14.6, P = 0.002). There are 12 alleles in the D1S249 locus. The frequency of A9 allele in hypertension was higher than in normotensives, (13.6% v.s. 2.7%, X2 = 6.30, p = 0.01, OR = 4.57, 95%CI = 1.24-25.4). The data from two-point affected sibpair linkage analysis demonstrated a linkage between EH and A9 allele, P<0.05. It suggested that microsatellite marker D1S249 locus might be associated with the genetic susceptibility to essential hypertension in Han Chinese.

  11. Calculations of the cross sections for synthesis of new {293-296}118 isotopes in {249-252}Cf(48Ca,xn) reactions

    CERN Document Server

    Cap, T; Kowal, M; Wilczynski, J

    2013-01-01

    A project of using a target consisting of the mixture of (249-252)Cf isotopes to be bombarded with the 48Ca beam, aimed to synthesize new isotopes of the heaviest known element Z = 118, is under way at the FLNR in Dubna. In the present work excitation functions for all the reactions: 249Cf(48Ca,xn)(297-x)118, 250Cf(48Ca,xn)(298-x)118, 251Cf(48Ca,xn)(299-x)118 and 252Cf(48Ca,xn)(300-x)118 have been calculated in the framework of the fusion-by-diffusion model, assuming fission barriers, ground-state masses and shell effects of the superheavy nuclei predicted by Kowal et al. Energy dependence of the effective cross sections for the synthesis of selected new isotopes: (293)118, (294)118, (295)118 and (296)118 is predicted for the particular isotopic composition of the Cf target prepared for the Dubna experiment.

  12. Observation of high-j quasiparticle states in Cm249 by in-beam γ-ray spectroscopy using heavy-ion transfer reactions

    Science.gov (United States)

    Ishii, T.; Makii, H.; Asai, M.; Tsukada, K.; Toyoshima, A.; Matsuda, M.; Makishima, A.; Shigematsu, S.; Kaneko, J.; Shizuma, T.; Toume, H.; Hossain, I.; Kohno, T.; Ogawa, M.

    2008-11-01

    We have measured de-excitation γ rays in Cm249 populated by one-neutron stripping reactions with a Cm248 target and 162-MeV O16, 162-MeV O18, and 120-MeV C13 beams. γ rays in Cm249 were identified by measuring kinetic energies of outgoing particles using Si ΔE-E detectors. It was demonstrated that high-j orbitals were selectively populated in the (O16, O15) reaction having a large negative Q value. We have observed eight quasiparticle states above the deformed shell gap of N=152. The 1/2+[620], 1/2-[750], and 7/2+[613] bands were extended up to 19/2+, 19/2-, and 13/2+ states, respectively. We have established the 9/29/2+[615] state at 526 keV, the 9/29/2+[604] state with a short life of T1/2≪2 ps at 1030 keV, and the 11/211/2-[725] state with T1/2=19(1) ns at 375 keV. Furthermore, the 17/21/2+[880] state, having a large component of the k17/2 spherical single-particle state, has been identified at 1505 keV. We discuss the properties of those quasiparticle states in the framework of a deformed shell model.

  13. Observation of high-j quasiparticle states in 249Cm by in-beam γ-ray spectroscopy using heavy-ion transfer reactions

    International Nuclear Information System (INIS)

    We have measured de-excitation γ rays in 249Cm populated by one-neutron stripping reactions with a 248Cm target and 162-MeV 16O, 162-MeV 18O, and 120-MeV 13C beams. γ rays in 249Cm were identified by measuring kinetic energies of outgoing particles using Si ΔE-E detectors. It was demonstrated that high-j orbitals were selectively populated in the (16O, 15O) reaction having a large negative Q value. We have observed eight quasiparticle states above the deformed shell gap of N=152. The 1/2+[620], 1/2-[750], and 7/2+[613] bands were extended up to 19/2+, 19/2-, and 13/2+ states, respectively. We have established the 9/2 9/2+[615] state at 526 keV, the 9/2 9/2+[604] state with a short life of T1/2-[725] state with T1/2=19(1) ns at 375 keV. Furthermore, the 17/2 1/2+[880] state, having a large component of the k17/2 spherical single-particle state, has been identified at 1505 keV. We discuss the properties of those quasiparticle states in the framework of a deformed shell model

  14. Dense Fe-Rich Ejecta in Supernova Remnants DEM L238 and DEM L249: A New Class of Type Ia Supernova?

    CERN Document Server

    Borkowski, K J; Reynolds, S P

    2006-01-01

    We present observations of two LMC supernova remnants (SNRs), DEM L238 and DEM L249, with the Chandra and XMM-Newton X-ray satellites. Bright central emission, surrounded by a faint shell, is present in both remnants. The central emission has an entirely thermal spectrum dominated by strong Fe L-shell lines, with the deduced Fe abundance in excess of solar and not consistent with the LMC abundance. This Fe overabundance leads to the conclusion that DEM L238 and DEM L249 are remnants of thermonuclear (Type Ia) explosions. The shell emission originates in gas swept up and heated by the blast wave. A standard Sedov analysis implies about 50 solar masses in both swept-up shells, SNR ages between 10,000 and 15,000 yr, low (< 0.05 cm^-3) preshock densities, and subluminous explosions with energies of 3x10^50 ergs. The central Fe-rich supernova ejecta are close to collisional ionization equilibrium. Their presence is unexpected, because standard Type Ia SNR models predict faint ejecta emission with short ionizati...

  15. A Novel Substitution of The Heme-binding Residue Histidine-245 by Histidine-249 in Heme Oxygenase HugZ%血红素氧合酶HugZ组氨酸-249对组氨酸-245侧链缺失补偿的结构基础

    Institute of Scientific and Technical Information of China (English)

    沈溪辉; 胡永林; 王大成

    2012-01-01

    The heme oxygenase HugZ from Helicobacter pylori plays essential roles in the colonization of the bacteria in human hosts and is required for the utilization of heme as the sole iron source. Residue His245, which is highly conserved, coordinates the heme iron through its sidechain imidazole group. Surprisingly, this residue was not required for the enzymatic activities of HugZ. To investigate the roles played by His245 in heme binding and enzymatic mechanisms of HugZ, we have solved the crystal structure of HugZ mutant H245A at 2.55 (A) resolution and found that a nearby histidine residue, His249, coordinates the heme iron. This substitution is made possible by the fact that both residues 245 and 249 are located in a flexible loop region ranged from Gly239 to the C-terminus. Similar structural features have not been observed in other heme oxygenases so far. We have also performed spectroscopic studies on the heme-binding properties of HugZ and relevant mutants and our results suggest that the flexible C-terminal loop region of HugZ and the presence of multiple histidine residues in this region may play important roles in heme recruiting and in the catalytic mechanisms of HugZ.%血红素氧合酶HugZ是幽门螺旋杆菌(Helicobacter pylori)利用宿主血红素作为铁源的关键蛋白.HugZ的His245残基侧链咪唑基与血红素中心铁配位结合,是酶活中心的重要组成部分.用定点突变的方法构建HugZ突变体H245A、H249A和H245A/H249A基因,并将突变体蛋白表达纯化.通过X射线晶体学途径解析了突变体H245A与血红素复合物的2.55(A)分辨率晶体结构.结构解析表明,HugZ的His249残基侧链咪唑基团与血红素的铁原子结合,从而补偿了His245侧链缺失.这种结构特征在已知血红素氧合酶中未曾发现.Va1238ψ平面的可翻转和Gly239的柔性是His249能与血红素配位结合的关键原因,二者的共同作用改变了C端肽链的走向,使Va1238与His249之间的柔性

  16. Modified model of neutron resonances widths distributions. Results of reduced neutron widths approximation for mass region 35 ≤ A ≤ 249

    International Nuclear Information System (INIS)

    The distributions of the reduced neutron widths of s-, p- and d-resonances of nuclei of any type from nuclear mass region 35 ≤ A ≤ 249 were approximated with maximal precision by the model which presents experimental data set as a superposition of a maximum of four independent neutron amplitudes. Under the assumption that each of these amplitudes has the Gauss distribution with the unique maximum there were determined the most probable values of contribution of each amplitude in summary width distribution, their most probable mean values and dispersions. Comparison of the obtained χ2 values with value χ2 at description of the experimental data by one distribution of neutron amplitudes with best fitted parameters shows that all widths from more than 157 analyzed data sets can have different types of wave functions

  17. Comment on “Human impacts on headwater fluvial systems in the northern and central Andes” (Carol P. Harden, Geomorphology 79, 249 263)

    Science.gov (United States)

    Buytaert, Wouter; De Bièvre, Bert; Celleri, Rolando; Cisneros, Felipe; Wyseure, Guido; Deckers, Seppe

    2008-04-01

    The high altitude grasslands of the tropical Andes, known as páramo, are a very fragile and unique ecosystem. Despite increasing human activities, many of its geomorphological and hydrological processes are still very poorly understood. We therefore welcome the paper of Harden [Harden, C.P., 2006. Human impacts on headwater fluvial systems in the northern and central Andes. Geomorphology 79, 249-263.] about "Human impacts on headwater fluvial systems in the northern and central Andes" as a valuable contribution to a better understanding of this complex ecosystem. However, in view of the available literature, we would like to complement the interpretation of the presented results and discuss some of the claims made in the paper.

  18. Eleven new heaviest isotopes of elements Z=105 to Z=117 identified among the products of 249Bk+48Ca reactions

    International Nuclear Information System (INIS)

    The heaviest isotopes of elements Z=117 to Z=105, 294117, 293117, 290115, 289115, 286113, 285113, 282Rg, 281Rg, 278Mt, 274Bh, and 270Db, were identified by means of the Dubna gas-filled recoil separator among the products of the 249Bk + 48Ca reaction. The details of the observed six decay chains, indicating the production and decay of isotopes 293117 and 294117, are presented and discussed. The decay energies and resulting half-lives of these new nuclei show a strong rise of stability with increasing neutron number, validating the concept of the island of enhanced stability for superheavy nuclei [Oganessian et al., Phys. Rev. Lett. 104, 142502 (2010)].

  19. Creación de un manual para el diseño e implementación de videojuegos en Blender 2.49b

    OpenAIRE

    Peral Castro, Roberto

    2010-01-01

    El objetivo principal de este proyecto, es crear un manual de referencia rápida, que enseñe a diseñar un videojuego del modo más sencillo y guiado posible, con la herramienta Blender en su versión 2.49b. No se pretende que sea un manual teórico que explique las propiedades físicas de los objetos, los distintos tipos de texturas, o los métodos de programación aplicables a los videojuegos. Con las herramientas de diseño que existen hoy en día, y haciendo una medición basada en la experiencia...

  20. Crystal structure of apatite type Ca2.49Nd7.51(SiO4)6O1.75.

    Science.gov (United States)

    Le, Thu Hoai; Brooks, Neil R; Binnemans, Koen; Blanpain, Bart; Guo, Muxing; Van Meervelt, Luc

    2016-02-01

    The title compound, Ca2+x Nd8-x (SiO4)6O2-0.5x (x = 0.49), was synthesized at 1873 K and rapidly quenched to room temperature. Its structure has been determined using single-crystal X-ray diffraction and compared with results reported using neutron and X-ray powder diffraction from samples prepared by slow cooling. The single-crystal structure from room temperature data was found to belong to the space group P63/m and has the composition Ca2.49Nd7.51(SiO4)6O1.75 [dicalcium octa-neodymium hexa-kis-(ortho-silicate) dioxide], being isotypic with natural apatite and the previously reported Ca2Nd8(SiO4)6O2 and Ca2.2Nd7.8(SiO4)6O1.9. The solubility limit of calcium in the equilibrium state at 1873 K was found to occur at a composition of Ca2+x Nd8-x (SiO4)6O2-0.5x , where x = 0.49. PMID:26958389

  1. Recoil-range studies of heavy products of multinucleon transfer from /sup 18/O to /sup 245/Cm and /sup 249/Cf

    Energy Technology Data Exchange (ETDEWEB)

    McFarland, R.M.

    1982-09-01

    Recoil range distributions were measured for alpha and spontaneous fission activities made in the bombardment of /sup 245/Cm and /sup 249/Cf with /sup 18/O from 6.20 MeV/nucleon down to the interaction barrier. The shape of the distributions indicates tht transfers of up to four protons take place via a combination of quasi-elastic (QET) and deep inelastic (DIT) mechanisms, rather than complete fusion-de-excitation (CF) or massive transfer (MT). Angular distributions constructed from recoil range distributions, assuming QET/DIT, indicate that the QET component contributes more significantly to the heavy product residue cross section than the DIT, even though primary cross sections are expected to be higher for DIT than for QET. This may be explained qualitatively as a result of the high excitation energies associated with DIT; the very negative Q/sub gg/ of projectile stripping for these systems combined with the lower expected optimal Q/sub rxn/ of QET compared to DIT can give QET products comparatively low excitation.

  2. Crystal structure of apatite type Ca2.49Nd7.51(SiO46O1.75

    Directory of Open Access Journals (Sweden)

    Thu Hoai Le

    2016-02-01

    Full Text Available The title compound, Ca2+xNd8–x(SiO46O2–0.5x (x = 0.49, was synthesized at 1873 K and rapidly quenched to room temperature. Its structure has been determined using single-crystal X-ray diffraction and compared with results reported using neutron and X-ray powder diffraction from samples prepared by slow cooling. The single-crystal structure from room temperature data was found to belong to the space group P63/m and has the composition Ca2.49Nd7.51(SiO46O1.75 [dicalcium octaneodymium hexakis(orthosilicate dioxide], being isotypic with natural apatite and the previously reported Ca2Nd8(SiO46O2 and Ca2.2Nd7.8(SiO46O1.9. The solubility limit of calcium in the equilibrium state at 1873 K was found to occur at a composition of Ca2+xNd8–x(SiO46O2–0.5x, where x = 0.49.

  3. Characterization of CCR5△32、 CCR2b-64I、 CX3CR1-249I280M and SDF1-3'A Allelic Polymorphisms in the Chinese Uygur Population

    Institute of Scientific and Technical Information of China (English)

    LIU Mingxu(刘明旭); WANG Fusheng(王福生); JIN Lei(金磊); HONG Weiguo(洪卫国); LEI Zhouyun(雷周云); ZHANG Bing(张冰); HOU Jing(候静); ZHANG Zhanping(张战平); TANG Chunjun(唐纯军)

    2002-01-01

    Objectives: Allelic polymorphisms of CCR5△32 、CCR2b-64I,CX3CR1-249I280M and SDF1-3'A associatedwith HIV-1 infection and disease progression wereinvestigated in indigenous Uygur populations from theXinjiang Uygur Autonomous Region of China.Methods: The study population comprised 316 healthyUygur subjects with an age range of 1-80 years old, fromwhom whole peripheral blood samples were collected andnone were HIV-1 seropositive. Genomic DNA samples werepurified using a Qiagen Blood Kit. Genotyping of theaforementioned four alleles was performed using PCR orPCR/RFLP assay, and further confirmed by direct DNAsequencing.Results: The allelic frequencies in Chinese Uygurpopulation were as follows: 3.48% for CCR5△32; 19.45% forCCR2b-64I; 13.8% for CX3CR1-249I280M haplotype, and20.41% for SDF1-3'A. Mutant allele distributions amongUygur populations were in accordance with theHardy-Weinberg equilibrium. No statistical difference wasfound between the frequency of the three HIV coreceptors andtheir respective ligand genes.Conclusion: The frequency of SDF1-3'A andCX3CR1-249I280M haplotypes in these Uygur populationswas similar to that of Caucasian people, while the frequency ofthe CCR2b-64I haplotype more closely matched the HanChinese. The frequency of CCR5△32 in Uygur populationswas between Caucasian and Han frequencies, the more closelymatching the frequency in Medi-Asia people. No geneticlinkage between any two of the three HIV coreceptor geneswas found, but obvious genetic linkages existed betweenCX3CR1-249I and CX3CR1-280M,with even higher linkagedegrees than Caucasian people.

  4. Thomas Le Roux (dir.), « L’émergence du risque industriel (France, Grande-Bretagne, XVIIIe – XIXe siècles), Le Mouvement social, n° 249

    OpenAIRE

    El Hage, Fadi

    2015-01-01

    L’histoire de l’industrie ne peut être pensée en faisant abstraction des risques. L’ère de la révolution industrielle a par ailleurs attiré l’attention sur ceux-ci, les risques industriels ayant remplacé les risques urbains plus classiques, comme les incendies de quartiers majoritairement construits en bois. Cette mutation du risque est le point de départ chronologique de la riche réflexion proposée par le numéro 249 de la revue Le Mouvement social autour de « l’émergence du risque industriel...

  5. Magnetic measurements of the transuranium elements. Progress report, January 1, 1984-December 31, 1984

    International Nuclear Information System (INIS)

    Measurements of the magnetic properties of dhcp californium-249 metal indicated the presence of three regions of differing magnetic character. Additional measurements are also reported. Magnetic moments and valence states of terbium in TbF3, BaTbO3, and TbO18 are discussed. Progress on high-field operation of the micro-magnetic susceptometer is reported

  6. Survey of potential markets for devices using Californium-252

    International Nuclear Information System (INIS)

    Potential applications for devices or systems containing 252Cf in the years from 1975 to 1980 are estimated. The estimated number of devices and associated business value were derived from a survey of 46 industrial, educational and governmental organizations conducted from Jan. to May, 1975. Applications for devices and systems based on 252Cf are expected to increase by a factor of 7 in the 6-y period from 1975 to 1980. The annual business value of 252Cf devices should increase from 1.5 million dollars in 1975 to 10.8 million dollars in 1980. The potential European market should be several times as large as the US market, based on actual sales of 252Cf, which have been two to four times greater in Europe than in the US

  7. The protective cell petrus for the production of californium 252

    International Nuclear Information System (INIS)

    The alpha, beta, gamma, neutron cell which is described in the present paper is devoted to the transplutonium element production and study. It is located at the CEN in Fontenay-aux-Roses (France). The 4 feet ordinary concrete shielding made of stacked blocs allows the manipulation of radioactive sources as high as 1000 curies of 1 MeV gamma rays and with a fast neutrons flux of 109 n.cm-2.s-1. The airtight alpha containment box is equipped with two transfer systems, one consists of a parallelepiped shaped airtight box located in a turntable, the other uses standard cylindrical containers made of polyethylene. The general equipment and the main setting up are also described. (authors)

  8. Californium-252 neutron activation facility at the Savannah River Laboratory

    International Nuclear Information System (INIS)

    A neutron irradiation facility has been established to develop new analytical methods and for the support of research programs. A major component of this facility is a 252Cf source which provides both fission spectrum and thermal neutrons. (U.S.)

  9. Californium-252 brachytherapy for anal and ano-rectal carcinoma

    International Nuclear Information System (INIS)

    Surgery has historically been the standard treatment for anal, ano-rectal and rectal carcinoma but is prone to local or regional failure. Over the past 15 years there has been increasing interest in and success with radiation therapy and combined chemoradiotherapy for treatment of anal and ano-rectal cancers. Cf-252 brachytherapy combined with external beam teletherapy has been investigated for anal and ano-rectal lesions at the Univ. of Kentucky with encouraging results

  10. Mobile equipment for neutron radiography using a californium-252 source

    International Nuclear Information System (INIS)

    The basic requirements for successful neutron radiography are first summarised and the use of 252Cf is placed in perspective by comparing its properties with those of sources based on the Be (γ, n) and Be (α, n) reactions which have a broadly similar range of applications. The more essential design features of mobile neutron radiography equipment are next examined in some detail, to show how the often conflicting requirements of optimum beam production and adequate shielding may be reconciled. An assembly with a maximum dimension around 1 m with a source of 1 mg is used as an example. The design data used are reproduced in graphical form to permit designs to be scaled to suit the source available and the requirements. The selection of suitable image recorders for 252Cf radiography is discussed with the conclusion that the gadolinium foil-film combinations are likely to remain the normal choice. Demonstration radiographs are presented with particular reference to the location of residual casting sand in gas-cooled turbine blades. Finally, it is suggested that other applications for mobile 252Cf-based neutron radiography equipment will be found in the ordnance, aero-space, chemical and nuclear fuel manufacturing industries. (author)

  11. Automated absolute activation analysis with californium-252 sources

    Energy Technology Data Exchange (ETDEWEB)

    MacMurdo, K.W.; Bowman, W.W.

    1978-09-01

    A 100-mg /sup 252/Cf neutron activation analysis facility is used routinely at the Savannah River Laboratory for multielement analysis of many solid and liquid samples. An absolute analysis technique converts counting data directly to elemental concentration without the use of classical comparative standards and flux monitors. With the totally automated pneumatic sample transfer system, cyclic irradiation-decay-count regimes can be pre-selected for up to 40 samples, and samples can be analyzed with the facility unattended. An automatic data control system starts and stops a high-resolution gamma-ray spectrometer and/or a delayed-neutron detector; the system also stores data and controls output modes. Gamma ray data are reduced by three main programs in the IBM 360/195 computer: the 4096-channel spectrum and pertinent experimental timing, counting, and sample data are stored on magnetic tape; the spectrum is then reduced to a list of significant photopeak energies, integrated areas, and their associated statistical errors; and the third program assigns gamma ray photopeaks to the appropriate neutron activation product(s) by comparing photopeak energies to tabulated gamma ray energies. Photopeak areas are then converted to elemental concentration by using experimental timing and sample data, calculated elemental neutron capture rates, absolute detector efficiencies, and absolute spectroscopic decay data. Calculational procedures have been developed so that fissile material can be analyzed by cyclic neutron activation and delayed-neutron counting procedures. These calculations are based on a 6 half-life group model of delayed neutron emission; calculations include corrections for delayed neutron interference from /sup 17/O. Detection sensitivities of < or = 400 ppB for natural uranium and 8 ppB (< or = 0.5 (nCi/g)) for /sup 239/Pu were demonstrated with 15-g samples at a throughput of up to 140 per day. Over 40 elements can be detected at the sub-ppM level.

  12. Californium-based neutron radiography for corrosion detection in aircraft

    International Nuclear Information System (INIS)

    In support of an overall program aimed at minimizing disassembly and reducing inspection time during aircraft maintenance, a series of projects has been carried out to determine the feasibility of applying neutron radiographic techniques to the nondestructive (NDT) inspection of aircraft and aircraft components. These investigations have clearly demonstrated the superiority of neutron radiography over all other NDT techniques in its ability to detect surface and subsurface corrosion in aircraft structure. This capability is particularly significant where the corrosion is hidden behind thick metallic structural members. The neutron radiographic technique has been applied successfully to detect corrosion in the wing tank of E-2C, C-130, and DC-9 aircraft; rear stabilators of F-4 and F-111 aircraft; aft spar, starboard and port wing, and rudder of the F-8; fuselage skin of the 727; rotary blades of AH-1 and SH-3 helicopters; rotary tail flaps of the UH-2 helicopter; and nose landing gear of A-7 aircraft

  13. Automated absolute activation analysis with californium-252 sources

    International Nuclear Information System (INIS)

    A 100-mg 252Cf neutron activation analysis facility is used routinely at the Savannah River Laboratory for multielement analysis of many solid and liquid samples. An absolute analysis technique converts counting data directly to elemental concentration without the use of classical comparative standards and flux monitors. With the totally automated pneumatic sample transfer system, cyclic irradiation-decay-count regimes can be pre-selected for up to 40 samples, and samples can be analyzed with the facility unattended. An automatic data control system starts and stops a high-resolution gamma-ray spectrometer and/or a delayed-neutron detector; the system also stores data and controls output modes. Gamma ray data are reduced by three main programs in the IBM 360/195 computer: the 4096-channel spectrum and pertinent experimental timing, counting, and sample data are stored on magnetic tape; the spectrum is then reduced to a list of significant photopeak energies, integrated areas, and their associated statistical errors; and the third program assigns gamma ray photopeaks to the appropriate neutron activation product(s) by comparing photopeak energies to tabulated gamma ray energies. Photopeak areas are then converted to elemental concentration by using experimental timing and sample data, calculated elemental neutron capture rates, absolute detector efficiencies, and absolute spectroscopic decay data. Calculational procedures have been developed so that fissile material can be analyzed by cyclic neutron activation and delayed-neutron counting procedures. These calculations are based on a 6 half-life group model of delayed neutron emission; calculations include corrections for delayed neutron interference from 17O. Detection sensitivities of 239Pu were demonstrated with 15-g samples at a throughput of up to 140 per day. Over 40 elements can be detected at the sub-ppM level

  14. An experimental investigation of M-subshell fluorescence yields and of the L1-L3 radiative transition in neptunium and curium from the radioactive decays of 241Am and 249Cf

    International Nuclear Information System (INIS)

    The construction and performance of a wall-less multiwire proportional counter (MWPC) is described. The absolute emission rate of M x rays from a 241Am source was measured with the MWPC and with a single-wire proportional counter and a value of (6.35 +- 0.60) x 10-2 M x rays per decay, or (0.470 +- 0.045) M x rays per L/sub α/ x ray is obtained. High resolution Ge(Li) and Si(Li) x-ray spectrometers and the multiwire proportional counter (MWPC) were used for measuring coincidences, respectively, between various L x rays and the M x rays of neptunium (Z = 93) from a 241Am source. In addition, M x rays of curium from a 249Cf source were measured with a Si(Li) detector in coincidence with various K and L x rays detected with a Ge(Li) spectrometer. 81 refs., 24 figs., 23 tabs

  15. Solution of the Skyrme-Hartree-Fock-Bogolyubov equations in the Cartesian deformed harmonic-oscillator basis. (VII) HFODD (v2.49s): a new version of the program

    CERN Document Server

    Schunck, N; McDonnell, J; Satula, W; Sheikh, J A; Staszczak, A; Stoitsov, M; Toivanen, P

    2011-01-01

    We describe the new version (v2.49s) of the code HFODD which solves the nuclear Skyrme Hartree-Fock (HF) or Skyrme Hartree-Fock-Bogolyubov (HFB) problem by using the Cartesian deformed harmonic-oscillator basis. In the new version, we have implemented the following physics features: (i) the isospin mixing and projection, (ii) the finite temperature formalism for the HFB and HF+BCS methods, (iii) the Lipkin translational energy correction method, (iv) the calculation of the shell correction. A number of specific numerical methods have also been implemented in order to deal with large-scale multi-constraint calculations and hardware limitations: (i) the two-basis method for the HFB method, (ii) the Augmented Lagrangian Method (ALM) for multi-constraint calculations, (iii) the linear constraint method based on the approximation of the RPA matrix for multi-constraint calculations, (iv) an interface with the axial and parity-conserving Skyrme-HFB code HFBTHO, (v) the mixing of the HF or HFB matrix elements instead...

  16. Solution of the Skyrme-Hartree-Fock-Bogolyubov equations in the Cartesian deformed harmonic-oscillator basis. (VII) HFODD (v2.49t): A new version of the program

    International Nuclear Information System (INIS)

    We describe the new version (v2.49t) of the code HFODD which solves the nuclear Skyrme Hartree-Fock (HF) or Skyrme Hartree-Fock-Bogolyubov (HFB) problem by using the Cartesian deformed harmonic-oscillator basis. In the new version, we have implemented the following physics features: (i) the isospin mixing and projection, (ii) the finite temperature formalism for the HFB and HF+BCS methods, (iii) the Lipkin translational energy correction method, (iv) the calculation of the shell correction. A number of specific numerical methods have also been implemented in order to deal with large-scale multi-constraint calculations and hardware limitations: (i) the two-basis method for the HFB method, (ii) the Augmented Lagrangian Method (ALM) for multi-constraint calculations, (iii) the linear constraint method based on the approximation of the RPA matrix for multi-constraint calculations, (iv) an interface with the axial and parity-conserving Skyrme-HFB code HFBTHO, (v) the mixing of the HF or HFB matrix elements instead of the HF fields. Special care has been paid to using the code on massively parallel leadership class computers. For this purpose, the following features are now available with this version: (i) the Message Passing Interface (MPI) framework, (ii) scalable input data routines, (iii) multi-threading via OpenMP pragmas, (iv) parallel diagonalization of the HFB matrix in the simplex breaking case using the ScaLAPACK library. Finally, several little significant errors of the previous published version were corrected.

  17. Identification of a novel BRCA1 nucleotide 4803delCC/c.4684delCC mutation and a nucleotide 249T>A/c.130T>A (p.Cys44Ser) mutation in two Greenlandic Inuit families

    DEFF Research Database (Denmark)

    Hansen, Thomas van Overeem; Jønson, Lars; Albrechtsen, Anders;

    2010-01-01

    >A/c.130T>A (p.Cys44Ser) mutation in another Greenlandic individual with ovarian cancer. This patient share a 1-2 Mb genomic fragment, containing the BRCA1 gene, with four Danish families harbouring the same mutation, suggesting that the 249T>A/c.130T>A (p.Cys44Ser) mutation originates from a Danish...

  18. Identification of a novel BRCA1 nucleotide 4803delCC/c.4684delCC mutation and a nucleotide 249T>A/c.130T>A (p.Cys44Ser) mutation in two Greenlandic Inuit families: implications for genetic screening of Greenlandic Inuit families with high risk for breast and/or ovarian cancer

    DEFF Research Database (Denmark)

    Hansen, Thomas V O; Jønson, Lars; Albrechtsen, Anders;

    2010-01-01

    >A/c.130T>A (p.Cys44Ser) mutation in another Greenlandic individual with ovarian cancer. This patient share a 1-2 Mb genomic fragment, containing the BRCA1 gene, with four Danish families harbouring the same mutation, suggesting that the 249T>A/c.130T>A (p.Cys44Ser) mutation originates from a Danish...

  19. 7 CFR 249.4 - State Plan.

    Science.gov (United States)

    2010-01-01

    ... procedures for identifying and certifying eligible SFMNP participants, including the specific age and income... description of age- and circumstance-appropriate nutrition education to be provided to SFMNP participants.../proxy and (if applicable) farmer are required to sign, stamp, or otherwise endorse the coupon before...

  20. 7 CFR 249.2 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... of Columbia, the Commonwealth of Puerto Rico, the Virgin Islands, Guam, and as applicable, American..., vegetables, honey, and herbs for human consumption. Eligible foods may not be processed or prepared...

  1. 7 CFR 249.12 - SFMNP costs.

    Science.gov (United States)

    2010-01-01

    ...-up; (2) The costs associated with the provision of nutrition education that meets the requirements of... Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS SENIOR FARMERS' MARKET NUTRITION PROGRAM (SFMNP) State Agency Provisions §...

  2. 7 CFR 249.7 - Nondiscrimination.

    Science.gov (United States)

    2010-01-01

    ... discrimination, under the SFMNP: (i) Title VI of the Civil Rights Act of 1964; (ii) Title IX of the Education Amendments of 1972; (iii) Section 504 of the Rehabilitation Act of 1973; (iv) The Age Discrimination Act of... title); and (vi) Applicable FNS Instructions, including requirements for racial and ethnic...

  3. 25 CFR 249.3 - Identification cards.

    Science.gov (United States)

    2010-04-01

    ... the issuance of an appropriate identification card to any Indian entitled thereto as prima facie... any Federal, State, or tribal enforcement officer shall be prima facie evidence that the person is...

  4. Solution of the Skyrme-Hartree-Fock-Bogolyubov equations in the Cartesian deformed harmonic-oscillator basis.. (VII) HFODD (v2.49t): A new version of the program

    Science.gov (United States)

    Schunck, N.; Dobaczewski, J.; McDonnell, J.; Satuła, W.; Sheikh, J. A.; Staszczak, A.; Stoitsov, M.; Toivanen, P.

    2012-01-01

    We describe the new version (v2.49t) of the code HFODD which solves the nuclear Skyrme-Hartree-Fock (HF) or Skyrme-Hartree-Fock-Bogolyubov (HFB) problem by using the Cartesian deformed harmonic-oscillator basis. In the new version, we have implemented the following physics features: (i) the isospin mixing and projection, (ii) the finite-temperature formalism for the HFB and HF + BCS methods, (iii) the Lipkin translational energy correction method, (iv) the calculation of the shell correction. A number of specific numerical methods have also been implemented in order to deal with large-scale multi-constraint calculations and hardware limitations: (i) the two-basis method for the HFB method, (ii) the Augmented Lagrangian Method (ALM) for multi-constraint calculations, (iii) the linear constraint method based on the approximation of the RPA matrix for multi-constraint calculations, (iv) an interface with the axial and parity-conserving Skyrme-HFB code HFBTHO, (v) the mixing of the HF or HFB matrix elements instead of the HF fields. Special care has been paid to using the code on massively parallel leadership class computers. For this purpose, the following features are now available with this version: (i) the Message Passing Interface (MPI) framework, (ii) scalable input data routines, (iii) multi-threading via OpenMP pragmas, (iv) parallel diagonalization of the HFB matrix in the simplex-breaking case using the ScaLAPACK library. Finally, several little significant errors of the previous published version were corrected. New version program summaryProgram title:HFODD (v2.49t) Catalogue identifier: ADFL_v3_0 Program summary URL:http://cpc.cs.qub.ac.uk/summaries/ADFL_v3_0.html Program obtainable from: CPC Program Library, Queen's University, Belfast, N. Ireland Licensing provisions: GNU General Public Licence v3 No. of lines in distributed program, including test data, etc.: 190 614 No. of bytes in distributed program, including test data, etc.: 985 898 Distribution

  5. Characterization of berkelium(III) dipicolinate and borate compounds in solution and the solid state.

    Science.gov (United States)

    Silver, Mark A; Cary, Samantha K; Johnson, Jason A; Baumbach, Ryan E; Arico, Alexandra A; Luckey, Morgan; Urban, Matthew; Wang, Jamie C; Polinski, Matthew J; Chemey, Alexander; Liu, Guokui; Chen, Kuan-Wen; Van Cleve, Shelley M; Marsh, Matthew L; Eaton, Teresa M; van de Burgt, Lambertus J; Gray, Ashley L; Hobart, David E; Hanson, Kenneth; Maron, Laurent; Gendron, Frédéric; Autschbach, Jochen; Speldrich, Manfred; Kögerler, Paul; Yang, Ping; Braley, Jenifer; Albrecht-Schmitt, Thomas E

    2016-08-26

    Berkelium is positioned at a crucial location in the actinide series between the inherently stable half-filled 5f(7) configuration of curium and the abrupt transition in chemical behavior created by the onset of a metastable divalent state that starts at californium. However, the mere 320-day half-life of berkelium's only available isotope, (249)Bk, has hindered in-depth studies of the element's coordination chemistry. Herein, we report the synthesis and detailed solid-state and solution-phase characterization of a berkelium coordination complex, Bk(III)tris(dipicolinate), as well as a chemically distinct Bk(III) borate material for comparison. We demonstrate that berkelium's complexation is analogous to that of californium. However, from a range of spectroscopic techniques and quantum mechanical calculations, it is clear that spin-orbit coupling contributes significantly to berkelium's multiconfigurational ground state. PMID:27563098

  6. Capture cross section measurement analysis in the Californium-252 spectrum with the Monte Carlo method

    International Nuclear Information System (INIS)

    Absolute average capture cross sections of gold, thorium, tantalum, molybdenum, copper and strontium in 252Cf spontaneous fission neutron spectrum were simulated for two types of experiment setups preformed by Z. Dezso and J. Csikai and by L. Green. The experiments were simulated with MCNP5 using cross section data from the ENDF/B-VII.0 library. The determination of neutron backscattering was calculated with the use of neutron flagging. Correction factors to experimentally measured values were determined to obtain average cross sections in a pure 252Cf spontaneous fission spectrum. Influence of concrete wall thickness, air moisture and room size on the average cross section was analyzed. Correction factors amounted to about 30%. Corrected values corresponding to average cross sections in a pure 252Cf spectrum were calculated for 197Au, 232Th, 181Ta, 98Mo, 65Cu and 84Sr. Average cross sections were also calculated with the RR-UNC software using IRDFF-v.1.05 and ENDF/B-VII.0 libraries. The revised average radiative capture cross sections are 75.5±0.1 mb for 197Au, 87.0±1.6 mb for 232Th , 98.0±4.5 mb for 181Ta, 21.2±0.5 mb for 98Mo, 10.3±0.3 mb for 63Cu, and 34.9±6.5 mb for 84Sr. - Highlights: • Average capture cross sections in 252Cf spontaneous fission spectrum were simulated. • Calculations were done using MCNP5 code and ENDF/B-VII.0 library. • Correction factors for self-shielding and room return effects were taken into account. • The revised average radiative capture cross sections for different materials are published

  7. Multi-element neutron activation analysis of sediment using a californium-252 source

    International Nuclear Information System (INIS)

    The application of a 252Cf source to the neutron activation analysis of several elements in small (approximately 1.5 in. in dia) cores was studied using high-resolution gamma ray spectroscopy and manual data reduction. (U.S.)

