WorldWideScience

Sample records for californium 249

  1. Californium-252 progress, report No. 7, April 1971

    Energy Technology Data Exchange (ETDEWEB)

    1971-12-31

    This report contains discusses of the following topics on Californium-252: First sales of californium-252; encapsulation services discussed; three new participants in market evaluation program; summer training programs to use californium; Californium-252 shipping casks available; Californium-252 questions and answers, radiotherapy; neutron radiography; natural resources exploration; nuclear safeguards; process control; dosimetry; neutron radiography; neutron shielding; and nuclear safeguards.

  2. Historical review of californium-252 discovery and development

    Science.gov (United States)

    Stoddard, D. H.

    This paper discusses the discovery and history of californium 252. This isotope may be synthesized by irradiating plutonium 239, plutonium 242, americium 243, or curium 244 with neutrons in a nuclear reactor. Various experiments and inventions involving (252)Cf conducted at the Savannah River Plant are discussed. The evolution of radiotherapy using californium 252 is reviewed.

  3. Californium-252: a remarkable versatile radioisotope

    Energy Technology Data Exchange (ETDEWEB)

    Osborne-Lee, I.W.; Alexander, C.W.

    1995-10-10

    A product of the nuclear age, Californium-252 ({sup 252}Cf) has found many applications in medicine, scientific research, industry, and nuclear science education. Californium-252 is unique as a neutron source in that it provides a highly concentrated flux and extremely reliable neutron spectrum from a very small assembly. During the past 40 years, {sup 252}Cf has been applied with great success to cancer therapy, neutron radiography of objects ranging from flowers to entire aircraft, startup sources for nuclear reactors, fission activation for quality analysis of all commercial nuclear fuel, and many other beneficial uses, some of which are now ready for further growth. Californium-252 is produced in the High Flux Isotope Reactor (HFIR) and processed in the Radiochemical Engineering Development Center (REDC), both of which are located at the Oak Ridge National Laboratory (ORNL) in Oak Ridge, Tennessee. The REDC/HFIR facility is virtually the sole supplier of {sup 252}Cf in the western world and is the major supplier worldwide. Extensive exploitation of this product was made possible through the {sup 252}Cf Market Evaluation Program, sponsored by the United States Department of Energy (DOE) [then the Atomic Energy Commission (AEC) and later the Energy Research and Development Administration (ERDA)]. This program included training series, demonstration centers, seminars, and a liberal loan policy for fabricated sources. The Market Evaluation Program was instituted, in part, to determine if large-quantity production capability was required at the Savannah River Laboratory (SRL). Because of the nature of the product and the means by which it is produced, {sup 252}Cf can be produced only in government-owned facilities. It is evident at this time that the Oak Ridge research facility can meet present and projected near-term requirements. The production, shipment, and sales history of {sup 252}Cf from ORNL is summarized herein.

  4. Production, Distribution, and Applications of Californium-252 Neutron Sources

    Energy Technology Data Exchange (ETDEWEB)

    Balo, P.A.; Knauer, J.B.; Martin, R.C.

    1999-10-03

    The radioisotope {sup 252}Cf is routinely encapsulated into compact, portable, intense neutron sources with a 2.6-year half-life. A source the size of a person's little finger can emit up to 10{sup 11} neutrons/s. Californium-252 is used commercially as a reliable, cost-effective neutron source for prompt gamma neutron activation analysis (PGNAA) of coal, cement, and minerals, as well as for detection and identification of explosives, laud mines, and unexploded military ordnance. Other uses are neutron radiography, nuclear waste assays, reactor start-up sources, calibration standards, and cancer therapy. The inherent safety of source encapsulations is demonstrated by 30 years of experience and by U.S. Bureau of Mines tests of source survivability during explosions. The production and distribution center for the U. S Department of Energy (DOE) Californium Program is the Radiochemical Engineering Development Center (REDC) at Oak Ridge National Laboratory (ORNL). DOE sells The radioisotope {sup 252}Cf is routinely encapsulated into compact, portable, intense neutron sources with a 2.6- year half-life. A source the size of a person's little finger can emit up to 10 neutrons/s. Californium-252 is used commercially as a reliable, cost-effective neutron source for prompt gamma neutron activation analysis (PGNAA) of coal, cement, and minerals, as well as for detection and identification of explosives, laud mines, and unexploded military ordnance. Other uses are neutron radiography, nuclear waste assays, reactor start-up sources, calibration standards, and cancer therapy. The inherent safety of source encapsulations is demonstrated by 30 years of experience and by U.S. Bureau of Mines tests of source survivability during explosions. The production and distribution center for the U. S Department of Energy (DOE) Californium Program is the Radiochemical Engineering Development Center (REDC) at Oak Ridge National Laboratory(ORNL). DOE sells {sup 252}Cf to commercial

  5. 46 CFR 249.11 - Confidentiality.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 8 2010-10-01 2010-10-01 false Confidentiality. 249.11 Section 249.11 Shipping MARITIME... UNDERWRITERS FOR MARINE HULL INSURANCE § 249.11 Confidentiality. (a) If the data submitted under this rule... for confidentiality at the time of any request for production of information under the FOIA by third...

  6. 7 CFR 249.15 - Closeout procedures.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Closeout procedures. 249.15 Section 249.15 Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS SENIOR FARMERS' MARKET NUTRITION PROGRAM (SFMNP) State Agency Provisions § 249...

  7. 7 CFR 249.7 - Nondiscrimination.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Nondiscrimination. 249.7 Section 249.7 Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS SENIOR FARMERS' MARKET NUTRITION PROGRAM (SFMNP) Participant Eligibility § 249...

  8. 7 CFR 249.13 - Program income.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Program income. 249.13 Section 249.13 Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS SENIOR FARMERS' MARKET NUTRITION PROGRAM (SFMNP) State Agency Provisions § 249...

  9. 7 CFR 249.26 - SFMNP information.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false SFMNP information. 249.26 Section 249.26 Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS SENIOR FARMERS' MARKET NUTRITION PROGRAM (SFMNP) Miscellaneous Provisions § 249...

  10. 32 CFR 249.6 - Responsibilities.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false Responsibilities. 249.6 Section 249.6 National Defense Department of Defense (Continued) OFFICE OF THE SECRETARY OF DEFENSE (CONTINUED) MISCELLANEOUS PRESENTATION OF DoD-RELATED SCIENTIFIC AND TECHNICAL PAPERS AT MEETINGS § 249.6 Responsibilities. (a) The Under...

  11. 25 CFR 249.3 - Identification cards.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Identification cards. 249.3 Section 249.3 Indians BUREAU... General Provisions § 249.3 Identification cards. (a) The Commissioner of Indian Affairs shall arrange for the issuance of an appropriate identification card to any Indian entitled thereto as prima facie...

  12. Unusual structure, bonding and properties in a californium borate

    Energy Technology Data Exchange (ETDEWEB)

    Polinski, Matthew J.; Garner, Edward B.; Maurice, Rémi; Planas, Nora; Stritzinger, Jared T.; Parker, T. Gannon; Cross, Justin N.; Green, Thomas D.; Alekseev, Evgeny V.; Van Cleve, Shelley M.; Depmeier, Wulf; Gagliardi, Laura; Shatruk, Michael; Knappenberger, Kenneth L.; Liu, Guokui; Skanthakumar, S.; Soderholm, Lynda; Dixon, David A.; Albrecht-Schmitt, Thomas E.

    2014-03-23

    The participation of the valence orbitals of actinides in bonding has been debated for decades. Recent experimental and computational investigations demonstrated the involvement of 6p, 6d and/or 5f orbitals in bonding. However, structural and spectroscopic data, as well as theory, indicate a decrease in covalency across the actinide series, and the evidence points to highly ionic, lanthanide-like bonding for late actinides. Here we show that chemical differentiation between californium and lanthanides can be achieved by using ligands that are both highly polarizable and substantially rearrange on complexation. A ligand that suits both of these desired properties is polyborate. We demonstrate that the 5f, 6d and 7p orbitals are all involved in bonding in a Cf(III) borate, and that large crystal-field effects are present. Synthetic, structural and spectroscopic data are complemented by quantum mechanical calculations to support these observations.

  13. Biomedical neutron research at the Californium User Facility for neutron science

    Energy Technology Data Exchange (ETDEWEB)

    Martin, R.C. [Oak Ridge National Lab., TN (United States); Byrne, T.E. [Roane State Community College, Harriman, TN (United States); Miller, L.F. [Univ. of Tennessee, Knoxville, TN (United States)

    1997-04-01

    The Californium User Facility for Neutron Science has been established at Oak Ridge National Laboratory (ORNL). The Californium User Facility (CUF) is a part of the larger Californium Facility, which fabricates and stores compact {sup 252}Cf neutron sources for worldwide distribution. The CUF can provide a cost-effective option for research with {sup 252}Cf sources. Three projects at the CUF that demonstrate the versatility of {sup 252}Cf for biological and biomedical neutron-based research are described: future establishment of a {sup 252}Cf-based neutron activation analysis system, ongoing work to produce miniature high-intensity, remotely afterloaded {sup 252}Cf sources for tumor therapy, and a recent experiment that irradiated living human lung cancer cells impregnated with experimental boron compounds to test their effectiveness for boron neutron capture therapy.

  14. 48 CFR 5452.249 - Allocation.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 7 2010-10-01 2010-10-01 false Allocation. 5452.249 Section 5452.249 Federal Acquisition Regulations System DEFENSE LOGISTICS AGENCY, DEPARTMENT OF DEFENSE... contemplated and the contract amount is expected to exceed the small purchase limitation. Allocation (DFSC 1995...

  15. 7 CFR 249.9 - Nutrition education.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Nutrition education. 249.9 Section 249.9 Agriculture... Nutrition education. (a) Goal. Nutrition education shall emphasize the relationship of proper nutrition to... agency shall integrate nutrition education into SFMNP operations and may satisfy nutrition education...

  16. 7 CFR 249.18 - Audits.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Audits. 249.18 Section 249.18 Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS SENIOR FARMERS' MARKET NUTRITION PROGRAM (SFMNP) Monitoring and Review of State...

  17. 7 CFR 249.19 - Investigations.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Investigations. 249.19 Section 249.19 Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS SENIOR FARMERS' MARKET NUTRITION PROGRAM (SFMNP) Monitoring and Review of State...

  18. 7 CFR 945.249 - Assessment rate.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 8 2010-01-01 2010-01-01 false Assessment rate. 945.249 Section 945.249 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Marketing Agreements and Orders; Fruits, Vegetables, Nuts), DEPARTMENT OF AGRICULTURE IRISH POTATOES GROWN IN CERTAIN DESIGNATED COUNTIES IN IDAHO, AND MALHEUR...

  19. 7 CFR 249.4 - State Plan.

    Science.gov (United States)

    2010-01-01

    ... Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS SENIOR FARMERS' MARKET NUTRITION PROGRAM (SFMNP) State Agency Eligibility § 249..., and/or nutrition education, as required in § 249.3(d). (2) A description of the State agency's...

  20. 27 CFR 44.249 - Lottery features.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 2 2010-04-01 2010-04-01 false Lottery features. 44.249... Requirements § 44.249 Lottery features. No certificate, coupon, or other device purporting to be or to represent a ticket, chance, share, or an interest in, or dependent on, the event of a lottery shall be...

  1. Dicty_cDB: SLB249 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLB249 (Link to dictyBase) - - - Contig-U16455-1 SLB249Z (Link... to Original site) - - SLB249Z 727 - - - - Show SLB249 Library SL (Link to library) Clone ID SLB249 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLB2-C/SLB249Q.Seq.d/ Representative seq. ID SLB24...9Z (Link to Original site) Representative DNA sequence >SLB249 (SLB249Q) /CSM/SL/SLB2-C/SLB249Q.Seq.d/ XXXXX...NA Score E Sequences producing significant alignments: (bits) Value SLB249 (SLB249Q) /CSM/SL/SLB2-C/SLB249Q.

  2. Apparatus for the measurement of total body nitrogen using prompt neutron activation analysis with californium-252.

    Science.gov (United States)

    Mackie, A; Hannan, W J; Smith, M A; Tothill, P

    1988-01-01

    Details of clinical apparatus designed for the measurement of total body nitrogen (as an indicator of body protein), suitable for the critically ill, intensive-care patient are presented. Californium-252 radio-isotopic neutron sources are used, enabling a nitrogen measurement by prompt neutron activation analysis to be made in 40 min with a precision of +/- 3.2% for a whole body dose equivalent of 0.145 mSv. The advantages of Californium-252 over alternative neutron sources are discussed. A comparison between two irradiation/detection geometries is made, leading to an explanation of the geometry adopted for the apparatus. The choice of construction and shielding materials to reduce the count rate at the detectors and consequently to reduce the pile-up contribution to the nitrogen background is discussed. Salient features of the gamma ray spectroscopy system to reduce spectral distortion from pulse pile-up are presented.