  8. OER of californium-252 at low dose rate for growth inhibition in Vicia faba

    International Nuclear Information System (INIS)

    OER of 252Cf, at low dose rate, has been determined for growth inhibition in Vicia faba roots. A new strain ''BelB'' was used; it was found to be more resistant to prolonged anoxia. Two sets of linear 252Cf sources were used (linear activity 0.31 and 0.47 (μg.cm-1)) in somewhat different geometrical arrangements. The (n+γ) 252Cf dose rates at the level of the root tips were 0.11 and 0.13 Gy.h-1 respectively. The relative contribution of the γ component Dsub(γ) to the total absorbed dose Dsub(n+γ) at the level of the root tips was evaluated Dsub(γ)/Dsub(n+γ)=0.35 for the first source-geometry and 0.42 for the second source-geometry. The reference radiation was the γ emission of 192Ir, used in the same geometrical conditions and for similar irradiation times. Irradiations performed in aerobic and anoxic conditions were alternated. OER values of 1.4 +- 0.1 and 1.5 +- 0.1 were observed for the 252Cf emission with the first and second source-geometry respectively. The corresponding OER values for 192Ir were 2.3 +- 0.2 and 2.6 +- 0.1; the derived oxygen gain factors were then equal to 1.6 and 1.7 repectively

  9. 7 CFR 2.49 - Administrator, Rural Housing Service.

    Science.gov (United States)

    2010-01-01

    ... joint regulations issued pursuant thereto by the Attorney General and the Comptroller General (4 CFR... Executive Order 12580, 3 CFR, 1987 Comp., p. 193, under the following provisions of the Comprehensive... section 1-601 of Executive Order 12088, 3 CFR, 1978 Comp., p. 243, to enter into an inter-agency...

  10. 7 CFR 249.23 - Records and reports.

    Science.gov (United States)

    2010-01-01

    ..., delivery receipts, equipment purchases and inventory, nutrition education, fair hearings, and civil rights... Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS SENIOR FARMERS' MARKET NUTRITION PROGRAM (SFMNP) Miscellaneous Provisions §...

  11. 7 CFR 249.17 - Management evaluations and reviews.

    Science.gov (United States)

    2010-01-01

    ... management, accountability, certification, nutrition education, financial management systems, and coupon and..., DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS SENIOR FARMERS' MARKET NUTRITION PROGRAM (SFMNP... SFMNP and the WIC Farmers' Market Nutrition Program are in operation, these reviews may be...

  12. Dicty_cDB: SHK249 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available olorF (JM107 adapted methyl filtered) Sorghum bicolor genomic clone ht56c07 5', DNA sequence. 32 0.11 3 BZ35...0960 |BZ350960.1 ht62h04.g1 WGS-SbicolorF (JM107 adapted methyl filtered) Sorghum bicolor genomic clone ht62...h04 5', DNA sequence. 32 0.12 3 CW043777 |CW043777.1 104_279_10508575_114_30273 Sorghum methylation filtered...ence. 32 0.12 3 CW183669 |CW183669.1 104_599_11164737_116_36675_037 Sorghum methylation filtered library (Li

  13. Dicty_cDB: CHS249 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available tii PhoA (PH... 171 4e-41 ( P32811 ) RecName: Full=Alpha-glucan phosphorylase, H isozyme; ... 170 9e-41 AB435244_1( AB435244 |pid...PNDINAISIERLSPLTFVKQTSASPLSVISGGDKTNNTLKPKQTTKGF NIGVNQVIQQIN*iiiikkxk Translated Amino Acid sequence (All Frames) Fram...e A: eiknnkinnlnnnnknkhqinqkilllnylh*nlkvikkknklyfglswqaifqrirvhf kknllnmlnilwlkprvnvlisqvskhfhivpgid...ments: (bits) Value N M77492 |M77492.1 Dictyostelium discoideum glycoprotein phosphorylase 2 (glpD) gene, co...mplete cds. 1417 0.0 2 X62142 |X62142.1 D. discoideum glpV gene for glycogen phosphorylase 1. 127 2e-46 6 BX

  14. 1935 15' Quad #249 Aerial Photo Mosaic Index

    Data.gov (United States)

    Earth Data Analysis Center, University of New Mexico — Aerial Photo Reference Mosaics contain aerial photographs that are retrievable on a frame by frame basis. The inventory contains imagery from various sources that...

  15. 48 CFR 249.501-70 - Special termination costs.

    Science.gov (United States)

    2010-10-01

    ... of $100 million; and (3) Adequate funds are available to cover the contingent reserve liability for... associated with contingent special termination costs is expected to fluctuate extensively over the period...

  16. Dicty_cDB: VFE249 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SEQUENCING IN PROGRESS ***, 20 unordered pieces. 54 7e-04 5 AC125395 |AC125395.1 Mus musculus chromosome UN...8600_1( BC078600 |pid:none) Xenopus laevis hypothetical protei... 43 0.009 BT075193_1( BT075193 |pid:none) Osmer... 2009. 6.18 PSORT psg: 0.83 gvh: 0.33 alm: 0.39 top: 0.53 tms: 0.00 mit: 0.28 mip: 0.00 nuc: 0.00 erl: 0.00 er...skplldlvvqeirqldf*lklkamlmlll Frame C: ffkhtnt*iifiylsthpkysy*wqk*qyqlkmkisfk*iynqikqlki*nve*nlkpqf **tikf*hlme...lium discoideum chromosome 2 map 2779865-2840915 strain AX4, *** SEQUENCING IN PROGRESS ***, in ordered piec

  17. Separation of 248Cm (III) from 252Cf (III) and its use in time resolved fluorescence spectroscopic (TRFS) studies

    International Nuclear Information System (INIS)

    The present report gives a description of the methodology for the separation of 248Cm(III) from decayed 252Cf (III) waste solution. The waste solution was first assayed for 252Cf content by neutron counting using a neutron well coincidence counter. The sample was subjected to the chemical separation of 248Cm (III) from 252Cf (III) following anion and cation exchange chromatography. The alpha spectrum of the separated curium fraction showed peaks due to 246Cm and 248Cm while the corresponding alpha spectrum of californium fraction showed 249,250,251,252Cf. The gamma ray abundances of 249Cf were determined with respect to its gamma rays of 387 keV and the data agreed well with that in literature. Separated Cm(III) was further characterized by recording its time resolved fluorescence spectrum (TRFS) in aqueous medium. (author)

  18. The determination of americium, curium and californium in biological samples by combined solvent extraction-liquid scintillation counting

    International Nuclear Information System (INIS)

    A method has been developed to extract Am, Cm and Cf from ashed biological samples dissolved in 8 M LiN03-10-2 M HN03 into a liquid/scintillation cocktail. This new method reduces tissue and instrument background and allows use of a larger sample for analysis than when using a commercial gelling cocktail. The extractant cocktail is 20% N,N,N-trioctyl-N-methylammonium chloride dissolved in toluene containing the scintillators p-terphenyl and 1,4-bis-2-(5-phenyl-oxazolyl)-benzene. Several different types of biological samples were analyzed and radionuclide recoveries greater than 90% were obtained in all cases. (author)

  19. Raman and absorption spectrophotometric studies of selected lanthanide, californium-doped lanthanide, and actinide trihalides in the solid state

    International Nuclear Information System (INIS)

    The solid-state absorption spectra of Cf(III) ions as a dopant in lanthanide trihalide hosts (LnCl3: Ln = Ce, Sm, and Y; LnBr3: Ln = Ce, Sm, Tb, and Y; LnI3: Ln = Ce and Y) have been recorded. The spectra of Cf(III) have been correlated with the various crystal structures. The phonon Raman spectra and solid-state absorption spectra of PmF3, PmCl3, PmBr3, and two crystal modifications of PmI3 have been recorded. Symmetry assignments have been made for the Raman-active bands for these trihalides and also the sesquioxide. The room-temperature absorption spectra have been correlated to crystal field effects. The symmetry assignments of the Raman-active phonon modes have been made based on polarized Raman spectra from single crystals of YF3-type orthorhombic TbF3 and PuBr3-type orthorhombic NdBr3. Raman spectra of other isostructural lanthanide compounds have been recorded and compared. Symmetry assignments for these compounds have been made by analogy to the single-crystal assignments. Raman spectra have been obtained and catalogued for a number of actinide compounds. Symmetry assignments have been made for the observed Raman-active phonon bands in this work based on the assignments made for isostructural lanthanide compounds. 29 figs., 22 tabs

  20. Optical Transitions in Highly Charged Californium Ions with High Sensitivity to Variation of the Fine-Structure Constant

    Science.gov (United States)

    Berengut, J. C.; Dzuba, V. A.; Flambaum, V. V.; Ong, A.

    2012-08-01

    We study electronic transitions in highly charged Cf ions that are within the frequency range of optical lasers and have very high sensitivity to potential variations in the fine-structure constant, α. The transitions are in the optical range despite the large ionization energies because they lie on the level crossing of the 5f and 6p valence orbitals in the thallium isoelectronic sequence. Cf16+ is a particularly rich ion, having several narrow lines with properties that minimize certain systematic effects. Cf16+ has very large nuclear charge and large ionization energy, resulting in the largest α sensitivity seen in atomic systems. The lines include positive and negative shifters.

  1. Optical transitions in highly-charged californium ions with high sensitivity to variation of the fine-structure constant

    CERN Document Server

    Berengut, J C; Flambaum, V V; Ong, A

    2012-01-01

    We study electronic transitions in highly-charged Cf ions that are within the frequency range of optical lasers and have very high sensitivity to potential variations in the fine-structure constant, alpha. The transitions are in the optical despite the large ionisation energies because they lie on the level-crossing of the 5f and 6p valence orbitals in the thallium isoelectronic sequence. Cf16+ is a particularly rich ion, having several narrow lines with properties that minimize certain systematic effects. Cf16+ has very large nuclear charge and large ionisation energy, resulting in the largest alpha-sensitivity seen in atomic systems. The lines include positive and negative shifters.

  2. AN INTEGRAL REACTOR PHYSICS EXPERIMENT TO INFER ACTINIDE CAPTURE CROSS-SECTIONS FROM THORIUM TO CALIFORNIUM WITH ACCELERATOR MASS SPECTROMETRY

    International Nuclear Information System (INIS)

    The principle of the proposed experiment is to irradiate very pure actinide samples in the Advanced Test Reactor (ATR) at INL and, after a given time, determine the amount of the different transmutation products. The determination of the nuclide densities before and after neutron irradiation will allow inference of effective neutron capture cross-sections. This approach has been used in the past and the novelty of this experiment is that the atom densities of the different transmutation products will be determined using the Accelerator Mass Spectroscopy (AMS) technique at the ATLAS facility located at ANL. It is currently planned to irradiate the following isotopes: 232Th, 235U, 236U, 238U, 237Np, 238Pu, 239Pu, 240Pu, 241Pu, 242Pu, 241Am, 243Am and 248Cm.

  3. Integral range, energy, residual range, and linear energy transfer distributions for Californium fission fragments in microelectronics materials

    International Nuclear Information System (INIS)

    This report discusses the advantages and limitations of using Cf-252 radiation sources for single event testing of microelectronics for space environments. Integral distributions for the range, energy, residual range, and linear energy transfer of Cf-252 fission fragments in absorber and microelectronic materials have been calculated. Techniques are suggested for determining when single event testing using Cf-252 is appropriate; also, techniques are given for estimating the saturation cross section and thresh old linear energy transfer from test data. 10 refs., 25 figs., 2 tabs

  4. Research and experimental work at Groote Schuur Hospital and the University of Cape Town using californium-252 sources

    International Nuclear Information System (INIS)

    Experiments have been undertaken to determine the high-LET and low-LET components of the absorbed dose from neutron beams. This is achieved by measuring the fluxes of the high-LET and low-LET radiations in a tissue-equivalent phantom individually and simultaneously using a scintillation probe fitted with a pulse shape discriminator. This system was successfully used with a 22 MeV neutron beam from the T(d,n) reaction and has been employed with 252Cf sources. Results obtained in the low-energy ranges (up to 3 MeV) indicate that the electron counts exceed the high-LET counts by a factor of 2 to 3. These results are related to the absorbed dose. Calculations have also been undertaken to establish whether the Paterson-Parker system could be used for the design of 252Cf treatments and the optimum needle activities to yield the desired dose. Experiments are under way to determine the variation of RBE and OER for 252Cf radiations around the source. The inhibition of root growth in Vicia Faba is being used to determine any such effects. Dose rates comparable to that employed in interstitial radiotherapy are being aimed at. A study of dose fractionation effects is also being undertaken. (author)

  5. Measurements of the neutron capture cross sections and incineration potentials of minor-actinides in high thermal neutron fluxes: Impact on the transmutation of nuclear wastes

    International Nuclear Information System (INIS)

    This thesis comes within the framework of minor-actinide nuclear transmutation studies. First of all, we have evaluated the impact of minor actinide nuclear data uncertainties within the cases of 241Am and 237Np incineration in three different reactor spectra: EFR (fast), GT-MHR (epithermal) and HI-HWR (thermal). The nuclear parameters which give the highest uncertainties were thus highlighted. As a result of fact, we have tried to reduce data uncertainties, in the thermal energy region, for one part of them through experimental campaigns in the moderated high intensity neutron fluxes of ILL reactor (Grenoble). These measurements were focused onto the incineration and transmutation of the americium-241, the curium-244 and the californium-249 isotopes. Finally, the values of 12 different cross sections and the 241Am isomeric branching ratio were precisely measured at thermal energy point. (author)

  6. Measurements of the neutron capture cross sections and incineration potentials of minor-actinides in high thermal neutron fluxes: Impact on the transmutation of nuclear wastes; Mesures des sections efficaces de capture et potentiels d'incineration des actinides mineurs dans les hauts flux de neutrons: Impact sur la transmutation des dechets

    Energy Technology Data Exchange (ETDEWEB)

    Bringer, O

    2007-10-15

    This thesis comes within the framework of minor-actinide nuclear transmutation studies. First of all, we have evaluated the impact of minor actinide nuclear data uncertainties within the cases of {sup 241}Am and {sup 237}Np incineration in three different reactor spectra: EFR (fast), GT-MHR (epithermal) and HI-HWR (thermal). The nuclear parameters which give the highest uncertainties were thus highlighted. As a result of fact, we have tried to reduce data uncertainties, in the thermal energy region, for one part of them through experimental campaigns in the moderated high intensity neutron fluxes of ILL reactor (Grenoble). These measurements were focused onto the incineration and transmutation of the americium-241, the curium-244 and the californium-249 isotopes. Finally, the values of 12 different cross sections and the {sup 241}Am isomeric branching ratio were precisely measured at thermal energy point. (author)

  7. 14 CFR 249.20 - Preservation of records by certificated air carriers.

    Science.gov (United States)

    2010-01-01

    ... Do. 4. Accounts receivables and payables: (a) Traffic accounts receivable or payable, detailed journals and ledgers or their equivalents, together with supporting papers Do. (b) General accounts receivable or payable, detailed journals and ledgers or their equivalents, together with supporting papers...

  8. People and things. CERN Courier, Nov 1984, v. 24(9)

    International Nuclear Information System (INIS)

    The article reports on achievements of various people, staff changes and position opportunities within the CERN organization and contains news updates on upcoming or past events. A landmark event took place at Stanford on 3-4 August in the form of a ' Pief-fest', a celebration tacked onto the end of the traditional annual Stanford Linear Accelerator Center (SLAC) Summer Institute to mark the retirement of Wolfgang 'Pief Panofsky as the Laboratory's Director.The University of California's Lawrence Berkeley Laboratory has been chosen as the host institution for the Central Design Group for the Superconducting Super Collider (SSC). The fifth Topical Workshop on Proton-Antiproton Collider Physics will be held in Saint-Vincent, Aosta Valley, Italy, from 25 February to 2 March 1985. The local users' organization at the Stanford Linear Accelerator Center is organizing a Workshop on Electron-Positron Physics at High Luminosities, to be held at SLAC from 30 November to 1 December. The Aspen (Colorado, USA) Center for Physics announces a Winter Physics Conference Series - Collider Physics at Ultrahigh Energies from 6-12 January 1985 and Electro weak Interactions from 13- 19 January. As this edition was going to press, the CERN SPS protonantiproton collider was back in action for physics for the first time since the historic run last year which produced the Z particle and the first evidence for the sixth ('top') quark

  9. S.I. No 249 of 1972, Factories Ionising Radiations (Unsealed Radioactive Substances) Regulations, 1972

    International Nuclear Information System (INIS)

    The Regulations which entered into force on 1 December 1972 apply to factories in which a process involving the use of unsealed radioactive substances is carried on and where the total activity of the unsealed radioactive substances exceeds specified levels, or where there are objects contaminated in excess of certain levels. The Schedules specify the maximum radiation doses and the maximum permissible levels of contamination and provide for a classification of radionuclides

  10. Association analyses of 249,796 individuals reveal eighteen new loci associated with body mass index

    Science.gov (United States)

    Speliotes, Elizabeth K.; Willer, Cristen J.; Berndt, Sonja I.; Monda, Keri L.; Thorleifsson, Gudmar; Jackson, Anne U.; Allen, Hana Lango; Lindgren, Cecilia M.; Luan, Jian’an; Mägi, Reedik; Randall, Joshua C.; Vedantam, Sailaja; Winkler, Thomas W.; Qi, Lu; Workalemahu, Tsegaselassie; Heid, Iris M.; Steinthorsdottir, Valgerdur; Stringham, Heather M.; Weedon, Michael N.; Wheeler, Eleanor; Wood, Andrew R.; Ferreira, Teresa; Weyant, Robert J.; Segré, Ayellet V.; Estrada, Karol; Liang, Liming; Nemesh, James; Park, Ju-Hyun; Gustafsson, Stefan; Kilpeläinen, Tuomas O.; Yang, Jian; Bouatia-Naji, Nabila; Esko, Tõnu; Feitosa, Mary F.; Kutalik, Zoltán; Mangino, Massimo; Raychaudhuri, Soumya; Scherag, Andre; Smith, Albert Vernon; Welch, Ryan; Zhao, Jing Hua; Aben, Katja K.; Absher, Devin M.; Amin, Najaf; Dixon, Anna L.; Fisher, Eva; Glazer, Nicole L.; Goddard, Michael E.; Heard-Costa, Nancy L.; Hoesel, Volker; Hottenga, Jouke-Jan; Johansson, Åsa; Johnson, Toby; Ketkar, Shamika; Lamina, Claudia; Li, Shengxu; Moffatt, Miriam F.; Myers, Richard H.; Narisu, Narisu; Perry, John R.B.; Peters, Marjolein J.; Preuss, Michael; Ripatti, Samuli; Rivadeneira, Fernando; Sandholt, Camilla; Scott, Laura J.; Timpson, Nicholas J.; Tyrer, Jonathan P.; van Wingerden, Sophie; Watanabe, Richard M.; White, Charles C.; Wiklund, Fredrik; Barlassina, Christina; Chasman, Daniel I.; Cooper, Matthew N.; Jansson, John-Olov; Lawrence, Robert W.; Pellikka, Niina; Prokopenko, Inga; Shi, Jianxin; Thiering, Elisabeth; Alavere, Helene; Alibrandi, Maria T. S.; Almgren, Peter; Arnold, Alice M.; Aspelund, Thor; Atwood, Larry D.; Balkau, Beverley; Balmforth, Anthony J.; Bennett, Amanda J.; Ben-Shlomo, Yoav; Bergman, Richard N.; Bergmann, Sven; Biebermann, Heike; Blakemore, Alexandra I.F.; Boes, Tanja; Bonnycastle, Lori L.; Bornstein, Stefan R.; Brown, Morris J.; Buchanan, Thomas A.; Busonero, Fabio; Campbell, Harry; Cappuccio, Francesco P.; Cavalcanti-Proença, Christine; Chen, Yii-Der Ida; Chen, Chih-Mei; Chines, Peter S.; Clarke, Robert; Coin, Lachlan; Connell, John; Day, Ian N.M.; den Heijer, Martin; Duan, Jubao; Ebrahim, Shah; Elliott, Paul; Elosua, Roberto; Eiriksdottir, Gudny; Erdos, Michael R.; Eriksson, Johan G.; Facheris, Maurizio F.; Felix, Stephan B.; Fischer-Posovszky, Pamela; Folsom, Aaron R.; Friedrich, Nele; Freimer, Nelson B.; Fu, Mao; Gaget, Stefan; Gejman, Pablo V.; Geus, Eco J.C.; Gieger, Christian; Gjesing, Anette P.; Goel, Anuj; Goyette, Philippe; Grallert, Harald; Gräßler, Jürgen; Greenawalt, Danielle M.; Groves, Christopher J.; Gudnason, Vilmundur; Guiducci, Candace; Hartikainen, Anna-Liisa; Hassanali, Neelam; Hall, Alistair S.; Havulinna, Aki S.; Hayward, Caroline; Heath, Andrew C.; Hengstenberg, Christian; Hicks, Andrew A.; Hinney, Anke; Hofman, Albert; Homuth, Georg; Hui, Jennie; Igl, Wilmar; Iribarren, Carlos; Isomaa, Bo; Jacobs, Kevin B.; Jarick, Ivonne; Jewell, Elizabeth; John, Ulrich; Jørgensen, Torben; Jousilahti, Pekka; Jula, Antti; Kaakinen, Marika; Kajantie, Eero; Kaplan, Lee M.; Kathiresan, Sekar; Kettunen, Johannes; Kinnunen, Leena; Knowles, Joshua W.; Kolcic, Ivana; König, Inke R.; Koskinen, Seppo; Kovacs, Peter; Kuusisto, Johanna; Kraft, Peter; Kvaløy, Kirsti; Laitinen, Jaana; Lantieri, Olivier; Lanzani, Chiara; Launer, Lenore J.; Lecoeur, Cecile; Lehtimäki, Terho; Lettre, Guillaume; Liu, Jianjun; Lokki, Marja-Liisa; Lorentzon, Mattias; Luben, Robert N.; Ludwig, Barbara; Manunta, Paolo; Marek, Diana; Marre, Michel; Martin, Nicholas G.; McArdle, Wendy L.; McCarthy, Anne; McKnight, Barbara; Meitinger, Thomas; Melander, Olle; Meyre, David; Midthjell, Kristian; Montgomery, Grant W.; Morken, Mario A.; Morris, Andrew P.; Mulic, Rosanda; Ngwa, Julius S.; Nelis, Mari; Neville, Matt J.; Nyholt, Dale R.; O’Donnell, Christopher J.; O’Rahilly, Stephen; Ong, Ken K.; Oostra, Ben; Paré, Guillaume; Parker, Alex N.; Perola, Markus; Pichler, Irene; Pietiläinen, Kirsi H.; Platou, Carl G.P.; Polasek, Ozren; Pouta, Anneli; Rafelt, Suzanne; Raitakari, Olli; Rayner, Nigel W.; Ridderstråle, Martin; Rief, Winfried; Ruokonen, Aimo; Robertson, Neil R.; Rzehak, Peter; Salomaa, Veikko; Sanders, Alan R.; Sandhu, Manjinder S.; Sanna, Serena; Saramies, Jouko; Savolainen, Markku J.; Scherag, Susann; Schipf, Sabine; Schreiber, Stefan; Schunkert, Heribert; Silander, Kaisa; Sinisalo, Juha; Siscovick, David S.; Smit, Jan H.; Soranzo, Nicole; Sovio, Ulla; Stephens, Jonathan; Surakka, Ida; Swift, Amy J.; Tammesoo, Mari-Liis; Tardif, Jean-Claude; Teder-Laving, Maris; Teslovich, Tanya M.; Thompson, John R.; Thomson, Brian; Tönjes, Anke; Tuomi, Tiinamaija; van Meurs, Joyce B.J.; van Ommen, Gert-Jan; Vatin, Vincent; Viikari, Jorma; Visvikis-Siest, Sophie; Vitart, Veronique; Vogel, Carla I. G.; Voight, Benjamin F.; Waite, Lindsay L.; Wallaschofski, Henri; Walters, G. Bragi; Widen, Elisabeth; Wiegand, Susanna; Wild, Sarah H.; Willemsen, Gonneke; Witte, Daniel R.; Witteman, Jacqueline C.; Xu, Jianfeng; Zhang, Qunyuan; Zgaga, Lina; Ziegler, Andreas; Zitting, Paavo; Beilby, John P.; Farooqi, I. Sadaf; Hebebrand, Johannes; Huikuri, Heikki V.; James, Alan L.; Kähönen, Mika; Levinson, Douglas F.; Macciardi, Fabio; Nieminen, Markku S.; Ohlsson, Claes; Palmer, Lyle J.; Ridker, Paul M.; Stumvoll, Michael; Beckmann, Jacques S.; Boeing, Heiner; Boerwinkle, Eric; Boomsma, Dorret I.; Caulfield, Mark J.; Chanock, Stephen J.; Collins, Francis S.; Cupples, L. Adrienne; Smith, George Davey; Erdmann, Jeanette; Froguel, Philippe; Grönberg, Henrik; Gyllensten, Ulf; Hall, Per; Hansen, Torben; Harris, Tamara B.; Hattersley, Andrew T.; Hayes, Richard B.; Heinrich, Joachim; Hu, Frank B.; Hveem, Kristian; Illig, Thomas; Jarvelin, Marjo-Riitta; Kaprio, Jaakko; Karpe, Fredrik; Khaw, Kay-Tee; Kiemeney, Lambertus A.; Krude, Heiko; Laakso, Markku; Lawlor, Debbie A.; Metspalu, Andres; Munroe, Patricia B.; Ouwehand, Willem H.; Pedersen, Oluf; Penninx, Brenda W.; Peters, Annette; Pramstaller, Peter P.; Quertermous, Thomas; Reinehr, Thomas; Rissanen, Aila; Rudan, Igor; Samani, Nilesh J.; Schwarz, Peter E.H.; Shuldiner, Alan R.; Spector, Timothy D.; Tuomilehto, Jaakko; Uda, Manuela; Uitterlinden, André; Valle, Timo T.; Wabitsch, Martin; Waeber, Gérard; Wareham, Nicholas J.; Watkins, Hugh; Wilson, James F.; Wright, Alan F.; Zillikens, M. Carola; Chatterjee, Nilanjan; McCarroll, Steven A.; Purcell, Shaun; Schadt, Eric E.; Visscher, Peter M.; Assimes, Themistocles L.; Borecki, Ingrid B.; Deloukas, Panos; Fox, Caroline S.; Groop, Leif C.; Haritunians, Talin; Hunter, David J.; Kaplan, Robert C.; Mohlke, Karen L.; O’Connell, Jeffrey R.; Peltonen, Leena; Schlessinger, David; Strachan, David P.; van Duijn, Cornelia M.; Wichmann, H.-Erich; Frayling, Timothy M.; Thorsteinsdottir, Unnur; Abecasis, Gonçalo R.; Barroso, Inês; Boehnke, Michael; Stefansson, Kari; North, Kari E.; McCarthy, Mark I.; Hirschhorn, Joel N.; Ingelsson, Erik; Loos, Ruth J.F.

    2010-01-01

    Obesity is globally prevalent and highly heritable, but the underlying genetic factors remain largely elusive. To identify genetic loci for obesity-susceptibility, we examined associations between body mass index (BMI) and ~2.8 million SNPs in up to 123,865 individuals, with targeted follow-up of 42 SNPs in up to 125,931 additional individuals. We confirmed 14 known obesity-susceptibility loci and identified 18 new loci associated with BMI (P<5×10−8), one of which includes a copy number variant near GPRC5B. Some loci (MC4R, POMC, SH2B1, BDNF) map near key hypothalamic regulators of energy balance, and one is near GIPR, an incretin receptor. Furthermore, genes in other newly-associated loci may provide novel insights into human body weight regulation. PMID:20935630

  11. 7 CFR 249.10 - Coupon, market, and CSA program management.

    Science.gov (United States)

    2010-01-01

    ... than the price charged to other customers; (iv) Assure that the shareholder receives eligible foods... stands. (5) The State agency must limit the value of shares awarded to CSA programs to no more than 50... redeemed only for eligible foods; (iii) Provide eligible foods at or less than the price charged to...

  12. Preserved urethral plate urethroplasty for failed hypospadias repair: report of 249 cases

    Institute of Scientific and Technical Information of China (English)

    ZHANG Wei-ping; TIAN Jun; LI Ming-lei; SONG Hong-cheng; BAI Ji-wu; HUANG Cheng-ru; SUN Ning

    2008-01-01

    @@ Hypospadias is one of the most common abnormalities of the external male genitalia but is very difficult to repair. Hypospadias reoperation is also a common practice for pediatric urologists, though repair of hypospadias at reoperation is much more difficult.

  13. Association analyses of 249,796 individuals reveal 18 new loci associated with body mass index

    NARCIS (Netherlands)

    E.K. Speliotes (Elizabeth); C.J. Willer (Cristen); S.I. Berndt (Sonja); K.L. Monda (Keri); G. Thorleifsson (Gudmar); A.U. Jackson (Anne); H.L. Allen; C.M. Lindgren (Cecilia); J. Luan; R. Mägi (Reedik); J.C. Randall (Joshua); S. Vedantam (Sailaja); T.W. Winkler (Thomas); L. Qi (Lu); T. Workalemahu (Tsegaselassie); I.M. Heid (Iris); V. Steinthorsdottir (Valgerdur); H.M. Stringham (Heather); E. Wheeler (Eleanor); A.R. Wood (Andrew); T. Ferreira (Teresa); R.J. Weyant (Robert); A.V. Segrè (Ayellet); K. Eestrada (Karol); L. Liang (Liming); J. Nemesh (James); J.H. Park; S. Gustafsson (Stefan); T.O. Kilpeläinen (Tuomas); J. Yang (Joanna); N. Bouatia-Naji (Nabila); T. Eesko (Tõnu); M.F. Feitosa (Mary Furlan); Z. Kutalik (Zoltán); M. Mangino (Massimo); S. Raychaudhuri (Soumya); A. Scherag (Andre); A.V. Smith (Albert Vernon); R.P. Welch (Ryan); J.H. Zhao; K.K.H. Aben (Katja); D. Absher (Devin); N. Amin (Najaf); A.L. Dixon (Anna); E. Fisher (Eeva); N.L. Glazer (Nicole); M.E. Goddard (Michael); N.L. Heard-Costa (Nancy); V. Hoesel (Volker); J.J. Hottenga (Jouke Jan); A. Johansson (Åsa); T. Johnson (Toby); S. Ketkar (Shamika); C. Lamina (Claudia); S. Li (Shengxu); M.F. Moffatt (Miriam); R.H. Myers (Richard); N. Narisu (Narisu); J.R.B. Perry (John); M.J. Peters (Marjolein); M. Preuss (Michael); S. Ripatti (Samuli); F. Rivadeneira Ramirez (Fernando); C. Sandholt (Camilla); L.J. Scott (Laura); N. Timpson (Nicholas); J.P. Tyrer (Jonathan); S. van Wingerden (Sophie); C.C. White (Charles); F. Wiklund (Fredrik); C. Barlassina (Christina); D.I. Chasman (Daniel); M.N. Cooper (Matthew); J.O. Jansson; R.W. Lawrence (Robert); N. Pellikka (Niina); I. Prokopenko (Inga); J. Shi (Jianxin); E. Thiering (Eelisabeth); H. Alavere (Helene); M.T.S. Alibrandi (Maria); P. Almgren (Peter); A.M. Arnold (Alice); T. Aspelund (Thor); L.D. Atwood (Larry); B. Balkau (Beverley); A.J. Balmforth (Anthony); A.J. Bennett (Amanda); Y. Ben-Shlomo; R.N. Bergman (Richard); S.M. Bergmann (Sven); H. Biebermann (Heike); A.I.F. Blakemore (Alexandra); T. Boes (Tanja); L.L. Bonnycastle (Lori); S.R. Bornstein (Stefan); M.J. Brown (Morris); T.A. Buchanan (Thomas); F. Busonero; H. Campbell (Harry); F.P. Cappuccio (Francesco); C. Cavalcanti-Proença (Christine); Y.D.I. Chen (Yii-Der Ida); C.-M. Chen (Chih-Mei); P.S. Chines (Peter); R. Clarke; L. Coin (Lachlan); J. Connell (John); I.N.M. Day (Ian); M. den Heijer (Martin); J. Duan (Jubao); S. Eebrahim (Shah); P. Eelliott (Paul); R. Eelosua (Roberto); G. Eeiriksdottir (Gudny); M.R. Eerdos (Micheal); J.G. Eeriksson (Johan); M.F. Facheris (Maurizio); S.B. Felix (Stephan); P. Fischer-Posovszky (Pamela); A.R. Folsom (Aaron); N. Friedrich (Nele); N.B. Freimer (Nelson); M. Fu (Mao); S. Gaget (Stefan); P.V. Gejman (Pablo); E.J. Geus (Eeco); C. Gieger (Christian); A.P. Gjesing (Anette); A. Goel (Anuj); P. Goyette (Philippe); H. Grallert (Harald); J. Gräßler (Jürgen); D. Greenawalt (Danielle); C.J. Groves (Christopher); V. Gudnason (Vilmundur); C. Guiducci (Candace); A.L. Hartikainen; N. Hassanali (Neelam); A.S. Hall (Alistair); A.S. Havulinna (Aki); C. Hayward (Caroline); A.C. Heath (Andrew); C. Hengstenberg (Christian); A.A. Hicks (Andrew); A. Hinney (Anke); A. Hofman (Albert); G. Homuth (Georg); J. Hui (Jennie); W. Igl (Wilmar); C. Iribarren (Carlos); B. Isomaa (Bo); K.B. Jacobs (Kevin); I. Jarick (Ivonne); E. Jewell (Eelizabeth); U. John (Ulrich); T. Jørgensen (Torben); P. Jousilahti (Pekka); A. Jula (Antti); M. Kaakinen (Marika); E. Kajantie (Eero); R.C. Kaplan (Robert); S. Kathiresan (Sekar); J. Kettunen (Johannes); L. Kinnunen (Leena); J.W. Knowles (Joshua); I. Kolcic (Ivana); I.R. König (Inke); S. Koskinen (Seppo); P. Kovacs (Peter); J. Kusisto (Johanna); P. Kraft (Peter); K. Kvaløy (Kirsti); J. Laitinen (Jaana); O. Lantieri (Olivier); C. Lanzani (Chiara); L.J. Launer (Lenore); C. Lecoeur (Cécile); T. Lehtimäki (Terho); G. Lettre (Guillaume); J. Liu (Jianjun); M.L. Lokki; M. Lorentzon (Mattias); R.N. Luben (Robert); B. Ludwig (Barbara); P. Manunta (Paolo); D. Marek (Diana); M. Marre (Michel); N.G. Martin (Nicholas); W.L. McArdle (Wendy); M.I. McCarthy (Mark); B. McKnight (Barbara); T. Meitinger (Thomas); O. Melander (Olle); D. Meyre (David); K. Midthjell (Kristian); G.W. Montgomery (Grant); M.A. Morken (Mario); A.D. Morris (Andrew); R. Mulic (Rosanda); J.S. Ngwa; M. Nelis (Mari); M.J. Neville (Matthew); D.R. Nyholt (Dale); C.J. O'Ddonnell (Christopher); S. O'Rahilly (Stephen); K. Ong (Ken); B.A. Oostra (Ben); G. Paré (Guillaume); A.N. Parker (Alex); M. Perola (Markus); I. Pichler (Irene); K.H. Pietilainen (Kirsi Hannele); C.P. Platou (Carl); O. Polasek (Ozren); A. Pouta (Anneli); S. Rafelt (Suzanne); O. Raitakari (Olli); N.W. Rayner (Nigel William); M. Ridderstråle (Martin); W. Rief (Winfried); A. Ruokonen (Aimo); N.R. Robertson (Neil); P. Rzehak (Peter); V. Salomaa (Veikko); A.R. Sanders (Alan); M.S. Sandhu (Manjinder); S. Sanna (Serena); J. Saramies (Jouko); M.J. Savolainen (Markku); S. Schipf (Sabine); S. Schreiber (Stefan); H. Schunkert (Heribert); K. Silander (Kaisa); J. Sinisalo (Juha); D.S. Siscovick (David); J.H. Smit (Jan); N. Soranzo (Nicole); U. Sovio (Ulla); J. Stephens (Jonathan); I. Surakka (Ida); A.J. Swift (Amy); M.L. Tammesoo; J.-C. Tardif (Jean-Claude); M. Teder-Laving (Maris); T.M. Teslovich (Tanya); J.R. Thompson (John); B. Thomson (Brian); A. Tönjes (Anke); T. Tuomi (Tiinamaija); J.B.J. van Meurs (Joyce); G.J. van OMen; V. Vatin (Vincent); J. Viikari (Jorma); S. Visvikis-Siest (Sophie); V. Vitart (Veronique); C.I. Vogel (Carla); B.F. Voight (Benjamin); L. Waite (Lindsay); H. Wallaschofski (Henri); G.B. Walters (Bragi); E. Widen (Elisabeth); S. Wiegand (Susanna); S.H. Wild (Sarah); G.A.H.M. Willemsen (Gonneke); D.R. Witte (Deniel); J.C.M. Witteman (Jacqueline); J. Xu (Jianfeng); Q. Zhang (Qunyuan); L. Zgaga (Lina); A. Ziegler (Andreas); P. Zitting (Paavo); J.P. Beilby (John); I.S. FarOqi (Ssadaf); J. Hebebrand (Johannes); H.V. Huikuri (Heikki); A. James (Alan); M. Kähönen (Mika); D.F. Levinson (Douglas); F. MacCiardi (Fabio); M.S. Nieminen (Markku); C. Ohlsson (Claes); C. Palmer (Cameron); P.M. Ridker (Paul); M. Stumvoll (Michael); J.S. Beckmann (Jacques); H. Boeing (Heiner); E. Boerwinkle (Eric); D.I. Boomsma (Dorret); M. Caulfield (Mark); S.J. Chanock (Stephen); F.S. Collins (Francis); L.A. Cupples (Adrienne); J. Eerdmann (Jeanette); P. Frogue (Philippe); H. Grönberg (Henrik); U. Gyllensten (Ulf); T. Hansen (Torben); T.B. Harris (Tamara); A.T. Hattersley (Andrew); R.B. Hayes (Richard); J. Heinrich (Joachim); F.B. Hu (Frank); K. Hveem (Kristian); T. Illig (Thomas); M.R. Järvelin; J. Kaprio (Jaakko); F. Karpe (Fredrik); K-T. Khaw (Kay-Tee); L.A.L.M. Kiemeney (Bart); H. Krude; M. Laakso (Markku); D.A. Lawlor (Debbie); A. Metspalu (Andres); P. Munroe (Patricia); W.H. Ouwehand (Willem); O. Pedersen (Oluf); B.W.J.H. Penninx (Brenda); P.P. Pramstaller (Peter Paul); T. Quertermous (Thomas); T. Reinehr (Thomas); A. Rissanen (Aila); I. Rudan (Igor); N.J. Samani (Nilesh); P.E.H. Schwarz (Peter); A.R. Shuldiner (Alan); T.D. Spector (Timothy); J. Tuomilehto (Jaakko); M. Uda (Manuela); A.G. Uitterlinden (André); T.T. Valle (Timo); M. Wabitsch (Martin); G. Waeber (Gérard); N.J. Wareham (Nick); H. Watkins (Hugh); J.F. Wilson (James); A.F. Wright (Alan); M.C. Zillikens (Carola); N. ChatterjE (Nilanjan); S.A. McCarroll (Steve); S. Purcell (Shaun); E.E. Schadt (Eric); P.M. Visscher (Peter); T.L. Assimes (Themistocles); I.B. Borecki (Ingrid); P. Deloukas (Panagiotis); C.S. Fox (Caroline); L. Groop (Leif); T. Haritunians (Talin); D.J. Hunter (David); K.L. Mohlke (Karen); J.R. O'ConneL (Jeffrey); L. Peltonen (Leena Johanna); D. SchleSinger (David); D.P. Strachan (David); R.M. Watanabe (Richard); C.M. van Duijn (Cock); H.E. Wichmann (Heinz Erich); T.M. Frayling (Timothy); U. Thorsteinsdottir (Unnur); G.R. Abecasis (Gonçalo); M. Boehnke (Michael); K. StefanSon (Kari); K.E. North (Kari); M.I. McArthy (Mark); J.N. Hirschhorn (Joel); E. IngelSon (Erik); R.J.F. Loos (Ruth); M.N. Weedon (Michael)

    2010-01-01

    textabstractObesity is globaLy prevalent and highly heritable, but its underlying genetic factors remain largely elusive. To identify genetic loci for obesity susceptibility, we examined aSociations betwEn body maS index and ĝ̂1/42.8 miLion SNPs in up to 123,865 individuals with targeted foLow up of

  14. Association analyses of 249,796 individuals reveal 18 new loci associated with body mass index

    DEFF Research Database (Denmark)

    Speliotes, Elizabeth K; Willer, Cristen J; Berndt, Sonja I;

    2010-01-01

    in up to 125,931 additional individuals. We confirmed 14 known obesity susceptibility loci and identified 18 new loci associated with body mass index (P R, POMC, SH2B1 and BDNF) map near key hypothalamic regulators...

  15. Association analyses of 249,796 individuals reveal 18 new loci associated with body mass index

    NARCIS (Netherlands)

    Speliotes, Elizabeth K.; Willer, Cristen J.; Berndt, Sonja I.; Monda, Keri L.; Thorleifsson, Gudmar; Jackson, Anne U.; Allen, Hana Lango; Lindgren, Cecilia M.; Luan, Jian'an; Maegi, Reedik; Randall, Joshua C.; Vedantam, Sailaja; Winkler, Thomas W.; Qi, Lu; Workalemahu, Tsegaselassie; Heid, Iris M.; Steinthorsdottir, Valgerdur; Stringham, Heather M.; Weedon, Michael N.; Wheeler, Eleanor; Wood, Andrew R.; Ferreira, Teresa; Weyant, Robert J.; Segre, Ayellet V.; Estrada, Karol; Liang, Liming; Nemesh, James; Park, Ju-Hyun; Gustafsson, Stefan; Kilpelaenen, Tuomas O.; Yang, Jian; Bouatia-Naji, Nabila; Esko, Tonu; Feitosa, Mary F.; Kutalik, Zoltan; Mangino, Massimo; Raychaudhuri, Soumya; Scherag, Andre; Smith, Albert Vernon; Welch, Ryan; Zhao, Jing Hua; Aben, Katja K.; Absher, Devin M.; Amin, Najaf; Dixon, Anna L.; Fisher, Eva; Glazer, Nicole L.; Goddard, Michael E.; Heard-Costa, Nancy L.; Hoesel, Volker; Hottenga, Jouke-Jan; Johansson, Asa; Johnson, Toby; Ketkar, Shamika; Lamina, Claudia; Li, Shengxu; Moffatt, Miriam F.; Myers, Richard H.; Narisu, Narisu; Perry, John R. B.; Peters, Marjolein J.; Preuss, Michael; Ripatti, Samuli; Rivadeneira, Fernando; Sandholt, Camilla; Scott, Laura J.; Timpson, Nicholas J.; Tyrer, Jonathan P.; van Wingerden, Sophie; Watanabe, Richard M.; White, Charles C.; Wiklund, Fredrik; Barlassina, Christina; Chasman, Daniel I.; Cooper, Matthew N.; Jansson, John-Olov; Lawrence, Robert W.; Pellikka, Niina; Prokopenko, Inga; Shi, Jianxin; Thiering, Elisabeth; Alavere, Helene; Alibrandi, Maria T. S.; Almgren, Peter; Arnold, Alice M.; Aspelund, Thor; Atwood, Larry D.; Balkau, Beverley; Balmforth, Anthony J.; Bennett, Amanda J.; Ben-Shlomo, Yoav; Bergman, Richard N.; Bergmann, Sven; Biebermann, Heike; Blakemore, Alexandra I. F.; Boes, Tanja; Bonnycastle, Lori L.; Bornstein, Stefan R.; Brown, Morris J.; Buchanan, Thomas A.; Busonero, Fabio; Campbell, Harry; Cappuccio, Francesco P.; Cavalcanti-Proenca, Christine; Chen, Yii-Der Ida; Chen, Chih-Mei; Chines, Peter S.; Clarke, Robert; Coin, Lachlan; Connell, John; Day, Ian N. M.; den Heijer, Martin; Duan, Jubao; Ebrahim, Shah; Elliott, Paul; Elosua, Roberto; Eiriksdottir, Gudny; Erdos, Michael R.; Eriksson, Johan G.; Facheris, Maurizio F.; Felix, Stephan B.; Fischer-Posovszky, Pamela; Folsom, Aaron R.; Friedrich, Nele; Freimer, Nelson B.; Fu, Mao; Gaget, Stefan; Gejman, Pablo V.; Geus, Eco J. C.; Gieger, Christian; Gjesing, Anette P.; Goel, Anuj; Goyette, Philippe; Grallert, Harald; Graessler, Juergen; Greenawalt, Danielle M.; Groves, Christopher J.; Gudnason, Vilmundur; Guiducci, Candace; Hartikainen, Anna-Liisa; Hassanali, Neelam; Hall, Alistair S.; Havulinna, Aki S.; Hayward, Caroline; Heath, Andrew C.; Hengstenberg, Christian; Hicks, Andrew A.; Hinney, Anke; Hofman, Albert; Homuth, Georg; Hui, Jennie; Igl, Wilmar; Iribarren, Carlos; Isomaa, Bo; Jacobs, Kevin B.; Jarick, Ivonne; Jewell, Elizabeth; John, Ulrich; Jorgensen, Torben; Jousilahti, Pekka; Jula, Antti; Kaakinen, Marika; Kajantie, Eero; Kaplan, Lee M.; Kathiresan, Sekar; Kettunen, Johannes; Kinnunen, Leena; Knowles, Joshua W.; Kolcic, Ivana; Koenig, Inke R.; Koskinen, Seppo; Kovacs, Peter; Kuusisto, Johanna; Kraft, Peter; Kvaloy, Kirsti; Laitinen, Jaana; Lantieri, Olivier; Lanzani, Chiara; Launer, Lenore J.; Lecoeur, Cecile; Lehtimaeki, Terho; Lettre, Guillaume; Liu, Jianjun; Lokki, Marja-Liisa; Lorentzon, Mattias; Luben, Robert N.; Ludwig, Barbara; Manunta, Paolo; Marek, Diana; Marre, Michel; Martin, Nicholas G.; McArdle, Wendy L.; McCarthy, Anne; McKnight, Barbara; Meitinger, Thomas; Melander, Olle; Meyre, David; Midthjell, Kristian; Montgomery, Grant W.; Morken, Mario A.; Morris, Andrew P.; Mulic, Rosanda; Ngwa, Julius S.; Nelis, Mari; Neville, Matt J.; Nyholt, Dale R.; O'Donnell, Christopher J.; O'Rahilly, Stephen; Ong, Ken K.; Oostra, Ben; Pare, Guillaume; Parker, Alex N.; Perola, Markus; Pichler, Irene; Pietilaeinen, Kirsi H.; Platou, Carl G. P.; Polasek, Ozren; Pouta, Anneli; Rafelt, Suzanne; Raitakari, Olli; Rayner, Nigel W.; Ridderstrale, Martin; Rief, Winfried; Ruokonen, Aimo; Robertson, Neil R.; Rzehak, Peter; Salomaa, Veikko; Sanders, Alan R.; Sandhu, Manjinder S.; Sanna, Serena; Saramies, Jouko; Savolainen, Markku J.; Scherag, Susann; Schipf, Sabine; Schreiber, Stefan; Schunkert, Heribert; Silander, Kaisa; Sinisalo, Juha; Siscovick, David S.; Smit, Jan H.; Soranzo, Nicole; Sovio, Ulla; Stephens, Jonathan; Surakka, Ida; Swift, Amy J.; Tammesoo, Mari-Liis; Tardif, Jean-Claude; Teder-Laving, Maris; Teslovich, Tanya M.; Thompson, John R.; Thomson, Brian; Toenjes, Anke; Tuomi, Tiinamaija; van Meurs, Joyce B. J.; van Ommen, Gert-Jan; Vatin, Vincent; Viikari, Jorma; Visvikis-Siest, Sophie; Vitart, Veronique; Vogel, Carla I. G.; Voight, Benjamin F.; Waite, Lindsay L.; Wallaschofski, Henri; Walters, G. Bragi; Widen, Elisabeth; Wiegand, Susanna; Wild, Sarah H.; Willemsen, Gonneke; Witte, Daniel R.; Witteman, Jacqueline C.; Xu, Jianfeng; Zhang, Qunyuan; Zgaga, Lina; Ziegler, Andreas; Zitting, Paavo; Beilby, John P.; Farooqi, I. Sadaf; Hebebrand, Johannes; Huikuri, Heikki V.; James, Alan L.; Kaehoenen, Mika; Levinson, Douglas F.; Macciardi, Fabio; Nieminen, Markku S.; Ohlsson, Claes; Palmer, Lyle J.; Ridker, Paul M.; Stumvoll, Michael; Beckmann, Jacques S.; Boeing, Heiner; Boerwinkle, Eric; Boomsma, Dorret I.; Caulfield, Mark J.; Chanock, Stephen J.; Collins, Francis S.; Cupples, L. Adrienne; Smith, George Davey; Erdmann, Jeanette; Froguel, Philippe; Greonberg, Henrik; Gyllensten, Ulf; Hall, Per; Hansen, Torben; Harris, Tamara B.; Hattersley, Andrew T.; Hayes, Richard B.; Heinrich, Joachim; Hu, Frank B.; Hveem, Kristian; Illig, Thomas; Jarvelin, Marjo-Riitta; Kaprio, Jaakko; Karpe, Fredrik; Khaw, Kay-Tee; Kiemeney, Lambertus A.; Krude, Heiko; Laakso, Markku; Lawlor, Debbie A.; Metspalu, Andres; Munroe, Patricia B.; Ouwehand, Willem H.; Pedersen, Oluf; Penninx, Brenda W.; Peters, Annette; Pramstaller, Peter P.; Quertermous, Thomas; Reinehr, Thomas; Rissanen, Aila; Rudan, Igor; Samani, Nilesh J.; Schwarz, Peter E. H.; Shuldiner, Alan R.; Spector, Timothy D.; Tuomilehto, Jaakko; Uda, Manuela; Uitterlinden, Andre; Valle, Timo T.; Wabitsch, Martin; Waeber, Gerard; Wareham, Nicholas J.; Watkins, Hugh; Wilson, James F.; Wright, Alan F.; Zillikens, M. Carola; Chatterjee, Nilanjan; McCarroll, Steven A.; Purcell, Shaun; Schadt, Eric E.; Visscher, Peter M.; Assimes, Themistocles L.; Borecki, Ingrid B.; Deloukas, Panos; Fox, Caroline S.; Groop, Leif C.; Haritunians, Talin; Hunter, David J.; Kaplan, Robert C.; Mohlke, Karen L.; O'Connell, Jeffrey R.; Peltonen, Leena; Schlessinger, David; Strachan, David P.; van Duijn, Cornelia M.; Wichmann, H-Erich; Frayling, Timothy M.; Thorsteinsdottir, Unnur; Abecasis, Goncalo R.; Barroso, Ines; Boehnke, Michael; Stefansson, Kari; North, Kari E.; McCarthy, Mark I.; Hirschhorn, Joel N.; Ingelsson, Erik; Loos, Ruth J. F.

    2010-01-01

    Obesity is globally prevalent and highly heritable, but its underlying genetic factors remain largely elusive. To identify genetic loci for obesity susceptibility, we examined associations between body mass index and similar to 2.8 million SNPs in up to 123,865 individuals with targeted follow up of

  16. Foreign Investment in the U.S.: Costs and Benefits. Headline Series 249.

    Science.gov (United States)

    Zupnick, Elliot

    The document discusses the implications and positive and negative aspects of foreign direct investment in the United States. The objective is to determine whether a restrictive U.S. policy as it relates to foreign direct investment in the United States is desirable. It is presented in five chapters. Chapter I defines foreign direct investment…

  17. Accurate determination of Curium and Californium isotopic ratios by inductively coupled plasma quadrupole mass spectrometry (ICP-QMS) in 248Cm samples for transmutation studies

    International Nuclear Information System (INIS)

    The French Atomic Energy Commission has carried out several experiments including the mini-INCA (INcineration of Actinides) project for the study of minor-actinide transmutation processes in high intensity thermal neutron fluxes, in view of proposing solutions to reduce the radiotoxicity of long-lived nuclear wastes. In this context, a Cm sample enriched in 248Cm (∼97 %) was irradiated in thermal neutron flux at the High Flux Reactor (HFR) of the Laue-Langevin Institute (ILL). This work describes a quadrupole ICP-MS (ICP-QMS) analytical procedure for precise and accurate isotopic composition determination of Cm before sample irradiation and of Cm and Cf after sample irradiation. The factors that affect the accuracy and reproducibility of isotopic ratio measurements by ICP-QMS, such as peak centre correction, detector dead time, mass bias, abundance sensitivity and hydrides formation, instrumental background, and memory blank were carefully evaluated and corrected. Uncertainties of the isotopic ratios, taking into account internal precision of isotope ratio measurements, peak tailing, and hydrides formations ranged from 0.3% to 1.3%. This uncertainties range is quite acceptable for the nuclear data to be used in transmutation studies.

  18. MANTRA: An Integral Reactor Physics Experiment to Infer Actinide Capture Cross-sections from Thorium to Californium with Accelerator Mass Spectrometry

    Energy Technology Data Exchange (ETDEWEB)

    G. Youinou; C. McGrath; G. Imel; M. Paul; R. Pardo; F. Kondev; M. Salvatores; G. Palmiotti

    2011-08-01

    The principle of the proposed experiment is to irradiate very pure actinide samples in the Advanced Test Reactor at INL and, after a given time, determine the amount of the different transmutation products. The determination of the nuclide densities before and after neutron irradiation will allow inference of effective neutron capture cross-sections. This approach has been used in the past and the novelty of this experiment is that the atom densities of the different transmutation products will be determined using the Accelerator Mass Spectrometry technique at the ATLAS facility located at ANL. It is currently planned to irradiate the following isotopes: 232Th, 235U, 236U, 238U, 237Np, 238Pu, 239Pu, 240Pu, 241Pu, 242Pu, 241Am, 243Am, 244Cm and 248Cm.

  19. Radiological Characterization Technical Report on Californium-252 Sealed Source Transuranic Debris Waste for the Off-Site Source Recovery Project at Los Alamos National Laboratory

    Energy Technology Data Exchange (ETDEWEB)

    Feldman, Alexander [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2014-04-24

    This document describes the development and approach for the radiological characterization of Cf-252 sealed sources for shipment to the Waste Isolation Pilot Plant. The report combines information on the nuclear material content of each individual source (mass or activity and date of manufacture) with information and data on the radionuclide distributions within the originating nuclear material. This approach allows for complete and accurate characterization of the waste container without the need to take additional measurements. The radionuclide uncertainties, developed from acceptable knowledge (AK) information regarding the source material, are applied to the summed activities in the drum. The AK information used in the characterization of Cf-252 sealed sources has been qualified by the peer review process, which has been reviewed and accepted by the Environmental Protection Agency.

  20. The development and medical applications of a simple facility for partial body in vivo neutron activation analysis using californium-252 sources

    International Nuclear Information System (INIS)

    A simple and cheap facility for partial body neutron activation analysis has been designed, based on the use of two 100 μg 252Cf neutron sources. The results reported show that calcium can be measured in parts of the body such as the tibia with a precision as good as +- 1.6 % for a radiation dose of 2 rem. The uniformity of the thermal neutron flux density is better than +- 3 % over 10 cm. Some applications of this irradiation facility for studies of trace elements, in particular cadmium in liver and aluminium in liver or brain, have also been explored. However, the sensitivity attainable is not yet sufficient for the study of normal levels, but could be of interest in toxicological investigations

  1. Accurate determination of Curium and Californium isotopic ratios by inductively coupled plasma quadrupole mass spectrometry (ICP-QMS) in Cm-248 samples for transmutation studies

    International Nuclear Information System (INIS)

    The French Atomic Energy Commission has carried out several experiments including the mini-INCA (Incineration of Actinides) project for the study of minor-actinide transmutation processes in high intensity thermal neutron fluxes, in view of proposing solutions to reduce the radiotoxicity of long-lived nuclear wastes. In this context, a Cm sample enriched in 248Cm (similar to 97%) was irradiated in thermal neutron flux at the High Flux Reactor (HFR) of the Laue-Langevin Institute (ILL). This work describes a quadrupole ICP-MS (ICP-QMS) analytical procedure for precise and accurate isotopic composition determination of Cm before sample irradiation and of Cm and Cf after sample irradiation. The factors that affect the accuracy and reproducibility of isotopic ratio measurements by ICP-QMS, such as peak centre correction, detector dead time, mass bias, abundance sensitivity and hydrides formation, instrumental background, and memory blank were carefully evaluated and corrected. Uncertainties of the isotopic ratios, taking into account internal precision of isotope ratio measurements, peak tailing, and hydrides' formations ranged from 0. 3% to 1. 3%. This uncertainties' range is quite acceptable for the nuclear data to be used in transmutation studies. (authors)

  2. MANTRA: An Integral Reactor Physics Experiment to Infer Actinide Capture Cross-sections from Thorium to Californium with Accelerator Mass Spectrometry

    International Nuclear Information System (INIS)

    The principle of the proposed experiment is to irradiate very pure actinide samples in the Advanced Test Reactor at INL and, after a given time, determine the amount of the different transmutation products. The determination of the nuclide densities before and after neutron irradiation will allow inference of effective neutron capture cross-sections. This approach has been used in the past and the novelty of this experiment is that the atom densities of the different transmutation products will be determined using the Accelerator Mass Spectrometry technique at the ATLAS facility located at ANL. It is currently planned to irradiate the following isotopes: 232Th, 235U, 236U, 238U, 237Np, 238Pu, 239Pu, 240Pu, 241Pu, 242Pu, 241Am, 243Am, 244Cm and 248Cm.

  3. 249株流感嗜血杆菌的分离与耐药性分析%Analysis on Isolation and Antibiotic Resistance of 249 Strains of Haemophilus influenzae

    Institute of Scientific and Technical Information of China (English)

    曹敏晖; 曹友德; 李浩; 蔡瑞云

    2011-01-01

    目的 了解流感嗜血杆菌(Hi)的检出状况与耐药情况,指导临床合理用药.方法 统计分析2007-2010年我院Hi的分离与耐药情况.结果 在1052份痰及咽拭子标本中分离出Hi 210株,在242份胆汁标本中分离出Hi 16株,在203份胸腹水标本中分离出Hi 12株,在163份眼、耳拭子标本中分离出Hi 11株.体外药敏结果显示Hi对复方磺胺甲恶哇耐药性最高为63.5%,氨苄西林次之为46.2%,而对阿莫西林/棒酸、利福平、头孢呋辛、头孢噻肟、亚氨培南敏感,耐药率≤2.0%.结论 Hi在呼吸道标本中的检出率最高,眼、耳拭子标本中次之,在胆汁、胸腹水中亦有检出.建议眼、耳拭子及胆汁、胸腹水标本作细菌培养时也应同时接种哥伦比亚血平板(COS)、淋球菌选择性平板(VCA)及嗜血杆菌选择性平板(HAE),Hi感染的治疗应首选复方阿莫西林、头孢二代或三代类抗生素.%Objective To investigate the isolation rate and antibiotic resistance rate of Haemophilus influenzae, and to guide the rational use of antibiotic therapy in clinical practice. Methods The data about the isolation rate and antibiotic resistance rate of Haemophilus influenzae from 2007 to 2010 were analyzed with SPSS11.0 statistical software. Results Totally 210 strains of Haemophilus influenzae were isolated from 1,052 specimens of sputum and pharyngeal secretion, 16 strains isolated from 242 bile specimens, 12 strains isolated from 203 hydrothoraxs specimens, and 11 strains isolated from 163 specimens of eye or ear secretion. In vitro drug- sensitivity test showed that the resistance rate of Haemophilus influenzae to trimethoprime sulfanomicles was the highest (63.5%), followed by ampicillin (46.2%). But the resistance rates to amoxicillin/clavalanic acid, rifampicine, cefuroxime, cefotaxime and imipenem were very low (≤2.0%). Conclusions Heamophilus influenzae could be isolated from the secretions of respiratory track, eye, ear, bile, and hydrothoraxs. It is necessary that using COS, VCA f- lat, and HAE while performing bacterial culture of the secretions of eye, ear, bile, and hydrothoraxs. The therapy of Heamophilus influenzae infection should choose the antibiotics, such as amoxicillin/ clavalanic acid, cefuroxime and cefotaxime.

  4. The House of Commons of Canada, Bill C-249: An act to amend the nuclear liability act

    International Nuclear Information System (INIS)

    The purpose of this bill is to increase the maximum level of liability for which a private sector nuclear facility operator may be required to have insurance coverage from 75 million dollars to 500 million dollars. If the Governor in Council is of the opinion that liability could exceed the insured amount and a Commission created under Part II of the Act orders that further compensation should be made. At present, the Crown may make such payments but is not required to do so

  5. Photo-induced effects of the virgin Ge24.9Sb11.6S63.5 film

    Czech Academy of Sciences Publication Activity Database

    Knotek, P.; Tichý, Ladislav; Kutálek, P.

    594 Part A, Nov 2 (2015), s. 67-73. ISSN 0040-6090 Institutional support: RVO:61389013 Keywords : chalcogenides * thin film * photo induced effects Subject RIV: CA - Inorganic Chemistry Impact factor: 1.759, year: 2014 http://www.sciencedirect.com/science/article/pii/S0040609015009372

  6. Are taxonomists required to bend to the will of bioinformatics? A response to Johnson (Skaphion 2:49)

    Science.gov (United States)

    Author names on the end of a species epithet are essential to stable taxonomy. These names are absolutely required in the case of homonymy, but they are also useful for obtaining original descriptions, locating type depositories, and determining the quality of a species concept. In this paper I ar...

  7. SU-E-J-249: Correlation of Mean Lung Ventilation Value with Ratio of Total Lung Volumes

    Energy Technology Data Exchange (ETDEWEB)

    Yu, N; Qu, H; Xia, P [Cleveland Clinic, Cleveland, OH (United States)

    2014-06-01

    Purpose: Lung ventilation function measured from 4D-CT and from breathing correlated CT images is a novel concept to incorporate the lung physiologic function into treatment planning of radiotherapy. The calculated ventilation functions may vary from different breathing patterns, affecting evaluation of the treatment plans. The purpose of this study is to correlate the mean lung ventilation value with the ratio of the total lung volumes obtained from the relevant CTs. Methods: A ventilation map was calculated from the variations of voxel-to-voxel CT densities from two breathing phases from either 4D-CT or breathing correlated CTs. An open source image registration tool of Plastimatch was used to deform the inhale phase images to the exhale phase images. To calculate the ventilation map inside lung, the whole lung was delineated and the tissue outside the lung was masked out. With a software tool developed in house, the 3D ventilation map was then converted in the DICOM format associated with the planning CT images. The ventilation map was analyzed on a clinical workstation. To correlate ventilation map thus calculated with lung volume change, the total lung volume change was compared the mean ventilation from our method. Results: Twenty two patients who underwent stereotactic body irradiation for lung cancer was selected for this retrospective study. For this group of patients, the ratio of lung volumes for the inhale (Vin ) and exhale phase (Vex ) was shown to be linearly related to the mean of the local ventilation (Vent), Vin/Vex=1.+0.49*Vent (R2=0.93, p<0.01). Conclusion: The total lung volume change is highly correlated with the mean of local ventilation. The mean of local ventilation may be useful to assess the patient's lung capacity.

  8. List of research reports with reportnumbers from RCN-1 to RCN-249 published by RCN between 1960 and 1976

    International Nuclear Information System (INIS)

    The Stichting Reactor Centrum Nederland (RCN) was founded on 6 July 1955.On 20 July 1976, the name was changed to Netherlands Energy Research Foundation ECN. Before, research reports were published with the reportcode RCN-. After, a new series of reports was started commencing with reportnumber ECN-1. This list constitutes all research reports with reportcode RCN- published between 1960 and 1976. In addition to the compilation of bibliographic descriptions, an author list and a KWOC list on all significant words in the report titles have been given

  9. SU-E-T-249: Neutron Model Upgrade for Radiotherapy Patients Monitoring Using a New Online Detector

    Energy Technology Data Exchange (ETDEWEB)

    Irazola, L; Sanchez Doblado, F. [Departamento de Fisiologia Medica y Biofisica, Universidad de Sevilla (Spain); Servicio de Radiofisica, Hospital Universitario Virgen Macarena, Sevilla (Spain); Lorenzoli, M; Pola, A. [Politecnico di Milano, Departimento di Ingegneria Nuclear, Milano (Italy); Terron, J.A. [Servicio de Radiofisica, Hospital Universitario Virgen Macarena, Sevilla (Spain); Bedogni, R. [Laboratori Nazionali di Frascati, Istituto Nazionale di Fisica Nucleare (INFN) (Italy); Sanchez Nieto, B. [Instituto de Fisica, Pontificia Universidad Catolica de Chile, Santiago (Chile); Romero-Exposito, M. [Departamento de Fisica, Universitat Autonoma de Barcelona (Spain)

    2014-06-01

    Purpose: The purpose of this work is to improve the existing methodology to estimate neutron equivalent dose in organs during radiotherapy treatments, based on a Static Random Access Memory neutron detector (SRAMnd) [1]. This is possible thanks to the introduction of a new digital detector with improved characteristics, which is able to measure online the neutron fluence rate in the presence of an intense photon background [2]. Its reduced size, allows the direct estimation of doses in specific points inside an anthropomorphic phantom (NORMA) without using passive detectors as TLD or CR-39. This versatility will allow not only to improve the existing models (generic abdomen and H and N [1]) but to generate more specific ones for any technique. Methods: The new Thermal Neutron Rate Detector (TNRD), based on a diode device sensitized to thermal neutrons, have been inserted in 16 points of the phantom. These points are distributed to infer doses to specific organs. Simultaneous measurements of these devices and a reference one, located in front of the gantry, have been performed for the mentioned generic treatments, in order to improve the existing model. Results: These new devices have shown more precise since they agree better with Monte Carlo simulations. The comparison of the thermal neutron fluence, measured with TNRD, and the existing models, converted from events to fluence, shows an average improvement of (3.90±3.37) % for H and N and (12.61±9.43) % for abdomen, normalized to the maximum value. Conclusion: This work indicates the potential of these new devices for more precise neutron equivalent dose estimation in organs, as a consequence of radiotherapy treatments. The simplicity of the process makes possible to establish more specific models that will provide a better dose estimation. References[1] Phys Med Biol 2012; 57:6167–6191.[2] A new active thermal neutron detector. Radiat. Prot. Dosim. (in press)

  10. Freeze drying method for preparing radiation source material

    International Nuclear Information System (INIS)

    Fabrication of a neutron source is specifically claimed. A palladium/californium solution is freeze dried to form a powder which, through conventional powder metallurgy, is shaped into a source containing the californium evenly distributed through a palladium metal matrix. (E.C.B.)

  11. Review of RBE and OER values for Cf-neutrons

    International Nuclear Information System (INIS)

    Californium-252, an isotope emitting neutrons, gamma photons and alpha particles, is being investigated for its practical use in intracavitary and interstitial brachytherapy. A review of published RBE and OER values for californium neutrons as a function of dose rate for a variety of biological endpoints is given. (Auth.)

  12. Evidence for association of D1S249 locus on human chromosome 1 with the susceptibility to essential hypertension in Han Chinese

    Institute of Scientific and Technical Information of China (English)

    ZHENG; Yong; (

    2001-01-01

    [1]Jeunemaitre, X., Soubrier, F., Kotelevtsev, Y. V. et al., Molecular basis of hypertension: role of angiotensinogen, Cell, 1993, 71: 169.[2]Hingorani, A. D., Sharma, P., Jia, H. et al., Blood pressure and M235T polymorphism of the angiotensinogen gene, Hypertension, 1996, 28: 907.[3]Liu, Y., Zhou, W. Y., Qiu, C. C. et al., Association analysis of polymorphisms of ACE gene and AGT gene with essential hypertension in Chinese Han's population, Chin. Med. Sci. J., 1998, 13(2): 71.[4]Davies, E., Bonnar, D. A., Lathrop, G. M. et al., Human angiotensin II type I receptor locus, CA repeat polymorphism and genetic mapping, Hum. Mol. Genet., 1994, 3: 838.[5]Kainulainen, K., Perola, M., Terwilliger, J. et al., Evidence for involvement of the type I angiotensin II receptor locus in essential hypertension, Hypertension, 1999, 33: 844.[6]Wang, W. Y. S., Zee, R. Y. L., Morris, B. J. et al., Association of angiotensin II type I receptor gene polymorphism with essential hypertension, Clin. Genet., 1997, 51: 31.[7]Mastana, S., Nunn, J., Angiotensin-converting enzyme deletion polymorphism is associated with hypertension in a sikh population, Human Hered., 1997, 47: 250.[8]Poirier, O., Georges, J. L., Ricard, S. et al., New polymorphisms of the angiotensin II type I receptor gene and their associations with myocardial infarction and blood pressure: the ECTIM study, J. of Hypertension, 1998, 16: 1443.[9]Liu, Y., Qiu, C. C., Zhou, W. Y. et al., Gene polymorphisms of the renin-angiotensin system in essential hypertension, Chinese Medical Journal, 1999, 112(2): 115.[10] Todd, J. A., Genetic analysis of type I diabetes using whole genome approaches, Proc. Natl. Acad. Sci. USA, 1995, 92: 8560.[11] Hanis, C. L., Boerwinkle, E., Chakraborty, R. et al., A genome-wide search for human non-insulin-dependent (type II) diabetes genes reveals a major susceptibility locus on chromosome 2, Nature Genetics, 1996, 13: 161.[12] Hager, J., Dina, C., Franke, S. et al., A genome-wide scan for human obesity genes reveals a major susceptibility locus on chromosome 10, Nature Genetics, 1998, 20: 304.[13] Schuster, H., Wienker, T. F., Bahring, S. et al., Severe autosomal dominant hypertension and brachydactyly in a unique Turkish Kindred maps to human chromosome 12, Nature Genetics, 1996, 13: 98.[14] Baima, J., Nicolaou, M., Schwartz, F. et al., Evidence for linkage between essential hypertension and a putative locus on human chromosome 17, Hypertension, 1999, 34: 4.[15] Wright, F. A., O'connor, D. T., Roberts, E. et al., Genome scan for blood pressure loci in mice, Hypertension, 1999, 34: 625.[16] Cox, N. J., Baker, L., Spielman, R. S., Insulin-gene sharing in sib pairs with insulin dependent diabetes mellitus: no evidence for linkage, Am. J. Hum. Genet., 1988, 42: 167.[17] Bonnardeaux, A., Davies, E., Jeunemaitre, X. et al., Angiotensin II type I receptor gene polymorphisms in human essential hypertension, Hypertension, 1994, 24: 63.

  13. 17 CFR 249.822 - Form 19b-7, for electronic filing with respect to proposed rule changes by self-regulatory...

    Science.gov (United States)

    2010-04-01

    ... filing with respect to proposed rule changes by self-regulatory organizations under Section 19(b)(7)(A... SECURITIES AND EXCHANGE COMMISSION (CONTINUED) FORMS, SECURITIES EXCHANGE ACT OF 1934 Forms for Self... proposed rule changes by self-regulatory organizations under Section 19(b)(7)(A) of the Securities...

  14. Measurement of the total cross section difference ΔσL in np transmission at 1.19, 2.49 and 3.65 GeV

    International Nuclear Information System (INIS)

    Results of the total cross section difference ΔσL in a np transmission experiment are presented. Results were obtained with a polarized beam of free quasi-monochromatic neutrons passing through the new Dubna frozen spin proton target. The beam and target polarizations were oriented longitudinally. The new results are compared with ΔσL(pn) data determined as a difference between ΔσL(pd) and ΔσL(pp) ANL-ZGS measurements. The values of ΔσL for the isospin state I=0 were deduced using known pp data. (author)

  15. 17 CFR 249.820 - Form 19b-4(e) for the listing and trading of new derivative securities products by self...

    Science.gov (United States)

    2010-04-01

    ... self-regulatory organization's listing and trading of a new derivative securities product that is not deemed a proposed rule change, pursuant to Rule 19b-4(e) under the Act (17 CFR 240.19b-4(e)). Editorial Note: For Federal Register citations affecting Form 19b-4(e), see the List of CFR Sections...