  3. Safety Analysis Report for Packaging (SARP) of the Oak Ridge National Laboratory TRU Californium Shipping Container

    Energy Technology Data Exchange (ETDEWEB)

    Box, W.D.; Shappert, L.B.; Seagren, R.D.; Klima, B.B.; Jurgensen, M.C.; Hammond, C.R.; Watson, C.D.

    1980-01-01

    An analytical evaluation of the Oak Ridge National Laboratory TRU Californium Shipping Container was made in order to demonstrate its compliance with the regulations governing off-site shipment of packages that contain radioactive material. The evaluation encompassed five primary categories: structural integrity, thermal resistance, radiation shielding, nuclear criticality safety, and quality assurance. The results of this evaluation demonstrate that the container complies with the applicable regulations.

  4. 7 CFR 249.12 - SFMNP costs.

    Science.gov (United States)

    2010-01-01

    ... Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS SENIOR FARMERS' MARKET NUTRITION PROGRAM (SFMNP) State Agency Provisions § 249...-up; (2) The costs associated with the provision of nutrition education that meets the requirements of...

  5. 7 CFR 249.3 - Administration.

    Science.gov (United States)

    2010-01-01

    ... Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS SENIOR FARMERS' MARKET NUTRITION PROGRAM (SFMNP) General § 249.3 Administration...' Market Nutrition Program (FMNP), one consolidated State Plan may be submitted for both programs, in...

  6. 7 CFR 249.25 - Other provisions.

    Science.gov (United States)

    2010-01-01

    ... Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS SENIOR FARMERS' MARKET NUTRITION PROGRAM (SFMNP) Miscellaneous Provisions § 249... (7 U.S.C. 2011, et seq.) and to any other Federal or State food or nutrition assistance program. (b...

  7. 46 CFR 249.5 - Eligibility criteria.

    Science.gov (United States)

    2010-10-01

    ... without further consideration, provided that the ILU member company actually underwriting the risk... risk prescribed in § 249.8. Parent companies or affiliates of the ILU member companies are treated as...'s Insurance Reports, and the amount of insurance does not exceed the limitation on risk prescribed...

  8. 7 CFR 249.11 - Financial management system.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Financial management system. 249.11 Section 249.11... § 249.11 Financial management system. (a) Disclosure of expenditures. The State agency must maintain a financial management system that provides accurate, current and complete disclosure of the financial status...

  9. 7 CFR 249.27 - OMB Control Number.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false OMB Control Number. 249.27 Section 249.27 Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS SENIOR FARMERS' MARKET NUTRITION PROGRAM (SFMNP) Miscellaneous Provisions § 249...

  10. 7 CFR 58.249 - Instant nonfat dry milk.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Instant nonfat dry milk. 58.249 Section 58.249... Products Bearing Usda Official Identification § 58.249 Instant nonfat dry milk. (a) Only instant nonfat dry milk manufactured and packaged in accordance with the requirements of this part and with the applicable...

  11. 7 CFR 249.5 - Selection of new State agencies.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Selection of new State agencies. 249.5 Section 249.5 Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS SENIOR FARMERS' MARKET NUTRITION PROGRAM (SFMNP) State Agency Eligibility...

  12. 7 CFR 249.20 - Claims and penalties.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Claims and penalties. 249.20 Section 249.20 Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS SENIOR FARMERS' MARKET NUTRITION PROGRAM (SFMNP) Miscellaneous Provisions...

  13. 48 CFR 249.110 - Settlement negotiation memorandum.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Settlement negotiation... Settlement negotiation memorandum. Follow the procedures at PGI 249.110 for preparation of a settlement negotiation memorandum. ...

  14. Application of TSH bioindicator for studying the biological efficiency of neutrons from californium-252 source

    Energy Technology Data Exchange (ETDEWEB)

    Cebulska-Wasilewska, A.; Rekas, K. [Institute of Nuclear Physics, Cracow (Poland); Kim, J.K. [Korea Atomic Energy Research Inst., Taejon (Korea, Republic of)

    1997-12-31

    The effectiveness of neutrons from a Californium-252 source in the induction of various abnormalities in the Tradescantia clone 4430 stamen hair cells (TSH-assay) was studied. The special attention was paid to check whether any enhancement in effects caused by process of boron neutron capture is visible in the cells enriched with boron ions. Two chemicals (borax and BSH) were applied to introduce boron-10 ions into cells. Inflorescence, normal or pretreated with chemicals containing boron, were irradiated in the air with neutrons from a Cf-252 source at KAERI, Taejon, Korea. To estimate the relative biological effectiveness (RBE) in the induction of gene mutations of the neutron beam under the study, Tradescantia inflorescences, without any chemical pretreatment, were irradiated with various doses of X-rays. The ranges of radiation doses used were 0-0.1 Gy in neutrons and 0-0.5 Gy in X-rays. After the time needed to complete the postirradiation repair Tradescantia cuttings were transferred to Cracow, where screening of gene and lethal; mutations, cell cycle alterations in somatic cells have been done, and dose response relationships were figured. The maximal RBE values were estimated in the range of 4.6-6.8. Alterations of RBE value were observed; from 6.8 to 7.8 in the case of plants pretreated with 240 ppm of B-10 from borax, and 4.6 to 6.1 in the case of 400 ppm of B-10 from BSH. Results showed a slight, although statistically insignificant increase in biological efficacy of radiation from the Cf-252 source in samples pretreated with boron containing chemicals. (author)

  15. Study of the shielding for spontaneous fission sources of Californium-252; Estudio de blindaje para fuentes de fision espontanea de Californio-252

    Energy Technology Data Exchange (ETDEWEB)

    Davila R, I

    1991-06-15

    A shielding study is made to attenuate, until maximum permissible levels, the neutrons radiation and photons emitted by spontaneous fission coming from a source of Californium-252. The compound package by a database (Library DLC-23) and the ANISNW code is used, in it version for personal computer. (Author)

  16. 7 CFR 249.1 - General purpose and scope.

    Science.gov (United States)

    2010-01-01

    ... Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS SENIOR FARMERS' MARKET NUTRITION PROGRAM (SFMNP) General § 249.1 General... carry out the Senior Farmers' Market Nutrition Program (SFMNP). The purposes of the SFMNP are to: (1...

  17. 7 CFR 249.21 - Procurement and property management.

    Science.gov (United States)

    2010-01-01

    ... 249.21 Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS SENIOR FARMERS' MARKET NUTRITION PROGRAM (SFMNP... evaluation, or other matters of a contractual nature. Matters concerning violation of law are to be referred...

  18. Simulation and design of an electron beam ion source charge breeder for the californium rare isotope breeder upgrade

    Directory of Open Access Journals (Sweden)

    Clayton Dickerson

    2013-02-01

    Full Text Available An electron beam ion source (EBIS will be constructed and used to charge breed ions from the californium rare isotope breeder upgrade (CARIBU for postacceleration into the Argonne tandem linear accelerator system (ATLAS. Simulations of the EBIS charge breeder performance and the related ion transport systems are reported. Propagation of the electron beam through the EBIS was verified, and the anticipated incident power density within the electron collector was identified. The full normalized acceptance of the charge breeder with a 2 A electron beam, 0.024π  mm mrad for nominal operating parameters, was determined by simulating ion injection into the EBIS. The optics of the ion transport lines were carefully optimized to achieve well-matched ion injection, to minimize emittance growth of the injected and extracted ion beams, and to enable adequate testing of the charge bred ions prior to installation in ATLAS.

  19. Extraction of Trivalent Actinides and Lanthanides from Californium Campaign Rework Solution Using TODGA-based Solvent Extraction System

    Energy Technology Data Exchange (ETDEWEB)

    Benker, Dennis [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Delmau, Laetitia Helene [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Dryman, Joshua Cory [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States)

    2017-07-01

    This report presents the studies carried out to demonstrate the possibility of quantitatively extracting trivalent actinides and lanthanides from highly acidic solutions using a neutral ligand-based solvent extraction system. These studies stemmed from the perceived advantage of such systems over cationexchange- based solvent extraction systems that require an extensive feed adjustment to make a low-acid feed. The targeted feed solutions are highly acidic aqueous phases obtained after the dissolution of curium targets during a californium (Cf) campaign. Results obtained with actual Cf campaign solutions, but highly diluted to be manageable in a glove box, are presented, followed by results of tests run in the hot cells with Cf campaign rework solutions. It was demonstrated that a solvent extraction system based on the tetraoctyl diglycolamide molecule is capable of quantitatively extracting trivalent actinides from highly acidic solutions. This system was validated using actual feeds from a Cf campaign.

  20. Beyond Californium-A Neutron Generator Alternative for Dosimetry and Instrument Calibration in the U.S.

    Science.gov (United States)

    Piper, Roman K; Mozhayev, Andrey V; Murphy, Mark K; Thompson, Alan K

    2017-09-01

    Evaluations of neutron survey instruments, area monitors, and personal dosimeters rely on reference neutron radiations, which have evolved from the heavy reliance on (α,n) sources to a shared reliance on (α,n) and the spontaneous fission neutrons of californium-252 (Cf). Capable of producing high dose equivalent rates from an almost point source geometry, the characteristics of Cf are generally more favorable when compared to the use of (α,n) and (γ,n) sources or reactor-produced reference neutron radiations. Californium-252 is typically used in two standardized configurations: unmoderated, to yield a fission energy spectrum; or with the capsule placed within a heavy-water moderating sphere to produce a softened spectrum that is generally considered more appropriate for evaluating devices used in nuclear power plant work environments. The U.S. Department of Energy Cf Loan/Lease Program, a longtime origin of affordable Cf sources for research, testing and calibration, was terminated in 2009. Since then, high-activity sources have become increasingly cost-prohibitive for laboratories that formerly benefited from that program. Neutron generators, based on the D-T and D-D fusion reactions, have become economically competitive with Cf and are recognized internationally as important calibration and test standards. Researchers from the National Institute of Standards and Technology and the Pacific Northwest National Laboratory are jointly considering the practicality and technical challenges of implementing neutron generators as calibration standards in the U.S. This article reviews the characteristics of isotope-based neutron sources, possible isotope alternatives to Cf, and the rationale behind the increasing favor of electronically generated neutron options. The evaluation of a D-T system at PNNL has revealed characteristics that must be considered in adapting generators to the task of calibration and testing where accurate determination of a dosimetric quantity is

  1. Californium-252 Brachytherapy Combined With External-Beam Radiotherapy for Cervical Cancer: Long-Term Treatment Results

    Energy Technology Data Exchange (ETDEWEB)

    Lei Xin; Qian Chengyuan; Qing Yi; Zhao Kewei; Yang Zhengzhou; Dai Nan; Zhong Zhaoyang; Tang Cheng; Li Zheng; Gu Xianqing; Zhou Qian; Feng Yan; Xiong Yanli; Shan Jinlu [Cancer Center, Research Institute of Surgery and Daping Hospital, Third Military Medical University, Chongqing (China); Wang Dong, E-mail: dongwang64@hotmail.com [Cancer Center, Research Institute of Surgery and Daping Hospital, Third Military Medical University, Chongqing (China)

    2011-12-01

    Purpose: To observe, by retrospective analysis, the curative effects and complications due to californium-252 ({sup 252}Cf) neutron intracavitary brachytherapy (ICBT) combined with external-beam radiotherapy (EBRT) in the treatment of cervical cancer. Methods and Materials: From February 1999 to December 2007, 696 patients with cervical cancer (Stages IB to IIIB) were treated with {sup 252}Cf-ICBT in combination of EBRT. Of all, 31 patients were at Stage IB, 104 at IIA, 363 at IIB, 64 at IIIA, and 134 at IIIB. Californium-252 ICBT was delivered at 7-12 Gy per insertion per week, with a total dose of 29-45 Gy to reference point A in three to five insertions. The whole pelvic cavity was treated with 8-MV X-ray external irradiation at 2 Gy per fraction, four times per week. After 16-38 Gy of external irradiation, the center of the whole pelvic field was blocked with a 4-cm-wide lead shield, with a total external irradiation dose of 44-56 Gy. The total treatment course was 5 to 6 weeks. Results: Overall survival rate at 3 and 5 years for all patients was 76.0% and 64.9%, respectively. Disease-free 3- and 5-year survival rates of patients were 71.2% and 58.4%, respectively. Late complications included vaginal contracture and adhesion, radiation proctitis, radiation cystitis, and inflammatory bowel, which accounted for 5.8%, 7.1%, 6.2%, and 4.9%, respectively. Univariate analysis results showed significant correlation of stage, age, histopathologic grade, and lymph node status with overall survival. Cox multiple regression analysis showed that the independent variables were stage, histopathologic grade, tumor size, and lymphatic metastasis in all patients. Conclusion: Results of this series suggest that the combined use of {sup 252}Cf-ICBT with EBRT is an effective method for treatment of cervical cancer.

  2. 17 CFR 249.10 - Form 1-N for notice registration as a national securities exchange.

    Science.gov (United States)

    2010-04-01

    ... registration as a national securities exchange. 249.10 Section 249.10 Commodity and Securities Exchanges... or Exemption of, and Notification of Action Taken by, National Securities Exchanges § 249.10 Form 1-N for notice registration as a national securities exchange. This form shall be used for notice, and...

  3. 48 CFR 52.249-7 - Termination (Fixed-Price Architect-Engineer).

    Science.gov (United States)

    2010-10-01

    ... Architect-Engineer). 52.249-7 Section 52.249-7 Federal Acquisition Regulations System FEDERAL ACQUISITION... Clauses 52.249-7 Termination (Fixed-Price Architect-Engineer). As prescribed in 49.503(b), insert the following clause in solicitations and contracts for architect-engineer services when a fixed-price contract...

  4. 17 CFR 249.331 - Form N-CSR, certified shareholder report.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Form N-CSR, certified shareholder report. 249.331 Section 249.331 Commodity and Securities Exchanges SECURITIES AND EXCHANGE... Required Under Sections 13 and 15(d) of the Securities Exchange Act of 1934 § 249.331 Form N-CSR, certified...

  5. 27 CFR 24.249 - Experimentation with new treating material or process.

    Science.gov (United States)

    2010-04-01

    ... treating material or process. 24.249 Section 24.249 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY LIQUORS WINE Storage, Treatment and Finishing of Wine § 24.249 Experimentation with new treating material or process. (a) General. The proprietor may...

  6. 7 CFR 249.22 - Nonprocurement debarment/suspension, drug-free workplace, and lobbying restrictions.

    Science.gov (United States)

    2010-01-01

    ... Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS SENIOR FARMERS' MARKET NUTRITION PROGRAM (SFMNP) Miscellaneous Provisions § 249.22 Nonprocurement debarment...

  7. Long-term effects of an intracavitary treatment with californium-252 on normal tissue. [Swine, /sup 226/Ra

    Energy Technology Data Exchange (ETDEWEB)

    Sullivan, M.F.; Beamer, J.L.; Mahony, T.D.; Cross, F.T.; Lund, J.E.; Endres, G.W.R.

    1976-01-01

    About one hundred fifty swine were exposed to either radium-226 or californium-252 sources in the uterine cervix to determine an RBE for both acute and long-term effects. That value for early changes in the tissues at risk in the treatment of cervical cancer was between 6.2 and 6.8. The incidence of complications increased with time after exposure, especially among animals treated with /sup 252/Cf. Analysis of rectal injury showed that ulceration occurred frequently within a year postexposure at doses between 1600 and 2400 rad calculated at 2 cm lateral to the source midline. Fat necrosis and smooth muscle atrophy, resulting in a local rectal stricture, were delayed changes observed in some animals. The lower ureter was the site for a greater frequency of complications than the GI tract. Ureteral stricture often occurred at doses of 1200 rad from /sup 252/Cf and 7000 rad from /sup 226/Ra. Observation of delayed effects in the uterine-cervix in animals held up to 4 years postexposure indicate that the RBE for /sup 252/Cf may be increased to a value as high as 18, while repair may have even decreased it to about 5.6 in the rectum. Fifty swine are still being observed for long-term effects after doses above 800 rad from /sup 252/Cf and 5000 rad from /sup 226/Ra.

  8. 14 CFR 249.8 - Premature loss or destruction of records.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Premature loss or destruction of records. 249.8 Section 249.8 Aeronautics and Space OFFICE OF THE SECRETARY, DEPARTMENT OF TRANSPORTATION... Premature loss or destruction of records. If records are destroyed or lost before the expiration of the...

  9. 7 CFR 249.16 - Administrative appeal of State agency decisions.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Administrative appeal of State agency decisions. 249.16 Section 249.16 Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS SENIOR FARMERS' MARKET NUTRITION...

  10. 7 CFR 249.14 - Distribution of funds to State agencies.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Distribution of funds to State agencies. 249.14 Section 249.14 Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS SENIOR FARMERS' MARKET NUTRITION PROGRAM...

  11. Ab initio full-potential study of mechanical properties and magnetic phase stability of californium monopnictides (CfN and CfP)

    Energy Technology Data Exchange (ETDEWEB)

    Amari, S., E-mail: siham_amari@yahoo.fr [Faculté des Sciences de la Nature et de la Vie, Université Hassiba Benbouali, Chlef, 02000 (Algeria); Bouhafs, B. [Laboratoire de Modélisation et Simulation en Sciences des Matériaux, Université Djillali Liabès de Sidi Bel-Abbés, Sidi Bel-Abbés, 22000 (Algeria)

    2016-09-15

    Based on the first-principles methods, the structural, elastic, electronic, properties and magnetic ordering of californium monopnictides CfX (X = P) have been studied using the full-potential augmented plane wave plus local orbitals (FP-L/APW + lo) method within the framework of density functional theory (DFT). The electronic exchange correlation energy is described by generalized gradient approximation GGA and GGA+U (U is the Hubbard correction). The GGA+U method is applied to the rare-earth 5f states. We have calculated the lattice parameters, bulk modulii and the first pressure derivatives of the bulk modulii. The elastic properties of the studied compounds are only investigated in the most stable calculated phase. In order to gain further information, we have calculated Young’s modulus, shear modulus, anisotropy factor and Kleinman parameter by the aid of the calculated elastic constants. The results mainly show that californium monopnictides CfX (X = P) have an antiferromagnetic spin ordering. Density of states (DOS) and charge densities for both compounds are also computed in the NaCl (B1) structure.

  12. 17 CFR 249.330 - Form N-SAR, annual and semi-annual report of certain registered investment companies.

    Science.gov (United States)

    2010-04-01

    ...-annual report of certain registered investment companies. 249.330 Section 249.330 Commodity and... Exchange Act of 1934 § 249.330 Form N-SAR, annual and semi-annual report of certain registered investment...) and the rules and regulations thereunder. Editorial Note: For Federal Register citations affecting...

  13. Low-Dose-Rate Californium-252 Neutron Intracavitary Afterloading Radiotherapy Combined With Conformal Radiotherapy for Treatment of Cervical Cancer

    Energy Technology Data Exchange (ETDEWEB)

    Zhang Min [Department of Oncology, Armed Police Hospital of Hangzhou, Hangzhou, Zhejiang Province (China); Xu Hongde [Cancer Center, Armed Police Hospital of Hangzhou, Hangzhou, Zhejiang Province (China); Pan Songdan; Lin Shan; Yue Jianhua [Department of Oncology, Armed Police Hospital of Hangzhou, Hangzhou, Zhejiang Province (China); Liu Jianren, E-mail: liujianren0571@hotmail.com [Second Affiliated Hospital, School of Medicine, Zhejiang University, Hangzhou, Zhejiang Province (China)

    2012-07-01

    Purpose: To study the efficacy of low-dose-rate californium-252 ({sup 252}Cf) neutron intracavitary afterloading radiotherapy (RT) combined with external pelvic RT for treatment of cervical cancer. Methods and Materials: The records of 96 patients treated for cervical cancer from 2006 to 2010 were retrospectively reviewed. For patients with tumors {<=}4 cm in diameter, external beam radiation was performed (1.8 Gy/day, five times/week) until the dose reached 20 Gy, and then {sup 252}Cf neutron intracavitary afterloading RT (once/week) was begun, and the frequency of external beam radiation was changed to four times/week. For patients with tumors >4 cm, {sup 252}Cf RT was performed one to two times before whole-pelvis external beam radiation. The tumor-eliminating dose was determined by using the depth limit of 5 mm below the mucosa as the reference point. In all patients, the total dose of the external beam radiation ranged from 46.8 to 50 Gy. For {sup 252}Cf RT, the dose delivered to point A was 6 Gy/fraction, once per week, for a total of seven times, and the total dose was 42 Gy. Results: The mean {+-} SD patient age was 54.7 {+-} 13.7 years. Six patients had disease assessed at stage IB, 13 patients had stage IIA, 49 patients had stage IIB, 3 patients had stage IIIA, 24 patients had stage IIIB, and 1 patient had stage IVA. All patients obtained complete tumor regression (CR). The mean {+-} SD time to CR was 23.5 {+-} 3.4 days. Vaginal bleeding was fully controlled in 80 patients within 1 to 8 days. The mean {+-} SD follow-up period was 27.6 {+-} 12.7 months (range, 6-48 months). Five patients died due to recurrence or metastasis. The 3-year survival and disease-free recurrence rates were 89.6% and 87.5 %, respectively. Nine patients experienced mild radiation proctitis, and 4 patients developed radiocystitis. Conclusions: Low-dose-rate {sup 252}Cf neutron RT combined with external pelvic RT is effective for treating cervical cancer, with a low incidence of

  14. 17 CFR 249.501b - Form BD-N for notice registration as a broker-dealer.

    Science.gov (United States)

    2010-04-01

    ... registration as a broker-dealer. 249.501b Section 249.501b Commodity and Securities Exchanges SECURITIES AND... Connection With Exempt Tender Offers § 249.501b Form BD-N for notice registration as a broker-dealer. This form shall be used for notice of registration as a broker-dealer pursuant to Section 15(b)(11)(A) of...

  15. 7 CFR 249.8 - Level of benefits and eligible foods.

    Science.gov (United States)

    2010-01-01

    ... 249.8 Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS SENIOR FARMERS' MARKET NUTRITION PROGRAM (SFMNP..., as long as that level is consistent for all Senior CSA program participants and does not exceed the...

  16. Study of the high-j states in {sup 249}Cm.

    Energy Technology Data Exchange (ETDEWEB)

    Ahmad, I.

    1998-07-16

    The authors have performed the reaction {sup 248}Cm({sup 4}He, {sup 3}He) using 98.5-MeV alpha particles from the IUCF cyclotron to populate high-j states in {sup 249}Cm. A tentative assignment of the K{sub 17/2} component of the 1/2{sup +}[880] Nilsson state has been made.

  17. 75 FR 69870 - Delegation of Authority Under 18 U.S.C. 249

    Science.gov (United States)

    2010-11-16

    ... 18 U.S.C. 249, relating to hate crimes, to the Assistant Attorney General for the Civil Rights... into law the Matthew Shepard and James Byrd, Jr., Hate Crimes Prevention Act of 2009 (Shepard-Byrd Act). Among other things, the Shepard-Byrd Act created a new federal hate crime statute to be codified at 18 U...

  18. 29 CFR 779.249 - Goods which move or have moved across State lines.

    Science.gov (United States)

    2010-07-01

    ... sells the goods. Thus, if goods have moved across State lines at some stage in the flow of trade before... 29 Labor 3 2010-07-01 2010-07-01 false Goods which move or have moved across State lines. 779.249... STANDARDS ACT AS APPLIED TO RETAILERS OF GOODS OR SERVICES Employment to Which the Act May Apply; Enterprise...

  19. 50 CFR 665.249 - Lobster size and condition restrictions in Permit Area 2.

    Science.gov (United States)

    2010-10-01

    ... 50 Wildlife and Fisheries 9 2010-10-01 2010-10-01 false Lobster size and condition restrictions in... WESTERN PACIFIC Hawaii Fisheries § 665.249 Lobster size and condition restrictions in Permit Area 2. (a) Only spiny lobsters with a carapace length of 8.26 cm or greater may be retained (see Figure 1 to this...

  20. 14 CFR 249.21 - Preservation of records by public charter operators and overseas military personnel charter...

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Preservation of records by public charter operators and overseas military personnel charter operators. 249.21 Section 249.21 Aeronautics and Space... public charter operators and overseas military personnel charter operators. Each operator authorized...

  1. 17 CFR 249.1001 - Form SIP, for application for registration as a securities information processor or to amend such...

    Science.gov (United States)

    2010-04-01

    ... registration as a securities information processor or to amend such an application or registration. 249.1001..., SECURITIES EXCHANGE ACT OF 1934 Form for Registration of, and Reporting by Securities Information Processors § 249.1001 Form SIP, for application for registration as a securities information processor or to amend...

  2. Direct high-precision mass measurements on Am241,243, Pu244, and Cf249

    Science.gov (United States)

    Eibach, M.; Beyer, T.; Blaum, K.; Block, M.; Düllmann, Ch. E.; Eberhardt, K.; Grund, J.; Nagy, Sz.; Nitsche, H.; Nörtershäuser, W.; Renisch, D.; Rykaczewski, K. P.; Schneider, F.; Smorra, C.; Vieten, J.; Wang, M.; Wendt, K.