  16. SU-E-J-249: Characterization of Gynecological Tumor Heterogeneity Using Texture Analysis in the Context of An 18F-FDG PET Adaptive Protocol

    International Nuclear Information System (INIS)

    Purpose: We propose a method to examine gynecological tumor heterogeneity using texture analysis in the context of an adaptive PET protocol in order to establish if texture metrics from baseline PET-CT predict tumor response better than SUV metrics alone as well as determine texture features correlating with tumor response during radiation therapy. Methods: This IRB approved protocol included 29 women with node positive gynecological cancers visible on FDG-PET treated with EBRT to the PET positive nodes. A baseline and intra-treatment PET-CT was obtained. Tumor outcome was determined based on RECIST on posttreatment PET-CT. Primary GTVs were segmented using 40% threshold and a semi-automatic gradient-based contouring tool, PET Edge (MIM Software Inc., Cleveland, OH). SUV histogram features, Metabolic Volume (MV), and Total Lesion Glycolysis (TLG) were calculated. Four 3D texture matrices describing local and regional relationships between voxel intensities in the GTV were generated: co-occurrence, run length, size zone, and neighborhood difference. From these, 39 texture features were calculated. Prognostic power of baseline features derived from gradientbased and threshold GTVs were determined using the Wilcoxon rank-sum test. Receiver Operating Characteristics and logistic regression was performed using JMP (SAS Institute Inc., Cary, NC) to find probabilities of predicting response. Changes in features during treatment were determined using the Wilcoxon signed-rank test. Results: Of the 29 patients, there were 16 complete responders, 7 partial responders, and 6 non-responders. Comparing CR/PR vs. NR for gradient-based GTVs, 7 texture values, TLG, and SUV kurtosis had a p < 0.05. Threshold GTVs yielded 4 texture features and TLG with p < 0.05. From baseline to intra-treatment, 14 texture features, SUVmean, SUVmax, MV, and TLG changed with p < 0.05. Conclusion: Texture analysis of PET imaged gynecological tumors is an effective method for early prognosis and should be used complimentary to SUV metrics, especially when using gradient based segmentation

  17. SU-E-J-249: Characterization of Gynecological Tumor Heterogeneity Using Texture Analysis in the Context of An 18F-FDG PET Adaptive Protocol

    Energy Technology Data Exchange (ETDEWEB)

    Nawrocki, J [Duke University Medical Physics Graduate Program, Durham, NC (United States); Chino, J; Craciunescu, O [Duke University Medical Center Department of Radiation Oncology, Durham, NC (United States); Das, S [University of North Carolina School of Medicine, Chapel Hill, NC (United States)

    2015-06-15

    Purpose: We propose a method to examine gynecological tumor heterogeneity using texture analysis in the context of an adaptive PET protocol in order to establish if texture metrics from baseline PET-CT predict tumor response better than SUV metrics alone as well as determine texture features correlating with tumor response during radiation therapy. Methods: This IRB approved protocol included 29 women with node positive gynecological cancers visible on FDG-PET treated with EBRT to the PET positive nodes. A baseline and intra-treatment PET-CT was obtained. Tumor outcome was determined based on RECIST on posttreatment PET-CT. Primary GTVs were segmented using 40% threshold and a semi-automatic gradient-based contouring tool, PET Edge (MIM Software Inc., Cleveland, OH). SUV histogram features, Metabolic Volume (MV), and Total Lesion Glycolysis (TLG) were calculated. Four 3D texture matrices describing local and regional relationships between voxel intensities in the GTV were generated: co-occurrence, run length, size zone, and neighborhood difference. From these, 39 texture features were calculated. Prognostic power of baseline features derived from gradientbased and threshold GTVs were determined using the Wilcoxon rank-sum test. Receiver Operating Characteristics and logistic regression was performed using JMP (SAS Institute Inc., Cary, NC) to find probabilities of predicting response. Changes in features during treatment were determined using the Wilcoxon signed-rank test. Results: Of the 29 patients, there were 16 complete responders, 7 partial responders, and 6 non-responders. Comparing CR/PR vs. NR for gradient-based GTVs, 7 texture values, TLG, and SUV kurtosis had a p < 0.05. Threshold GTVs yielded 4 texture features and TLG with p < 0.05. From baseline to intra-treatment, 14 texture features, SUVmean, SUVmax, MV, and TLG changed with p < 0.05. Conclusion: Texture analysis of PET imaged gynecological tumors is an effective method for early prognosis and should be used complimentary to SUV metrics, especially when using gradient based segmentation.

  18. Sylvie Schweitzer, Femmes de pouvoir. Une histoire de l’égalité professionnelle en Europe (XIXe - XXIe siècle, Paris, Payot, 2010, 249 p.

    Directory of Open Access Journals (Sweden)

    Isabelle Ernot

    2010-07-01

    Full Text Available Avec cet ouvrage, Sylvie Schweitzer poursuit son investigation autour de l’histoire du travail des femmes. L’étude se focalise particulièrement sur la voie du savoir, à travers la question des diplômées et de leur accession progressive à des professions valorisantes et de pouvoir, dans le cadre d’un temps long de cent cinquante années, courant du milieu du XIXe au début du XXIe siècle. Si la France constitue le cadre de référence essentiel, cet essai d’histoire comparée regarde aussi vers l’e...

  19. Characterization of the in vitro expressed autoimmune rippling muscle disease immunogenic domain of human titin encoded by TTN exons 248-249

    International Nuclear Information System (INIS)

    Highlights: → Affinity purification of the autoimmune rippling muscle disease immunogenic domain of titin. → Partial sequence analysis confirms that the peptides is in the I band region of titin. → This region of the human titin shows high degree of homology to mouse titin N2-A. -- Abstract: Autoimmune rippling muscle disease (ARMD) is an autoimmune neuromuscular disease associated with myasthenia gravis (MG). Past studies in our laboratory recognized a very high molecular weight skeletal muscle protein antigen identified by ARMD patient antisera as the titin isoform. These past studies used antisera from ARMD and MG patients as probes to screen a human skeletal muscle cDNA library and several pBluescript clones revealed supporting expression of immunoreactive peptides. This study characterizes the products of subcloning the titin immunoreactive domain into pGEX-3X and the subsequent fusion protein. Sequence analysis of the fusion gene indicates the cloned titin domain (GenBank ID: (EU428784)) is in frame and is derived from a sequence of N2-A spanning the exons 248-250 an area that encodes the fibronectin III domain. PCR and EcoR1 restriction mapping studies have demonstrated that the inserted cDNA is of a size that is predicted by bioinformatics analysis of the subclone. Expression of the fusion protein result in the isolation of a polypeptide of 52 kDa consistent with the predicted inferred amino acid sequence. Immunoblot experiments of the fusion protein, using rippling muscle/myasthenia gravis antisera, demonstrate that only the titin domain is immunoreactive.

  20. Characterization of the in vitro expressed autoimmune rippling muscle disease immunogenic domain of human titin encoded by TTN exons 248-249

    Energy Technology Data Exchange (ETDEWEB)

    Zelinka, L. [Biomedical Sciences Program, Kent State University, Kent, OH (United States); McCann, S.; Budde, J.; Sethi, S.; Guidos, M.; Giles, R. [Center for Applied Chemical Biology, Department of Biological Sciences, Youngstown State University, One University Plaza, Youngstown, OH 44555 (United States); Walker, G.R., E-mail: grwalker@ysu.edu [Center for Applied Chemical Biology, Department of Biological Sciences, Youngstown State University, One University Plaza, Youngstown, OH 44555 (United States); Biomedical Sciences Program, Kent State University, Kent, OH (United States)

    2011-08-05

    Highlights: {yields} Affinity purification of the autoimmune rippling muscle disease immunogenic domain of titin. {yields} Partial sequence analysis confirms that the peptides is in the I band region of titin. {yields} This region of the human titin shows high degree of homology to mouse titin N2-A. -- Abstract: Autoimmune rippling muscle disease (ARMD) is an autoimmune neuromuscular disease associated with myasthenia gravis (MG). Past studies in our laboratory recognized a very high molecular weight skeletal muscle protein antigen identified by ARMD patient antisera as the titin isoform. These past studies used antisera from ARMD and MG patients as probes to screen a human skeletal muscle cDNA library and several pBluescript clones revealed supporting expression of immunoreactive peptides. This study characterizes the products of subcloning the titin immunoreactive domain into pGEX-3X and the subsequent fusion protein. Sequence analysis of the fusion gene indicates the cloned titin domain (GenBank ID: (EU428784)) is in frame and is derived from a sequence of N2-A spanning the exons 248-250 an area that encodes the fibronectin III domain. PCR and EcoR1 restriction mapping studies have demonstrated that the inserted cDNA is of a size that is predicted by bioinformatics analysis of the subclone. Expression of the fusion protein result in the isolation of a polypeptide of 52 kDa consistent with the predicted inferred amino acid sequence. Immunoblot experiments of the fusion protein, using rippling muscle/myasthenia gravis antisera, demonstrate that only the titin domain is immunoreactive.

  1. 33 CFR 207.249 - Ouachita and Black Rivers, Ark. and La., Mile 0.0 to Mile 338.0 (Camden, Ark.) above the mouth of...

    Science.gov (United States)

    2010-07-01

    ... other lockages, then separate lockages shall be made. Dangerous cargoes are described in 46 CFR part 146.... and La., Mile 0.0 to Mile 338.0 (Camden, Ark.) above the mouth of the Black River; the Red River, La.... and La., Mile 0.0 to Mile 338.0 (Camden, Ark.) above the mouth of the Black River; the Red River,...

  2. 17 CFR 41.11 - Method for determining market capitalization and dollar value of average daily trading volume...

    Science.gov (United States)

    2010-04-01

    ... Form F-6 (17 CFR 239.36). (d) Definitions. For purposes of this section: (1) SEC means the Securities...-QSB, or Form 20-F (17 CFR 249.310, 249.308a, 249.310b, 249.308b, or 249.220f) filed with the... outstanding shares subsequently reported by the issuer on a Form 8-K (17 CFR 249.308). (8) Preceding 6...

  3. RESGPSPNTS_JD249.SHP: Navigation and Bathymetry Points of Ship Position During Continuous Resistivity Profile Data Collection in the Potomac River/Chesapeake Bay on Sept. 6, 2006 on USGS Cruise 06018

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — In order to test hypotheses about groundwater flow under and into Chesapeake Bay, geophysical surveys were conducted by U.S. Geological Survey (USGS) scientists on...

  4. Vlasov B. Natural properties of Karst lakes in Belarus / B. Vlasov // Lakes and artificial water reservoirs – functioning, revitalization and protection. – Cosnowiec, 2005. – Р. 249–255.

    OpenAIRE

    Vlasov, Boris

    2005-01-01

    Abstract: Karst lakes of Belarus belong to the azonal type and are distributed in Polesje region in the area of superficial deposition of chalk rocks. Specific features of these type lakes include: small water surface, tunneled form of a hollow, low water exchange rate and increased level of water mineralization; the lakes refer to mesotrophic or eutrophic types.

  5. Nuclear Liability Act of 8 March 1968 (No. 45) as amended by an Act of 10 May 1974 (No. 249) and by an Act of 22 December 1982 (No. 1275)

    International Nuclear Information System (INIS)

    The amendments to this Act fall into two categories. The first category of amendments enabled Sweden to ratify two 1982 Protocols amending the Paris Convention and the Brussels Supplementary Convention respectively. The other amendments raise the nuclear operator's liability from 50 million to 500 million Swedish crowns per incident and introduce a State liability over and above compensation available under the Brussels Convention, thus raising the aggregate amount of compensation to 3,000 million Swedish crowns. (NEA)

  6. The activation of N-glycosidic bond cleavage performed by base-excision repair enzyme hOGG1; Theoretical study of the role of Lys 249 residue in activation of G, OxoG and FapyG

    Czech Academy of Sciences Publication Activity Database

    Šebera, Jakub; Trantírek, L.; Tanaka, Y.; Nencka, Radim; Fukal, J.; Sychrovský, Vladimír

    2014-01-01

    Roč. 4, č. 83 (2014), s. 44043-44051. ISSN 2046-2069 R&D Projects: GA ČR GA13-27676S Grant ostatní: GA AV ČR(CZ) M200551205; GA MŠk(CZ) ED1.1.00/02.0068; GA MŠk(CZ) EE2.3.20.0042 Institutional support: RVO:61388963 Keywords : DFT * QM/MM * Fukui indices * hOGG1 * aromaticity * 8-OxoG Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 3.840, year: 2014

  7. RESGPSLNS_JD249.SHP: Ship Trackline along which Continuous Resistivity Profile Data was Collected in the Potomac River/Chesapeake Bay on Sept., 6, 2006 on USGS Cruise 06018

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — In order to test hypotheses about groundwater flow under and into Chesapeake Bay, geophysical surveys were conducted by U.S. Geological Survey (USGS) scientists on...

  8. Thermosalinograph data of the Hawaii Ocean Time-series (HOT) program in the North Pacific 100 miles north of Oahu, Hawaii for cruises HOT249-258 during 2013 (NODC Accession 0125648)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The HOT program makes repeated observations of the physics, biology and chemistry at a site approximately 100 km north of Oahu, Hawaii. The program began in 1988....

  9. Niskin bottle data of the Hawaii Ocean Time-series (HOT) program in the North Pacific 100 miles north of Oahu, Hawaii for cruises HOT249-258 during 2013 (NODC Accession 0125579)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The HOT program makes repeated observations of the physics, biology and chemistry at a site approximately 100 km north of Oahu, Hawaii. Two stations are visited...

  10. CTD data of the Hawaii Ocean Time-series (HOT) program in the North Pacific 100 miles north of Oahu, Hawaii for cruises HOT249-258 during 2013 (NODC Accession 0125647)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The HOT program makes repeated observations of the physics, biology and chemistry at a site approximately 100 km north of Oahu, Hawaii. The program began in 1988....

  11. Avaliação nutricional da casca de soja integral ou moída, ensilada ou não, para suínos em fase de crescimento - DOI: 10.4025/actascianimsci.v29i1.249 Nutritional evaluation of whole or grinder soybean hull, ensilaged or not, for growing pigs - DOI: 10.4025/actascianimsci.v29i1.249

    OpenAIRE

    Cleber Rogério Ribeiro; Diovani Paiano; Ivan Moreira; Arlei Rodrigues Bonet Quadros; Nikychiella Silvestrim; Antônio Cláudio Furlan

    2007-01-01

    Foi conduzido um experimento com 11 suínos híbridos, machos castrados, com peso vivo de 41,42 ± 0,99 kg. Os animais foram alojados individualmente em gaiolas de metabolismo e distribuídos em um delineamento experimental inteiramente casualizado, com parcelas subdivididas, com quatro tratamentos em esquema fatorial 2 x 2 (moagem x ensilagem). Os alimentos avaliados foram: a casca de soja (CS) integral (CSI), CS moída (CSM), silagem de CSI (SCSI) e silagem de CSM (SCSM), que substituíram, com b...

  12. A new shipping container for an intense neutron emitter

    International Nuclear Information System (INIS)

    Californium-252 is an intense neutron emitter (2.34 x 1012 n/s·g) used in medicine, research, and industry. The western world's sole source of this rare radioisotope is the Californium Facility at Oak Ridge National Laboratory's Radiochemical Engineering Development Center (REDC). A project has been initiated at the REDC to design a new Type B Californium Shipping Container. This effort is essential for future transportation of californium to meet the needs of users all over the world. The shipping container must meet all requirements for transport by motor freight, air, vessel, and rail, both domestic and foreign. There are unique problems in the design, fabrication, and licensing of a new Type B shipping container that will accommodate up to 60 milligrams of californium-252. One of the first challenges in the design phase of the project is the selection of a material to shield the high neutron flux. The more stringent safety precautions of today's world impel us to consider more exotic materials for such a purpose. The candidate materials must be examined not just for their neutron shielding properties, but also in conjunction with other properties such as thermal and structural requirements to withstand the hypothetical accident conditions. The design and building of such a container is a formidable task requiring much planning. The licensing process, with the complex, interactive federal codes, is a special challenge and may be the biggest on the project in terms of time and money

  13. Application of Cf for the quantitative measurement of nuclear reactor fuel materials

    International Nuclear Information System (INIS)

    Sensitive and rapid measurements of the quantity and geometric distribution of nuclear reactor fuel materials can be made using neutrons from californium. The neutron-induced fission rate in these materials may be measured by detection of either prompt radiations from fission or delayed radiations from radioactive fission products. A number of californium-based instruments are presently in use by the nuclear industry for purposes of process control, quality control, nuclear materials safeguards, and environmentl assessment. An Automated Fuel Rod Scanner (AFRS) is used for high-speed measurement of the uniformity of loading and total fissile content of reactor fuel rods. The fuel rods are moved first through an irradiator containing about 1 mg of californium, and subsequently through high-efficiency detectors for the measurement of fission-product gamma-rays. Multiple detectors on each of two irradiation channels are used to reduce the californium source strength requirement. The fuel loading of each 15-mm-long pellet is tested to +-10% on 100% of the plant throughput. By summing the response over length, the total fissile material content of the fuel rod is measured to better than 0.5%. An on-line computer for data processing allows the instrument to measure about 150 rods per hour with a single operator. The same activation concept is used with a 25-μg californium source in a Small Sample Assay System (SSAS) which measures the fissile content of fuel pellet sized samples with a precision of 0.5%

  14. Developments for transactinide chemistry experiments behind the gas-filled separator TASCA

    Energy Technology Data Exchange (ETDEWEB)

    Even, Julia

    2011-12-13

    Topic of this thesis is the development of experiments behind the gas-filled separator TASCA (TransActinide Separator and Chemistry Apparatus) to study the chemical properties of the transactinide elements. In the first part of the thesis, the electrodepositions of short-lived isotopes of ruthenium and osmium on gold electrodes were studied as model experiments for hassium. From literature it is known that the deposition potential of single atoms differs significantly from the potential predicted by the Nernst equation. This shift of the potential depends on the adsorption enthalpy of therndeposited element on the electrode material. If the adsorption on the electrode-material is favoured over the adsorption on a surface made of the same element as the deposited atom, the electrode potential is shifted to higher potentials. This phenomenon is called underpotential deposition. Possibilities to automatize an electro chemistry experiment behind the gas-filled separator were explored for later studies with transactinide elements. The second part of this thesis is about the in-situ synthesis of transition-metal-carbonyl complexes with nuclear reaction products. Fission products of uranium-235 and californium-249 were produced at the TRIGA Mainz reactor and thermalized in a carbon-monoxide containing atmosphere. The formed volatile metal-carbonyl complexes could be transported in a gas-stream. Furthermore, short-lived isotopes of tungsten, rhenium, osmium, and iridium were synthesised at the linear accelerator UNILAC at GSI Helmholtzzentrum fuer Schwerionenforschung, Darmstadt. The recoiling fusion products were separated from the primary beam and the transfer products in the gas-filled separator TASCA. The fusion products were stopped in the focal plane of TASCA in a recoil transfer chamber. This chamber contained a carbon-monoxide - helium gas mixture. The formed metal-carbonyl complexes could be transported in a gas stream to various experimental setups. All

  15. Protein (Viridiplantae): 225469115 [

    Lifescience Database Archive (English)

    Full Text Available XP_002269781.1 33090:8648 35493:7702 131221:7702 3193:7702 58023:874 78536:4279 58024:4279 3398: ... 91834:249 403667:249 3602:249 3603:249 29760:249 PRE DICTE D: (E ,E )-alpha-farne se ne ... synthase ... Vitis vinife ... ra MDSANHIQNSQE FLQCQAKSE GVGTISQRRSANYKPNIWKYDCVQSLTSE YMGE PYTRQVQQL ... KGE VRRVFVE VVE PLAKLE FIDSIKKLGLGNFFEEE IRE ALDTIMSDKNNSPGI ... KANLYAAALCFRLLRQHGYGVSQDMFSGFMEE VGMFSKSTCTNVKGMIE LFE ASHLALE GE NILDE AKAFSSGYLKE IISNL ...

  16. Protein (Viridiplantae): 359496694 [

    Lifescience Database Archive (English)

    Full Text Available XP_002264134.2 33090:8648 35493:7702 131221:7702 3193:7702 58023:874 78536:4279 58024:4279 3398: ... 91834:249 403667:249 3602:249 3603:249 29760:249 PRE DICTE D: (E ,E )-alpha-farne se ne ... synthase -like ... Vitis v ... inife ra MDSANHIQNSQE FLQCQAKSE GVGTISQRRSANYKPNIWKYDCVQSLT ... SE YMGE PYTRQVQQLKGE VRRVFVE VVE PLAKLE FIDSIKKLGLGNFFEEE IR E ALDTIMSDKNNSPGIKANLYAAALCFRLLRQHGYGVSQDMFSGFMEE VGMFSKSTCTNVKGMIE LFE ASHLALE GE NILDE AKAFSSGYLKE IISNL ...

  17. Protein (Viridiplantae): 359496696 [

    Lifescience Database Archive (English)

    Full Text Available XP_003635303.1 33090:8648 35493:7702 131221:7702 3193:7702 58023:874 78536:4279 58024:4279 3398: ... 91834:249 403667:249 3602:249 3603:249 29760:249 PRE DICTE D: (E ,E )-alpha-farne se ne ... synthase -like ... Vitis v ... inife ra MDSANHIQNSQE FLQCQAKSE GVGTISQRRSANYKPNIWKYDCVQSLT ... SE YMGE PYTRQVQQLKGE VRRVFVE VVE PLAKLE FIDSIKKLGLGNFFEEE XV ... GMFSKSTCTNVKGMIE LFE ASHLALE GE NILDE AKAFSSGYLKE IISNLDNNLAKQVVHSLE RPLHW ...

  18. Protein (Viridiplantae): 359497519 [

    Lifescience Database Archive (English)

    Full Text Available XP_003635550.1 33090:8648 35493:7702 131221:7702 3193:7702 58023:874 78536:4279 58024:4279 3398: ... 91834:249 403667:249 3602:249 3603:249 29760:249 PRE DICTE D: (E ,E )-ge ranyllinalool synthase -like , partia ... l Vitis vinife ra IE HE LSLPWIARLDHLDHRMWIE QQYKNNTLWTGKASFYRLSCFHDE G ... LMQLAVKNYE LRQAIFKSE LEE LKRWCKDWGLTDMGFGRE KTTYCYFAVAASSSLPHDSAV ... RTIVAKSAILVTVADDFFDTKGSLDE LE SLTE AVGRWNGKGLSSHSKTIFDALDNLVRDMTE KHLHQQGSDITNDLQ ...

  19. Protein (Viridiplantae): 359494876 [

    Lifescience Database Archive (English)

    Full Text Available XP_002279869.2 33090:8648 35493:7702 131221:7702 3193:7702 58023:874 78536:4279 58024:4279 3398: ... 91834:249 403667:249 3602:249 3603:249 29760:249 PRE DICTE D: (E ,E )-ge ranyllinalool synthase -like ... Vitis v ... inife ra ME SSHSIIE ALVRKIKDE MFSSVDLYSFVSPSAYDTAWLAMVPDPAGG ... NDGRPMFGE CLNWVVNNQRE DGFWGE SDGYGNPTIDCLPATLACMLALKTWGVGSGNLE R ... GLAFIHDNTE KLLAE NHGRCPRWFAIVFPTMIE LAQKTGLE IVFSDE LEE VLTNIFHHRQR ...

  20. Protein (Viridiplantae): 359497234 [

    Lifescience Database Archive (English)

    Full Text Available XP_003635459.1 33090:8648 35493:7702 131221:7702 3193:7702 58023:874 78536:4279 58024:4279 3398: ... 91834:249 403667:249 3602:249 3603:249 29760:249 PRE DICTE D: (E ,E )-ge ranyllinalool synthase -like ... Vitis v ... inife ra ME SSHSIIE ALVRKIKDE MFSSVDLYSFVSPSAYDTAWLAMVPGGNDG ... RPMFGE CLNWVVNNQRE GGFWGE SDGYGNPTIDCLPATLACMLALKTWGVGSGNLE R ... GLAFIHDNTE KLLAE NHGRCPRWFAIVFPAMIE LAQKTGFE IVFSDE LEE VLTNIFHHRQR ...

  1. Application of PGNAA to preincineration assay of combustible waste for chlorine

    Energy Technology Data Exchange (ETDEWEB)

    Gehrke, R.J.; Pawelko, R.J.; Greenwood, R.C. [Idaho National Engineering Lab., Idaho Falls, ID (United States)

    1995-12-31

    A prompt gamma neutron activation analysis method is being developed for on-stream pre-incineration assay of low level radioactive combustible waste for it`s chlorine content. The assay system consists of three californium 252 sources and a germanium or scintillation gamma-ray spectrometer.

  2. Source storage and transfer cask: Users Guide

    International Nuclear Information System (INIS)

    The storage and shield cask for the dual californium source is designed to shield and transport up to 3.7 mg (2 Ci) of 252Cf. the cask meets Department of Transportation (DOT) license requirements for Type A materials (DOT-7A). The cask is designed to transfer sources to and from the Flourinel and Fuel Storage (FAST) facility delayed-neutron interrogator. Californium sources placed in the cask must be encapsulated in the SR-CF-100 package and attached to Teleflex cables. The cask contains two source locations. Each location contains a gear box that allows a Teleflex cable to be remotely moved by a hand crank into and out of the cask. This transfer procedure permits sources to be easily removed and inserted into the delayed-neutron interrogator and reduces personnel radiation exposure during transfer. The radiation dose rate with the maximum allowable quantity of californium (3.7 mg) in the cask is 30 mR/h at the surface and less than 2 mR/h 1 m from the cask surface. This manual contains information about the cask, californium sources, describes the method to ship the cask, and how to insert and remove sources from the cask. 28 figs

  3. Discovery of Isotopes of the Transuranium Elements with 93 <= Z <= 98

    OpenAIRE

    Fry, C; Thoennessen, M

    2012-01-01

    One hundred and five isotopes of the transuranium elements neptunium, plutonium, americium, curium, berkelium and californium have so far been observed; the discovery of these isotopes is discussed. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  4. Developments for transactinide chemistry experiments behind the gas-filled separator TASCA

    International Nuclear Information System (INIS)

    Topic of this thesis is the development of experiments behind the gas-filled separator TASCA (TransActinide Separator and Chemistry Apparatus) to study the chemical properties of the transactinide elements. In the first part of the thesis, the electrodepositions of short-lived isotopes of ruthenium and osmium on gold electrodes were studied as model experiments for hassium. From literature it is known that the deposition potential of single atoms differs significantly from the potential predicted by the Nernst equation. This shift of the potential depends on the adsorption enthalpy of therndeposited element on the electrode material. If the adsorption on the electrode-material is favoured over the adsorption on a surface made of the same element as the deposited atom, the electrode potential is shifted to higher potentials. This phenomenon is called underpotential deposition. Possibilities to automatize an electro chemistry experiment behind the gas-filled separator were explored for later studies with transactinide elements. The second part of this thesis is about the in-situ synthesis of transition-metal-carbonyl complexes with nuclear reaction products. Fission products of uranium-235 and californium-249 were produced at the TRIGA Mainz reactor and thermalized in a carbon-monoxide containing atmosphere. The formed volatile metal-carbonyl complexes could be transported in a gas-stream. Furthermore, short-lived isotopes of tungsten, rhenium, osmium, and iridium were synthesised at the linear accelerator UNILAC at GSI Helmholtzzentrum fuer Schwerionenforschung, Darmstadt. The recoiling fusion products were separated from the primary beam and the transfer products in the gas-filled separator TASCA. The fusion products were stopped in the focal plane of TASCA in a recoil transfer chamber. This chamber contained a carbon-monoxide - helium gas mixture. The formed metal-carbonyl complexes could be transported in a gas stream to various experimental setups. All

  5. Gclust Server: 76570 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available 76570 HSA_8923040 Cluster Sequences Related Sequences(249) 580 NP_060102.1 collabor...elated sequences Related Sequences(249) Sequence length 580 Representative annotation NP_060102.1 collabor

  6. Protein (Viridiplantae): 357439925 [

    Lifescience Database Archive (English)

    Full Text Available XP_003590240.1 33090:207 35493:345 131221:345 3193:345 58023:188 78536:6156 58024:6156 3398:6156 ... 249 3803:249 3814:249 163742:554 3877:554 3880:554 CRM ... domain-containing protein, putative Medicago trunc ...

  7. Protein (Viridiplantae): 357439975 [

    Lifescience Database Archive (English)

    Full Text Available XP_003590265.1 33090:207 35493:345 131221:345 3193:345 58023:188 78536:6156 58024:6156 3398:6156 ... 249 3803:249 3814:249 163742:554 3877:554 3880:554 CRM ... domain-containing protein, putative Medicago trunc ...

  8. Protein (Viridiplantae): 357478871 [

    Lifescience Database Archive (English)

    Full Text Available XP_003609721.1 33090:207 35493:345 131221:345 3193:345 58023:188 78536:6156 58024:6156 3398:6156 ... 249 3803:249 3814:249 163742:554 3877:554 3880:554 CRM ... domain-containing protein, putative Medicago trunc ...

  9. Protein (Viridiplantae): 357521229 [

    Lifescience Database Archive (English)

    Full Text Available XP_003630903.1 33090:207 35493:345 131221:345 3193:345 58023:188 78536:6156 58024:6156 3398:6156 ... 249 3803:249 3814:249 163742:554 3877:554 3880:554 CRM ... domain-containing protein, putative Medicago trunc ...

  10. Safety and reliability of plant technology: Application of knowledge based systems technology in analysis and management of power and process plant components and systems. Vol. 3. SPRINT/KBS dissemination workshops of MPA seminar

    International Nuclear Information System (INIS)

    The third volume of this report covers the following topics: 1) SPRINT SP249 and RA230 dissemination workshop: Implementation of power plant component life assessment technology using a knowledge-based system, 2) SPRINT RA230 and SP249 dissemination workshop: Methodologies, tools and systems, 3) SPRINT SP249 and RA230 dissemination workshop: KBS-dissemination and case studies, 4) SPRINT SP249 and RA230 dissemination workshop: KBS-dissemination and data, 5) SPRINT SP249 and RA230 dissemination workshop: KBS-dissemination and plant operating. (orig./GL)

  11. Struggling to Improve Our Understanding of Nursing Student Information Needs. A review of: Gannon‐Leary, Pat, Graham Walton, Raffik Cader, Julie Derbyshire, and Ann Smith. “Use of Evidence by Nursing Students: An Interdisciplinary Study.” Library & Information Science Research 28.2 (Mar. 2006: 249‐64.

    Directory of Open Access Journals (Sweden)

    Michael Corkett

    2007-06-01

    Full Text Available Objective – To identify the sources used by student nurses when undertaking a health needs analysis of particular client groups, and to determine students’ ease in accessing source materials.Design – Case series, incorporating citation analysis and focus groups.Setting – Honours Nursing Studies program (Adult Branch, Northumbria University, Newcastle upon Tyne, United Kingdom.Subjects – Citation analysis: 40 students undertaking health needs analysis assignment. Focus groups: 2 groups of 8 students.Methods – Subjects for the citation analysis were not randomly selected. Citation analysis was performed and references tabulated using a previously piloted proforma. Distribution of references between sources was measured using quantitative analysis. Focus groups consisted of self selecting volunteers from the student cohort undertaking the assignment. Issues of potential bias/coercion relating to research team members being group participant tutors were addressed. Results were analysed through the categorisation of key themes.Main results – The mean number of sources cited per assignment was 16. More than half( 56% of the sources were published after 1999. Twenty‐nine percent of citations were published between 1996 and 1999, and 12% between 1990 and 1995. Only small percentages were published in the 1980s (2% and 1970s (1%. Journals (37% formed the largest body of references, followed by books at 27%. UK government publications accounted for 14% of total references; Web based resources totalled 12%. Students acknowledged the importance of supporting assignments with references. Government publications were recognised as high quality pieces of evidence. Difficulty was experienced extrapolating evidence from different care settings and moving outside of usual parameters. Students indicated that statistical data was hard to find. Those without home Internet facilities had greater difficulty in accessing information than students with such facilities. Support from information professionals was received, but quality was variable.Conclusion – Doubts exist as to whether opportunities for student learning to inform educators are being fully exploited. Upon completion of assignments students are arguably in a better position to debate subjects more deeply and so advance understanding. Potential for peer group development may be lost. Collaboration between nursing academics and information professionals offers potential for nursing students and health professionals to advance their exploitation and evaluation of information resources.

  12. Dietary exposure to benzoates (E210-E213), parabens (E214-E219), nitrites (E249-E250), nitrates (E251-E252), BHA (E320), BHT (E321) and aspartame (E951) in children less than 3 years old in France.

    Science.gov (United States)

    Mancini, F R; Paul, D; Gauvreau, J; Volatier, J L; Vin, K; Hulin, M

    2015-01-01

    This study aimed to estimate the exposure to seven additives (benzoates, parabens, nitrites, nitrates, BHA, BHT and aspartame) in children aged less than 3 years old in France. A conservative approach, combining individual consumption data with maximum permitted levels, was carried out for all the additives. More refined estimates using occurrence data obtained from products' labels (collected by the French Observatory of Food Quality) were conducted for those additives that exceeded the acceptable daily intake (ADI). Information on additives' occurrence was obtained from the food labels. When the ADI was still exceeded, the exposure estimate was further refined using measured concentration data, if available. When using the maximum permitted level (MPL), the ADI was exceeded for benzoates (1.94 mg kg(-1) bw day(-1)), nitrites (0.09 mg kg(-1) bw day(-1)) and BHA (0.39 mg kg(-1) bw day(-1)) in 25%, 54% and 20% of the entire study population respectively. The main food contributors identified with this approach were current foods as these additives are not authorised in specific infant food: vegetable soups and broths for both benzoates and BHA, delicatessen and meat for nitrites. The exposure estimate was significantly reduced when using occurrence data, but in the upper-bound scenario the ADI was still exceeded significantly by the age group 13-36 months for benzoates (2%) and BHA (1%), and by the age group 7-12 months (16%) and 13-36 months (58%) for nitrites. Measured concentration data were available exclusively for nitrites and the results obtained using these data showed that the nitrites' intake was below the ADI for all the population considered in this study. These results suggest that refinement of exposure, based on the assessment of food levels, is needed to estimate the exposure of children to BHA and benzoates for which the risk of exceeding the ADI cannot be excluded when using occurrence data. PMID:25686474

  13. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFC249 (Link to dictyBase) - - - Contig-U16272-1 VFC249P (Link... to Original site) VFC249F 500 VFC249Z 585 VFC249P 1085 - - Show VFC249 Library VF (Link to library) Clone ID VFC249 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16272-1 Original site URL http://dict...te 2004.12.25 Homology vs DNA Score E Sequences producing significant alignments: (bits) Value N L08391 |L08391.1 Dict...0.00 mNt: 0.00 m3a: 0.00 m3b: 0.00 m_ : 1.00 88.0 %: cytoplasmic 8.0 %: mitochondrial 4.0 %: nuclear >> predict

  14. Oxidation of microquantities of transplutonium elements to tetravalent state in mineral acid solutions and their stability

    International Nuclear Information System (INIS)

    Kinetics of americium(3) microquantity oxidation and stability of forming americium(4), as well as possibility of curium and californium oxidation to tetravalent state in solutions of sulfuric and nitric acids depending on the concentration of mineral acid, potassium tungstophosphate and ammonium persulfate are studied by the extraction method. It is shown that curium(3) and californium(3) in solutions of 0.05-2.5 mol/l H2SO4 and HNO3 containing 10-3 mol/l potassium tungstophosphate is not practically oxidized by the mixture of silver nitrate and ammonium persulfate. Americium(3) is oxidized to the utmost to Am(4) for 2-3 min at room temperature, but stability of Am(4) depends on the concentration of sulfuric acid and potassium tungstophosphate

  15. Neutron activation determination of gold in technogenic raw materials with different mineral composition

    OpenAIRE

    Yudakov Aleksandr A.; Ivannikov Sergey I.; Zheleznov Veniamin V.; Taskin Andrei V.; Tsybulskaya Oksana N.

    2015-01-01

    The methods used to determine the gold content in the technogenic objects of gold mining were analyzed regarding their non-homogeneity and complexity of chemical and mineral compositions. A possible application of the neutron activation analysis with the use of the californium source of neutrons for determining the content of fine-grained and extra-fine-grained gold in the technogenic objects, including the bottom-ash waste of energy providers, is considere...

  16. Jak bylo objeveno spontánní štěpení

    Czech Academy of Sciences Publication Activity Database

    Vobecký, Miloslav

    Praha: Spektroskopická společnost J.M. Marci, 2010 - (Vobecký, M.), s. 5-10 ISBN 978-80-904539-0-6. [Seminář Radioanalytické metody IAA 10. Praha (CZ), 30.06.2010-01.07.2010] Institutional research plan: CEZ:AV0Z40310501 Keywords : spontaneous fission * fission -track dating method * californium 252 neutron source Subject RIV: CB - Analytical Chemistry, Separation

  17. Study of heavy particle decay from superheavy elements by SK model

    International Nuclear Information System (INIS)

    Heavy nuclei usually decay by alpha decay or spontaneous fission. These two decay modes are generally the most probable competing processes. Another less probable decay process is cluster radioactivity in which nuclei from carbon to silicon are emitted from Radium to Californium leading to the most stable daughter nucleus, lead. This work reports such a study using the cubic plus Yukawa plus exponential model of Shanmugam and Kamalaharan (SK)

  18. Measurement of the energy spectra of fission fragments using nuclear track detectors and digital image processing

    International Nuclear Information System (INIS)

    Energy spectra of fission fragments were determined using a Nuclear Track Methodology (NTM) supported by digital image analysis and numerical data processing using a standard personal computer. The analysis of a californium (252Cf) spectrum with this approach shows improvement compared with the values reported previously using the standard procedure, in terms of resolution and accuracy. This new method adds full automation to the technical advantages and cost effectiveness of an NTM.

  19. Heavy ion tests on programmable VLSI

    International Nuclear Information System (INIS)

    The radiation from space environment induces operation damages in onboard computers systems. The definition of a strategy, for the Very Large Scale Integrated Circuitry (VLSI) qualification and choice, is needed. The 'upset' phenomena is known to be the most critical integrated circuit radiation effect. The strategies for testing integrated circuits are reviewed. A method and a test device were developed and applied to space applications candidate circuits. Cyclotron, synchrotron and Californium source experiments were carried out

  20. Properties of neutron sources

    International Nuclear Information System (INIS)

    The Conference presentations were divided into sessions devoted to the following topics: white neutron sources, primarily pulsed (6 papers); fast neutron fields (5 papers); Californium-252 prompt fission neutron spectra (14 papers); monoenergetic sources and filtered beams (11 papers); 14 MeV neutron sources (10 papers); selected special application (one paper); and a general interest session (4 papers). Individual abstracts were prepared separately for the papers

  1. Neutron multiplicities for the transplutonium nuclides

    International Nuclear Information System (INIS)

    This paper continues, with respect to the transplutonium nuclides, earlier efforts to collate and evaluate data from the scientific literature on the prompt neutron multiplicity distribution from fission and its first moment = ΣnuPnu. The isotopes considered here for which P/sub nu/ and or data (or both) were found in the literature are of americium (Am), curium (Cm), berkelium (Bk), californium (Cf), einsteinium (Es), fermium (Fm), and nobelium (No)

  2. EST Table: BP120097 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available BP120097 ceN-1828 10/09/28 98 %/249 aa ref|NP_001036916.1| G protein alpha subunit Go isoform 1 ... 8 86 %/249 aa C26C6.2#CE05311#WBGene00001648#locus:goa -1#guanine nucleotide-binding protein#status:Confir ...

  3. EST Table: BP120113 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available BP120113 ceN-1846 10/09/28 98 %/249 aa ref|NP_001036916.1| G protein alpha subunit Go isoform 1 ... 8 86 %/249 aa C26C6.2#CE05311#WBGene00001648#locus:goa -1#guanine nucleotide-binding protein#status:Confir ...

  4. Strategic tariff protection, market conduct, and government commitment levels in developing economies

    Czech Academy of Sciences Publication Activity Database

    Ionascu, D.; Žigić, Krešimir

    -, č. 249 (2005), s. 1-43. ISSN 1211-3298 Institutional research plan: CEZ:AV0Z70850503 Keywords : optimal tariff protection * government non-commitment regime * symmetric versus asymmetric information Subject RIV: AH - Economics http://www.cerge-ei.cz/pdf/wp/Wp249.pdf

  5. Review of: Islam, Migration and Integration: The Age of Securitization

    DEFF Research Database (Denmark)

    Vinding, Niels Valdemar

    2010-01-01

    Islam, Migration and Integration: The Age of Securitization. By Ayhan Kaya. (Migration, Minorities and Citizenship). Houndmills, Basingstoke: Palgrave Macmillan, 2009. Pp. xiv+249. Hbk 978-0-230-51679-3. £55.......Islam, Migration and Integration: The Age of Securitization. By Ayhan Kaya. (Migration, Minorities and Citizenship). Houndmills, Basingstoke: Palgrave Macmillan, 2009. Pp. xiv+249. Hbk 978-0-230-51679-3. £55....

  6. 17 CFR 229.407 - (Item 407) Corporate governance.

    Science.gov (United States)

    2010-04-01

    ... company's annual report on Form 10-K (17 CFR 249.310) (or, for closed-end investment companies registered... CFR 270.30d-1) thereunder) for the last fiscal year for filing with the Commission. (ii) The name of... annual report pursuant to General Instruction G(3) to Form 10-K (17 CFR 249.310). 2. If a...

  7. Significance of mangrove swamps for aquaculture

    Digital Repository Service at National Institute of Oceanography (India)

    Wafar, S.; Untawale, A.G.

    stream_size 9 stream_content_type text/plain stream_name I.O_21_Century_Linkage_Networking_1998_249.pdf.txt stream_source_info I.O_21_Century_Linkage_Networking_1998_249.pdf.txt Content-Encoding ISO-8859-1 Content-Type text...

  8. Drug: D00314 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D00314 Drug Etidronate disodium (JP16/USP); Didronel (TN) C2H6O7P2. 2Na 249.9384 249.9919 D00314 ... rapeutic category: 3999 ATC code: M05BA01 map07047 Osteoporosis ... drugs Therapeutic category of drugs in Japan [BR:b ...

  9. Drug: D07119 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D07119 Drug Alendronic acid (INN) C4H13NO7P2 249.0167 249.096 D07119.gif Calcium regulating agen ... 900(2224) Terpenoid backbone biosynthesis map07047 Osteoporosis ... drugs Anatomical Therapeutic Chemical (ATC) classi ...

  10. Analysis of the complex between amyloid beta peptides and mitochondrial enzyme 17beta-HSD in cerebrospinal fluid

    Czech Academy of Sciences Publication Activity Database

    Krištofíková, Z.; Hegnerová, Kateřina; Bocková, Markéta; Vaisocherová, Hana; Bartoš, A.; Říčný, J.; Řípová, D.; Homola, J.

    2008-01-01

    Roč. 275, podzim (2008), s. 249-249. ISSN 1742-464X. [EUROPTRODE /9./. Dublin, 30.03.2008-02.04.2008] Institutional research plan: CEZ:AV0Z20670512 Keywords : surface plasmon resonance * alzheimer disease * 17beta-HSD10 Subject RIV: JB - Sensors, Measurment, Regulation Impact factor: 3.139, year: 2008

  11. Transferring of environmentally important genes for dioxygenase ISPtol into plants

    Czech Academy of Sciences Publication Activity Database

    Nováková, M.; Macková, M.; Sylvestre, M.; Prokešová, J.; Macek, Tomáš

    Chania: Technical University of Crete, 2008 - (Kalogerakis, N.; Fava, F.; Banwart, S.). s. 249-249 ISBN 978-960-8475-12-0. [European Bioremediation Conference /4./. 03.09.2008-06.09.2008, Chania] R&D Projects: GA MŠk 1M06030 Institutional research plan: CEZ:AV0Z40550506 Keywords : dioxygenase ISPtol * phytoremediation Subject RIV: EI - Biotechnology ; Bionics

  12. 75 FR 65442 - Disclosure for Asset-Backed Securities Required by Section 943 of the Dodd-Frank Wall Street...

    Science.gov (United States)

    2010-10-25

    ... Register of October 13, 2010, in FR Doc. 2010-25361, the reference ``249.1300'' is corrected to read ``249... Securities Required by Section 943 of the Dodd-Frank Wall Street Reform and Consumer Protection Act AGENCY...-Backed Securities Required by Section 943 of the Dodd-Frank Wall Street Reform and Consumer...

  13. 17 CFR 240.19b-4 - Filings with respect to proposed rule changes by self-regulatory organizations.

    Science.gov (United States)

    2010-04-01

    ... organizations. Preliminary Note: A self-regulatory organization also must refer to Form 19b-4 (17 CFR 249.819... paragraph (e), a self-regulatory organization shall submit Form 19b-4(e) (17 CFR 249.820) to the Commission... proposed rule changes by a self-regulatory organization submitted on Form 19b-4 (17 CFR...

  14. Drug: D07383 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D07383 Drug Erdosteine (INN); Mucotec (TN) C8H11NO4S2 249.0129 249.3072 D07383.gif Mucolytic ATC ... assification [BR:br08303] R RESPIRATORY SYSTEM R05 COUGH ... AND COLD PREPARATIONS R05C EXPECTORANTS, EXCL. COM ... BINATIONS WITH COUGH ... SUPPRESSANTS R05CB Mucolytics R05CB15 Erdosteine D ...

  15. Dependence of metal partition coefficients in D2EHPA capacity on extraction from acid solutions

    International Nuclear Information System (INIS)

    In devising solvent-extraction schemes for extracting the transplutonium elements (TPE), one usually employs the partition coefficients K/sub p/ for trace amounts; when the results are transferred to weighable amounts of the elements, there are difficulties because one lacks capacity characteristics for the extractants under the conditions used. They have determined the capacity of D2EHPA over a wide range in acidity (0.001-2 mole/liter) in relation to dysprosium (the analog of californium) in the system formed by D2EHPA with nitric acid by saturating a set volume of the extractant with dysprosium in nitric acid containing the necessary amount of free acid

  16. TOWARD AN IMPROVED UNDERSTANDING OF STRUCTURE AND MAGNETISM IN NEPTUNIUM AND PLUTONIUM PHOSPHONATES AND SULFONATES

    Energy Technology Data Exchange (ETDEWEB)

    Albrecht-Schmitt, Thomas

    2012-03-01

    This grant supported the exploratory synthesis of new actinide materials with all of the actinides from thorium to californium with the exceptions of protactinium and berkelium. We developed detailed structure-property relationships that allowed for the identification of novel materials with selective ion-exchange, selective oxidation, and long-range magnetic ordering. We found novel bonding motifs and identified periodic trends across the actinide series. We identified structural building units that would lead to desired structural features and novel topologies. We also characterized many different spectroscopic trends across the actinide series. The grant support the preparation of approximately 1200 new compounds all of which were structurally characterized.

  17. NONDESTRUCTIVE IDENTIFICATION OF CHEMICAL WARFARE AGENTS AND EXPLOSIVES BY NEUTRON GENERATOR-DRIVEN PGNAA

    International Nuclear Information System (INIS)

    Prompt gamma-ray neutron activation analysis (PGNAA) is now a proven method for the identification of chemical warfare agents and explosives in military projectiles and storage containers. Idaho National Laboratory is developing a next-generation PGNAA instrument based on the new Ortec Detective mechanically-cooled HPGe detector and a neutron generator. In this paper we review PGNAA analysis of suspect chemical warfare munitions, and we discuss the advantages and disadvantages of replacing the californium-252 radioisotopic neutron source with a compact accelerator neutron generator

  18. NONDESTRUCTIVE IDENTIFICATION OF CHEMICAL WARFARE AGENTS AND EXPLOSIVES BY NEUTRON GENERATOR-DRIVEN PGNAA

    Energy Technology Data Exchange (ETDEWEB)

    T. R. Twomey; A. J. Caffrey; D. L. Chichester

    2007-02-01

    Prompt gamma-ray neutron activation analysis (PGNAA) is now a proven method for the identification of chemical warfare agents and explosives in military projectiles and storage containers. Idaho National Laboratory is developing a next-generation PGNAA instrument based on the new Ortec Detective mechanically-cooled HPGe detector and a neutron generator. In this paper we review PGNAA analysis of suspect chemical warfare munitions, and we discuss the advantages and disadvantages of replacing the californium-252 radioisotopic neutron source with a compact accelerator neutron generator.

  19. Composition containing transuranic elements for use in the homeopathic treatment of aids

    International Nuclear Information System (INIS)

    A homeopathic remedy consisting of a composition containing one or more transuranic elements, particularly plutonium, for preventing and treating acquired immunodeficiency syndrome (AIDS) in humans, as well as seropositivity for human immunodeficiency virus (HIV). Said composition is characterized in that it uses any chemical or isotopic form of one or more transuranic elements (neptunium, plutonium, americium, curium, berkelium, californium or einsteinium), particularly plutonium, said form being diluted and dynamized according to conventional homeopathic methods, particularly the so-called Hahnemann and Korsakov methods, and provided preferably but not exclusively in the form of lactose and/or saccharose globules or granules impregnated with the active principle of said composition. (author)

  20. Neutron nondestructive essay of the plutonium metal parts

    International Nuclear Information System (INIS)

    Based on the principle of neutron multiplicity and data unfolding mathematics, this paper developed the software which can execute the neutron multiplicity analysis, neutron attenuation analysis, parameter calibration, Pu mass solution with the neutron pulse sequence acquisition method. The measurement system consisted of detector,nuclear electronic apparatus, pulsed sequence acquisition and analysis software was tested and calibrated by californium source. Three mental plutonium components with different mass were used for experimental assay and validation, which showed that the assay bias was within 15% against the nominal value of the samples. (authors)

  1. Physical-chemical studies of transuranium elements. Progress report, April 1, 1982-March 31, 1983

    International Nuclear Information System (INIS)

    Progress is reported on the following topics: electrochemical and spectroscopic studies of less-stable higher oxidation states of transuranium elements in complexing aqueous media; spectroscopic and electrochemical studies of selected lanthanides and actinides in molten dimethyl sulfone; spectroelectronchemical studies of the Ce(IV)/Ce(III) couple in aqueous carbonate solutions; characterization of actinide orthophosphates by Raman and absorption spectrophotometries and by x-ray diffraction; relativistic multiple scattering calculations on transuranium element compounds; Raman spectroscopic studies of natural minerals containing the uranyl ion; and solution calorimetry of californium metal

  2. Transuranium element production. II. Chemical processing of targets

    International Nuclear Information System (INIS)

    The chemical processing described concerns small experimental targets irradiated in OSIRIS or EL-III and industrial targets irradiated in the CELESTIN reactors. In view of the difficulties encountered when processing highly irradiated targets (760MWd.kg-1) by liquid-liquid extraction (interface sludges leading to stable emulsion) the new processes developed are based on inverse phase chromatography. This technique applied to targets of americium 241, plutonium 239 and a plutonium mixture rich in isotope 242 has given tens of milligrams of curium 242, grams of americium 243 and curium 244 and micrograms of californium 252

  3. Detection of rare earth elements in Powder River Basin sub-bituminous coal ash using laser-induced breakdown spectroscopy (LIBS)

    Energy Technology Data Exchange (ETDEWEB)

    Tran, Phuoc [National Energy Technology Lab. (NETL), Pittsburgh, PA, (United State; Mcintyre, Dustin [National Energy Technology Lab. (NETL), Pittsburgh, PA, (United State

    2015-10-01

    We reported our preliminary results on the use of laser-induced breakdown spectroscopy to analyze the rare earth elements contained in ash samples from Powder River Basin sub-bituminous coal (PRB-coal). We have identified many elements in the lanthanide series (cerium, europium, holmium, lanthanum, lutetium, praseodymium, promethium, samarium, terbium, ytterbium) and some elements in the actinide series (actinium, thorium, uranium, plutonium, berkelium, californium) in the ash samples. In addition, various metals were also seen to present in the ash samples

  4. Radiation protection data sheet. Radiation protection data sheets for the use of radionuclides in unsealed sources

    International Nuclear Information System (INIS)

    These radiation protection data sheet are devoted to responsible persons and employees of various laboratories or medical, pharmaceutical, university and industrial departments where radionuclides are handled as well as all the persons who attend to satisfy in this field. They contain the essential radiation protection data for the use of unsealed sources: physical characteristics, risk assessment, administrative procedures, recommendations, regulations and bibliography. This new series includes the following radionuclides: californium 252, curium 244, gallium 67, indium 113m, plutonium 238, plutonium 239, polonium 210, potassium 42, radium 226, thorium 232, uranium 238 and zinc 65. (O.M.)

  5. Study by thermochromatography of fluorides of transuranium elements

    International Nuclear Information System (INIS)

    Thermochromatography was made suitable for fluoride study. So, an investigation of actinide tetrafluorides was accomplished from uranium to californium. Pentavalent and hexavalent fluorospecies of uranium, neptunium, plutonium and ruthenium were studied. Some new compounds have been identified in gaseous phase, whose: PuF5, PuOF3 and PaOF3. Furthermore, some presomptions as for the existence in gaseous phase of EsF4 and of an heptavalent fluorospecies of plutonium have been established. An important analogy between plutonium and ruthenium behaviour with fluorine have been shown, these results could explain the difficulties encountered in the fluoride-volatility processes

  6. PROCEEDINGS OF THE SYMPOSIUM COMMEMORATING THE 25th ANNIVERSARY OF ELEMENTS 97 and 98 HELD ON JAN. 20, 1975

    Energy Technology Data Exchange (ETDEWEB)

    Seaborg, Glenn T.; Street Jr., Kenneth; Thompson, Stanley G.; Ghiorso, Albert

    1976-07-01

    This volume includes the talks given on January 20, 1975, at a symposium in Berkeley on the occasion of the celebration of the 25th anniversary of the discovery of berkelium and californium. Talks were given at this symposium by the four people involved in the discovery of these elements and by a number of people who have made significant contributions in the intervening years to the investigation of their nuclear and chemical properties. The papers are being published here, without editing, in the form in which they were submitted by the authors in the months following the anniversary symposium, and they reflect rather faithfully the remarks made on that occasion.

  7. Method for measuring multiple scattering corrections between liquid scintillators

    Science.gov (United States)

    Verbeke, J. M.; Glenn, A. M.; Keefer, G. J.; Wurtz, R. E.

    2016-07-01

    A time-of-flight method is proposed to experimentally quantify the fractions of neutrons scattering between scintillators. An array of scintillators is characterized in terms of crosstalk with this method by measuring a californium source, for different neutron energy thresholds. The spectral information recorded by the scintillators can be used to estimate the fractions of neutrons multiple scattering. With the help of a correction to Feynman's point model theory to account for multiple scattering, these fractions can in turn improve the mass reconstruction of fissile materials under investigation.

  8. Surface fission tracks in diamond

    International Nuclear Information System (INIS)

    Scanning Probe Microscope (SPM) images reveal important fingerprint features of latent tracks induced in diamond by fission fragments from a californium source. Collimated fission fragments with a binary distribution of the predominant energies of 79.4 and 103.8 MeV, are assumed. Cavities, reticular formations around these cavities, and black spots of graphite were found. A brief discussion on the possible track formation mechanism is given on the basis of the explosion spike theory; an attempt to determine latent track core and halo parameters is included

  9. Use of trioctylphosphine oxide for transplutonium element extraction and purification

    International Nuclear Information System (INIS)

    Investigated was extraction of tri-valent curium, berkelium, californium, einsteinium as well as cerium and europium with trioctylphosphin oxide from lactic acid solutions, containing DTPA and aluminium nitrate depending on the aluminium nitrate and TOPO concentrations and nitric acid solutions of variable concentration as well. Under optimum conditions of extraction chromatography of berkelium studied was the distribution of cobalt, nickel, chromium, iron, aluminium, titanium, zirconium and niobium ions, and the coefficients of berkelium purification from cations investigated were determined. The effect of weight quantities of cation impurities on extraction chromatographic yield of berkelium has been investigated. Examples of practice application of the extraction chromatography with the use of TOPO are given

  10. Monte Carlo aided enhanced design of an neutron scatterometer

    International Nuclear Information System (INIS)

    This paper will present a particular example for the use of the Monte Carlo Method to enhance the performance of a neutron scatterometer, currently employed to detect the void fraction in fast-transient high-pressure water-vapour flow in a rod-bundle channel. The scatterometer relies on measuring the slowing-down of californium-252 neutrons by the hydrogen in the water to determine the liquid, hence vapour (void) content. However, californium-252 is a relatively fast-decaying source and alternative isotopic sources are typically too energetic to provide sufficient moderation given the small amount of liquid in the channel. Monte Carlo simulation were utilized to examine various design enhancement possibilities, including: filtering out unthermalized fast neutrons, amplifying by a fissionable material the amount of detected thermal neutrons, adding a dissolvable contrast material to the liquid phase, or relying on the scattering of fast neutrons by oxygen in water. In addition, methods to determine the distribution of the pattern of liquid-vapour phase in the channel are devised

  11. The Moravian Karst: and interconnection between surface and subsurface natural sceneries

    Czech Academy of Sciences Publication Activity Database

    Kadlec, Jaroslav; Neruda, P.

    Cham: Springer, 2016 - (Pánek, T.; Hradecký, J.), s. 249-262 ISBN 978-3-319-27536-9 Institutional support: RVO:67985530 Keywords : Moravian Karst * morphology * tectonics Subject RIV: DB - Geology ; Mineralogy

  12. Ionic conductivity study of Lil-Ga2S3-GeS2 chalcogenide glasses using a random – walk approach

    Czech Academy of Sciences Publication Activity Database

    Patil, S. D.; Konale, M. S.; Kolář, J.; Shimakawa, K.; Zima, Vítězslav; Wágner, T.

    2015-01-01

    Roč. 87, č. 3 (2015), s. 249-259. ISSN 0033-4545 Institutional support: RVO:61389013 Keywords : chalcogenide glasses * impedance spectroscopy * ionic conductivity Subject RIV: CA - Inorganic Chemistry Impact factor: 2.492, year: 2014

  13. Od Pavla Eisnera k Pavlu Železnému? Pražský kulturní prostředník v období mezi světovými válkami

    Czech Academy of Sciences Publication Activity Database

    Wögerbauer, Michael

    Passau : Stutz, 2012 - (Džambo, J.), s. 99-113 ISBN 978-3-88849-249-5 Institutional support: RVO:68378068 Keywords : Czech literature * German, literature * Eisner, Paul Subject RIV: AJ - Letters, Mass-media, Audiovision

  14. Fúzní palivo a obnovitelné zdroje

    Czech Academy of Sciences Publication Activity Database

    Entler, Slavomír

    2015-01-01

    Roč. 65, č. 5 (2015), s. 249-252. ISSN 0375-8842 Keywords : nuclear fusion * fusion fuel power plant * renewable source * fusion energy Subject RIV: JF - Nuclear Energetics http://www.casopisenergetika.cz

  15. EST Table: BB985913 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available ar to putative lysosomal glucocerebrosidase [Tribolium castaneum] 10/08/28 30 %/249 aa FBpp0129766|DereGG112...EDICTED: similar to putative lysosomal glucocerebrosidase [Tribolium castaneum] BB985877 MSV3 ...

  16. 1983 walrus harvest, health, and welfare study at Gambell, Alaska: Progress report

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — The total documented harvest during the period of observation in 1983 was 642 walruses. This included 249 adult males (38.8%), 203 adult females (31.6%), and 190...

  17. Devitrification kinetics of Sb2O3-PbI2 glasses

    Czech Academy of Sciences Publication Activity Database

    Legouera, M.; Rahal, F.; Kostka, Petr; Poulain, M.

    2009-01-01

    Roč. 34, č. 4 (2009), s. 249-266. ISSN 0151-9107 Institutional research plan: CEZ:AV0Z40320502 Keywords : crystallization kinetics * nucleation Subject RIV: CA - Inorganic Chemistry Impact factor: 0.250, year: 2009

  18. Prevalence, dynamics, and biochemical predictors of optic nerve remyelination after methanol-induced acute optic neuropathy: a 2-year prospective study in 54 patients

    Czech Academy of Sciences Publication Activity Database

    Nurieva, O.; Kotíková, K.; Urban, P.; Pelclová, D.; Petřík, V.; Navrátil, Tomáš; Zakharov, S.

    2016-01-01

    Roč. 147, č. 1 (2016), s. 239-249. ISSN 0026-9247 Institutional support: RVO:61388955 Keywords : methanol optic neuropathy * visual evoked potentials * remyelination Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 1.222, year: 2014

  19. Temperature, salinity, oxygen, nutrients and productivity profile data from THOMAS G. THOMPSON Cruise 001, 19651014 to 19651207 in the Caribbean Sea and the northeastern tropical Pacific Ocean (NODC Accession 7100507)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This accession contains a copy of University of Washington Department of Oceanography Technical Report No. 249, Physical, chemical, and productivity data from a...

  20. 76 FR 1492 - Notice of Actions Taken at December 16, 2010, Meeting

    Science.gov (United States)

    2011-01-10

    ...: Hughesville-Wolf Township Joint Municipal Authority. Project Facility: Wastewater Treatment Plant, Wolf Township, Lycoming County, Pa. Withdrawal of treated wastewater effluent of up to 0.249 mgd. 6....

  1. Partial genetic characterization of Sedlec virus (Orthobunyavirus, Bunyaviridae)

    Czech Academy of Sciences Publication Activity Database

    Bakonyi, T.; Kolodziejek, J.; Rudolf, Ivo; Berčič, R.; Nowotny, N.; Hubálek, Zdeněk

    2013-01-01

    Roč. 19, October (2013), s. 244-249. ISSN 1567-1348 Institutional support: RVO:68081766 Keywords : Sedlec virus * Leanyer virus * Simbu group * Orthobunyavirus * Acrocephalus Subject RIV: EE - Microbiology, Virology Impact factor: 3.264, year: 2013

  2. Disease: H00156 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available osity. Clin Exp Nephrol 11:174-9 (2007) PMID:15630634 Smelt AH, de Beer F Apolipoprotein E and familial dysbetalipoproteinemia: clini...cal, biochemical, and genetic aspects. Semin Vasc Med 4:249-57 (2004) ...

  3. Accumulation of Ag and Cu in Amanita strobiliformis and characterization of its Cu and Ag uptake transporter genes AsCTR2 and AsCTR3

    Czech Academy of Sciences Publication Activity Database

    Beneš, V.; Hložková, K.; Matěnová, M.; Borovička, Jan; Kotrba, P.

    2016-01-01

    Roč. 29, č. 2 (2016), s. 249-264. ISSN 0966-0844 Institutional support: RVO:67985831 Keywords : heavy metals * metal uptake * metallothionein * Copper transporter protein family * ectomycorrhizal fungi Impact factor: 2.503, year: 2014

  4. Bez těla

    Czech Academy of Sciences Publication Activity Database

    Bydžovská, Lenka; Srp, K.

    Praha: Scriptorium, 2002 - (Bydžovská, L.; Prahl, R.), s. 231-249 ISBN 80-86197-35-2 Institutional research plan: CEZ:AV0Z8033913 Keywords : surrealism Subject RIV: AL - Art, Architecture, Cultural Heritage

  5. Výstava Václav Šebele (1835-1899), v Písku ztracený venkovan, Prácheňské muzeum v Písku, 1. 3. - 3. 5. 2015

    Czech Academy of Sciences Publication Activity Database

    Kafka, Luboš

    2015-01-01

    Roč. 102, č. 2 (2015), s. 249-250. ISSN 0009-0794 Institutional support: RVO:68378076 Keywords : exhibition * South Bohemia * painter * folk architecture Subject RIV: AC - Archeology, Anthropology, Ethnology

  6. Dynamic scaling and kinetic roughening of poly(ethylene) islands grown by vapor phase deposition

    Czech Academy of Sciences Publication Activity Database

    Choukourov, A.; Melnichuk, I.; Gordeev, I.; Kylián, O.; Hanuš, J.; Kousal, J.; Solař, P.; Hanyková, L.; Brus, Jiří; Slavínská, D.; Biederman, H.

    2014-01-01

    Roč. 565, 28 August (2014), s. 249-260. ISSN 0040-6090 Institutional support: RVO:61389013 Keywords : poly(ethylene) * physical vapor deposition * island growth Subject RIV: CD - Macromolecular Chemistry Impact factor: 1.759, year: 2014

  7. 17 CFR 270.23c-1 - Repurchase of securities by closed-end companies.

    Science.gov (United States)

    2010-04-01

    ... losses realized from the sale of securities or other properties, was distributed to its shareholders... Commission, as an exhibit to Form N-CSR (§ 249.331 and § 274.128), a copy of any written solicitation...

  8. A numerical study of two different specimen fixtures for the modified compact tension test – their influence on concrete fracture parameters

    Czech Academy of Sciences Publication Activity Database

    Holušová, Táňa; Seitl, Stanislav; Cifuentes, H.; Canteli, A.

    2016-01-01

    Roč. 10, č. 35 (2016), s. 242-249. ISSN 1971-8993 Institutional support: RVO:68081723 Keywords : Modified Compact Tension Test * Fracture Parameters * Cementitious Composites * FEM Subject RIV: JL - Materials Fatigue, Friction Mechanics

  9. Pediatric Palliative Care: A Personal Story

    Medline Plus

    Full Text Available ... count__/__total__ Find out why Close Pediatric Palliative Care: A Personal Story NINRnews Subscribe Subscribed Unsubscribe 249 ... and her family. The story demonstrates how palliative care can positively influence a patient's and family's experience ...

  10. 47 CFR 73.606 - Table of allotments.

    Science.gov (United States)

    2010-10-01

    .... 155) Editorial Note: For Federal Register citations affecting § 73.606, see the List of CFR Sections...+, 24, *34 Centralia *15+ East Wenatchee 249A Everett 16- Kennewick 42+ Morton 39 Olympia 67 Pasco...

  11. Gene : CBRC-MDOM-02-0481 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available his domestica protamine 1 (PRM1), mRNA /cds=p(73,249) /gb=NM_001032967 /gi=74136486 /ug=Mdm.246 /len=400 0.17 37% MERVEEREEKRREEKRRE...EKRREEKRREEKRREEKRREEKRREEKRREEKRREEKRREEKRREEKRREEKRRGREEDREEKRREEKRREEKRRE...EKREDKRRQERREEKRREEKRREEKRREEKRREEKRREEKREKKREEKRREKKKEKRREEKRREEKRREEKRREEKRREEKRREEKRREEKRRGREEDREEKRREEKRRE...EKRREKTREDKREEKRREEKRREEKRREEKRREEKRRERRKEKRREEKKRKRREEKRREEKRREEKRREEKRREEKRREEKRREEKRREKRSNAQLRVAKT ...

  12. Hydrodynamic characteristics of mechanical heart valve prostheses in steady and pulsatile flow

    Czech Academy of Sciences Publication Activity Database

    Klimeš, František; Kořenář, Josef

    2002-01-01

    Roč. 9, č. 4 (2002), s. 249-258. ISSN 1210-2717 Institutional research plan: CEZ:AV0Z2060917 Keywords : mechanical heart valve prostheses * flow visualization- steady and pulsatile flow Subject RIV: BO - Biophysics

  13. Podíl "paleolitických" versus "neolitických" haploskupin Y chromozomu u české populace

    Czech Academy of Sciences Publication Activity Database

    Kráčmarová, A.; Bruchová, H.; Černý, Viktor; Brdička, R.

    2006-01-01

    Roč. 58, č. 2 (2006), s. 237-249. ISSN 0323-1267 Institutional research plan: CEZ:AV0Z80020508 Keywords : archaeogenetics * Y chromosome * migrations Subject RIV: AC - Archeology, Anthropology, Ethnology

  14. The ecological motivation of ethics and the moral critique of the value orientations of society

    Czech Academy of Sciences Publication Activity Database

    Hála, Vlastimil

    Sofia : Commission nationale de la République de la Bulgarie pour l' UNESCO, 1998, s. 235-249. ["Philosophie et démocratie". Sofia (BG), 00.00.1996-00.00.1997] Subject RIV: AA - Philosophy ; Religion

  15. An exact exponential time algorithm for counting bipartite cliques

    DEFF Research Database (Denmark)

    Kutzkov, Konstantin

    2012-01-01

    We present a simple exact algorithm for counting bicliques of given size in a bipartite graph on n vertices. We achieve running time of O(1.249^n), improving upon known exact algorithms for finding and counting bipartite cliques.......We present a simple exact algorithm for counting bicliques of given size in a bipartite graph on n vertices. We achieve running time of O(1.249^n), improving upon known exact algorithms for finding and counting bipartite cliques....

  16. 17 CFR 240.3a55-1 - Method for determining market capitalization and dollar value of average daily trading volume...

    Science.gov (United States)

    2010-04-01

    ... market capitalization and dollar value of average daily trading volume; application of the definition of... Securities Act of 1933 (15 U.S.C. 77a et seq.) on Form F-6 (17 CFR 239.36). (d) Definitions. For purposes of... recent Form 10-K, Form 10-Q, Form 10-KSB, Form 10-QSB, or Form 20-F (17 CFR 249.310, 249.308a,...

  17. Oxygen bubble development on a platinum electrode in borosilicate glass melt by the effect of alternating current

    Czech Academy of Sciences Publication Activity Database

    Matěj, J.; Jebavá, Marcela

    2014-01-01

    Roč. 58, č. 4 (2014), s. 249-259. ISSN 0862-5468 R&D Projects: GA TA ČR TA01010844 Institutional support: RVO:67985891 Keywords : glass melt * platinum electrode * alternating current * oxygen bubble Subject RIV: JH - Ceramics, Fire-Resistant Materials and Glass Impact factor: 0.435, year: 2014 http://www.ceramics-silikaty.cz/2014/pdf/2014_04_249.pdf

  18. Recension: Efectos personales del divorcio respecto de los hijos – Review: Personal Effects of Divorce in Relation to Children

    OpenAIRE

    Teresa Dupla Marin

    2013-01-01

    Recension: Carmen López‐Rendo Rodríguez, Efectos personales del divorcio respecto de los hijos, De Roma al Codigo civil español, RIDROM (online) 9, 2012, Pág. 249–270Review: Carmen López‐Rendo Rodríguez, Personal Effects of Divorce in Relation to Children, from Classical Rome to the Spanish Civil Code, RIDROM (online) 9, 2012, pp. 249–270

  19. Recension: Efectos personales del divorcio respecto de los hijos – Review: Personal Effects of Divorce in Relation to Children

    Directory of Open Access Journals (Sweden)

    Teresa Dupla Marin

    2013-05-01

    Full Text Available Recension: Carmen López‐Rendo Rodríguez, Efectos personales del divorcio respecto de los hijos, De Roma al Codigo civil español, RIDROM (online 9, 2012, Pág. 249–270Review: Carmen López‐Rendo Rodríguez, Personal Effects of Divorce in Relation to Children, from Classical Rome to the Spanish Civil Code, RIDROM (online 9, 2012, pp. 249–270

  20. Die Wirksamkeit der stereotaktischen Radiochirurgie und der fraktionierten stereotaktischen Radiotherapie bei Vestibularisschwannomen (Akustikusneurinomen)

    OpenAIRE

    Müllner, Stefanie Barbara

    2015-01-01

    Background: Vestibular schwannoma are benigne, slow growing tumors susceptible to various treatment regimes. Methods: From 1998 to 2008 249 patients had treatment for vestibular schwannoma using a linear accelerator. We investigated change in tumor volume as well as change in tumor specific clinical symptomsfor example like facial nerve dysfunction, tinnitus, vertigo or hearing loss. Results: Of these 249 patients 190 patients (46,3% male, 53% female, median age 59y) underwent stereot...

  1. Obstetric Outcomes in Chinese Women with Endometriosis: A Retrospective Cohort Study

    OpenAIRE

    Hong Lin; Jin-Hua Leng; Jun-Tao Liu; Jing-He Lang

    2015-01-01

    Background: The effect of endometriosis on obstetric outcomes is still ambiguous. The aim of our study was to determine the association between endometriosis and adverse obstetric outcomes in a cohort of Chinese women. Methods: A retrospective cohort study was undertaken to compare obstetric outcomes between 249 women with endometriosis and 249 women without endometriosis. All women were nulliparous and achieved singleton pregnancies naturally. Women with endometriosis were diagnosed duri...

  2. 17 CFR 270.30a-3 - Controls and procedures.

    Science.gov (United States)

    2010-04-01

    ... and procedures, within the 90-day period prior to the filing date of each report on Form N-CSR (§§ 249... to be disclosed by the investment company on Form N-CSR (§§ 249.331 and 274.128 of this chapter) and... disclosed by an investment company in the reports that it files or submits on Form N-CSR and Form N-Q...

  3. 17 CFR 240.10b-18 - Purchases of certain equity securities by the issuer and others.

    Science.gov (United States)

    2010-04-01

    ... report their repurchasing activity as required by Item 8 of Form N-CSR (17 CFR 249.331; 17 CFR 274.128... report their repurchasing activity as required by Item 703 of Regulations S-K and S-B (17 CFR 229.703 and 228.703) and Item 15(e) of Form 20-F (17 CFR 249.220f) (regarding foreign private issuers), and...