    2014-06-01

    The absolute masses of four long-lived transuranium nuclides, Am241,243, Pu244, Pu244, and Cf249, in the vicinity of the deformed N =152 neutron shell closure have been measured directly with the Penning-trap mass spectrometer TRIGA-TRAP. Our measurements confirm the AME2012 mass values of Am241,243 and Pu244 within one standard deviation, which were indirectly determined, by decay spectroscopy studies. In the case of the Cf249 mass, a discrepancy of more than three standard deviations has been observed, affecting absolute masses even in the superheavy element region. The implementation of the mass values into the AME2012 network yields a reduced mass uncertainty for 84 nuclides, particularly for Pu244 and its strongly correlated α decay chains.

  3. Numerical simulation and experimental validation of arc welding of DMR-249A steel

    Directory of Open Access Journals (Sweden)

    Rishi Pamnani

    2016-08-01

    Full Text Available The thermo-mechanical attributes of DMR-249A steel weld joints manufactured by shielded metal arc welding (SMAW and activated gas tungsten arc welding (A-GTAW processes were studied using Finite Element Model (FEM simulation. The thermal gradients and residual stresses were analyzed with SYSWELD software using double ellipsoidal heat source distribution model. The numerically estimated temperature distribution was validated with online temperature measurements using thermocouples. The predicted residual stresses profile across the weld joints was compared with the values experimentally measured using non-destructive techniques. The measured and predicted thermal cycles and residual stress profile was observed to be comparable. The residual stress developed in double sided A-GTAW joint were marginally higher in comparison to five pass SMAW joint due to phase transformation associated with high heat input per weld pass for A-GTAW process. The present investigations suggest the applicability of numerical modeling as an effective approach for predicting the thermo-mechanical properties influenced by welding techniques for DMR-249A steel weld joints. The tensile, impact and micro-hardness tests were carried to compare the welds. Considering benefits of high productivity and savings of labor and cost associated with A-GTAW compared to SMAW process, the minor variation in residual stress build up of A-GTAW joint can be neglected to develop A-GTAW as qualified alternative welding technique for DMR-249A steel.

  4. A Possible Dynamically Cold Classical Contact Binary: (126719) 2002 CC249

    Science.gov (United States)

    Thirouin, Audrey; Sheppard, Scott S.

    2017-12-01

    Images of the Kuiper Belt object (126719) 2002 CC249 obtained in 2016 and 2017 using the 6.5 m Magellan-Baade Telescope and the 4.3 m Discovery Channel Telescope are presented. A light curve with a periodicity of 11.87 ± 0.01 hr and a peak-to-peak amplitude of 0.79 ± 0.04 mag is reported. This high amplitude double-peaked light curve can be due to a single elongated body, but it is best explained by a contact binary system from its U-/V-shaped light curve. We present a simple full-width-at-half-maximum test that can be used to determine if an object is likely a contact binary or an elongated object based on its light curve. Considering that 2002 CC249 is in hydrostatic equilibrium, a system with a mass ratio q min = 0.6, and a density ρ min = 1 g cm-3, or less plausible a system with q max = 1, and ρ max = 5 g cm-3 can interpret the light curve. Assuming a single Jacobi ellipsoid in hydrostatic equilibrium and an equatorial view, we estimate ρ ≥ 0.34 g cm-3, and a/b = 2.07. Finally, we report a new color study showing that 2002 CC249 displays an ultra red surface characteristic of a dynamically Cold Classical trans-Neptunian object.

  5. Californium-252 neutron intracavity brachytherapy alone for T1N0 low-lying rectal adenocarcinoma: A definitive anal sphincter-preserving radiotherapy

    Science.gov (United States)

    Xiong, Yanli; Shan, Jinlu; Liu, Jia; Zhao, Kewei; Chen, Shu; Xu, Wenjing; Zhou, Qian; Yang, Mei; Lei, Xin

    2017-01-01

    This study evaluated the 4-year results of 32 patients with T1N0 low-lying rectal adenocarcinoma treated solely with californium-252 (Cf-252) neutron intracavity brachytherapy (ICBT). Patients were solicited into the study from January 2008 to June 2011. All the patients had refused surgery or surgery was contraindicated. The patients were treated with Cf-252 neutron ICBT using a novel 3.5-cm diameter off-axis 4-channel intrarectal applicator designed by the authors. The dose reference point was defined on the mucosa surface, with a total dose of 55–62 Gy-eq/4 f (13–16 Gy-eq/f/wk). All the patients completed the radiotherapy in accordance with our protocol. The rectal lesions regressed completely, and the acute rectal toxicity was mild (≤G2). The 4-year local control, overall survival, disease-free survival, and late complication (≥G2) rates were 96.9%, 90.6%, 87.5% and 15.6%, respectively. No severe late complication (≥G3) occurred. The mean follow-up was 56.1 ± 16.0 months. At the end of last follow-up, 29 patients remained alive. The mean survival time was 82.1 ± 2.7 months. Cf-252 neutron ICBT administered as the sole treatment (without surgery) for patients with T1N0 low-lying rectal adenocarcinoma is effective with acceptable late complications. Our study and method offers a definitive anal sphincter-preserving radiotherapy for T1N0 low-lying rectal adenocarcinoma patients. PMID:28094790

  6. Host competence and helicase activity differences exhibited by West Nile viral variants expressing NS3-249 amino acid polymorphisms.

    Directory of Open Access Journals (Sweden)

    Stanley A Langevin

    Full Text Available A single helicase amino acid substitution, NS3-T249P, has been shown to increase viremia magnitude/mortality in American crows (AMCRs following West Nile virus (WNV infection. Lineage/intra-lineage geographic variants exhibit consistent amino acid polymorphisms at this locus; however, the majority of WNV isolates associated with recent outbreaks reported worldwide have a proline at the NS3-249 residue. In order to evaluate the impact of NS3-249 variants on avian and mammalian virulence, multiple amino acid substitutions were engineered into a WNV infectious cDNA (NY99; NS3-249P and the resulting viruses inoculated into AMCRs, house sparrows (HOSPs and mice. Differential viremia profiles were observed between mutant viruses in the two bird species; however, the NS3-249P virus produced the highest mean peak viral loads in both avian models. In contrast, this avian modulating virulence determinant had no effect on LD50 or the neurovirulence phenotype in the murine model. Recombinant helicase proteins demonstrated variable helicase and ATPase activities; however, differences did not correlate with avian or murine viremia phenotypes. These in vitro and in vivo data indicate that avian-specific phenotypes are modulated by critical viral-host protein interactions involving the NS3-249 residue that directly influence transmission efficiency and therefore the magnitude of WNV epizootics in nature.

  7. Current situation of International Organization for Standardization/Technical Committee 249 international standards of traditional Chinese medicine.

    Science.gov (United States)

    Liu, Yu-Qi; Wang, Yue-Xi; Shi, Nan-Nan; Han, Xue-Jie; Lu, Ai-Ping

    2017-05-01

    To review the current situation and progress of traditional Chinese medicine (TCM) international standards, standard projects and proposals in International Organization for Standardization (ISO)/ technical committee (TC) 249. ISO/TC 249 standards and standard projects on the ISO website were searched and new standard proposals information were collected from ISO/TC 249 National Mirror Committee in China. Then all the available data were summarized in 5 closely related items, including proposed time, proposed country, assigned working group (WG), current stage and classifification. In ISO/TC 249, there were 2 international standards, 18 standard projects and 24 new standard proposals proposed in 2014. These 44 standard subjects increased year by year since 2011. Twenty-nine of them were proposed by China, 15 were assigned to WG 4, 36 were in preliminary and preparatory stage and 8 were categorized into 4 fifields, 7 groups and sub-groups based on International Classifification Standards. A rapid and steady development of international standardization in TCM can be observed in ISO/TC 249.

  8. Rorschach Comprehensive System data for a sample of 249 adult nonpatients from Italy.

    Science.gov (United States)

    Lis, Adriana; Parolin, Laura; Salcuni, Silvia; Zennaro, Alessandro

    2007-01-01

    This project provides information on how Italian adult nonpatients perform on the Rorschach test administered and scored following Rorschach Comprehensive System (CS) guidelines (Exner, 1995). Lis, Zennaro, Calvo, and Salcuni (2001) reported previously initial data for 101 of the nonpatients who were administered this instrument between July 1998 and February 2001 by graduate and postgraduate students in a 2-year research course at the Psychotherapy School of the University of Padua. The current study extends that previous work and includes information on an additional 148 participants gathered between April 2001 and March 2004, for a total of 249 individuals. Exclusion criteria are described and interrater reliability statistics at the response level for scoring segments are reported using both percent of agreement and iota. Comprehensive System findings are presented.

  9. Evaluation of anticancer properties of a new α-methylene-δ-lactone DL-249 on two cancer cell lines

    Directory of Open Access Journals (Sweden)

    Pomorska Dorota K.

    2017-06-01

    Full Text Available The anticancer activity of a new synthetic α-methylene-δ-lactone DL-249 was reported in leukemia HL-60 and breast cancer MCF-7 cells and compared with the activity of a natural α-methylene-γ-lactone from Tanacetum parthenium, parthenolide.

  10. 17 CFR 249.635 - Form X-17A-19, report by national securities exchanges and registered national securities...

    Science.gov (United States)

    2010-04-01

    ... national securities exchanges and registered national securities associations of changes in the membership... Certain Exchange Members, Brokers, and Dealers § 249.635 Form X-17A-19, report by national securities exchanges and registered national securities associations of changes in the membership status of any of...

  11. 17 CFR 249.821 - Form PILOT, information required of self-regulatory organizations operating pilot trading systems...

    Science.gov (United States)

    2010-04-01

    ... required of self-regulatory organizations operating pilot trading systems pursuant to § 240.19b-5 of this... Associations § 249.821 Form PILOT, information required of self-regulatory organizations operating pilot trading systems pursuant to § 240.19b-5 of this chapter. This form shall be used by all self-regulatory...

  12. Association of chemokine receptor CX3CR1 V249I and T280M polymorphisms with chronic kidney disease

    Directory of Open Access Journals (Sweden)

    A K Yadav

    2016-01-01

    Full Text Available The chemokine fractalkine (CX3CL1 and its receptor CX3CR1 are involved in the activation of leukocytes. Two common single-nucleotide polymorphisms of the CX3CR1 gene, V249I and T280M, have been associated with reduced fractalkine signaling, leading to decreased adhesive function and leukocyte chemotaxis. We hypothesized that variation in the CX3CR1 gene could be associated with chronic kidney disease (CKD, a disease of inflammatory activation. We studied the association between CX3CR1 V249I and T280M polymorphisms, and fractalkine and highly sensitive C-reactive protein (hs-CRP levels in 123 patients with CKD and 100 healthy controls (HCs. Genotype analysis was done by polymerase chain reaction-restriction fragment length polymorphism, and fractalkine and hs-CRP levels were analyzed by enzyme-linked immunosorbent assay. MM genotype of T280M was absent in CKD patients, while in controls it was seen in 1% of the individuals. The allele frequencies in both the groups were similar (P = 0.059. Compared to HC, M280M + T280M genotype was more frequent in CKD (P = 0.041. The frequency of II genotype of V249I was 0.8% in CKD, whereas in HC, it was 2%. I249I + V249I genotype was more frequent in CKD as compared to HC (P = 0.034. No difference in allelic frequency of V249I was noted between the two groups (P = 0.061, odds ratios = 1.74, 95% confidence intervals = 0.96–3.12. Plasma fractalkine and serum hs-CRP levels were higher in CKD subjects (P = 0.004 and P 's 0.0001. No association of either genotype was found with fractalkine and hs-CRP levels. Polymorphisms at I249 and M280 genotype in CX3CR1 gene are associated with CKD; however, there was no association of fractalkine or inflammatory marker with these genotypes.