  4. Factors affecting haematological indices in free-living fish populations

    Czech Academy of Sciences Publication Activity Database

    Lusková, Věra

    1998-01-01

    Roč. 67, č. 4 (1998), s. 249-255. ISSN 0001-7213. [International ichthyohaematology conference /5./. Protivín, 30.11.1998-03.12.1998] R&D Projects: GA ČR GA514/95/0203; GA AV ČR IAA6087704 Subject RIV: EH - Ecology, Behaviour Impact factor: 0.288, year: 1998 http://vfu-www.vfu.cz/acta-vet/vol67/249-98.htm

  5. Fire exposed facades: Numerical modelling of the LEPIR2 testing facility

    OpenAIRE

    Dréan Virginie; Schillinger Renaud; Auguin Gildas

    2016-01-01

    LEPIR2 testing facility is aimed to evaluate the fire behaviour of construction solutions implemented on facade according with the experimental evaluation required by the French Technical Specification 249 (IT249) of the safety regulation. It aims to limit the risks of fire spreading by facades to upper levels. This facility involves a wood crib fire in the lower compartment of a full scale two levels high structure. Flames are coming outside from the compartment through windows openings and ...

  6. Electronic Health Record in Continuous Shared Dental Care

    Czech Academy of Sciences Publication Activity Database

    Dostálová, T.; Hanzlíček, Petr; Teuberová, Z.; Zvárová, Jana; Pieš, Martin; Nagy, Miroslav; Špidlen, Josef

    Luxembourg: Luxexpo, 2006 - (Jordanova, M.; Lievens, F.). s. 249-249 [Med-e-tel 2006. International Conference for eHealth, Telemedicine and Health ICT. 05.04.2006-07.04.2006, Luxembourg] R&D Projects: GA AV ČR 1ET200300413 Institutional research plan: CEZ:AV0Z10300504 Keywords : electronic health record * dental medicine * data model * medical informatics Subject RIV: IN - Informatics, Computer Science

  7. AcEST: DK959142 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TKQVDSRRKS 97 Query: 249 AEVTSGRGSKRAINQIMR*ESHTNAEKD 332 + T +GS + + R +NAEK+ Sbjct: 98 GDATDKQGSTQTTDTPSRR...FTSSRTSYKEKAPPSEDAPENAENNDGAEGKDTTKQVDSRRKS 97 Query: 249 AEVTSGRGSKRAINQ.../57 (3%) Frame = +3 Query: 126 LRRRTSRKVSLPLTSNRRRCHKTNARENVSDEKESSSKAKTAEVTSGR--GSKRAIN 290 +RR + VS L +NR ...R + K++LP + R +C H+T++ N S SSS + Sbjct: 62 TKTRYPDIFMREEVAMKINLPESRVQVWFKNRRAKCRQQLQHQTSSNLNSSKTSSSSSSS 121 ...+ S Sbjct: 404 ETIPENAERIMDENFKEKLEKLLEENTNTLSKENSKENTKDNTKDNAKESEAVITSKQAS 463 Query: 276 KRAINQ 293 ++A ++ Sbjct: 464 EKAASE 469 ...

  8. HIV-1 Thai B strain has spread out of former plasma donors into general population through sexual contact in Henan, China.

    Science.gov (United States)

    Li, Lin; Sun, Guoqing; Zhong, Ping; Han, Jingwan; Li, Tianyi; Jia, Dijing; Liu, Yongjian; Sun, Changrong; Wang, Zhe; Li, Hanping; Wang, Xiaolin; Li, Jingyun

    2016-04-01

    Henan, China is characterized by the outbreak of HIV epidemic of Thai B strain in former plasma donors in 1990s. After the forbidden of paid blood donation, whether Thai B strain will spread out of former plasma donors into sexual transmitted population is unknown. To answer the question, phylogenetic analysis was used to explore relationships of HIV strains circulating in those two populations in the study. HIV-1 sero-positive drug-naïve patients infected through sexual contact were enrolled into the study. Full length gag and pol genes were amplified with nested RT-PCR followed by sequencing and phylogenetic analysis. The genotypes of anti-HIV drug resistance were also analyzed with available pol genes. HIV subtypes were determined in 249 individuals from 288 participants. Subtype B was dominant (202/249, 81.1%), followed by CRF01_AE (25/249, 10.0%), CRF07_BC (14/249, 5.6%), C (4/249, 1.6%), URF (3/249, 1.2%), and CRF08_BC (1/249, 0.4%). Most of subtype B strains belong to Thailand B lineage. All of Thai B strains identified in sexual transmitted population intermixed with those from former blood donors in phylogenetic tree, suggesting close phylogenetic relationship between strains epidemic in those two populations. TDR was identified in 9.9% individuals. Thai B strain has spread out of former blood donors in Henan province. The finding will contribute to understanding the distribution and evolution of HIV-1 in Henan province and also provide clue to behavior change intervention. PMID:26381060

  9. Neutron radiography for nondestructive testing

    International Nuclear Information System (INIS)

    Neutron radiography is similar to X-ray inspection in that both depend upon use of radiation that penetrates some materials and is absorbed by others to provide a contrast image of conditions not readily available for visual inspection. X-rays are absorbed by dense materials, such as metals, whereas neutrons readily penetrate metals, but are absorbed by materials containing hydrogen. The neutron radiography has been successfully applied to a number of inspection situations. These include the inspection of explosives, advanced composites, adhesively bonded structures and a number of aircraft engine components. With the availability of Californium-252, it has become feasible to construct mobile neutron radiography systems suitable for field use. Such systems have been used for in-situ inspection of flight line aircraft, particularly to locate and measure hidden corrosion

  10. Preparation of actinide targets by electrodeposition

    Science.gov (United States)

    Trautmann, N.; Folger, H.

    1989-10-01

    Actinide targets with varying thicknesses on different substrates have been prepared by electrodeposition either from aqueous solutions or from solutions of their nitrates in isopropyl alcohol. With these techniques the actinides can be deposited almost quantitatively on various backing materials within 15 to 30 min. Targets of thorium, uranium, neptunium, plutonium, americium, curium and californium with areal densities from almost carrier-free up to 1.4 mg/cm 2 on thin beryllium, carbon, titanium, tantalum and platinum foils have been prepared. In most cases, prior to the deposition, the actinides had to be purified chemically and for some of them, due to the limited amount of material available, recycling procedures were required. Applications of actinide targets in heavy-ion reactions are briefly discussed.

  11. An atomic beam source for actinide elements: concept and realization

    International Nuclear Information System (INIS)

    For ultratrace analysis of actinide elements and studies of their atomic properties with resonance ionization mass spectroscopy (RIMS), efficient and stable sources of actinide atomic beams are required. The thermodynamics and kinetics of the evaporation of actinide elements and oxides from a variety of metals were considered, including diffusion, desorption, and associative desorption. On this basis various sandwich-type filaments were studied. The most promising system was found to consist of tantalum as the backing material, an electrolytically deposited actinide hydroxide as the source of the element, and a titanium covering layer for its reduction to the metal. Such sandwich sources were experimentally proven to be well suited for the production of atomic beams of plutonium, curium, berkelium and californium at relatively low operating temperatures and with high and reproducible yields. (orig.)

  12. Environmental assessment of the thermal neutron activation explosive detection system for concourse use at US airports

    International Nuclear Information System (INIS)

    This document is an environmental assessment of a system designed to detect the presence of explosives in checked airline baggage or cargo. The system is meant to be installed at the concourse or lobby ticketing areas of US commercial airports and uses a sealed radioactive source of californium-252 to irradiate baggage items. The major impact of the use of this system arises from direct exposure of the public to scattered or leakage radiation from the source and to induced radioactivity in baggage items. Under normal operation and the most likely accident scenarios, the environmental impacts that would be created by the proposed licensing action would not be significant. 44 refs., 19 figs., 18 tabs

  13. A comparative study of bulk etch rate measurement methods in polycarbonate detectors

    International Nuclear Information System (INIS)

    The response of a plastic detector to an incoming charged particle is given by the ratio of track etch rate vt to bulk etch rate vg along its path. Although the accurate determination of vt offers no difficulty as cone length can be comfortably measured, there seems to be a certain ambiguity as how to measure vg. Several LEXAN and TUFFAK polycarbonate plates have been exposed to normally incident Californium-252 fission fragments, etched in a stirred aqueous NaOH solution saturated with etch products and with a 0.05% of Dowfax surfactant, for different etching times, concentrations and temperatures. We have used three methods to measure vg and we obtain consistent results in agreement with those published in the literature. Surface quality and, consequently, ellipses neatness, are far superior in TUFFAK than in LEXAN. (author)

  14. A Novel Approach to β-delayed Neutron Spectroscopy Using the Beta-decay Paul Trap

    International Nuclear Information System (INIS)

    A new approach to β-delayed neutron spectroscopy has been demonstrated that circumvents the many limitations associated with neutron detection by instead inferring the decay branching ratios and energy spectra of the emitted neutrons by studying the nuclear recoil. Using the Beta-decay Paul Trap, fission-product ions were trapped and confined to within a 1-mm3 volume under vacuum using only electric fields. Results from recent measurements of 137I+ and plans for development of a dedicated ion trap for future experiments using the intense fission fragment beams from the Californium Rare Isotope Breeder Upgrade (CARIBU) facility at Argonne National Laboratory are summarized. The improved nuclear data that can be collected is needed in many fields of basic and applied science such as nuclear energy, nuclear astrophysics, and stockpile stewardship

  15. Devices for rapid protein determination in grain products and mixed feeds by the neutron method

    International Nuclear Information System (INIS)

    Protein determination should be carried out using rapid techniques so that each truckful of grain can be checked for protein while mixed feeds can be checked for protein directly in the product flow lines with automatic correction of their work. The existing methods of protein determination do not meet the above requirements. In this connection, the Azot analyzer has beem developed based on the reaction of capture of thermal neutrons by the nuclei of the nitrogen present in the analyzed product and the registration of the resulting gamma-quanta emission of 10.8 Mev. Readings of the nitrogen will be converted to those of protein with the help of standard conversion coefficients. Alongside with protein content, the Azot can measure the test weight of the grain by absorbing californium 252 neutrons

  16. Probe for the exploration of deposits

    International Nuclear Information System (INIS)

    The exploration probes work by means of a prompt (n,γ) analysis, activation analysis or X-ray fluorescence analysis. The neutrons or gamma radiation are provided by a californium-252 source or a cobalt-57 source which are placed in the probe. The probe is in the form of a pipe consisting of single modules. Each module contains a part of the whole radiation producing, shielding, detector, detector cooling and detector electronic system. They can be screwed onto one another and can be exchanged for other parts. A melt cryostatat or a compressor is used as cooling device, a germanium-(Li) detector as detector, and bismuth and heavy water as shielding. All measuring process can thus be carried out in situ in a relatively short measuring time. (DG)

  17. Robotics and remote systems applications

    International Nuclear Information System (INIS)

    This article is a review of numerous remote inspection techniques in use at the Savannah River (and other) facilities. These include: (1) reactor tank inspection robot, (2) californium waste removal robot, (3) fuel rod lubrication robot, (4) cesium source manipulation robot, (5) tank 13 survey and decontamination robots, (6) hot gang valve corridor decontamination and junction box removal robots, (7) lead removal from deionizer vessels robot, (8) HB line cleanup robot, (9) remote operation of a front end loader at WIPP, (10) remote overhead video extendible robot, (11) semi-intelligent mobile observing navigator, (12) remote camera systems in the SRS canyons, (13) cameras and borescope for the DWPF, (14) Hanford waste tank camera system, (15) in-tank precipitation camera system, (16) F-area retention basin pipe crawler, (17) waste tank wall crawler and annulus camera, (18) duct inspection, and (19) deionizer resin sampling

  18. Utilization of radiation facilities at TNRC for shielding researches and related topics

    International Nuclear Information System (INIS)

    This paper presents the running shielding research activities at Tajura Nuclear research center. The main area of researches are concentrated on the investigation of different types of concrete made from local materials such as conventional concrete, Magnetite-Limonite concrete, and heat resistant concrete. The measuring techniques used were neutron-gamma spectrometry, and activation foils. The measurements were performed using collimated beam of reactor neutrons emitted from one of the horizontal channels, as well as from californium-252 neutron source. The transmitted neutron spectra through concrete barriers of different thicknesses were measured by a scintillation spectrometer with NE-213 liquid organic scintillator. A non-destructive testing of some reactor materials were also carried out using neutron and gamma ray computerized tomography technique (CT). Some experiments were also carried out related to measurements of neutron depth dose distributions inside tissue equivalent materials. 10 figs

  19. Nuclear fission and the transuranium elements

    International Nuclear Information System (INIS)

    Many of the transuranium elements are produced and isolated in large quantities through the use of neutrons furnished by nuclear fission reactions: plutonium (atomic number 94) in ton quantities; neptunium (93), americium (95), and curium (96) in kilogram quantities; berkelium (97) in 100 milligram quantities; californium (98) in gram quantities; and einsteinium (99) in milligram quantities. Transuranium isotopes have found many practical applications---as nuclear fuel for the large-scale generation of electricity, as compact, long-lived power sources for use in space exploration, as means for diagnosis and treatment in the medical area, and as tools in numerous industrial processes. Of particular interest is the unusual chemistry and impact of these heaviest elements on the periodic table. This account will feature these aspects. 9 refs., 5 figs

  20. Potential nuclear safeguards applications for neutron generators

    International Nuclear Information System (INIS)

    Many nuclear safeguards inspection instruments use neutron sources to interrogate the fissile material (commonly 235U and 239Pu) to be measured. The neutron sources currently used in these instruments are isotopics such as Californium-252, Americium-Lithium, etc. It is becoming increasingly more difficult to transport isotopic sources from one measurement location to another. This represents a significant problem for the International Atomic Energy Agency (IAEA) safeguards inspectors because they must take their safeguards instruments with them to each nuclear installation to make an independent measurement. Purpose of this paper is to review the possibility of replacing isotopic neutron sources now used in IAEA safeguards instruments with electric neutron sources such as deuterium-tritium (D-T, 14-MeV neutrons) or deuterium-deuterium (D-D, 2-MeV neutrons). The potential for neutron generators to interrogate spent-light water reactor fuel assemblies in storage pools is also reviewed

  1. Reliability of semiconductor and gas-filled diodes for over-voltage protection exposed to ionizing radiation

    Directory of Open Access Journals (Sweden)

    Stanković Koviljka

    2009-01-01

    Full Text Available The wide-spread use of semiconductor and gas-filled diodes for non-linear over-voltage protection results in a variety of possible working conditions. It is therefore essential to have a thorough insight into their reliability in exploitation environments which imply exposure to ionizing radiation. The aim of this paper is to investigate the influence of irradiation on over-voltage diode characteristics by exposing the diodes to californium-252 combined neutron/gamma radiation field. The irradiation of semiconductor over-voltage diodes causes severe degradation of their protection characteristics. On the other hand, gas-filled over-voltage diodes exhibit a temporal improvement of performance. The results are presented with the accompanying theoretical interpretations of the observed changes in over-voltage diode behaviour, based on the interaction of radiation with materials constituting the diodes.

  2. Multi-purpose neutron radiography system

    International Nuclear Information System (INIS)

    A conceptual design is given for a low cost, multipurpose radiography system suited for the needs of the Los Alamos National Laboratory (LANL). The proposed neutron source is californium-252. One purpose is to provide an in-house capability for occasional, reactor quality, neutron radiography thus replacing the recently closed Omega-West Reactor. A second purpose is to provide a highly reliable standby transportable neutron radiography system. A third purpose is to provide for transportable neutron probe gamma spectroscopy techniques. The cost is minimized by shared use of an existing x-ray facility, and by use of an existing transport cask. The achievable neutron radiography and radioscopy performance characteristics have been verified. The demonstrated image qualities range from high resolution gadolinium - SR film, with L:D = 100:1, to radioscopy using a LIXI image with L:D = 30:1 and neutron fluence 3.4 x 105 n/cm2

  3. Triton and alpha-particle contribution from LiF converter for neutron dosimeter

    CERN Document Server

    Camacho, M E; Balcazar, M

    1999-01-01

    A personnel neutron dosimeter prototype based on chemical and electrochemical etched CR-39 detector, combined with LiF converter, has been calibrated using an ICRP-like phantom, under a heavy-water moderated Californium source neutron spectra; A conversion factor of 1.052+-126 spots cm sup - sup 2 mSv sup - sup 1 was obtained. The sealing properties of the detector holder showed a ten-fold reduction in radon background when it was tested in a high radon atmosphere. A convenient mechanical shock resistance was achieved in LiF converters by sintering to 11 tons pressure LiF powder at 650 deg. C, during one hour.

  4. Nuclear fission and the transuranium elements

    Energy Technology Data Exchange (ETDEWEB)

    Seaborg, G.T.

    1989-02-01

    Many of the transuranium elements are produced and isolated in large quantities through the use of neutrons furnished by nuclear fission reactions: plutonium (atomic number 94) in ton quantities; neptunium (93), americium (95), and curium (96) in kilogram quantities; berkelium (97) in 100 milligram quantities; californium (98) in gram quantities; and einsteinium (99) in milligram quantities. Transuranium isotopes have found many practical applications---as nuclear fuel for the large-scale generation of electricity, as compact, long-lived power sources for use in space exploration, as means for diagnosis and treatment in the medical area, and as tools in numerous industrial processes. Of particular interest is the unusual chemistry and impact of these heaviest elements on the periodic table. This account will feature these aspects. 9 refs., 5 figs.

  5. General purpose nuclear irradiation chamber

    International Nuclear Information System (INIS)

    Nuclear technology has found a great need for use in medicine, industry, and research. Smoke detectors in our homes, medical treatments and new varieties of plants by irradiating its seeds are just a few examples of the benefits of nuclear technology. Portable neutron source such as Californium-252, available at Industrial Technology Division (BTI/ PAT), Malaysian Nuclear Agency, has a 2.645 year half-life. However, 252Cf is known to emit gamma radiation from the source. Thus, this chamber aims to provide a proper gamma shielding for samples to distinguish the use of mixed neutron with gamma-rays or pure neutron radiation. The chamber is compatible to be used with other portable neutron sources such as 241Am-Be as well as the reactor TRIGA PUSPATI for higher neutron dose. This chamber was designed through a collaborative effort of Kulliyyah Engineering, IIUM with the Industrial Technology Division (BTI) team, Malaysian Nuclear Agency. (Author)

  6. Experimental survey of the potential energy surfaces associated with fission

    International Nuclear Information System (INIS)

    Progress in the experimental determination of the properties of the potential energy surface associated with fission is reviewed. The importance of nuclear symmetry effects on the calculation of fission widths is demonstrated. Evidence is presented for the fragmentation of the mass-asymmetric second barrier in the thorium region and the axial asymmetric first barrier in the californium region. Detailed analyses of experimental data suggest the presence of two parallel second barriers; the normal mass-asymmetric, axial-symmetric barrier and a slightly higher mass-symmetric, axial-asymmetric barrier. Experimental barrier parameters are determined systematically and compared with calculations from various theoretical models. Techniques for expanding fission probability measurements to higher energies are discussed. (author)

  7. Effects of 252Cf neutrons, transmitted through an iron block on human lymphocyte chromosome

    International Nuclear Information System (INIS)

    Chromosome aberration of human peripheral blood lymphocytes exposed to californium-252 (252Cf) neutrons transmitted through a 15 cm thick iron block was analysed. The spectrum of the filtered neutrons ranged from 0.1 to 2MeV with a peak at 0.7 MeV, simulating the Hiroshima atomic bomb neutron spectrum as shown in the Dosimetry System 1986 (DS86). Chromosome aberration frequencies after exposure to filtered and unfiltered 252Cf radiation were compared. Acentric ring chromosomes were significantly increased (p 0.1). The relative biological effectiveness (RBE) of the neutrons with respect to the formation of dicentrics and centric rings was 10.9 and 12.3 in the filtered and unfiltered conditions respectively, but the difference was not statistically significant. These results provide useful information for the re-evaluation of the biological effect of the Hiroshima atomic bomb radiations. (Author)

  8. Test and evaluation results of the 252Cf shuffler at the Savannah River Plant

    International Nuclear Information System (INIS)

    The 252Cf Shuffler, a nondestructive assay instrument employing californium neutron source irradiation and delayed-neutron counting, was developed for measuring 235U content of scrap and waste items generated at the Savannah River Plant (SRP) reactor fuel fabrication facility. The scrap and waste items include high-purity uranium-aluminum alloy ingots as well as pieces of castings, saw and lathe chips from machining operations, low-purity items such as oxides of uranium or uranium intermixed with flux materials found in recovery operations, and materials not recoverable at SRP such as floor sweepings or residues from the uranium scrap recovery operation. The uranium contains about 60% 235U with the remaining isotopes being 236U, 238U, and 234U in descending order. The test and evaluation at SRP concluded that the accuracy, safety, reliability, and ease of use made the 252Cf Shuffler a suitable instrument for routine use in an industrial, production-oriented plant

  9. Highly charged ions for atomic clocks and search for variation of the fine structure constant

    CERN Document Server

    Dzuba, V A

    2015-01-01

    We review a number of highly charged ions which have optical transitions suitable for building extremely accurate atomic clocks. This includes ions from Hf$^{12+}$ to U$^{34+}$, which have the $4f^{12}$ configuration of valence electrons, the Ir$^{17+}$ ion, which has a hole in almost filled $4f$ subshell, the Ho$^{14+}$, Cf$^{15+}$, Es$^{17+}$ and Es$^{16+}$ ions. Clock transitions in most of these ions are sensitive to variation of the fine structure constant, $\\alpha$ ($\\alpha = e^2/\\hbar c$). E.g., californium and einsteinium ions have largest known sensitivity to $\\alpha$-variation while holmium ion looks as the most suitable ion for experimental study. We study the spectra of the ions and their features relevant to the use as frequency standards.

  10. The CARIBU EBIS control and synchronization system

    Science.gov (United States)

    Dickerson, Clayton; Peters, Christopher

    2015-01-01

    The Californium Rare Isotope Breeder Upgrade (CARIBU) Electron Beam Ion Source (EBIS) charge breeder has been built and tested. The bases of the CARIBU EBIS electrical system are four voltage platforms on which both DC and pulsed high voltage outputs are controlled. The high voltage output pulses are created with either a combination of a function generator and a high voltage amplifier, or two high voltage DC power supplies and a high voltage solid state switch. Proper synchronization of the pulsed voltages, fundamental to optimizing the charge breeding performance, is achieved with triggering from a digital delay pulse generator. The control system is based on National Instruments realtime controllers and LabVIEW software implementing Functional Global Variables (FGV) to store and access instrument parameters. Fiber optic converters enable network communication and triggering across the platforms.

  11. Neutrons in cancer therapy

    Science.gov (United States)

    Allen, Barry J.

    1995-03-01

    The role of neutrons in the management of cancer has a long history. However, it is only in recent years that neutrons are beginning to find an accepted place as an efficacious radiation modality. Fast neutron therapy is already well established for the treatment of certain cancers, and clinical trials are ongoing. Californium neutron sources are being used in brachytherapy. Boron neutron capture therapy has been well tested with thermal neutrons and epithermal neutron dose escalation studies are about to commence in the USA and Europe. Possibilities of neutron induced auger electron therapy are also discussed. With respect to chemotherapy, prompt neutron capture analysis is being used to study the dose optimization of chemotherapy in the management of breast cancer. The rationales behind these applications of neutrons in the management of cancer are examined.

  12. Study of reproducibility of measurements with the spectrometer of Bonner multispheres

    Energy Technology Data Exchange (ETDEWEB)

    Azevedo, G.A.; Pereira, W.W.; Patrao, K.C.S.; Fonseca, E.S., E-mail: geisadeazevedo@gmail.com, E-mail: walsan@ird.gov.br, E-mail: karla@ird.gov.br, E-mail: evaldo@ird.gov.br [Instituto de Radionprotecao e Dosimetria (IRD/CNEN-RJ), Rio de Janeiro, RJ (Brazil)

    2013-07-01

    This work aims to study the metrological behavior of the Bonner Multisphere Spectrometer (BMS) of the LN / LNMRI / IRD - Laboratorio Metrologia de Neutrons / Laboratorio Nacional de Metrologia e Radiacao Ionizante / Instituto de Radioprotecao e Dosimetria, for measurements in repeatability and reproducibility conditions. Initially, a simulation was done by applying the Monte Carlo method, using the MCNP code and respecting the ISO 8529-1 (2001), using the sources of Californium ({sup 252} Cf), Americium-Beryllium ({sup 241} AmBe) and californium in heavy water (Cf + D{sub 2}O), all located at a distance of 100 cm from the neutron detector ({sup 6}Li (Eu) - crystal scintillator). In this program, the counting of neutrons that are captured by the detector was made. The source is located in the center of a sphere of radius 300 cm. Analyzes the impact of these neutrons in a point of the sphere wall, which in this case acted as a neutron detector and from there, it is estimated the number of neutrons that collide in the whole sphere. The purpose is to obtain the neutron count for different energy bands in a solid field of neutrons, since they have a spectrum ranging from a low to a high energy that can also vary within a particular environment. Wishes to obtain new fields with different sources and moderators materials to be used as new reference fields. Measurements are being conducted for these fields, with the aim of analyzing the variability conditions of the measurement (repeatability and reproducibility) in LEN - Laboratorio de Espectrometria de Neutrons of the LN/LMNRI/IRD. Thus, the spectrometer will be used to improve both the knowledge of the spectrum as the standard of neutrons of the lab, proving that a spectrometry is essential for correct measurement.

  13. Pseudomonas cepacia adherence to respiratory epithelial cells is enhanced by Pseudomonas aeruginosa

    International Nuclear Information System (INIS)

    Pseudomonas aeruginosa and Pseudomonas cepacia are both opportunistic pathogens of patients with cystic fibrosis. The binding characteristics of these two species were compared to determine if they use similar mechanisms to adhere to respiratory epithelial cells. P. cepacia 249 was shown to be piliated, but there was no detectable homology between P. aeruginosa pilin gene probes and P. cepacia genomic DNA. P. cepacia and P. aeruginosa did not appear to compete for epithelial receptors. In the presence of purified P. aeruginosa pili, the adherence of 35S-labeled strain 249 to respiratory epithelial monolayers was unaffected, while that of P. aeruginosa PAO1 was decreased by 55%. The binding of P. cepacia 249 and 715j was increased by 2.4-fold and 1.5-fold, respectively, in the presence of an equal inoculum of PAO1. Interbacterial agglutination contributed to the increased adherence of P. cepacia, as the binding of 249 was increased twofold in the presence of irradiated PAO1. PAO1 exoproducts had a marked effect in enhancing the ability of the P. cepacia strains to adhere to the epithelial monolayers. A PAO1 supernatant increased the binding of 249 by eightfold and that of 715j by fourfold. Thus, there appears to be a synergistic relationship between P. aeruginosa and P. cepacia in which PAO1 exoproducts modify the epithelial cell surface, exposing receptors and facilitating increased P. cepacia attachment

  14. Dicty_cDB: Contig-U16528-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 2 DQ925126_1( DQ925126 |pid:none) Oxymonadida environmental sample c... 243 2e-62 AF157293_1( AF157293 |pid:none) Sporodiniell...ofi... 249 2e-64 U81804_1( U81804 |pid:none) Filobasidiella neoformans translation ... 249 2e-64 AY643820_1(...57273 |pid:none) Parasitella parasitica translation... 249 3e-64 U81803_1( U81803 |pid:none) Filobasidiell...AF157260_1( AF157260 |pid:none) Mortierella multidivaricata transl... 248 7e-64 AB253792_1( AB253792 |pid:no...ongation... 247 1e-63 EU016386_1( EU016386 |pid:none) Trichoplusia ni clone L608 elo

  15. Actinide targets for the synthesis of super-heavy elements

    Science.gov (United States)

    Roberto, J. B.; Alexander, C. W.; Boll, R. A.; Burns, J. D.; Ezold, J. G.; Felker, L. K.; Hogle, S. L.; Rykaczewski, K. P.

    2015-12-01

    Since 2000, six new super-heavy elements with atomic numbers 113 through 118 have been synthesized in hot fusion reactions of 48Ca beams on actinide targets. These target materials, including 242Pu, 244Pu, 243Am, 245Cm, 248Cm, 249Cf, and 249Bk, are available in very limited quantities and require specialized production and processing facilities resident in only a few research centers worldwide. This report describes the production and chemical processing of heavy actinide materials for super-heavy element research, current availabilities of these materials, and related target fabrication techniques. The impact of actinide materials in super-heavy element discovery is reviewed, and strategies for enhancing the production of rare actinides including 249Bk, 251Cf, and 254Es are described.

  16. Differential expression of carotenoid biosynthetic pathway genes in two contrasting tomato genotypes for lycopene content

    Indian Academy of Sciences (India)

    Shilpa Pandurangaiah; Kundapura V Ravishankar; Kodthalu S Shivashankar; Avverahally T Sadashiva; Kavitha Pillakenchappa; Sunil Kumar Narayanan

    2016-06-01

    Tomato (Solanum lycopersicum L.) is one of the model plants to study the carotenoid biosynthesis. In the present study, the fruit carotenoid content were quantified at different developmental stages for two contrasting genotypes viz. IIHR-249-1and IIHR-2866 by UPLC. Lycopene content was high in IIHR-249-1(19.45 mg/100g fresh weight) compared to IIHR-2866 ((1.88 mg/100g fresh weight) at the ripe stage. qPCR was performed for genes that are involved in the carotenoid biosynthetic pathway to study the difference in lycopene content in fruits of both the genotypes. The expression of Phytoene Synthase (PSY) increased by 36 fold and Phytoene desaturase (PDS) increased by 14fold from immature green stage to ripe stage in IIHR-249-1. The expression of Chloroplast lycopene β cyclase (LCY-B) and Chromoplast lycopene β cyclase (CYC-B) decreased gradually from the initial stage to the ripe stage in IIHR-249-1. IIHR 249-1 showed 3 and 1.8 fold decrease in gene expression for Chloroplast lycopene β cyclase ((LCY-B) and Chromoplast lycopene β cyclase (CYC-B) .The F2 hybrids derived from IIHR-249-1 and IIHR-2866 were analyzed at the ripe stage for lycopene content. The gene expression of Chloroplast lycopene β cyclase (LCY-B) and Chromoplast lycopene β cyclase (CYC-B) in high and low lycopene lines from F2 progenies also showed the decrease in transcript levels of both the genes in high lycopene F2 lines. We wish to suggest that the differential expression of Lycopene β -cyclases can be used in marker assisted breeding.

  17. 轻机枪为士兵减负

    Institute of Scientific and Technical Information of China (English)

    2013-01-01

    战士打仗想得胜,除了勇敢和坚强外,武器还要轻巧好用。这不,一款新型轻机枪在美国诞生,它名叫“LSAT”轻机枪。它可真是轻啊,自重仅为4.27千克(相当于1桶食用油的重量),比有名的轻机枪M249还轻。M249重8千克。

  18. Secular evolution of exoplanetary systems and close encounters

    Czech Academy of Sciences Publication Activity Database

    Šidlichovský, Miloš; Gerlach, E.

    Cambridge: Cambridge University Press, 2008 - (Sun, Y.; Ferraz-Mello, S.; Zhou, J.), s. 479-484. (Proceedings of the International Astronomical Union. IAU S249). ISBN 978-0-521-87471-7. ISSN 1743-9213. [Symposium of the International Astronomical Union /249./. Suzhou (CN), 21.10.2007-27.10.2007] R&D Projects: GA MŠk(CZ) LC06014 Institutional research plan: CEZ:AV0Z10030501 Keywords : celestial mechanics * exoplanets * stability Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics

  19. Communication of nuclear data progress: No.6 Supplement (1992)

    International Nuclear Information System (INIS)

    This is a supplement to No.6 of Communication of Nuclear Data Progress (CNDP), in which the second and final part of the papers of CENDL-2 (Chinese Evaluated Nuclear Data Library, Version 2.0) is published. It includes the evaluation reports of 17 elements and isotopes with incident neutron energy from 10-5 eV to 20 MeV, they are 16O, 23Na, 31P, Ca, Zn, Mn, 59Co, Cd, In, Hf, 232Th, 235U, 239Pu, 240Pu, 241Am, 249Bk, 249Cf

  20. 新款PSP GO PSP-N1000正式发布

    Institute of Scientific and Technical Information of China (English)

    魏晓燕

    2009-01-01

    如图1所示,索尼终于在E3前发布了最新款的PSP掌上游戏机-全新的PSP GO掌上游戏机,型号为PSP—N1000。全新的PSP GO掌上游戏机在北美售价249.99美元,在欧洲售价249.99欧元,日本售价26800日元。如图2所示。

  1. PSP Go

    Institute of Scientific and Technical Information of China (English)

    2009-01-01

    索尼官方正式公布的消息,PSP新机型“PSP GO”(PSP-N1000),将于2009年10月1日在欧美和亚洲部分地区发售预定价格为249美元、249欧元,至于日版则将会延后一个月在日本发售也就是2009年的11月1日,预定发售价格为26800日元。

  2. First dedicated observations of runaway electrons in the COMPASS tokamak

    Czech Academy of Sciences Publication Activity Database

    Vlainić, M.; Mlynář, Jan; Weinzettl, Vladimír; Papřok, Richard; Imríšek, Martin; Ficker, Ondřej; Vondráček, Petr; Havlíček, Josef

    2015-01-01

    Roč. 60, č. 2 (2015), s. 249-255. ISSN 0029-5922. [Kudowa Summer School 2014 "Towards Fusion Energy"/12./. Kudowa Zdrój, 09.06.2014-13.06.2014] R&D Projects: GA MŠk(CZ) LM2011021 Institutional support: RVO:61389021 Keywords : plasma diagnostics * runaway electrons * tokamak Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 0.477, year: 2014 http://www.nukleonika.pl/www/back/full/vol60_2015/v60n2p249f.pdf

  3. Prompt neutron multiplicities for the transplutonium nuclides

    International Nuclear Information System (INIS)

    The direct determination of the average prompt neutron emission values is reviewed, and a method of comparing different sites of neutron emission multiplicity distribution values is described. Measured and recommended values are tabulated for these nuclides: 241Am, 242Am, 242Cm, 243Cm, 244Cm, 246Cm, 247Cm, 248Cm, 250Cm, 245Cm, 249Bk, 246Cf, 249Cf, 250Cf, 252Cf, 254Cf, 251Cf, 253Es, 254Es, 244Fm, 246Fm, 255Fm, 252No, 254Fm, 256Fm, 257Fm. 59 refs., 24 tabs

  4. Dicty_cDB: SFB134 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 1( BT075193 |pid:none) Osmerus mordax clone omor-eva-507-... 43 0.011 protein update 2009. 5.22 PSORT psg: 0.83 gvh: 0.33 alm....1 Dictyostelium discoideum chromosome 2 map 2779865-2840915 strain AX4, *** SEQUENCING IN PROGRESS ***, in ordere...t*iifiylsthpkysy*wqk*qyqlkmkisfk*iynqikqlki*nve*nlkpqf** tikf*hlmeky*imkrnyqtiqlkvvisy**qkmf*ehhnkdhnnpnnhnn...s*rqc Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value VFE249 (VFE249Q)...cus clone CH230-414I23, *** SEQUENCING IN PROGRESS ***, 20 unordered pieces. 52 2

  5. 17 CFR 232.104 - Unofficial PDF copies included in an electronic submission.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Unofficial PDF copies included... Filing Requirements § 232.104 Unofficial PDF copies included in an electronic submission. (a) An... (§ 249.101 of this chapter) or a Form D (§ 239.500 of this chapter), may include one unofficial PDF...

  6. An Improved Consensus Linkage Map of Barley Based on Flow-Sorted Chromosomes and Single Nucleotide Polymorphism Markers

    Czech Academy of Sciences Publication Activity Database

    Munoz-Amatriain, M.; Moscou, M. J.; Bhat, P. R.; Bartoš, Jan; Suchánková, Pavla; Šimková, Hana; Endo, T. R.; Fenton, R. D.; Lonardi, S.; Castillo, A. M.; Doležel, Jaroslav; Close, T. J.