  13. Safety of quadrivalent live attenuated influenza vaccine in subjects aged 2-49years.

    Science.gov (United States)

    Baxter, Roger; Eaton, Abigail; Hansen, John; Aukes, Laurie; Caspard, Herve; Ambrose, Christopher S

    2017-03-01

    Quadrivalent live attenuated influenza vaccine (Q/LAIV) was licensed in 2012 and replaced trivalent live attenuated influenza vaccine in the United States during the 2013-2014 influenza season. This study assessed the safety of Q/LAIV in children and adults aged 2-49years. This was a prospective observational cohort study using data collected from Kaiser Permanente Northern California. Post-vaccination events of interest were any hospitalization, hospitalization for lower respiratory tract infection, and the following medically attended events: hypersensitivity, seizures/convulsions, lower respiratory tract infection, wheezing, Guillain-Barré syndrome, Bell's palsy, encephalitis, neuritis, vasculitis, and narcolepsy/cataplexy. The rates of these events during the risk interval post-vaccination were compared with rates observed during reference periods later in the follow-up (within-cohort analysis) and with rates observed in frequency-matched unvaccinated controls and inactivated influenza vaccine (IIV) recipients. A total of 62,040 eligible Q/LAIV recipients were identified during the 2013-2014 influenza season. Within-cohort comparisons of all Q/LAIV recipients as well as comparisons between Q/LAIV recipients and unvaccinated controls or IIV recipients did not show any significantly higher risk of hospitalizations or medically attended events following administration of Q/LAIV. Additional analyses by setting (clinic visits, emergency department visits, and hospital admissions) and age group (2-4, 5-8, 9-17, and 18-49years) also did not reveal clinically consistent findings that suggested any increased risk after administration of Q/LAIV. In this large population study of individuals aged 2-49years, no safety signals associated with the administration of Q/LAIV were observed. A much larger study population would be needed to confidently reject any association between Q/LAIV and very rare events, specifically those with an incidence of <1 event/10,000 person

  14. Results from the First {sup 249}Cf + {sup 48}Ca Experiment

    Science.gov (United States)

    Oganessian, Y. T.; Utyonkov, V. K.; Lobanov, Y. V.; Abdullin, F. S.; Polyakov, A. N.; Shirokovsky, I. V.; Tsyganov, Y. S.; Mezentsev, A. N.; Iliev, S.; Subbotin, V. G.; Sukhov, A. M.; Ivanov, O. V.; Voinov, A. A.; Subotic, K.; Zagrebaev, V. I.; Itkis, M. G.; Moody, K. J.; Wild, J. F.; Stoyer, M. A.; Stoyer, N. J.; Laue, C. A.; Shaughnessy, D. A.; Patin, J. B.; Lougheed, R. W.

    2003-02-03

    The present paper reports the results of an attempt aimed at the synthesis of element 118 in the reaction {sup 249}Cf({sup 48}Ca,3n){sup 294}118. The experiment was performed employing the Dubna Gas-filled Recoil Separator and the U400 heavy-ion cyclotron at FLNR, JINR, Dubna. In the course of a 2300-hour irradiation of an enriched {sup 249}Cf target (0.23 mg/cm{sup 2}) with a beam of 245-MeV {sup 48}Ca ions, we accumulated a total beam dose of 2.5 x 10{sup 19} ions. We detected two events that may be attributed to the formation and decay of nuclei with Z=118. For one event, we observed a decay chain of two correlated {alpha}-decays with corresponding energies and correlation times of E{sub {alpha}1} = 11.65 {+-} 0.06 MeV, t{sub {alpha}1} = 2.55 ms and E{sub {alpha}2} = 10.71 {+-} 0.17 MeV, t{sub {alpha}2} = 42.1 ms and, finally, a spontaneous fission with the sum of the kinetic energies of the fission fragments E{sub tot} = 207 MeV (TKE {approx} 230 MeV) and t{sub SF} = 0.52 s. In the second event chain, the recoil nucleus decayed into two fission fragments with E{sub tot} = 223 MeV (TKE {approx} 245 MeV) 3.16 ms later, without intervening {alpha} decays. The probabilities that these events were caused by the chance correlations of unrelated signals are negligible. Both events were observed at an excitation energy of the compound nucleus {sup 297}118 of E* = 30.0 {+-} 2.4 MeV, close to the expected maximum of the 3n-evaporation channel. The relationship between the decay energy Q{sub {alpha}} and decay period T{sub {alpha}} shows that sequential {alpha}-transitions in the first event correspond to the decay chain with Z = 118{_}116{_}114. Decay characteristics of the newly observed nuclides are compared with radioactive decay properties of the even-even isotopes with Z = 116, 114 and 112 previously produced in the reactions {sup 244}Pu, {sup 248}Cm + {sup 48}Ca and calculations made in various nuclear models.

  15. Production and decay of the heaviest odd-Z nuclei in the 249Bk + 48Ca reaction

    Science.gov (United States)

    Oganessian, Yu Ts; Abdullin, F. Sh; Alexander, C.; Binder, J.; Boll, R. A.; Dmitriev, S. N.; Ezold, J.; Felker, K.; Gostic, J. M.; Grzywacz, R. K.; Hamilton, J. H.; Henderson, R. A.; Itkis, M. G.; Miernik, K.; Miller, D.; Moody, K. J.; Polyakov, A. N.; Ramayya, A. V.; Roberto, J. B.; Ryabinin, M. A.; Rykaczewski, K. P.; Sagaidak, R. N.; Shaughnessy, D. A.; Shirokovsky, I. V.; Shumeiko, M. V.; Stoyer, M. A.; Stoyer, N. J.; Subbotin, V. G.; Sukhov, A. M.; Tsyganov, Yu S.; Utyonkov, V. K.; Voinov, A. A.; Vostokin, G. K.

    2015-02-01

    The reaction of 249Bk with 48Ca has been investigated with an aim of synthesizing and studying the decay properties of isotopes of the new element 117. The experiments were performed at five projectile energies (in two runs, in 2009-2010 and 2012) and with a total beam dose of 48Ca ions of about 9x1019 The experiments yielded data on a-decay characteristics and excitation functions of the produced nuclei that establish these to be 293117 and 294117 - the products of the 4n- and 3n-evaporation channels, respectively. In total, we have observed 20 decay chains of Z=117 nuclides. The cross sections were measured to be 1.1 pb for the 3n and 2.4 pb for the 4n-reaction channel. The new 289115 events, populated by α decay of 117, demonstrate the same decay properties as those observed for 115 produced in the 243Am(48Ca,2n) reaction thus providing cross-bombardment evidence. In addition, a single decay of 294118 was observed from the reaction with 249Cf - a result of the in-growth of 249Cf in the 249Bk target. The observed decay chain of 294118 is in good agreement with decay properties obtained in 2002-2005 in the experiments with the reaction 249Cf(48Ca,3n)294118. The energies and half-lives of the odd-Z isotopes observed in the 117 decay chains together with the results obtained for lower-Z superheavy nuclei demonstrate enhancement of nuclear stability with increasing neutron number towards the predicted new magic number N=184.

  16. Factors associated with relapse of lupus nephritis: A single center study of 249 cases

    Directory of Open Access Journals (Sweden)

    Meriam Hajji

    2017-01-01

    Full Text Available This is a retrospective cohort study over 20 years (1990–2013 that included all patients with biopsy-proven lupus nephritis (LN followed up at our nephrology department. We aimed to determine the clinicobiologic predictors of flare-up of LN. Flare was defined as an increase in systemic lupus erythematosus (SLE disease activity index (SLEDAI score of at least four points. Clinical manifestations and laboratory parameters were assessed and the SLEDAI score was determined for each patient. We included patients with SLE who fulfilled at least four of the American College of Rheumatology criteria for the classification of SLE. A total of 249 patients including 227 females and 22 males with a median age at diagnosis of 34.32 years (range 16–69 were studied. The mean follow-up duration was 122.4 ± 27 months. Renal symptoms included hypertension in 40%, nephrotic syndrome in 30%, and renal failure in 69.4% of the cases. Class IV and class III nephritis (ISN/RPS were observed in 44.9% and 24% of the patients, respectively. On univariate analysis, flare predictors were age <30 years (P = 0.02, lymphocytopenia (P = 0.002, the presence of diffuse proliferative LN (P = 0.009, and discontinuation of immunosuppressive therapy (P = 0.004. Our study suggests that these markers should be monitored routinely as prognostic parameters in SLE to characterize patients who are at risk and who should be followed more closely.

  17. Californium-252 Program Equipment Evaluation

    Energy Technology Data Exchange (ETDEWEB)

    Chattin, Fred Rhea [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Wilson, Kenton [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Ezold, Julie G. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States)

    2017-12-01

    To successfully continue the 252Cf production and meet the needs of the customers, a comprehensive evaluation of the Building 7920 processing equipment was requested to identify equipment critical to the operational continuity of the program.

  18. Essentials and guidelines for clinical medical physics residency training programs: executive summary of AAPM Report Number 249.

    Science.gov (United States)

    Prisciandaro, Joann I; Willis, Charles E; Burmeister, Jay W; Clarke, Geoffrey D; Das, Rupak K; Esthappan, Jacqueline; Gerbi, Bruce J; Harkness, Beth A; Patton, James A; Peck, Donald J; Pizzutiello, Robert J; Sandison, George A; White, Sharon L; Wichman, Brian D; Ibbott, Geoffrey S; Both, Stefan

    2014-05-08

    There is a clear need for established standards for medical physics residency training. The complexity of techniques in imaging, nuclear medicine, and radiation oncology continues to increase with each passing year. It is therefore imperative that training requirements and competencies are routinely reviewed and updated to reflect the changing environment in hospitals and clinics across the country. In 2010, the AAPM Work Group on Periodic Review of Medical Physics Residency Training was formed and charged with updating AAPM Report Number 90. This work group includes AAPM members with extensive experience in clinical, professional, and educational aspects of medical physics. The resulting report, AAPM Report Number 249, concentrates on the clinical and professional knowledge needed to function independently as a practicing medical physicist in the areas of radiation oncology, imaging, and nuclear medicine, and constitutes a revision to AAPM Report Number 90. This manuscript presents an executive summary of AAPM Report Number 249.

  19. [Clinical analysis of 249 cases of children with foreign bodies in the nasal cavity and paranasal sinus].

    Science.gov (United States)

    Wang, Ying; Su, Hongxia; Wu, Yuying; Zhao, Yulin

    2016-02-01

    Insertion of a foreign body in the nasal cavity is a very common incident in children. It is easily diagnosed, but the type of foreign body varies and the extraction can sometimes be difficult with risk of complications. The present study reported nasal foreign bodies diagnosed in emergency in our ENT department, with an update on the state of knowledge. A prospective study between Feb 2013 to Sept 2015 included patients admitted to the ENT emergency unit for nasal foreign body. Data comprised age, gender, circumstances of discovery, symptoms, type of foreign body, extraction method and complications. Many patients required anterior rhinoscope for the diagnosis and removal (179/249, 71. 9%), and 170 cases were directly removed and 9 cases were into alimentary canal; Most irregularly shaped objects were removed by a endoscope under general anesthesia (70/249, 28.1%), including button batteries (n= 65), nasal calculi (n = 2) and chopsticks (n = 3). The main types of foreign body were vegetal forms (61.8%). The incident was discovered following nasal symptoms in 24.9% (n = 62). Extraction was easy by using forceps, micro-hooks or suction in 71.9% of qn:Nasal sinuses foreign body on prevention, detailed history and make the necessary inspection, can improve the correct diagnostic rate.

  20. Manganese determination om minerals by activation analysis, using the californium-252 as a neutron source; Determinacao de manganes em minerios, por analise por ativacao, usando californio-252 como fonte de neutrons

    Energy Technology Data Exchange (ETDEWEB)

    Cardoso, Antonio

    1976-07-01

    Neutron Activation Analysis, using a Californium-252 neutron source, has been applied for the determination of manganese in ores such as pyrolusite, rodonite (manganese silicate)' and blending used in dry-batteries The favorable nuclear properties of manganese, such as high thermal neutron cross-section for the reaction {sup 55}Mn (n.gamma){sup 56} Mn, high concentration of manganese in the matrix and short half - life of {sup 56}Mn, are an ideal combination for non-destructive analysis of manganese in ores. Samples and standards of manganese dioxide were irradiated for about 20 minutes, followed by a 4 to 15 minutes decay and counted in a single channel pulse-height discrimination using a NaI(Tl) scintillation detector. Counting time was equal to 10 minutes. The interference of nuclear reactions {sup 56}Fe(n,p){sup 56}Mn and {sup 59} Co (n, {alpha}){sup 56} were studied, as well as problems in connection with neutron shadowing during irradiation, gamma-rays attenuation during counting and influence of granulometry of samples. One sample,was also analysed by wet-chemical method (sodium bismuthate) in order to compare results. As a whole, i t was shown that the analytical method of neutron activation for manganese in ores and blending, is a method simple, rapid and with good precision and accuracy. (author)

  1. Design of a homogeneous subcritical nuclear reactor based on thorium with a source of californium 252; Diseno de un reactor nuclear subcritico homogeneo a base de Torio con una fuente de Californio 252

    Energy Technology Data Exchange (ETDEWEB)

    Delgado H, C. E.; Vega C, H. R. [Universidad Autonoma de Zacatecas, Unidad Academica de Estudios Nucleares, Cipres No. 10, Fracc. La Penuela, 98068 Zacatecas, Zac. (Mexico); Sajo B, L., E-mail: ce_delgado89@hotmail.com [Universidad Simon Bolivar, Laboratorio de Fisica Nuclear, Apdo. 89000, 1080A Caracas (Venezuela, Bolivarian Republic of)

    2015-10-15

    Full text: One of the energy alternatives to fossil fuels which do not produce greenhouse gases is the nuclear energy. One of the drawbacks of this alternative is the generation of radioactive wastes of long half-life and its relation to the generation of nuclear materials to produce weapons of mass destruction. An option to these drawbacks of nuclear energy is to use Thorium as part of the nuclear fuel which it becomes in U{sup 233} when capturing neutrons, that is a fissile material. In this paper Monte Carlo methods were used to design a homogeneous subcritical reactor based on thorium. As neutron reflector graphite was used. The reactor core is homogeneous and is formed of 70% light water as moderator, 12% of enriched uranium UO{sub 2}(NO{sub 3}){sub 4} and 18% of thorium Th(NO{sub 3}){sub 4} as fuel. To start the nuclear fission chain reaction an isotopic source of californium 252 was used with an intensity of 4.6 x 10{sup 7} s{sup -1}. In the design the value of the effective multiplication factor, whose value turned out k{sub eff} <1 was calculated. Also, the neutron spectra at different distances from the source and the total fluence were calculated, as well as the values of the ambient dose equivalent in the periphery of the reactor. (Author)

  2. Aflatoxin-induced TP53 R249S mutation in hepatocellular carcinoma in Thailand: association with tumors developing in the absence of liver cirrhosis.

    Directory of Open Access Journals (Sweden)

    Stephanie Villar

    Full Text Available Primary Liver Cancer (PLC is the leading cause of death by cancer among males in Thailand and the 3(rd among females. Most cases are hepatocellular carcinoma (HCC but cholangiocarcinomas represent between 4 and 80% of liver cancers depending upon geographic area. Most HCC are associated with chronic infection by Hepatitis B Virus while a G → T mutation at codon 249 of the TP53 gene, R249S, specific for exposure to aflatoxin, is detected in tumors for up to 30% of cases. We have used Short Oligonucleotide Mass Analysis (SOMA to quantify free circulating R249S-mutated DNA in plasma using blood specimens collected in a hospital case:control study. Plasma R249S-mutated DNA was detectable at low concentrations (≥ 67 copies/mL in 53 to 64% of patients with primary liver cancer or chronic liver disease and in 19% of controls. 44% of patients with HCC and no evidence of cirrhosis had plasma concentrations of R249S-mutated DNA ≥ 150 copies/mL, compared to 21% in patients with both HCC and cirrhosis, 22% in patients with cholangiocarcinoma, 12% in patients with non-cancer chronic liver disease and 3% of subjects in the reference group. Thus, plasma concentrations of R249S-mutated DNA ≥ 150 copies/mL tended to be more common in patients with HCC developing without pre-existing cirrhosis (p = 0.027. Overall, these results support the preferential occurrence of R249S-mutated DNA in HCC developing in the absence of cirrhosis in a context of HBV chronic infection.

  3. Mutations of residues 249 and 256 in VP2 are involved in the replication and virulence of infectious Bursal disease virus.

    Directory of Open Access Journals (Sweden)

    Xiaole Qi

    Full Text Available Infectious bursal disease virus (IBDV is a pathogen of worldwide significance to the poultry industry. Although the PDE and PFG domains of the capsid protein VP2 contribute significantly to virulence and fitness, the detailed molecular basis for the pathogenicity of IBDV is still not fully understood. Because residues 253 and 284 of VP2 are not the sole determinants of virulence, we hypothesized that other residues involved in virulence and fitness might exist in the PDE and PFG domains of VP2. To test this, five amino acid changes selected by sequence comparison of the PDE and PFG domains of VP2 were introduced individually using a reverse genetics system into the virulent strain (rGx-F9VP2. Then reverse mutations of the selected residues 249 and 256 were introduced individually into the attenuated strain (rGt. Seven modified viruses were generated and evaluated in vitro (CEF cells and in vivo (SPF chicken. For residue 249, Q249R could elevate in vitro and reduce in vivo the replication of rGx-F9VP2 while R249Q could reduce in vitro and elevate in vivo the replication of rGt; meanwhile Q249R reduced the virulence of rGx-F9VP2 while R249Q increased the virulence of rGt, which indicated that residue 249 significantly contributed to the replication and virulence of IBDV. For residue 256, I256V could elevate in vitro and reduce in vivo the replication of rGx-F9VP2 while V256I could reduce in vitro but didn't change in vivo the replication of rGt; although V256I didn't increase the virulence of rGt, I256V obviously reduced the virulence of virulent IBDV. The present results demonstrate for the first time, to different extent, residues 249 and 256 of VP2 are involved in the replication efficiency and virulence of IBDV; this is not only beneficial to further understanding of pathogenic mechanism but also to the design of newly tailored vaccines against IBDV.

  4. Incidence of fibroblast growth factor receptor 3 gene (FGFR3) A248C, S249C, G372C, and T375C mutations in bladder cancer.

    Science.gov (United States)

    Dodurga, Y; Tataroglu, C; Kesen, Z; Satiroglu-Tufan, N L

    2011-01-18

    Bladder cancer is the most frequent cancer of the urinary system. Fibroblast growth factor receptors (FGFR) belong to the tyrosine kinase family and have important roles in cell differentiation and proliferation and embryogenesis. FGFR3 is located on chromosome 4p16.3, and missense mutations of FGFR3 are associated with autosomal dominant human skeletal disorders and have some oncogenic effects. We examined the incidence of FGFR3 thanatophoric dysplasia mutations located in exon 7, A248C and S249C, and in exon 10, G372C and T375C, and their correlation with clinical-pathological parameters in bladder carcinoma patients. Fifty-six paraffin-embedded specimens of transitional cell carcinoma of the urinary bladder were included in this study. Analysis of FGFR3 thanatophoric dysplasia mutations located in exon 7, A248C and S249C, and in exon 10, G372C and T375C, was performed by PCR-restriction fragment length polymorphism (RFLP) analysis and DNA sequencing. FGFR3 thanatophoric dysplasia mutations located in exon 7, A248C and S249C, and in exon 10, G372C and T375C, were detected in 33 of the 56 patients (heterozygous mutant). Among the 56 transitional cell carcinomas, missense point mutations were detected in seven of them at codon A248C, 28 of them at codon S249C, and three of them at codon T375C, similar to data from previous reports. When the results of the FGFR3 thanatophoric dysplasia mutations located in exon 7, A248C and S249C and in exon 10, G372C and T375C, were analyzed one by one or as a group, despite the findings of previous research reports, our data suggest that these mutations are detected homogenously regardless of the tumor classification and tumor grade.

  5. Etiologia das crises epilépticas na cidade do Recife, Brasil: estudo de 249 pacientes Etiology of the epileptic seizures in Recife City, Brazil: study of 249 patients

    Directory of Open Access Journals (Sweden)

    MARCELO MORAES VALENÇA

    2000-12-01

    Full Text Available Estudamos as causas etiológicas das crises epilépticas apresentadas por 249 pacientes, que procuraram um serviço de neurologia na Cidade do Recife, Brasil. A causa da crise não foi identificada em 43,0% dos pacientes. Como fatores de risco determinantes das crises encontramos: acidente vascular cerebral isquêmico (AVCI ; 17,3%, cisticercose (8,8%, trauma crânio-encefálico (TCE; 6,8%, neoplasias intracranianas (6,8%, AVC hemorrágico (AVCH; 4,8%, malformação vascular cerebral (3,6% e outras causas (8,4%. Nos pacientes com menos de 15 anos, a causa mais frequente foi cisticercose (10,3%, seguida por malformação vascular (5,1% e AVCI (5,1%. No grupo com idade entre 15 e 45 anos o fator determinante mais frequente foi cisticercose (11,6%, seguido por TCE (10,7%, AVCI (4,5% e neoplasia (3,6%. Porém, nos pacientes com mais de 45 anos a principal causa foi AVCI (36,7%, seguido por neoplasia (12,3%, AVCH (11,2% e cisticercose (5,1%. Concluindo, a doença cerebrovascular foi a causa mais prevalente de crise epiléptica, quando consideramos todas as idades. No entanto, a cisticercose cerebral foi a principal causa encontrada em pacientes com menos de 45 anos.The etiological causes of the epileptic seizures presenting by 249 patients were studied, in a neurological clinic in Recife City, Brazil. The cause of the seizure was not identified in 43.0% of the patients. As suspected causal factors we found: ischemic cerebrovascular disease (ICVD, 17.3%, cysticercosis (8.8%, head trauma (HT, 6.8%, brain tumors (6.8%, hemorrhagic cerebrovascular disease (HCVD, 4.8%, vascular malformation (3.6%, other causes (8.4%. In the patients with age less than 15-year-old, the most frequent cause was cysticercosis (10.3%, following vascular malformation (5.1%, and ICVD (5.1%. In the group between 15 and 45 years of age the major cause of seizure was cysticercosis (11.6%, following HT (10.7%, ICVD (4.5%, and brain tumors (3.6%. On the other hand, in the patients

  6. Association of the PPP3CA c.249G>A variant with clinical outcomes of tacrolimus-based therapy in kidney transplant recipients

    Directory of Open Access Journals (Sweden)

    Salgado PC

    2017-03-01

    Full Text Available Patricia C Salgado,1 Fabiana DV Genvigir,1 Claudia R Felipe,2 Helio Tedesco-Silva Jr,2 Jose O Medina-Pestana,2 Sonia Q Doi,3 Mario H Hirata,1 Rosario DC Hirata1 1Department of Clinical and Toxicological Analysis, School of Pharmaceutical Sciences, University of Sao Paulo, 2Division of Nephrology, Hospital do Rim, Federal University of Sao Paulo, Sao Paulo, Brazil; 3School of Medicine, Uniformed Services University of the Health Sciences, Bethesda, MD, USA Background: The effects of genetic variants related to the pharmacodynamic mechanisms of immunosuppressive drugs on their therapeutic efficacy and safety have been poorly explored. This study was performed to investigate the influence of the PPP3CA c.249G>A variant on the clinical outcomes of kidney transplant recipients. Patients and methods: A total of 148 Brazilian patients received tacrolimus (TAC-based immunosuppressive therapy for 90 days post-kidney transplantation. The PPP3CA rs3730251 (c.249G>A polymorphism was determined by real-time polymerase chain reaction. Single-nucleotide polymorphism (SNP data for CYP3A5 rs776746 (CYP3A5*3C; g.6986A>G were used to eliminate the confounding effects of this variant. Results: The PPP3CA c.249G>A SNP did not influence early TAC exposure, renal function, or other laboratory parameters, including levels of urea, creatinine, glucose, and lipids, and blood counts. This variant also did not account for the cumulative incidence of biopsy-confirmed acute rejection or delayed graft function. Regarding adverse events, PPP3CA c.249A allele carriers initially had a 3.05-fold increased probability of treatment-induced blood and lymphatic system disorders compared with c.249GG genotype individuals (95% confidence interval: 1.10–8.48, p=0.032. However, this result was not maintained after adjusting for body weight and CYP3A5*3C SNP status (p=0.086. Conclusion: The PPP3CA c.249G>A variant does not influence the clinical outcomes of Brazilian patients in the

  7. Case 249: Intramuscular Mycetoma.

    Science.gov (United States)

    Neyaz, Zafar; Mohindra, Namita; Bhatnagar, Ankur; Marak, Rungmei S K

    2018-01-01

    History A 21-year-old man presented with swelling of the medial aspect of the left thigh of 1-month duration. There was no history of fever or penetrating injury in the left thigh. The patient had undergone renal transplantation 7 years earlier and had been taking immunosuppressants since transplantation. He had undergone two surgeries at the same site in the medial aspect of the left thigh in the past 3 years for a similar problem. At physical examination, there was swelling in the medial aspect of the left thigh, with mild tenderness. A surgical scar was noted anterior to the swelling ( Fig 1 ). No redness or discharging sinus was present. Laboratory results were as follows: hemoglobin level, 11.3 g/dL (normal range, 13.8-17.2 g/dL); white blood cell count, 9.7 × 109/L (normal range, [4-11] × 109/L); neutrophil, 75% (normal range, 48%-77%); lymphocyte, 22% (normal range, 10%-24%); eosinophil, 1% (normal range, 0.3%- 7%); monocyte, 1% (normal range, 0.6%-10%); serum creatinine level, 1.3 mg/dL (114.9 μmol/L) (normal range, 0.5-1.6 mg/dL [44.2-141.4 μmol/L]); and serum glucose (random) level, 82 mg/dL (4.5 mmol/L) (normal range, 79-140 mg/dL [4.4-7.8 mmol/L]). Radiography of the left thigh showed soft-tissue swelling in the medial aspect of the left thigh, without underlying bone involvement (not shown). Ultrasonography (US) and magnetic resonance (MR) imaging of the left thigh were performed. [Figure: see text].