    2011-01-01

    Roč. 4, č. 3 (2011), s. 238-249. ISSN 1940-3372 R&D Projects: GA MŠk(CZ) LC06004; GA MŠk ED0007/01/01 Institutional research plan: CEZ:AV0Z50380511 Keywords : Chromosomes sorting * Barley * Nucleotide polymorphism Subject RIV: EB - Genetics ; Molecular Biology

  7. 78 FR 4766 - Adoption of Updated EDGAR Filer Manual

    Science.gov (United States)

    2013-01-23

    ... From the Federal Register Online via the Government Publishing Office SECURITIES AND EXCHANGE COMMISSION 17 CFR Parts 232, 239, 249, 269, 274 Adoption of Updated EDGAR Filer Manual AGENCY: Securities and.... Along with the adoption of the Filer Manual, we are amending Rule 301 of Regulation S-T to provide...

  8. Liposomal formulation of alpha-tocopheryl maleamide: In vitro and in vivo toxicological profile and anticancer effect against spontaneous breast carcinomas in mice

    Czech Academy of Sciences Publication Activity Database

    Turánek, J.; Wang, X. F.; Knötigová, P.; Koudelka, Š.; Dong, L. F.; Vrublová, E.; Mahdavian, E.; Procházka, L.; Sangsura, S.; Vacek, A.; Salvatore, B. A.; Neužil, Jiří

    2009-01-01

    Roč. 237, č. 3 (2009), s. 249-257. ISSN 0041-008X R&D Projects: GA AV ČR KAN200520703; GA AV ČR(CZ) IAA500520602 Institutional research plan: CEZ:AV0Z50520701 Keywords : Liposome * apoptosis * vitamin E analogues Subject RIV: FR - Pharmacology ; Medidal Chemistry Impact factor: 3.359, year: 2009

  9. Self-Efficacy, Gender and Trait Anxiety as Moderators of Test Anxiety

    Science.gov (United States)

    Onyeizugbo, Euckay U.

    2010-01-01

    Introduction: Test anxiety inhibits students from performing according to their full potential in academic setting. Objectives: This study investigated self-efficacy, gender and trait anxiety as moderators of test anxiety. Method: Two hundred and forty nine (249) psychology majors drawn from a university in Eastern Nigeria participated in the…

  10. Locomotor diseases among male long-haul truck drivers and other professional drivers

    DEFF Research Database (Denmark)

    Jensen, Anker; Kaerlev, Linda; Tüchsen, Finn;

    2007-01-01

    -haul truck drivers and bus drivers had higher SHR for intervertebral disc disorders (SHR: 133, 95% CI: 114-155/SHR: 141, 95% CI: 129-154, respectively) than other truck drivers (SHR: 109, 95% CI: 102-116). The SHR for carpal tunnel syndrome was high among long-haul drivers (SHR: 163, 95% CI: 101-249) and for...

  11. Literatura jako výzva k obraně subjektu

    Czech Academy of Sciences Publication Activity Database

    Kanda, Roman

    Opava: Slezská univerzita v Opavě, 2014 - (Mainx, O.), s. 242-249 ISBN 978-80-7510-131-0 Institutional support: RVO:68378068 Keywords : Kundera, Milan * Gombrowicz, Witold * modernism * post- modernism * Central European novel * Czech and Polish prose Subject RIV: AJ - Letters, Mass-media, Audiovision

  12. Andromeda's Liberation in Monastery. Kosmas Damian Asam’s Fresco Painting at Břevnov (1726) Revisited

    Czech Academy of Sciences Publication Activity Database

    Bažant, Jan

    2010-01-01

    Roč. 46, č. 46 (2010), s. 234-249. ISSN 0046-1628 R&D Projects: GA AV ČR(CZ) IAA800090902 Institutional research plan: CEZ:AV0Z90090514 Keywords : frescoes * ancient mythology * monastery * Baroque Subject RIV: AA - Philosophy ; Religion

  13. Production and investigation of thin films of metal actinides (Pu, Am, Cm, Bk, Cf)

    Science.gov (United States)

    Radchenko, V. M.; Ryabinin, M. A.; Stupin, V. A.

    2010-03-01

    Under limited availability of transplutonium metals some special techniques and methods of their production have been developed that combine the process of metal reduction from a chemical compound and preparation of a sample for examination. In this situation the evaporation and condensation of metal onto a substrate becomes the only possible technology. Thin film samples of metallic 244Cm, 248Cm and 249Bk were produced by thermal reduction of oxides with thorium followed by deposition of the metals in the form of thin layers on tantalum substrates. For the production of 249Cf metal in the form of a thin layer the method of thermal reduction of oxide with lanthanum was used. 238Pu and 239Pu samples in the form of films were prepared by direct high temperature evaporation and condensation of the metal onto a substrate. For the production of 241Am films a gram sample of plutonium-241 metal was used containing about 18 % of americium at the time of production. Thermal decomposition of Pt5Am intermetallics in vacuum was used to produce americium metal with about 80% yield. Resistivity of the metallic 249Cf film samples was found to decrease exponentially with increasing temperature. The 249Cf metal demonstrated a tendency to form preferably a DHCP structure with the sample mass increasing. An effect of high specific activity on the crystal structure of 238Pu nuclide thin layers was studied either.

  14. Production and investigation of thin films of metal actinides (Pu, Am, Cm, Bk, Cf)

    International Nuclear Information System (INIS)

    Under limited availability of transplutonium metals some special techniques and methods of their production have been developed that combine the process of metal reduction from a chemical compound and preparation of a sample for examination. In this situation the evaporation and condensation of metal onto a substrate becomes the only possible technology. Thin film samples of metallic 244Cm, 248Cm and 249Bk were produced by thermal reduction of oxides with thorium followed by deposition of the metals in the form of thin layers on tantalum substrates. For the production of 249Cf metal in the form of a thin layer the method of thermal reduction of oxide with lanthanum was used. 238Pu and 239Pu samples in the form of films were prepared by direct high temperature evaporation and condensation of the metal onto a substrate. For the production of 241Am films a gram sample of plutonium-241 metal was used containing about 18 % of americium at the time of production. Thermal decomposition of Pt5Am intermetallics in vacuum was used to produce americium metal with about 80% yield. Resistivity of the metallic 249Cf film samples was found to decrease exponentially with increasing temperature. The 249Cf metal demonstrated a tendency to form preferably a DHCP structure with the sample mass increasing. An effect of high specific activity on the crystal structure of 238Pu nuclide thin layers was studied either.

  15. Copper(I) Chelation by Tetradentate NSSN Donor Ligands: Reversible Oxidation but no Oxygenation

    Czech Academy of Sciences Publication Activity Database

    Schnödt, J.; Sieger, M.; Sarkar, B.; Fiedler, Jan; Manzur, J.; Su, Ch. Y.; Kaim, W.

    2011-01-01

    Roč. 637, 7-8 (2011), s. 930-934. ISSN 0044-2313 R&D Projects: GA ČR GA203/09/0705 Institutional research plan: CEZ:AV0Z40400503 Keywords : benzimidazole ligands * coordination geometry * copper Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 1.249, year: 2011

  16. Lead-vacancy-related hole centers in lead tungstate crystals

    Czech Academy of Sciences Publication Activity Database

    Laguta, Valentyn; Nikl, Martin; Zazubovich, S.

    2012-01-01

    Roč. 249, č. 11 (2012), s. 2161-2166. ISSN 0370-1972 R&D Projects: GA AV ČR IAA100100810 Institutional research plan: CEZ:AV0Z10100521 Keywords : hole centers * lead tungstate * thermally stimulated luminescence Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.489, year: 2012

  17. Distribution analysis of ultra-high molecular mass poly(ethylene oxide) containing silica particles by size-exclusion chromatography with dual light scattering and refractometric detection

    Czech Academy of Sciences Publication Activity Database

    Porsch, Bedřich; Welinder, A.; Körner, A.; Wittgren, B.

    2005-01-01

    Roč. 1068, č. 2 (2005), s. 249-260. ISSN 0021-9673 R&D Projects: GA AV ČR(CZ) KSK4050111 Keywords : size-exclusion chromatography * poly(ethylene oxide) * molecular mass distribution Subject RIV: CD - Macromolecular Chemistry Impact factor: 3.096, year: 2005

  18. Attitudes toward Physical Education and Class Preferences of Turkish Adolescents in Terms of School Gender Composition

    Science.gov (United States)

    Koca, Canan; Asci, F. Hulya; Demirhan, Giyasettin

    2005-01-01

    The purpose of this study was to examine attitudes toward physical education (PE and PE class preferences of high school Turkish students in terms of school gender composition; 213 girls and 249 boys from coeducational public schools, and 196 girls and 210 boys from single-sex vocational schools participated in the study. The Attitudes Toward…

  19. Relative Calibration of Galileo receivers within the Time Validation Facility (TVF)

    Czech Academy of Sciences Publication Activity Database

    Piriz, A.; Rodriguez, D.; Roldan, P.; Mudrak, A.; Bauch, A.; Leute, J.; Pánek, Petr; Kuna, Alexander

    Piscataway: IEEE, 2015, s. 245-249. ISBN 978-1-4799-8865-5. [Frequency Control Symposium & the European Frequency and Time Forum (FCS), 2015 Joint Conference of the IEEE International. Denver (US), 12.04.2015-16.04.2015] Institutional support: RVO:67985882 Keywords : receiver calibration * Galileo * ground infrastructure Subject RIV: JB - Sensors, Measurment, Regulation

  20. "Euroopa viimased metslased" : eestlased saksa koloniaaldiskursis 1770-1870 / Ulrike Plath

    Index Scriptorium Estoniae

    Plath, Ulrike

    2008-01-01

    Eesti ja läti pärisorjade võrdlemisest metslastega, eestlaste "eksoteerimisest", põhjuseks keelesugulus saamide ja samojeedidega. Pikemalt Johann Georg Kohli teosest "Die Völker Europas" (1868). Baltisaksa koloniaaldiskursi kujunemisest 19. sajandil. Sisaldab bibliograafiat. Autorist lk. 249

  1. 17 CFR 243.100 - General rule regarding selective disclosure.

    Science.gov (United States)

    2010-04-01

    ... a disclosure made: (i) To a person who owes a duty of trust or confidence to the issuer (such as an...(f)(5)), that filed a report on Form 13F (17 CFR 249.325) with the Commission for the most recent... disclosed information in confidence; (iii) To the following entities solely for the purpose of...

  2. 17 CFR 243.101 - Definitions.

    Science.gov (United States)

    2010-04-01

    ..., or agent of an issuer who discloses material nonpublic information in breach of a duty of trust or confidence to the issuer shall not be considered to be acting on behalf of the issuer. (d) Promptly... or filing with the Commission a Form 8-K (17 CFR 249.308) disclosing that information. (2) An...

  3. Archeologie a hračky

    Czech Academy of Sciences Publication Activity Database

    Mašková, Pavlína

    Praha: Lidové noviny, 2014 - (Dvořáčková-Malá, D.; Zelenka, J.), s. 249-252 ISBN 978-80-7422-276-4 Institutional support: RVO:67985955 Keywords : archaeology * medieval toys * childhood Subject RIV: AB - History

  4. 76 FR 63573 - Roundtable on Issues Relating to Conflict Minerals

    Science.gov (United States)

    2011-10-13

    ... COMMISSION 17 CFR Parts 229 and 249 Roundtable on Issues Relating to Conflict Minerals AGENCY: Securities and... conflict minerals originating in the Democratic Republic of the Congo and adjoining countries. Roundtable... reporting regulations regarding the use of conflict minerals from the Democratic Republic of the Congo...

  5. 76 FR 6110 - Conflict Minerals

    Science.gov (United States)

    2011-02-03

    ... FR 80948 (December 23, 2010)]. The original comment period for Release No. 34-63547 is scheduled to... COMMISSION 17 CFR Parts 229 and 249 RIN 3235-AK84 Conflict Minerals AGENCY: Securities and Exchange... 1934 (the ``Exchange Act'') and would require any such issuer for which conflict minerals are...

  6. 25 CFR 170.471 - How are projects administered?

    Science.gov (United States)

    2010-04-01

    ... under ISDEAA, BIA will monitor performance under the requirements of 25 CFR 900.130 and 900.131(b)(9) or 25 CFR 1000.243 and 1000.249(c) and (e), as appropriate. If BIA discovers a problem during an on-site... PROGRAM Planning, Design, and Construction of Indian Reservation Roads Program Facilities Construction...

  7. 25 CFR 170.474 - Who conducts the project closeout?

    Science.gov (United States)

    2010-04-01

    ... responsible for closeout and preparing the report (1) Meet the requirements of ISDEAA;(2) Comply with 25 CFR 900.130(d) and 131(b) (10) and 25 CFR 1000.249, as applicable; (3) Be completed within 120 calendar... ROADS PROGRAM Planning, Design, and Construction of Indian Reservation Roads Program...

  8. A comparison of three activation analysis methods for iodine determination in foodstuffs

    Czech Academy of Sciences Publication Activity Database

    Kučera, Jan; Řanda, Zdeněk; Soukal, Ladislav

    2001-01-01

    Roč. 249, č. 1 (2001), s. 61-65. ISSN 0236-5731 R&D Projects: GA ČR GV202/97/K038; GA AV ČR KSK4055109 Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 0.398, year: 2001

  9. The Relations between Student Motivational Beliefs and Cognitive Engagement in High School

    Science.gov (United States)

    Walker, Christopher O.; Greene, Barbara A.

    2009-01-01

    The authors examined relations among student perceptions of classroom achievement goals, self-efficacy, perceived instrumentality of classroom work, and sense of belonging within a classroom. Participants were 249 high school students. The authors also examined how cognitive engagement was predicted by those variables along with personal…

  10. Gas scrubbers used in pollution control. 1976-February, 1980 (citations from the American Petroleum Institute). Report for 1976-February 1980

    Energy Technology Data Exchange (ETDEWEB)

    Cavagnaro, D.M.

    1980-05-01

    The citations from a worldwide literature survey relate to particle and gas scrubbers. The reports discuss design, performance, gas flow characteristics, and chemistry of the pollutants. Pollution control of SO/sub 2/, NOx, CO, Co/sub 2/, hydrocarbons, and particles is considered. (This updated bibliography contains 249 abstracts, 47 of which are new entries to the previous edition.)

  11. 17 CFR 240.14a-101 - Schedule 14A. Information required in proxy statement.

    Science.gov (United States)

    2010-04-01

    ... attorneys, accountants, public relations or financial advisers, solicitors, advertising, printing..., accountant, or advertising, public relations or financial adviser, and whose activities are limited to the... in the registrant's Form 10-Q (17 CFR 249.308a) or services that are normally provided by...

  12. MOOC & B-Learning: Students' Barriers and Satisfaction in Formal and Non-Formal Learning Environments

    Science.gov (United States)

    Gutiérrez-Santiuste, Elba; Gámiz-Sánchez, Vanesa-M.; Gutiérrez-Pérez, Jose

    2015-01-01

    The study presents a comparative analysis of two virtual learning formats: one non-formal through a Massive Open Online Course (MOOC) and the other formal through b-learning. We compare the communication barriers and the satisfaction perceived by the students (N = 249) by developing a qualitative analysis using semi-structured questionnaires and…

  13. Multiple product channels in the collision-free UV photodissociation of 2-nitropropane

    Science.gov (United States)

    Radhakrishnan, G.; Parr, T.; Wittig, C.

    1984-10-01

    The one-photon, collision-free, UV (222, 249, and 308 nm) photodissociation of 2-nitropropane leads to several chemically distinct sets of products. We report the detection of OH, HONO and NO 2 and discuss mechanisms as well as implications concerning condensed phase reactions.

  14. Etude comparative d'extraction de l'huile essentielle d'Ylang-Ylang

    Czech Academy of Sciences Publication Activity Database

    Kristiawan, K.; Sobolík, Václav; Allaf, K.

    Nantes: TEC@DOC, 2004, s. 241-249. ISBN 2-7430-0754-0. [rencontres Agoral Nantes 2004 /16./. Nantes (FR), 30.11.2004-01.12.2004] Grant ostatní: DIC SME(XE) IPS/2000/00087 Institutional research plan: CEZ:AV0Z4072921 Keywords : ylang-ylang * essential oil * extraction Subject RIV: CI - Industrial Chemistry, Chemical Engineering

  15. EST Table: FY020340 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available 7 11/11/04 79 %/249 aa gnl|Amel|GB19218-PA 11/11/04 75 %/246 aa gi|189241909|ref|XP_970822.2| PREDICTED: similar to Darkener of apricot CG33553-PG [Tribolium castaneum] FS779323 bmov ...

  16. Using Fun in the Statistics Classroom: An Exploratory Study of College Instructors' Hesitations and Motivations

    Science.gov (United States)

    Lesser, Lawrence M.; Wall, Amitra A.; Carver, Robert H.; Pearl, Dennis K.; Martin, Nadia; Kuiper, Shonda; Posner, Michael A.; Erickson, Patricia; Liao, Shu-Min; Albert, Jim; Weber, John J., III

    2013-01-01

    This study examines statistics instructors' use of fun as well as their motivations, hesitations, and awareness of resources. In 2011, a survey was administered to attendees at a national statistics education conference, and follow-up qualitative interviews were conducted with 16 of those ("N" = 249) surveyed to provide further…

  17. ABA and Diverse Cultural and Linguistic Environments: A Welsh Perspective

    Science.gov (United States)

    Jones, E. W.; Hoerger, M.; Hughes, J. C.; Williams, B. M.; Jones, B.; Moseley, Y.; Hughes, D. R.; Prys, D.

    2011-01-01

    Gwynedd Local Education Authority (LEA) in North West Wales, UK, is funding a small-scale autism-specific specialist education service using ABA methodology. The program is available through the medium of Welsh, English or bilingually, depending on the individual needs of the child (Jones and Hoerger in Eur J Behav Anal 10:249-253, "2009").…

  18. Bk and Cf chromatographic separation and ²⁴⁹Bk/²⁴⁸Cm and ²⁴⁹Cf/²⁴⁸Cm elemental ratios determination by inductively coupled plasma quadrupole mass spectrometry.

    Science.gov (United States)

    Gourgiotis, A; Isnard, H; Nonell, A; Aubert, M; Stadelmann, G; Dupont, E; AlMahamid, I; Tiang, G; Rao, L; Lukens, W; Cassette, P; Panebianco, S; Letourneau, A; Chartier, F

    2013-03-15

    The French Atomic Energy Commission has carried out several experiments for the study of minor-actinide transmutation processes in high intensity thermal neutron flux. In this context a Cm sample enriched in (248)Cm (∼97%) was irradiated in a thermal neutron flux at the High Flux Reactor (HFR) of the Laue-Langevin Institute (ILL). The precise and accurate determination of Cf isotope ratios and of (249)Bk/(248)Cm and (249)Cf/(248)Cm elemental ratios in the (248)Cm irradiated sample is crucial for the calculation of actinide neutron capture cross-sections. This work describes an analytical procedure for the separation and the isotope ratio measurement of Bk and Cf in the irradiated sample. The Bk and Cf separation is based on a lanthanides separation protocol previously developed by the laboratory. Well-defined retention times for Bk and Cf were obtained by coupling the Ionic Chromatography (IC) with an ICP-QMS. All conditions of element separation by IC and the different steps of the analytical protocol in order to obtain the isotopic and elemental ratios are presented. Relative uncertainties of Cf isotopic ratios range from 0.3% to 0.5% and the uncertainty of the (249)Bk/(248)Cm and (249)Cf/(248)Cm elemental ratios are respectively 6.1% and 3.2%. This level of uncertainty for both isotopic and elemental ratios is in perfect agreement with the requirement for transmutation studies. PMID:23598093

  19. Degradation of PET, PEEK and PI induced by irradiation with 150 keV Ar+ and 1.76 MeV He+ ions

    Czech Academy of Sciences Publication Activity Database

    Macková, Anna; Havránek, Vladimír; Švorčík, V.; Suzuki, T.; Djourelov, N.

    2005-01-01

    Roč. 240, 1/2 (2005), s. 245-249. ISSN 0168-583X R&D Projects: GA MŠk(CZ) OC 527.100 Institutional research plan: CEZ:AV0Z10480505 Keywords : irradiated polymers * ion beam modification * ERDA Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.181, year: 2005

  20. AcEST: DK951813 [AcEST

    Lifescience Database Archive (English)

    Full Text Available dase OS=Pinus pinaster GN... 332 7e-90 tr|B8XF08|B8XF08_ONCHC Ascorbate peroxidase OS=Oncidium Gower Ra... 3...CHC Ascorbate peroxidase OS=Oncidium Gower Ramsey PE=2 SV=1 Length = 249 Score = 332 bits (850), Expect = 1e

  1. 75 FR 64752 - Submission for OMB Review; Comment Request

    Science.gov (United States)

    2010-10-20

    .... Extension: Form N-CSR, SEC File No. 270-512, OMB Control No. 3235-0570. Notice is hereby given that... extension of the previously approved collection of information discussed below. Form N-CSR (17 CFR 249.331... N-CSR is to be used for reports under Section 30(b)(2) of the Investment Company Act and Section...

  2. Measurements of phytoplankton of sub-nanomolar chlorophyll concentrations by a modified double-modulation fluorometer

    Czech Academy of Sciences Publication Activity Database

    Dijkman, N.; Kaftan, David; Trtílek, M.; Nedbal, Ladislav

    1999-01-01

    Roč. 37, č. 2 (1999), s. 249-254. ISSN 0300-3604. [Regional Photosynthesis Workshop /2./. Lipno, 31.01.1999-03.02.1999] R&D Projects: GA MŠk OK 271 Grant ostatní: INCO-COPERNICUS(EC) IC15CT95-0105 Subject RIV: BO - Biophysics Impact factor: 0.734, year: 1999

  3. Domain Modeling: NP_001020371.3 [SAHG[Archive

    Lifescience Database Archive (English)

    Full Text Available NP_001020371.3 chr16 Eukaryotic proteases d1bmla_ chr16/NP_001020371.3/NP_001020371.3..._apo_16-263.pdb d1buib_ chr16/NP_001020371.3/NP_001020371.3_holo_16-263.pdb blast 28L,29S,249V,250A 34I,35

  4. Species and hybrid richness in spined loaches of the genus Cobitis (Teleostei:Cobitidae), with a checklist of European forms and suggestions for conservation

    Czech Academy of Sciences Publication Activity Database

    Bohlen, Jörg; Ráb, Petr

    2001-01-01

    Roč. 59, - (2001), s. 75-89. ISSN 0022-1112 R&D Projects: GA ČR GA206/00/0668; GA AV ČR KSK6005114 Keywords : biodiversity * unisexual fish * conservation Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 1.249, year: 2001

  5. Complete Genome Sequence of Corynebacterium camporealensis DSM 44610, Isolated from the Milk of a Manchega Sheep with Subclinical Mastitis.

    Science.gov (United States)

    Rückert, Christian; Albersmeier, Andreas; Winkler, Anika; Tauch, Andreas

    2015-01-01

    Corynebacterium camporealensis has been isolated in pure culture from milk samples of dairy sheep affected by subclinical mastitis. The complete genome sequence of the type strain DSM 44610, recovered from milk of a Manchega sheep, comprises 2,451,810 bp with a mean G+C content of 59.41% and 2,249 protein-coding genes. PMID:26021938

  6. Comparison of Inhibitory Mold Agar to Sabouraud Dextrose Agar as a Primary Medium for Isolation of Fungi▿

    OpenAIRE

    Scognamiglio, Theresa; Zinchuk, Riva; Gumpeni, Pramod; Larone, Davise H.

    2010-01-01

    Clinical specimens cultured on two selective fungal media, inhibitory mold agar (IMA) and Sabouraud dextrose agar (SDA), were compared with respect to recovery of fungi. Of the 840 fungal isolates recovered, 69.3% grew on both IMA and SDA; 24.9% grew only on IMA; and 5.8% grew only on SDA, showing that IMA is superior (P = 0.003).

  7. The effectiveness of selected housing subsidies in the Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Lux, Martin; Sunega, Petr; Boelhouwer, P.

    2009-01-01

    Roč. 24, č. 3 (2009), s. 249-269. ISSN 1566-4910 R&D Projects: GA ČR GA403/09/1915 Institutional research plan: CEZ:AV0Z70280505 Keywords : Housing policy * Welfare economics * Subsidy effectiveness Subject RIV: AH - Economics http://www.springerlink.com/content/y8km555k622v8vu0/

  8. Measurement equivalence of the dispositional resistance to change scale

    Czech Academy of Sciences Publication Activity Database

    Oreg, S.; Bayazıt, M.; Vakola, M.; Arciniega, L.; Armenakis, A.; Barkauskiene, R.; Bozionelos, N.; Fujimoto, Y.; González, L.; Han, J.; Hřebíčková, Martina; Jimmieson, N.; Kordačová, J.; Mitsuhashi, H.; Mlačić, B.; Ferič, I.; Kotrla Topič, M.; Ohly, S.; Oystein Saksvik, P.; Hetland, H.; Saksvik, I.B.; van Dam, K.

    New York : Routledge, 2011 - (Davidov, E.; Schmidt, P.; Billiet, J.), s. 249-278 ISBN 978-1-84872-823-3 R&D Projects: GA AV ČR IAA700250702 Institutional research plan: CEZ:AV0Z70250504 Keywords : dispositional resistance to change * measurement * validation across cultures Subject RIV: AN - Psychology

  9. Experience in the separation and purification of transplutonium elements in the transuranium processing plant at the Oak Ridge National Laboratory

    International Nuclear Information System (INIS)

    Since 1966, TRU has been the main center of production for transcurium elements in the US, producing 460 mg 249Bk, 4 g 252Cf, 18 mg 253Es, and 10 pg 257Fm. During the 14 years operation, 39 chemical processing campaigns were conducted to process 265 HFIR targets and 195 SRP production reactor targets

  10. 75 FR 28228 - Federal Acquisition Regulation; FAR Case 2009-031, Terminating Contracts

    Science.gov (United States)

    2010-05-20

    ... Federal Acquisition Regulation; FAR Case 2009-031, Terminating Contracts AGENCIES: Department of Defense... Regulations Council (Councils) are proposing to amend the Federal Acquisition Regulation (FAR) to provide clarification to the prescription for the FAR clause at 52.249-1, Termination for Convenience of the...

  11. Analysis of the Decision Making in the Personnel Selection Process

    Czech Academy of Sciences Publication Activity Database

    Navrátil, Marek; Klimusová, Helena

    Lanškroun: GOSC Group, s.r.o., 2001. s. 249. [The Tenth European Congress on Work and Organizational Psychology. 16.05.2001-19.05.2001, Praha] Institutional research plan: CEZ:AV0Z7025918 Keywords : Personnel Selection Process * Judgement Analysis * Decision-making process Subject RIV: AN - Psychology

  12. Hemoglobin, Growth, and Attention of Infants in Southern Ethiopia

    Science.gov (United States)

    Aubuchon-Endsley, Nicki L.; Grant, Stephanie L.; Berhanu, Getenesh; Thomas, David G.; Schrader, Sarah E.; Eldridge, Devon; Kennedy, Tay; Hambidge, Michael

    2011-01-01

    Male and female infants from rural Ethiopia were tested to investigate relations among hemoglobin (Hb), anthropometry, and attention. A longitudinal design was used to examine differences in attention performance from 6 (M = 24.9 weeks, n = 89) to 9 months of age (M = 40.6 weeks, n = 85), differences hypothesized to be related to changes in iron…

  13. Vizuální kultura: mezi lokálním a globálním pohledem

    Czech Academy of Sciences Publication Activity Database

    Kreuzzieger, Milan

    Dolní Břežany : Scriptorium, 2007 - (Prahl, R.; Winter, T.), 23-27, 248-249 ISBN 978-80-86197-89-0 Institutional research plan: CEZ:AV0Z90090514 Keywords : global isation * visual culture * history of art Subject RIV: AA - Philosophy ; Religion

  14. Physical Activity of Male and Female Adolescents Living in a Town and a City in the Context of Public Health Recommendations

    Science.gov (United States)

    Mynarski, Wladyslaw; Nawrocka, Agnieszka; Rozpara, Michal; Garbaciak, Wieslaw

    2012-01-01

    Study aim: To assess the physical activity of male and female adolescents from Poland living in a town (Czechowice-Dziedzice) and in a city (Katowice). Material and methods: The research involved 431 high school students aged 16-18 years (249 from Czechowice-Dziedzice and 182 from Katowice). Physical activity was measured by the short form of the…

  15. Dicty_cDB: Contig-U14580-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U14580-1 no gap 249 5 1838993 1838745 MINUS 1 2 U14580 0 0 0 0 0 0 0 1 0 0 0 0 0 0 Show C ... 2 1.6 2 ( DD293979 ) SUSCEPTIBILITY GENE FOR HUMAN STROKE ; METHODS OF ... 44 2.2 1 ( AX573239 ) Sequence 85 ...

  16. Joint location and source mechanism inversion of microseismic events: benchmarking on seismicity induced by hydraulic fracturing

    Czech Academy of Sciences Publication Activity Database

    Anikiev, D.; Valenta, Jan; Staněk, František; Eisner, Leo

    2014-01-01

    Roč. 198, č. 1 (2014), s. 249-258. ISSN 0956-540X R&D Projects: GA ČR GAP210/12/2451 Institutional support: RVO:67985891 Keywords : inverse theory * probability distributions * wave scattering and diffraction * fractures and faults Subject RIV: DB - Geology ; Mineralogy Impact factor: 2.724, year: 2013

  17. Establishment of target and invasive plant species on a reclaimed coal mining dump in relation to their occurrence in the surroundings

    Czech Academy of Sciences Publication Activity Database

    Kabrna, M.; Hendrychová, M.; Prach, Karel

    2014-01-01

    Roč. 28, č. 4 (2014), s. 242-249. ISSN 1748-0930 R&D Projects: GA ČR(CZ) GAP505/11/0256 Institutional support: RVO:67985939 Keywords : mining * reclamation * vascular plants Subject RIV: EH - Ecology, Behaviour Impact factor: 0.562, year: 2014

  18. 77 FR 50114 - Food and Drug Administration Modernization Act of 1997: Modifications to the List of Recognized...

    Science.gov (United States)

    2012-08-20

    .... Radiology 12-102 ANSI/IESNA RP-27.2-00 CFR citation and product Recommended Practice for codes, devices.... Radiology 12-249 Photobiological safety of IEC 62471 First lamps and lamp systems. edition 2006-07. I... the Federal Register of February 25, 1998 (63 FR 9561), FDA announced the availability of a...

  19. 12 CFR 335.311 - Forms for annual, quarterly, current, and other reports of issuers.

    Science.gov (United States)

    2010-01-01

    ... Results of Operations can be found at 17 CFR 229.300. Industry Guide 3, Statistical Disclosure by Bank..., and other reports are codified in subpart D of 17 CFR part 249. All forms shall be filed with the FDIC... for Financial Statements can generally be found in Regulation S-X (17 CFR part 210). Banks may...

  20. HEMATOPOIETIC SYSTEM

    Institute of Scientific and Technical Information of China (English)

    2003-01-01

    12.1 Leukocyte and leukocyte function2003360 Expression of vascular endothelial growth factor and its receptors KDR and Fltl in acute myeloid leukemia. WANG Yi(王一), et al. Instit Hematol, CAMS & PUMC, Tianjin 300020. Chin J Hematol 2003;24(5):249-252Objective: To evaluate the expression of vascular endothelial growth factor (VEGF) and its receptors KDR

  1. QTL Information Table: 198 [Q-TARO

    Lifescience Database Archive (English)

    Full Text Available Morphological trait Panicle/flower grains/plant RFLP C)Interval RIL Lemont Teqing A G249 RG418 p ... c Loci Are the Primary Genetic Basis of Inbreeding Depression ... and Heterosis in Rice. II. Grain Yield Components. ...

  2. Birth weight and systolic blood pressure in adolescence and adulthood

    DEFF Research Database (Denmark)

    Gamborg, Michael; Byberg, Liisa; Rasmussen, Finn;

    2007-01-01

    The authors investigated the shape, sex- and age-dependency, and possible confounding of the association between birth weight and systolic blood pressure (SBP) in 197,954 adults from 20 Nordic cohorts (birth years 1910-1987), one of which included 166,249 Swedish male conscripts. Random...

  3. Occupational Employment in Nuclear-Related Activities, 1981.

    Science.gov (United States)

    Baker, Joe G.; Olsen, Kathryn

    Employment in nuclear- and nuclear energy-related activities in 1981 was examined and compared to that in previous years. Survey instruments were returned by 784 establishments. Total 1981 nuclear-related employment was estimated to be 249,500--a growth of 22,600 (10%) workers over the 1977 total. Government-owned, contractor-operated (GOCO)…

  4. Nuclear power plant decommissioning. January 1972-September 1989 (Citations from the NTIS data base). Report for January 1972-September 1989

    International Nuclear Information System (INIS)

    This bibliography contains citations concerning nuclear power plant phase-out and decommissioning. Included are case histories of the dismantling process, hazardous-waste management, site monitoring, and economic aspects of the phase-out. (This updated bibliography contains 249 citations, 71 of which are new entries to the previous edition.)

  5. Myths and Misconceptions in Popular Psychology: Comparing Psychology Students and the General Public

    Science.gov (United States)

    Furnham, Adrian; Hughes, David J.

    2014-01-01

    This study examined the prevalence of psychological myths and misconceptions among psychology students and within the general population. In total, 829 participants completed a 249-item questionnaire designed to measure a broad range of psychological myths. Results revealed that psychological myths and misconceptions are numerous and widely held.…

  6. K názvům moruše ve slovanských jazycích

    Czech Academy of Sciences Publication Activity Database

    Janyšková, Ilona

    Warszawa : Instytut Slawistyki PAN, Fundacja Slawistyczna, 2014 - (Jakubowicz, M.; Raszewska-Zurek, B.), s. 249-260 ISBN 978-83-64031-07-6 R&D Projects: GA ČR GA13-17435S Institutional support: RVO:68378092 Keywords : Slavonic languages * etymology * semantics * names of trees * mulberry Subject RIV: AI - Linguistics

  7. Cyanobacterial water bloom of Limnoraphis robusta in the Lago Mayor of Lake Titicaca. Can it develop?

    Czech Academy of Sciences Publication Activity Database

    Komárková, Jaroslava; Montoya, H.; Komárek, J.

    2016-01-01

    Roč. 764, č. 1 (2016), s. 249-258. ISSN 0018-8158 Institutional support: RVO:60077344 Keywords : Titicaca Lake * cyanobacterial water bloom * Limnoraphis robusta * Diazocytes * Atitlan Lake * N:P ratio Subject RIV: DA - Hydrology ; Limnology Impact factor: 2.275, year: 2014

  8. A general method for the calculation of absolute trace gas concentrations in air and breath from selected ion flow tube mass spectrometry data

    Czech Academy of Sciences Publication Activity Database

    Španěl, Patrik; Dryahina, Kseniya; Smith, D.

    249-250, - (2006), s. 230-239. ISSN 1387-3806 R&D Projects: GA ČR GA202/03/0827 Institutional research plan: CEZ:AV0Z40400503 Keywords : selected ion flow tube * mass spectrometry * SIFT-MS * trace gas analysis Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.337, year: 2006

  9. QTL Information Table: 42 [Q-TARO

    Lifescience Database Archive (English)

    Full Text Available qGW5 Morphological trait Seed 1,000-grain weight SSR d)Co-segregated BC4F4 Guichao 2 Chinese com ... rufipogon Griff.) A RM249 pha Tian, F., Li, D.J., Fu , Q., Zhu, Z.F., Fu , Y.C., Wang, X.K., and Sun, C.Q ...

  10. Pesticide residues in fruit and vegetables from Africa - a Nordic Project

    DEFF Research Database (Denmark)

    Petersen, Annette

    . Most of the samples came from South Africa (249), followed by Egypt (129), Morocco (92) and Kenya (88). In total 45 different commodities were analyzed, oranges (162) being the largest group, followed by beans with pods (80) and table grapes (71). In the analytical scope 220 to 345 pesticides and...

  11. Use of asthma medication during pregnancy and risk of specific congenital anomalies

    DEFF Research Database (Denmark)

    Garne, Ester; Hansen, Anne Vinkel; Morris, Joan;

    2015-01-01

    addition, exploratory analyses were done for each nonsignal anomaly. The data set included 76,249 registrations of congenital anomalies from 13 EUROmediCAT registries. RESULTS: Cleft palate (OR, 1.63; 95% CI, 1.05-2.52) and gastroschisis (OR, 1.89; 95% CI, 1.12-3.20) had significantly increased odds of...