  8. Biological, chemical and other data collected aboard the THOMAS G. THOMPSON during cruise TN249 in the Bering Sea from 2010-05-10 to 2010-06-15 (NODC Accession 0117397)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NODC accession 0117397 includes biological, chemical, optical and physical data collected aboard the THOMAS G. THOMPSON during cruise TN249 in the Bering Sea from...

  9. Fibroblast Growth Factor Receptor 3 (FGFR3–Analyses of the S249C Mutation and Protein Expression in Primary Cervical Carcinomas

    Directory of Open Access Journals (Sweden)

    Haiyan Dai

    2001-01-01

    Full Text Available Fibroblast growth factor receptor 3 (FGFR3 seems to play an inhibitory role in bone development, as activating mutations in the gene underlie disorders such as achondroplasia and thanatophoric dysplasia. Findings from multiple myeloma (MM indicate that FGFR3 also can act as an oncogene, and mutation of codon 249 in the fibroblast growth factor receptor 3 (FGFR3 gene was recently detected in 3/12 primary cervical carcinomas. We have analysed 91 cervical carcinomas for this specific S249C mutation using amplification created restriction site methodology (ACRS, and detected no mutations. Immunohistochemistry was performed on 73 of the tumours. Reduced protein staining was seen in 43 (58.8% samples. Six of the tumours (8.2% revealed increased protein staining compared with normal cervical tissue. These patients had a better prognosis than those with reduced or normal levels, although not statistically significant. This report weakens the hypothesis of FGFR3 as an oncogene of importance in cervical carcinomas.

  10. Association of V249I and T280M variants of fractalkine receptor CX3CR1 with carotid intima-media thickness in a mexican population with type 2 diabetes.

    Science.gov (United States)

    Gómez-Díaz, Rita A; Gutiérrez, Jorge; Contreras-Rodriguez, Alicia; Valladares-Salgado, Adán; Tanus-Hajj, Janet; Mondragón-González, Rafael; Talavera, Juan O; Mejía-Benitez, María Aurora; García-Mena, Jaime; Cruz, Miguel; Wacher, Niels H

    2017-01-01

    To evaluate the association of the V249I and T280M variants of CX3CR1 fractalkine gene with carotid intima-media thickness in Mexican subjects with and without type 2 diabetes. We analyzed the V249I and T280M variants of the CX3CR1 receptor by TaqMan assays in 111 subjects with type 2 diabetes and 109 healthy controls. Hemoglobin A1c, glucose, and lipid profile were determined. A significant increase in carotid intima-media thickness was observed in type 2 diabetes patients (0.979 ± 0.361 mm) compared to healthy controls (0.588 ± 0.175 mm). In subjects carrying the MM variant of the T280M polymorphism, hemoglobin A1c was higher (p = 0.008). Classic risk factors for atherosclerosis showed no differences between carriers of the T280M and V249I variants. Controls with the II249 genotype associated with carotid intima-media thickness (0.747 ± 0.192 mm; p = 0.041), and this difference remained significant even after adjusting factors such as age, gender, and body mass index (OR: 7.7; 95% CI: 1.269-47.31; p = 0.027). V249I genotype of the fractalkine receptor showed a protector role in patients with type 2 diabetes. The T280M genotype is associated with increased carotid intima-media thickness in Mexican individuals with or without type 2 diabetes.

  11. Global, regional, and national life expectancy, all-cause mortality, and cause-specific mortality for 249 causes of death, 1980–2015: a systematic analysis for the Global Burden of Disease Study 2015

    NARCIS (Netherlands)

    Wang, Haidong; Naghavi, Mohsen; Allen, Christine; Barber, R.M.; Bhutta, Zulfiqar; Carter, Austin; Casey, Daniel C.; Charlson, Fiona J.; Chen, Alan Z.; Coates, M.; Geleijnse, J.M.

    2016-01-01

    Background
    Improving survival and extending the longevity of life for all populations requires timely, robust evidence on local mortality levels and trends. The Global Burden of Disease 2015 Study (GBD 2015) provides a comprehensive assessment of all-cause and cause-specific mortality for 249

  12. Global, regional, and national life expectancy, all-cause mortality, and cause-specific mortality for 249 causes of death, 1980-2015 : a systematic analysis for the Global Burden of Disease Study 2015

    NARCIS (Netherlands)