  12. Clinical and cytogenetic features of a population-based consecutive series of 285 pediatric T-cell acute lymphoblastic leukemias: rare T-cell receptor gene rearrangements are associated with poor outcome

    DEFF Research Database (Denmark)

    Karrman, Kristina; Forestier, Erik; Heyman, Mats; Andersen, Mette K; Autio, Kirsi; Blennow, Elisabeth; Borgström, Georg; Ehrencrona, Hans; Golovleva, Irina; Heim, Sverre; Heinonen, Kristiina; Hovland, Randi; Johannsson, Johann H; Kerndrup, Gitte; Nordgren, Ann; Palmqvist, Lars; Johansson, Bertil

    2009-01-01

    Clinical characteristics and cytogenetic aberrations were ascertained and reviewed in a population-based consecutive series of 285 pediatric T-cell acute lymphoblastic leukemias (T-ALLs) diagnosed between 1992 and 2006 in the Nordic countries. Informative karyotypic results were obtained in 249 (...

  13. The Developmental Trajectories of Executive Function of Children and Adolescents with Attention Deficit Hyperactivity Disorder

    Science.gov (United States)

    Qian, Ying; Shuai, Lan; Chan, Raymond C. K.; Qian, Qiu-Jin; Wang, Yufeng

    2013-01-01

    This study examined the developmental trajectories of executive function (EF) of children and adolescents with Attention Deficit Hyperactivity Disorder (ADHD) in Han Chinese. Five hundred and fifteen children and adolescents with ADHD and 249 healthy controls took part in this study. All of them were administered four EF tests capturing…

  14. DNA instability in low-risk myelodysplastic syndromes: refractory anemia with or without ring sideroblasts.

    Czech Academy of Sciences Publication Activity Database

    Novotná, Božena; Neuwirtová, R.; Šišková, M.; Bagryantseva, Yana

    2008-01-01

    Roč. 17, č. 14 (2008), s. 2144-2149. ISSN 0964-6906 R&D Projects: GA MZd NR8265 Institutional research plan: CEZ:AV0Z50390512 Keywords : Anemia * DNA Subject RIV: FD - Oncology ; Hematology Impact factor: 7.249, year: 2008

  15. KSČ a věda. Hlavní koncepty vědní politiky v Československu 1945-1989

    Czech Academy of Sciences Publication Activity Database

    Kostlán, Antonín

    Praha : Ústav pro soudobé dějiny AV ČR, 2012 - (Kalous, J.; Kocian, J.), s. 239-249 ISBN 978-80-7285-156-0 R&D Projects: GA ČR GA409/08/1621 Institutional support: RVO:68378114 Keywords : Communist Party of Czechoslovakia * science policy Subject RIV: AB - History

  16. Diel variations in the photosynthetic parameters of Prochlorococcus strain PCC 9511: Combined effects of light and cell cycle

    Czech Academy of Sciences Publication Activity Database

    Bruyant, F.; Babin, M.; Genty, B.; Prášil, Ondřej; Behrenfeld, M. J.; Claustre, H.; Bricaud, A.; Garczarek, L.; Holtzendorff, J.; Koblížek, Michal; Doušová, Helena; Partensky, F.

    2005-01-01

    Roč. 50, č. 3 (2005), s. 850-863. ISSN 0024-3590 R&D Projects: GA MŠk LN00A141 Institutional research plan: CEZ:AV0Z50200510 Keywords : prochlorococcus * phytoplankton Subject RIV: EE - Microbiology, Virology Impact factor: 3.249, year: 2005

  17. Současné psychologické přístupy k autobiografické paměti

    Czech Academy of Sciences Publication Activity Database

    Vlčková, Irena; Čermák, Ivo

    Brno: Psychologický ústav AV ČR, 2006, s. 243-249. [Kognice 2006. Praha (CZ), 06.10.2006-07.10.2006] Institutional research plan: CEZ:AV0Z70250504 Keywords : autobiographical memory * self-story * cognitive psychology Subject RIV: AN - Psychology

  18. Diskurzivní analýza v soudobé sociální psychologii: teorie, koncepty a aplikace

    Czech Academy of Sciences Publication Activity Database

    Zábrodská, Kateřina

    2010-01-01

    Roč. 54, č. 3 (2010), s. 249-262. ISSN 0009-062X R&D Projects: GA ČR GPP407/10/P146 Institutional research plan: CEZ:AV0Z70250504 Keywords : discourse analysis * conversation analysis * critical discursive psychology Subject RIV: AN - Psychology Impact factor: 0.230, year: 2010

  19. Academic Expectations and Actual Achievements: The Roles of Hope and Effort

    Science.gov (United States)

    Levi, Uzi; Einav, Michal; Ziv, Orit; Raskind, Ilana; Margalit, Malka

    2014-01-01

    This study sought to extend the research on adolescents' hope, academic expectations, and average grades. The hope theory (Snyder, "Psychological Inquiry" 13(4):249-275, 2002), the salutogenic paradigm (with a focus on sense of coherence (SOC) (Antonovsky 1987)), and Bandura's ("Journal of Management" 38(1):9-44,…

  20. Osteoporosis or Low Bone Mass at the Femur Neck or Lumbar Spine in Older Adults: United States, 2005-2008

    Science.gov (United States)

    ... HW, Dunn WL, Calvo MS, et al. Updated data on proximal femur bone mineral levels of U.S. adults. Osteoporos Int 8:468–89. 1998. Kelly TJ. Bone mineral density reference databases for American men and women. J Bone Miner Res 5 (Suppl1):S249. 1990. Centers for Disease ...

  1. Investigation of Problem Solving Ability of Students in School of Physical Education and Sports (Kafkas University Sample)

    Science.gov (United States)

    Ozmutlu, Ilker

    2014-01-01

    The aim of this research is to examine the problem solving abilities of School of Physical Education and Sports students. To achieve this aim, in the academic year 2013-2014, a research group did a study of 433 students of the School of Physical Education and Sports, Kafkas University. This sample consisted of 184 female and 249 male students.…

  2. The shear-flow properties of electro-rheological liquid polymeric blends

    Czech Academy of Sciences Publication Activity Database

    Říha, Pavel; Kimura, H.; Aikawa, K.; Masubuchi, Y.; Takimoto, J.; Koyama, K.

    1999-01-01

    Roč. 85, 2-3 (1999), s. 249-256. ISSN 0377-0257 R&D Projects: GA AV ČR IAA2060703 Keywords : electro-rheological effect * urethane- modified polypropylene glycol/dimethylsiloxane liquid blend * stochastic process * Maxwell-like rheological equation Subject RIV: BK - Fluid Dynamics Impact factor: 1.861, year: 1999

  3. Preface to the injection tables

    International Nuclear Information System (INIS)

    Twelve groups of dogs received intravenous injections of various doses of 226Ra, 239Pu, 228Ra, 228Th, 90Sr, 241Am, 249Cf, or 252Cf at approximately 17 months of age. The animals were euthanized when death appeared imminent. Data are presented on the calculated radiation dose to the skeleton and pathological changes observed at autopsy

  4. Information Systems and Technology Sourcing Strategies and Performance of E-Retailers

    Science.gov (United States)

    Tsai, Juliana Yuh-Shun

    2012-01-01

    The e-Retail industry has grown rapidly over the last few years and is projected to continue its upward trend as consumers shift from traditional channels to online channels. In March 2010, Forrester Research forecasted that online retail sales will grow by 10% a year for the next 5 years and e-Retail sales will amount to $249 billion by 2014.…

  5. Best Practices in Faculty Development in North American Higher Education: Distinctions and Dilemmas.

    Science.gov (United States)

    King, Kathleen P.; Lawler, Patricia A.

    2003-01-01

    Uses quantitative and qualitative methods to analyze interview and survey data concerning best practices, goals, purposes, and influences among faculty developers in the U.S. and Canada. Presents the current state of the field, an interpretation of its meaning, and recommendations for future directions. Authors sent out 976 surveys; 249 were…

  6. EST Table: FY754787 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available FY754787 E_FL_famL_16C13_R_0 11/11/04 47 %/249 aa ref|XP_001606351.1| PREDICTED: similar to MGC6 ... .1| PREDICTED: similar to regulator of microtubule dynamics ... 1 [Tribolium castaneum] FS783762 famL ...

  7. Measuring Attitude Functions.

    Science.gov (United States)

    Anderson, Deborah S.; Kristiansen, Connie M.

    1990-01-01

    Discusses the Attitude Functions Inventory (AFI), which assesses the extent to which a person's attitude fulfills each of four psychological functions. Reports findings of a study, involving 249 undergraduates, that tested the construct validity of the AFI. Suggests that the AFI provides conceptually meaningful measures of the functions of…

  8. Evaluation of flooring produced from small diameters logs of Eucalyptus sp. clones

    Directory of Open Access Journals (Sweden)

    José Reinaldo Moreira da Silva

    2010-12-01

    Full Text Available This study evaluated two Eucalyptus clones, MN 249 and MN 89, for the flooring production using small diameters logs. It was considered the wood physical properties - NBR 7190/97 (ABNT, 1997 and simulation of the product in service (ASTM D 2394/83 with two thicknesses, 8 and 14 mm. The basic density of the clone 89 NM was the highest one (0,615 g/cm3. The contractions were more pronounced in clone NM 249, however, the anisotropy coefficient of this clone was small. In the simulation tests, the floor produced by clone MN 249 presented the lowest deformation rate. The floor of 8 mm, in addition to the differences between clones, there was significant interaction between the positions for the indentation test caused by loads applied in small areas. The deformations obtained for the floor with 14 mm thickness, produced with the MN clone 89, were higher than those found in the literature for the indentation load applied on a small area test. The clone MN 249 presented the best results in both thicknesses.

  9. Corporate Governance Country Assessment : Chile

    OpenAIRE

    World Bank

    2003-01-01

    Chile's equity market is fairly large and successful. The market capitalization of the 249 listed firms represented 89 percent of GDP at year-end, 2001. Corporate ownership is concentrated and pyramid structures are common. Business groups/conglomerates are the predominant corporate form. Institutional investors, especially pension funds, are active equity investors. The Securities Market ...

  10. "I Like to Plan Events": A Document Analysis of Essays Written by Applicants to a Public Relations Program

    Science.gov (United States)

    Taylor, Ronald E.

    2016-01-01

    A document analysis of 249 essays written during a 5-year period by applicants to a public relations program at a major state university in the southeast suggests that there are enduring reasons why students choose to major in public relations. Public relations is described as a major that allows for and encourages creative expression and that…

  11. AcEST: BP915463 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000071_H06 283 Adiantum capillus-veneris mRNA. clone: YMU001_000071_H06. BP915463 CL1305C ... Frame = +1 Query: 97 ADGHTFQVDSNHSVHG*LCWLP--LSSS*AVC TKSLTKGFDYVDSNPRAWIAK 249 A GHT H + + W P + AVC ... KS ... VD+ R WIAK Sbjct: 302 AKGHTSPKRRTHGILTGVIWSPDKAGGNRAVC RKSTDGTYAYVDNTTRKWIAK 354 ...

  12. Helical screw type magnetic structure of the multiferroic CaMn.sub.7./sub.O.sub.12./sub. with low Cu-doping

    Czech Academy of Sciences Publication Activity Database

    Slawinski, W.; Przenioslo, R.; Sosnowska, I.; Petříček, Václav

    2012-01-01

    Roč. 68, č. 3 (2012), s. 240-249. ISSN 0108-7681 Grant ostatní: AV ČR(CZ) Praemium Academiae Institutional research plan: CEZ:AV0Z10100521 Keywords : magnetic modulated structure * powder neutron scattering * structural refinement Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.175, year: 2012

  13. Ultraviolet photodissociation of the van der Waals dimer (CH3I)(2) revisited. II. Pathways giving rise to neutral molecular iodine

    NARCIS (Netherlands)

    Vidma, K.V.; Baklanov, A.V.; Zhang, Y.W.; Parker, D.H.

    2006-01-01

    The formation of neutral I-2 by the photodissociation of the methyl iodide dimer, (CH3I)(2), excited within the A band at 249.5 nm is evaluated using velocity map imaging. In previous work [J. Chem. Phys. 122, 204301 (2005)], we showed that the formation of I-2(+) from photodissociation of the methy

  14. Financial Information Source, Knowledge, and Practices of College Students from Diverse Backgrounds

    Science.gov (United States)

    Mimura, Yoko; Koonce, Joan; Plunkett, Scott W.; Pleskus, Lindsey

    2015-01-01

    Using cross-sectional data, we examined the financial information sources, financial knowledge, and financial practices of young adults, many of whom are first generation college students, ethnic minorities, and immigrants or children of immigrants. Participants (n = 1,249) were undergraduate students at a large regional comprehensive university.…

  15. Information Activities and Appropriation in Teacher Trainees' Digital, Group-Based Learning

    Science.gov (United States)

    Hanell, Fredrik

    2016-01-01

    Introduction: This paper reports results from an ethnographic study of teacher trainees' information activities in digital, group-based learning and their relation to the interplay between use and appropriation of digital tools and the learning environment. Method: The participants in the present study are 249 pre-school teacher trainees in…

  16. ISOLATION OF TOXOPLASMA GONDII FROM ANIMALS IN DURANGO, MEXICO

    Science.gov (United States)

    Little is known concerning the epidemiology of Toxoplasma gondii infection in people and animals in rural Mexico. Serum samples and tissues from 150 dogs, 150 cats, 65 opossums (Didelphis virginianus), 249 rats (Rattus spp.), 127 mice (Mus musculus), and 69 squirrels (Spermophilus variegatus) from t...

  17. Vliv vegetačního krytu na disipaci energie a vodní režim v krajině - dopady na interakce biotických a abiotických složek v povrchových vodách

    Czech Academy of Sciences Publication Activity Database

    Pechar, Libor; Pokorný, Jan; Procházka, J.; Wotavová, K.; Pecharová, E.; Švehla, J.

    2004-01-01

    Roč. 3, č. 21 (2004), s. 249-255. ISSN 1212-0731. [Agroregion 2004. České Budějovice, 06.09.2004-07.09.2004] Institutional research plan: CEZ:AV0Z6087904 Keywords : Landscape function * water cycle * remote sensing Subject RIV: DO - Wilderness Conservation

  18. Temporal in vitro expansion of the luminal lineage of human mammary epithelial cells achieved with the 3T3 feeder layer technique

    Czech Academy of Sciences Publication Activity Database

    Matoušková, Eva; Dudorkinová, D.; Krásná, Luboslava; Veselý, Pavel

    2000-01-01

    Roč. 60, č. 3 (2000), s. 241-249. ISSN 0167-6806 R&D Projects: GA ČR GA312/97/1222; GA MZd NC5614; GA AV ČR KSK2039602 Institutional research plan: CEZ:AV0Z5052915 Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.720, year: 2000

  19. Bacterial Surface Display of Metal-Binding Sites

    Czech Academy of Sciences Publication Activity Database

    Kotrba, P.; Rulíšek, Lubomír; Ruml, T.

    Dordrecht: Springer, 2011 - (Kotrba, P.; Macková, M.; Macek, T.), s. 249-283 ISBN 978-94-007-0442-8 Grant ostatní: GA MŠk(CZ) 1M0520 Institutional research plan: CEZ:AV0Z40550506 Keywords : bioremediation * biosorption * metal-binding peptide * cell-surface display Subject RIV: EI - Biotechnology ; Bionics

  20. 76 FR 71872 - Rescission of Outdated Rules and Forms, and Amendments To Correct References

    Science.gov (United States)

    2011-11-21

    ... Accountants, Accounting, Securities. 17 CFR Parts 229, 230, 232, 239, 240, 243, and 249 Reporting and... CONTENT OF AND REQUIREMENTS FOR FINANCIAL STATEMENTS, SECURITIES ACT OF 1933, SECURITIES EXCHANGE ACT OF... Act of 1935,'' from the third sentence of the introductory text; 0 b. Removing the phrase...

  1. Some duality relations in the theory of tensor products

    Czech Academy of Sciences Publication Activity Database

    Hájek, Petr Pavel; Smith, R. J.

    2012-01-01

    Roč. 30, č. 3 (2012), s. 239-249. ISSN 0723-0869 R&D Projects: GA ČR(CZ) GAP201/11/0345 Institutional support: RVO:67985840 Keywords : tensor * projective * injective Subject RIV: BA - General Mathematics Impact factor: 0.780, year: 2012 http://www.sciencedirect.com/science/article/pii/S072308691200045X

  2. El modelo de la diversidad. La Bioética y los Derechos Humanos como herramientas para alcanzar la plena dignidad en la diversidad funcional [book review

    OpenAIRE

    Morente Parra, Vanesa

    2007-01-01

    Este artículo reseña: Palacios, Agustina; Romañach, Javier. El modelo de la diversidad. La Bioética y los Derechos Humanos como herramientas para alcanzar la plena dignidad en la diversidad funcional. Madrid: Diversitás Ediciones, 2006. 249 p.

  3. 48 CFR 970.5223-7 - Sustainable acquisition program.

    Science.gov (United States)

    2010-10-01

    ... Management, and Executive Order 13514, Federal Leadership in Environmental, Energy, and Economic Performance... may request an equitable adjustment to the terms of its contract using the procedures at 48 CFR 970..., see 48 CFR 52.249-6, Termination (Cost Reimbursement). (h) These provisions shall be flowed down...

  4. Sociolinguistic Variation and Change in British Sign Language Number Signs: Evidence of Leveling?

    Science.gov (United States)

    Stamp, Rose; Schembri, Adam; Fenlon, Jordan; Rentelis, Ramas

    2015-01-01

    This article presents findings from the first major study to investigate lexical variation and change in British Sign Language (BSL) number signs. As part of the BSL Corpus Project, number sign variants were elicited from 249 deaf signers from eight sites throughout the UK. Age, school location, and language background were found to be significant…

  5. Structural evolution of the Prague synform (Czech Republic) during Silurian times: An AMS, rock magnetism, and palomagnetic study of the Svatý Jan pod Skalou dikes. Consequences for the nappes emplacement

    Czech Academy of Sciences Publication Activity Database

    Aifa, T.; Pruner, Petr; Chadima, Martin; Štorch, Petr

    Colorado : Boulder, 2007 - (Linnemann, U.), s. 249-265 ISBN 978-0-8137-2423-2. - (Special papers- Geological Society of America . 423) R&D Projects: GA AV ČR IAA3013406 Institutional research plan: CEZ:AV0Z30130516 Keywords : magnetic properies * dikes * Variscan orogen * stress * rheic * AMS * magnetization * Variscan orogen Subject RIV: DB - Geology ; Mineralogy

  6. 78 FR 6132 - Agency Information Collection Activities; Submission for OMB Review; Comment Request; Petition...

    Science.gov (United States)

    2013-01-29

    ... published in the Federal Register on September 6, 2012 (77 FR 54929). Interested parties are encouraged to...: Section 221 (a) of Title II, Chapter 2 of the Trade Act of 1974, as amended by the Trade and Globalization..., and 249 of the Trade Act of 1974, as amended by the Trade and Globalization Adjustment Assistance...

  7. Patterns of bryophyte and vascular plant richness in European subalpine springs

    Czech Academy of Sciences Publication Activity Database

    Sekulová, L.; Hájek, Michal; Hájková, Petra; Mikulášková, E.; Buttler, A.; Syrovátka, V.; Rozbrojová, Zuzana

    2012-01-01

    Roč. 213, č. 2 (2012), s. 237-249. ISSN 1385-0237 Institutional research plan: CEZ:AV0Z60050516 Keywords : springs * spesies richness * environmental factors Subject RIV: EF - Botanics Impact factor: 1.534, year: 2012 http://www.springerlink.com/content/m6gq67w137746672/

  8. 75 FR 33901 - Physical Protection of Byproduct Material

    Science.gov (United States)

    2010-06-15

    ...; manufacturer and distributor licensees; medical facilities with gamma knife devices; self-shielded irradiator...-249; June 6, 2003) (68 FR 35458; June 13, 2003). The next series of orders were issued to certain manufacturing and distribution (M&D) licensees (EA- 03-225; January 12, 2004) (69 FR 5375; February 4,...

  9. 78 FR 16921 - Physical Protection of Byproduct Material

    Science.gov (United States)

    2013-03-19

    ... and distributor licensees; medical facilities with gamma knife devices; self-shielded irradiator... material (EA- 02-249; June 6, 2003) (68 FR 35458; June 13, 2003). The next series of orders were issued to certain manufacturing and distribution (M&D) licensees (EA-03-225; January 12, 2004) (69 FR 5375;...

  10. Practice (Rather than Graded) Quizzes, with Answers, May Increase Introductory Psychology Exam Performance

    Science.gov (United States)

    Wickline, Virginia B.; Spektor, Valeriya G.

    2011-01-01

    The authors investigated whether practice (or graded) quizzes, with or without provision of correct answers, would be more beneficial for introductory psychology exam performance. In six sections (N = 249) of an introductory psychology class, taught by the same professor, different approaches to quizzes were applied across sections to measure…

  11. Root-sprouting in myco-heterotrophic plants: prepackaged symbioses or overcoming meristem limitation?

    Czech Academy of Sciences Publication Activity Database

    Klimešová, Jitka

    2007-01-01

    Roč. 173, - (2007), s. 8-10. ISSN 0028-646X Institutional research plan: CEZ:AV0Z60050516 Keywords : root sprouting * bud bank * Myco-heterotrophic plants Subject RIV: EF - Botanics Impact factor: 5.249, year: 2007

  12. The Relationship between Experiences of Discrimination and Mental Health among Lesbians and Gay Men: An Examination of Internalized Homonegativity and Rejection Sensitivity as Potential Mechanisms

    Science.gov (United States)

    Feinstein, Brian A.; Goldfried, Marvin R.; Davila, Joanne

    2012-01-01

    Objective: The current study used path analysis to examine potential mechanisms through which experiences of discrimination influence depressive and social anxiety symptoms. Method: The sample included 218 lesbians and 249 gay men (total N = 467) who participated in an online survey about minority stress and mental health. The proposed model…

  13. Subjektivní blahobyt v České republice a střední Evropě: makro- a mikro-determinanty

    Czech Academy of Sciences Publication Activity Database

    Večerník, Jiří

    2014-01-01

    Roč. 62, č. 2 (2014), s. 249-270. ISSN 0032-3233 R&D Projects: GA ČR(CZ) GAP404/11/1521 Institutional support: RVO:68378025 Keywords : subjective well-being * life satisfaction * Central Europe Subject RIV: AO - Sociology, Demography Impact factor: 0.650, year: 2014

  14. Das Minoriten- und Klarissenkloster in Znaim und seine mittelalterliche Gestalt

    Czech Academy of Sciences Publication Activity Database

    Benešovská, Klára

    Prag: Philosophische Fakultät der Karlsuniversität, 1998 - (Bláhová, M.; Hlaváček, I.), s. 249-272 ISBN 80-85899-42-6. [Böhmisch-österreichische Beziehungen im 13. Jahrhundert. Znojmo (CZ), 26.09.1996-27.09.1996] Subject RIV: AL - Art, Architecture, Cultural Heritage

  15. Effect of heavy metals on the structure and function of photosystem II: potential and prospects for use as bioindicator

    Czech Academy of Sciences Publication Activity Database

    Masojídek, Jiří; Malý, Jan; Alessandrelli, S.; Koblížek, Michal; Rizzuto, M.; Geiken, B.; Kopecký, Jiří; Komenda, Josef; Prášil, Ondřej; Giardi, M. T.

    Roma : Italian National Agency for new Technology, Energy and the Environment, 2000 - (Mazzei, F.; Pilloton, R.), s. 249-256 ISBN 88-8286-072-8. [Workshop on Chemical Sensors and Biosensors /2./. Casaccia (IT), 18.03.1999-19.03.1999] R&D Projects: GA MŽP MR/340/2/97 Subject RIV: EI - Biotechnology ; Bionics

  16. Mitochondria: An intriguing target for killing tumour-initiating cells

    Czech Academy of Sciences Publication Activity Database

    Yan, B.; Dong, L.; Neužil, Jiří

    2016-01-01

    Roč. 26, JAN 2016 (2016), s. 86-93. ISSN 1567-7249 R&D Projects: GA MŠk(CZ) ED1.1.00/02.0109 Institutional support: RVO:86652036 Keywords : Tumour-initiating cells * ALPHA-TOCOPHERYL SUCCINATE * Therapeutic resistance * Mitochondria Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.249, year: 2014

  17. Categorizing Moving Objects into Film Genres: The Effect of Animacy Attribution, Emotional Response, and the Deviation from Non-Fiction

    Science.gov (United States)

    Visch, Valentijn T.; Tan, Ed S.

    2009-01-01

    The reported study follows the footsteps of Heider, and Simmel (1944) [Heider, F., & Simmel, M. (1944). An experimental study of apparent behavior. "American Journal of Psychology," 57, 243-249] and Michotte (1946/1963) [Michotte, A. (1963). "The perception of causality" (T.R. Miles & E. Miles, Trans.). London: Methuen (Original work published…

  18. Characterization of spirochetal isolates from arthropods collected in South Moravia, Czech Republic, using fatty acid methyl esters analysis

    Czech Academy of Sciences Publication Activity Database

    Čechová, L.; Durnová, E.; Šikutová, Silvie; Halouzka, Jiří; Němec, M.

    2004-01-01

    Roč. 808, č. 2 (2004), s. 249-254. ISSN 1570-0232 R&D Projects: GA ČR GA206/03/0726 Institutional research plan: CEZ:AV0Z6093917 Keywords : spirochetes * arthropods * fatty acid methyl esters Subject RIV: EE - Microbiology, Virology Impact factor: 2.176, year: 2004

  19. EST Table: DC534780 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available DC534780 E_ET_J150_25E10_R_0 10/09/28 42 %/249 aa ref|NP_001116815.1| carboxylesterase CarE -11 [ ... Bombyx mori] gb|ACB12415.1| carboxylesterase CarE -11 [Bombyx mori] 10/09/01 34 %/185 aa FBpp0159923| ...

  20. EST Table: BB986106 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available BB986106 E_ET_MSV3_13F05_F_0 10/09/28 35 %/249 aa ref|NP_001121786.1| alpha-esterase 3 [Bombyx m ... ori] gb|ACD80423.1| carboxylesterase CarE -14 [Bombyx mori] 10/08/28 low homology 10/08/27 n. ...

  1. 75 FR 64120 - Technical Amendments to Forms N-CSR and N-SAR in Connection With the Comprehensive Iran Sanctions...

    Science.gov (United States)

    2010-10-19

    ... COMMISSION 17 CFR Parts 249 and 274 Technical Amendments to Forms N-CSR and N-SAR in Connection With the... adopting technical amendments to Forms N-CSR and N-SAR under the Securities Exchange Act of 1934 and the... Securities and Exchange Commission (``Commission'') is adopting technical amendments to Form N-CSR \\1\\...

  2. Combination of micropreparative solution isoelectric focusing and high-performance liquid chromatography for differentiation of biofilm-positive and biofilm-negative Candida parapsilosis group from vascular catheter

    Czech Academy of Sciences Publication Activity Database

    Vykydalová, Marie; Horká, Marie; Růžička, F.; Duša, Filip; Moravcová, Dana; Kahle, Vladislav; Šlais, Karel

    2014-01-01

    Roč. 812, Feb (2014), s. 243-249. ISSN 0003-2670 R&D Projects: GA MV VG20112015021 Institutional support: RVO:68081715 Keywords : Candida parapsilosis group * biofilm * sonicate from vascular cathether * sIEF * HPLC Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 4.513, year: 2014 http://hdl.handle.net/11104/0230766

  3. 78 FR 46656 - Program for Allocation of Regulatory Responsibilities Pursuant to Rule 17d-2; Notice of Filing of...

    Science.gov (United States)

    2013-08-01

    ... From the Federal Register Online via the Government Publishing Office SECURITIES AND EXCHANGE... of 1975, Report of the Senate Committee on Banking, Housing, and Urban Affairs to Accompany S. 249, S... Exchange Act Release No. 12352 (April 20, 1976), 41 FR 18808 (May 7, 1976). To address...

  4. 75 FR 57998 - Program for Allocation of Regulatory Responsibilities Pursuant to Rule 17d-2; Notice of Filing of...

    Science.gov (United States)

    2010-09-23

    ... From the Federal Register Online via the Government Publishing Office SECURITIES AND EXCHANGE... of the Senate Committee on Banking, Housing, and Urban Affairs to Accompany S. 249, S. Rep. No. 94-75... No. 12352 (April 20, 1976), 41 FR 18808 (May 7, 1976). To address regulatory duplication in these...

  5. Dependence of the human skin protection against the UV solar carcinoma radiation on the sunscreens and cosmetics layer thickness

    Czech Academy of Sciences Publication Activity Database

    Stádník, Bohumil; Jirásková, M.

    2000-01-01

    Roč. 45, č. 3 (2000), s. 241-249. ISSN 0001-7043 R&D Projects: GA ČR GA102/99/0548 Institutional research plan: CEZ:AV0Z2067918 Keywords : cancer * fluorescence * patient diagnosis Subject RIV: JB - Sensors, Measurment, Regulation

  6. Factors related to oral health-related quality of life of independent brazilian elderly

    DEFF Research Database (Denmark)

    Ulinski, Karla Giovana Bavaresco; do Nascimento, Mariele Andrade; Lima, Arinilson Moreira Chaves;

    2013-01-01

    95%: 1.15-2.00); poor self-perception of oral health (PR = 2.49; CI 95%: 1.92-3.24); and poor perception of dental care provided (PR = 1.34; CI 95%: 1.12-1.59). The younger elderly also noticed this negative impact. These findings showed that the clinical, sociodemographic, and subjective factors...

  7. 17 CFR 232.311 - Documents submitted in paper under cover of Form SE.

    Science.gov (United States)

    2010-04-01

    ... English summary or English translation of the foreign language document in accordance with § 232.306(b) or... filing in electronic format an English translation of its latest annual budget submitted as Exhibit B to... SE (§§ 239.64, 249.444, 259.601, 269.8, and 274.403 of this chapter) no later than one business...

  8. Glass melting and its innovation potentials : the role of glass flow in the bubble-removal process

    Czech Academy of Sciences Publication Activity Database

    Němec, Lubomír; Cincibusová, P.

    2008-01-01

    Roč. 52, č. 4 (2008), s. 240-249. ISSN 0862-5468 R&D Projects: GA MPO 2A-1TP1/063 Institutional research plan: CEZ:AV0Z40320502 Keywords : bubble removal * temperature gradients * glass-flow pattern s, Subject RIV: CA - Inorganic Chemistry Impact factor: 0.644, year: 2008

  9. Theta-paced flickering between place-cell maps in the hippocampus

    Czech Academy of Sciences Publication Activity Database

    Ježek, Karel; Henriksen, E. J.; Treves, A.; Moser, E. I.; Moser, M.B.

    2011-01-01

    Roč. 478, č. 7368 (2011), s. 246-249. ISSN 0028-0836 R&D Projects: GA MŠk(CZ) LC554; GA MŠk(CZ) 1M0517 Institutional research plan: CEZ:AV0Z50110509 Keywords : memory * theta * hippocampus * place cells * teleportation Subject RIV: FH - Neurology Impact factor: 36.280, year: 2011

  10. Rudolf Winternitz

    Czech Academy of Sciences Publication Activity Database

    Šimůnek, Michal V.

    Červený Kostelec : Pavel Mervart, 2013 - (Šimůnek, M.; Kostlán, A.), s. 249-251 ISBN 978-80-7465-041-3. - (Studies in the History of Sciences and Humanities. 29) Institutional support: RVO:68378114 Keywords : holocaust * intellectual elite * history of science Subject RIV: AB - History

  11. Attention-Deficit, Fear and Aggression in Iranian Preschool Students with Regard to Gender Differences

    Science.gov (United States)

    Sheikhzade, Mostafa; Assemi, Arezoo

    2013-01-01

    The cause of most adult psychopathologies or behavioural disorders can be traced back to childhood. In this study, we examine the attention-deficit, fear and aggression in Iran's preschool students in Oshnaviye city. In this analytical-descriptive study, 50 students were selected through stratified sampling method from 249 students. Data were…

  12. Deformation effects in rock massifs and their long-term monitoring

    Czech Academy of Sciences Publication Activity Database

    Košťák, Blahoslav

    2006-01-01

    Roč. 39, č. 3 (2006), s. 249-258. ISSN 1470-9236 R&D Projects: GA MŠk(CZ) OC 625.10 Institutional research plan: CEZ:AV0Z30460519 Keywords : anchors * extensometers * monitoring Subject RIV: DO - Wilderness Conservation Impact factor: 0.778, year: 2006

  13. Association of variants in the PCSK1 gene with obesity in the EPIC-Norfolk study

    DEFF Research Database (Denmark)

    Oskari Kilpeläinen, Tuomas; Bingham, Sheila A; Khaw, Kay-Tee; Wareham, Nicholas J; Loos, Ruth J F

    2009-01-01

    -based cohort consisting of 20 249 individuals of European descent from Norfolk, UK. Logistic regression and generalized linear models were used to test the associations of the risk alleles with obesity and related quantitative traits, respectively. Neither of the SNPs was significantly associated with obesity...

  14. Intergenerational Relationships in Cross-Cultural Comparison: How Social Networks Frame Intergenerational Relations between Mothers and Grandmothers in Japan, Korea, China, Indonesia, Israel, Germany, and Turkey

    Science.gov (United States)

    Nauck, Bernhard; Suckow, Jana

    2006-01-01

    The article explores the relevance of intergenerational relationships within the overall network of young mothers and grandmothers in seven societies: Japan, Korea, China, Indonesia, Turkey, Israel, and Germany. The empirical base is 2,945 named network members in 249 pairs of interviews of grandmothers and their daughters from a cross-cultural…

  15. 17 CFR 239.13 - Form S-3, for registration under the Securities Act of 1933 of securities of certain issuers...

    Science.gov (United States)

    2010-04-01

    ... on the same registration statement as are the guaranteed non-convertible securities. (d) Automatic... amendment pursuant to Rule 413(b) (§ 230.413(b) of this chapter); and (5) An automatic shelf registration... statements were included in the registrant's latest filing on Form 20-F (17 CFR 249.220f). In complying...

  16. Accumulation of Ag and Cu in Amanita strobiliformis and characterization of its Cu and Ag uptake transporter genes AsCTR2 and AsCTR3

    Czech Academy of Sciences Publication Activity Database

    Beneš, V.; Hložková, K.; Matěnová, M.; Borovička, Jan; Kotrba, P.

    2016-01-01

    Roč. 29, č. 2 (2016), s. 249-264. ISSN 0966-0844 R&D Projects: GA ČR(CZ) GAP504/11/0484 Institutional support: RVO:61389005 Keywords : heavy metals * metal uptake * Metallothionein * copper transporter protein family * Ectomycorrhizal fungi Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 2.503, year: 2014

  17. Accumulation of Ag and Cu in Amanita strobiliformis and characterization of its Cu and Ag uptake transporter genes AsCTR2 and AsCTR3

    Czech Academy of Sciences Publication Activity Database

    Beneš, V.; Hložková, K.; Matěnová, M.; Borovička, Jan; Kotrba, P.

    2016-01-01

    Roč. 29, č. 2 (2016), s. 249-264. ISSN 0966-0844 Institutional support: RVO:67985831 Keywords : Copper transporter protein family * Ectomycorrhizal fungi * heavy metals * metal uptake * metallothionein Subject RIV: CE - Biochemistry Impact factor: 2.503, year: 2014

  18. Quasi-linear heating and acceleration in bi-Maxwellian plasmas

    Czech Academy of Sciences Publication Activity Database

    Hellinger, Petr; Passot, T.; Sulem, P. L.; Trávníček, Pavel M.

    2013-01-01

    Roč. 20, č. 12 (2013), 122306/1-122306/6. ISSN 1070-664X Institutional support: RVO:68378289 Keywords : plasma electromagnetic waves * plasma nonlinear phenomena * diffusion Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 2.249, year: 2013 http://scitation.aip.org/content/aip/journal/pop/20/12/10.1063/1.4846955

  19. Effect of disorder on spin and charge excitations in the FQHE

    Czech Academy of Sciences Publication Activity Database

    Výborný, Karel; Müller, Ch.; Dethlefsen, A.F.; Haug, R.J.; Wójs, A.

    2007-01-01

    Roč. 112, č. 2 (2007), s. 249-254. ISSN 0587-4246 R&D Projects: GA AV ČR KAN400100652 Institutional research plan: CEZ:AV0Z10100521 Keywords : disorder * activated transport * gap * fractional quantum Hall effect Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.340, year: 2007

  20. Sex Differences in the Expression of Depression in Adolescents.

    Science.gov (United States)

    Baron, Pierre; Joly, Elisabeth

    1988-01-01

    Examination of 249 Quebec adolescents on the Beck Depression Inventory (BDI) revealed in 67.8 percent of the cases that depressed males show a symptomatology characterized by irritability, work inhibition, social withdrawal and sleep disturbance. Depressed females present symptoms characterized by body image distortion, weight loss, loss of…