    Wang, Haidong; Naghavi, Mohsen; Allen, Christine; Barber, Ryan M.; Bhutta, Zulfiqar A.; Carter, Austin; Casey, Daniel C.; Charlson, Fiona J.; Chen, Alan Zian; Coates, Matthew M.; Coggeshall, Megan; Dandona, Lalit; Dicker, Daniel J.; Erskine, Holly E.; Ferrari, Alize J.; Fitzmaurice, Christina; Foreman, Kyle; Forouzanfar, Mohammad H.; Fraser, Maya S.; Pullman, Nancy; Gething, Peter W.; Goldberg, Ellen M.; Graetz, Nicholas; Haagsma, Juanita A.; Hay, Simon I.; Huynh, Chantal; Johnson, Catherine; Kassebaum, Nicholas J.; Kinfu, Yohannes; Kulikoff, Xie Rachel; Kutz, Michael; Kyu, Hmwe H.; Larson, Heidi J.; Leung, Janni; Liang, Xiaofeng; Lim, Stephen S.; Lind, Margaret; Lozano, Rafael; Marquez, Neal; Mensah, George A.; Mikesell, Joe; Mokdad, Ali H.; Mooney, Meghan D.; Nguyen, Grant; Nsoesie, Elaine; Pigott, David M.; Pinho, Christine; Roth, Gregory A.; Salomon, Joshua A.; Sandar, Logan; Silpakit, Naris; Sligar, Amber; Sorensen, Reed J. D.; Stanaway, Jeffrey; Steiner, Caitlyn; Teeple, Stephanie; Thomas, Bernadette A.; Troeger, Christopher; VanderZanden, Amelia; Vollset, Stein Emil; Wanga, Valentine; Whiteford, Harvey A.; Wolock, Timothy; Zoeckler, Leo; Abate, Kalkidan Hassen; Abbafati, Cristiana; Abbas, Kaja M.; Abd-Allah, Foad; Abera, Semaw Ferede; Abreu, Daisy M. X.; Abu-Raddad, Laith J.; Abyu, Gebre Yitayih; Achoki, Tom; Adelekan, Ademola Lukman; Ademi, Zanfina; Adou, Arsene Kouablan; Adsuar, Jose C.; Afanvi, Kossivi Agbelenko; Afshin, Ashkan; Agardh, Emilie Elisabet; Agarwal, Arnav; Agrawal, Anurag; Kiadaliri, Aliasghar Ahmad; Ajala, Oluremi N.; Akanda, All Shafqat; Akinyemi, Rufus Olusola; Akinyemiju, Tomi F.; Akseer, Nadia; Al Lami, Faris Hasan; Alabed, Samer; Al-Aly, Ziyad; Alam, Khurshid; Alam, Noore K. M.; Alasfoor, Deena; Aldhahri, Saleh Fahed; Aldridge, Robert William; Alegretti, Miguel Angel; Aleman, Alicia V.; Alemu, Zewdie Aderaw; Alexander, Lily T.; Alhabib, Samia; Ali, Raghib; Alkerwi, Ala'a; Alla, Francois; Allebeck, Peter; Al-Raddadi, Rajaa; Alsharif, Ubai; Altirkawi, Khalid A.; Martin, Elena Alvarez; Alvis-Guzman, Nelson; Amare, Azmeraw T.; Amegah, Adeladza Kofi; Ameh, Emmanuel A.; Amini, Heresh; Ammar, Walid; Amrock, Stephen Marc; Andersen, Hjalte H.; Anderson, Benjamin; Anderson, Gregory M.; Antonio, Carl Abelardo T.; Aregay, Atsede Fantahun; Arnlov, Johan; Arsenijevic, Valentina S. Arsic; Al Artaman, Ali; Asayesh, Hamid; Asghar, Rana Jawad; Atique, Suleman; Arthur Avokpaho, Euripide Frinel G.; Awasthi, Ashish; Azzopardi, Peter; Bacha, Umar; Badawi, Alaa; Bahit, Maria C.; Balakrishnan, Kalpana; Banerjee, Amitava; Barac, Aleksandra; Barker-Collo, Suzanne L.; Barnighausen, Till; Barregard, Lars; Barrero, Lope H.; Basu, Arindam; Basu, Sanjay; Bayou, Yibeltal Tebekaw; Bazargan-Hejazi, Shahrzad; Beardsley, Justin; Bedi, Neeraj; Beghi, Ettore; Belay, Haileeyesus Adamu; Bell, Brent; Bell, Michelle L.; Bello, Aminu K.; Bennett, Derrick A.; Bensenor, Isabela M.; Berhane, Adugnaw; Bernabe, Eduardo; Betsu, Balem Demtsu; Beyene, Addisu Shunu; Bhala, Neeraj; Bhalla, Ashish; Biadgilign, Sibhatu; Bikbov, Boris; Bin Abdulhak, Aref A.; Biroscak, Brian J.; Biryukov, Stan; Bjertness, Espen; Blore, Jed D.; Blosser, Christopher D.; Bohensky, Megan A.; Borschmann, Rohan; Bose, Dipan; Bourne, Rupert R. A.; Brainin, Michael; Brayne, Carol E. G.; Brazinova, Alexandra; Breitborde, Nicholas J. K.; Brenner, Hermann; Brewer, Jerry D.; Brown, Alexandria; Brown, Jonathan; Brugha, Traolach S.; Buckle, Geoffrey Colin; Butt, Zahid A.; Calabria, Bianca; Campos-Novato, Ismael Ricardo; Campuzano, Julio Cesar; Carapetis, Jonathan R.; Cardenas, Rosario; Carpenter, David; Carrero, Juan Jesus; Castaneda-Oquela, Carlos A.; Rivas, Jacqueline Castillo; Catala-Lopez, Ferran; Cavalleri, Fiorella; Cercy, Kelly; Cerda, Jorge; Chen, Wanqing; Chew, Adrienne; Chiang, Peggy Pei -Chia; Chibalabala, Mirriam; Chibueze, Chioma Ezinne; Chimed-Ochir, Odgerel; Chisumpa, Vesper Hichilombwe; Choi, Jee-Young Jasmine; Chowdhury, Rajiv; Christensen, Hanne; Christopher, Devasahayam Jesudas; Ciobanu, Liliana G.; Cirillo, Massimo; Cohen, Aaron J.; Colistro, Valentina; Colomar, Mercedes; Colquhoun, Samantha M.; Cooper, Cyrus; Cooper, Leslie Trumbull; Cortinovis, Monica; Cowie, Benjamin C.; Crump, John A.; Damsere-Derry, James; Danawi, Hadi; Dandona, Rakhi; Daoud, Farah; Darby, Sarah C.; Dargan, Paul I.; das Neves, Jose; Davey, Gail; Davis, Adrian C.; Davitoiu, Dragos V.; de Castro, E. Filipa; de Jager, Pieter; De Leo, Diego; Degenhardt, Louisa; Dellavalle, Robert P.; Deribe, Kebede; Deribew, Amare; Dharmaratne, Samath D.; Dhillon, Preet K.; Diaz-Torne, Cesar; Ding, Eric L.; dos Santos, Kadine Priscila Bender; Dossou, Edem; Driscoll, Tim R.; Duan, Leilei; Dubey, Manisha; Bartholow, Bruce; Ellenbogen, Richard G.; Lycke, Christian; Elyazar, Iqbal; Endries, Aman Yesuf; Ermakov, Sergey Petrovich; Eshrati, Babak; Esteghamati, Alireza; Estep, Kara; Faghmous, Imad D. A.; Fahimi, Saman; Jose, Emerito; Farid, Talha A.; Sa Farinha, Carla Sofia e; Faro, Andre; Farvid, Maryam S.; Farzadfar, Farshad; Feigin, Valery L.; Fereshtehnejad, Seyed-Mohammad; Fernandes, Jefferson G.; Fernandes, Joao C.; Fischer, Florian; Fitchett, Joseph R. A.; Flaxman, Abraham; Foigt, Nataliya; Fowkes, F. Gerry R.; Franca, Elisabeth Barboza; Franklin, Richard C.; Friedman, Joseph; Frostad, Joseph; Hirst, Thomas; Futran, Neal D.; Gall, Seana L.; Gambashidze, Ketevan; Gamkrelidze, Amiran; Ganguly, Parthasarathi; Gankpe, Fortune Gbetoho; Gebre, Teshome; Gebrehiwot, Tsegaye Tsewelde; Gebremedhin, Amanuel Tesfay; Gebru, Alemseged Aregay; Geleijnse, Johanna M.; Gessner, Bradford D.; Ghoshal, Aloke Gopal; Gibney, Katherine B.; Gillum, Richard F.; Gilmour, Stuart; Giref, Ababi Zergaw; Giroud, Maurice; Gishu, Melkamu Dedefo; Giussani, Giorgia; Glaser, Elizabeth; Godwin, William W.; Gomez-Dantes, Hector; Gona, Philimon; Goodridge, Amador; Gopalani, Sameer Vali; Gosselin, Richard A.; Gotay, Carolyn C.; Goto, Atsushi; Gouda, Hebe N.; Greaves, Felix; Gugnani, Harish Chander; Gupta, Rahul; Gupta, Rajeev; Gupta, Vipin; Gutierrez, Reyna A.; Hafezi-Nejad, Nima; Haile, Demewoz; Hailu, Alemayehu Desalegne; Hailu, Gessessew Bugssa; Halasa, Yara A.; Hamadeh, Randah Ribhi; Hamidi, Samer; Hancock, Jamie; Handal, Alexis J.; Hankey, Graeme J.; Hao, Yuantao; Harb, Hilda L.; Harikrishnan, Sivadasanpillai; Haro, Josep Maria; Havmoeller, Rasmus; Heckbert, Susan R.; Heredia-Pi, Ileana Beatriz; Heydarpour, Pouria; Hilderink, Henk B. M.; Hoek, Hans W.; Hogg, Robert S.; Horino, Masako; Horita, Nobuyuki; Hosgood, H. Dean; Hotez, Peter J.; Hoy, Damian G.; Hsairi, Mohamed; Htet, Aung Soe; Than Htike, Maung Maung; Hu, Guoqing; Huang, Cheng; Huang, Hsiang; Huiart, Laetitia; Husseini, Abdullatif; Huybrechts, Inge; Huynh, Grace; Iburg, Kim Moesgaard; Innos, Kaire; Inoue, Manami; Iyer, Veena J.; Jacobs, Troy A.; Jacobsen, Kathryn H.; Jahanmehr, Nader; Jakovljevic, Mihajlo B.; James, Peter; Javanbakht, Mehdi; Jayaraman, Sudha P.; Jayatilleke, Achala Upendra; Jeemon, Panniyammakal; Jensen, Paul N.; Jha, Vivekanand; Jiang, Guohong; Jiang, Ying; Jibat, Tariku; Jimenez-Corona, Aida; Jonas, Jost B.; Joshi, Tushar Kant; Kabir, Zubair; Karnak, Ritul; Kan, Haidong; Kant, Surya; Karch, Andre; Karema, Corine Kakizi; Karimkhani, Chante; Karletsos, Dimitris; Karthikeyan, Ganesan; Kasaeian, Amir; Katibeh, Marzieh; Kaul, Anil; Kawakami, Norito; Kayibanda, Jeanne Francoise; Keiyoro, Peter Njenga; Kemmer, Laura; Kemp, Andrew Haddon; Kengne, Andre Pascal; Keren, Andre; Kereselidze, Maia; Kesavachandran, Chandrasekharan Nair; Khader, Yousef Saleh; Khalil, Ibrahim A.; Khan, Abdur Rahman; Khan, Ejaz Ahmad; Khang, Young-Ho; Khera, Sahil; Muthafer Khoja, Tawfik Ahmed; Kieling, Christian; Kim, Daniel; Kim, Yun Jin; Kissela, Brett M.; Kissoon, Niranjan; Knibbs, Luke D.; Knudsen, Ann Kristin; Kokubo, Yoshihiro; Kolte, Dhaval; Kopec, Jacek A.; Kosen, Soewarta; Koul, Parvaiz A.; Koyanagi, Ai; Krog, Norun Hjertager; Defo, Barthelemy Kuate; Bicer, Burcu Kucuk; Kudom, Andreas A.; Kuipers, Ernst J.; Kulkarni, Veena S.; Kumar, G. Anil; Kwan, Gene F.; Lal, Aparna; Lal, Dharmesh Kumar; Lalloo, Ratilal; Lam, Hilton; Lam, Jennifer O.; Langan, Sinead M.; Lansingh, Van C.; Larsson, Anders; Laryea, Dennis Odai; Latif, Asma Abdul; Lawrynowicz, Alicia Elena Beatriz; Leigh, James; Levi, Miriam; Li, Yongmei; Lindsay, M. Patrice; Lipshultz, Steven E.; Liu, Patrick Y.; Liu, Shiwei; Liu, Yang; Lo, Loon-Tzian; Logroscino, Giancarlo; Lotufo, Paulo A.; Lucas, Robyn M.; Lunevicius, Raimundas; Lyons, Ronan A.; Ma, Stefan; Pedro Machado, Vasco Manuel; Mackay, Mark T.; MacLachlan, Jennifer H.; Abd El Razek, Hassan Magdy; Abd El Razek, Mohammed Magdy; Majdan, Marek; Majeed, Azeem; Malekzadeh, Reza; Ayele Manamo, Wondimu Ayele; Mandisarisa, John; Mangalam, Srikanth; Mapoma, Chabila C.; Marcenes, Wagner; Margolis, David Joel; Martin, Gerard Robert; Martinez-Raga, Jose; Marzan, Melvin Barrientos; Masiye, Felix; Mason-Jones, Amanda J.; Massano, Joao; Matzopoulos, Richard; Mayosi, Bongani M.; McGarvey, Stephen Theodore; McGrath, John J.; Mckee, Martin; McMahon, Brian J.; Meaney, Peter A.; Mehari, Alem; Mehndiratta, Man Mohan; Mena-Rodriguez, Fabiola; Mekonnen, Alemayehu B.; Melaku, Yohannes Adama; Memiah, Peter; Memish, Ziad A.; Mendoza, Walter; Meretoja, Atte; Meretoja, Tuomo J.; Mhimbira, Francis Apolinary; Micha, Renata; Miller, Ted R.; Mirarefin, Mojde; Misganaw, Awoke; Mock, Charles N.; Abdulmuhsin Mohammad, Karzan; Mohammadi, Alireza; Mohammed, Shafiu; Mohan, Viswanathan; Mola, Glen Liddell D.; Monasta, Lorenzo; Montanez Hernandez, Julio Cesar; Montero, Pablo; Montico, Marcella; Montine, Thomas J.; Moradi-Lakeh, Maziar; Morawska, Lidia; Morgan, Katherine; Mori, Rintaro; Mozaffarian, Dariush; Mueller, Ulrich; Satyanarayana Murthy, Gudlavalleti Venkata; Murthy, Srinivas; Musa, Kamarul Imran; Nachega, Jean B.; Nagel, Gabriele; Naidoo, Kovin S.; Naik, Nitish; Naldi, Luigi; Nangia, Vinay; Nash, Denis; Nejjari, Chakib; Neupane, Subas; Newton, Charles R.; Newton, John N.; Ng, Marie; Ngalesoni, Frida Namnyak; Ngirabega, Jean de Dieu; Quyen Le Nguyen, [Unknown; Nisar, Muhammad Imran; Nkamedjie Pete, Patrick Martial; Nomura, Marika; Norheim, Ole F.; Norman, Paul E.; Norrving, Bo; Nyakarahuka, Luke; Ogbo, Felix Akpojene; Ohkubo, Takayoshi; Ojelabi, Foluke Adetola; Olivares, Pedro R.; Olusanya, Bolajoko Olubukunola; Olusanya, Jacob Olusegun; Opio, John Nelson; Oren, Eyal; Ortiz, Alberto; Osman, Majdi; Ota, Erika; Ozdemir, Raziye; Pa, Mahesh; Pandian, Jeyaraj D.; Pant, Puspa Raj; Papachristou, Christina; Park, Eun-Kee; Park, Jae-Hyun; Parry, Charles D.; Parsaeian, Mahboubeh; Caicedo, Angel J. Paternina; Patten, Scott B.; Patton, George C.; Paul, Vinod K.; Pearce, Neil; Pedro, Joao Mario; Stokic, Ljiljana Pejin; Pereira, David M.; Perico, Norberto; Pesudovs, Konrad; Petzold, Max; Phillips, Michael Robert; Piel, Frederic B.; Pillay, Julian David; Plass, Dietrich; Platts-Mills, James A.; Polinder, Suzanne; Pope, C. Arden; Popova, Svetlana; Poulton, Richie G.; Pourmalek, Farshad; Prabhakaran, Dorairaj; Qorbani, Mostafa; Quame-Amaglo, Justice; Quistberg, D. Alex; Rafay, Anwar; Rahimi, Kazem; Rahimi-Movaghar, Vafa; Rahman, Mahfuzar; Rahman, Mohammad Hifz Ur; Rahman, Sajjad Ur; Rai, Rajesh Kumar; Rajavi, Zhale; Rajsic, Sasa; Raju, Murugesan; Rakovac, Ivo; Rana, Saleem M.; Ranabhat, Chhabi L.; Rangaswamy, Thara; Rao, Puja; Rao, Sowmya R.; Refaat, Amany H.; Rehm, Jurgen; Reitsma, Marissa B.; Remuzzi, Giuseppe; Resnikofff, Serge; Ribeiro, Antonio L.; Ricci, Stefano; Blancas, Maria Jesus Rios; Roberts, Bayard; Roca, Anna; Rojas-Rueda, David; Ronfani, Luca; Roshandel, Gholamreza; Rothenbacher, Dietrich; Roy, Ambuj; Roy, Nawal K.; Ruhago, George Mugambage; Sagar, Rajesh; Saha, Sukanta; Sahathevan, Ramesh; Saleh, Muhammad Muhammad; Sanabria, Juan R.; Sanchez-Nino, Maria Dolores; Sanchez-Riera, Lidia; Santos, Itamar S.; Sarmiento-Suarez, Rodrigo; Sartorius, Benn; Satpathy, Maheswar; Savic, Miloje; Sawhney, Monika; Schaub, Michael P.; Schmidt, Maria Ines; Schneider, Ione J. C.; Schottker, Ben; Schutte, Aletta E.; Schwebel, David C.; Seedat, Soraya; Sepanlou, Sadaf G.; Servan-Mori, Edson E.; Shackelford, Katya A.; Shaddick, Gavin; Shaheen, Amira; Shahraz, Saeid; Shaikh, Masood Ali; Shakh-Nazarova, Marina; Sharma, Rajesh; She, Jun; Sheikhbahaei, Sara; Shen, Jiabin; Shen, Ziyan; Shepard, Donald S.; Sheth, Kevin N.; Shetty, Balakrishna P.; Shi, Peilin; Shibuya, Kenji; Shin, Min-Jeong; Shiri, Rahman; Shiue, Ivy; Shrime, Mark G.; Sigfusdottir, Inga Dora; Silberberg, Donald H.; Silva, Diego Augusto Santos; Silveira, Dayane Gabriele Alves; Silverberg, Jonathan I.; Simard, Edgar P.; Singh, Abhishek; Singh, Gitanjali M.; Singh, Jasvinder A.; Singh, Om Prakash; Singh, Prashant Kumar; Singh, Virendra; Soneji, Samir; Soreide, Kjetil; Soriano, Joan B.; Sposato, Luciano A.; Sreeramareddy, Chandrashekhar T.; Stathopoulou, Vasiliki; Stein, Dan J.; Stein, Murray B.; Stranges, Saverio; Stroumpoulis, Konstantinos; Sunguya, Bruno F.; Sur, Patrick; Swaminathan, Soumya; Sykes, Bryan L.; Szoeke, Cassandra E. I.; Tabares-Seisdedos, Rafael; Tabb, Karen M.; Takahashi, Ken; Takala, Jukka S.; Talongwa, Roberto Tchio; Tandon, Nikhil; Tavakkoli, Mohammad; Taye, Bineyam; Taylor, Hugh R.; Ao, Braden J. Te; Tedla, Bemnet Amare; Tefera, Worku Mekonnen; Ten Have, Margreet; Terkawi, Abdullah Sulieman; Tesfay, Fisaha Haile; Tessema, Gizachew Assefa; Thomson, Alan J.; Thorne-Lyman, Andrew L.; Thrift, Amanda G.; Thurston, George D.; Tillmann, Taavi; Tirschwell, David L.; Tonelli, Marcello; Topor-Madry, Roman; Topouzis, Fotis; Nx, Jeffrey Allen Towb; Traebert, Jefferson; Tran, Bach Xuan; Truelsen, Thomas; Trujillo, Ulises; Tura, Abera Kenay; Tuzcu, Emin Murat; Uchendu, Uche S.; Ukwaja, Kingsley N.; Undurraga, Eduardo A.; Uthman, Olalekan A.; Van Dingenen, Rita; Van Donkelaar, Aaron; Vasankari, Tommi; Vasconcelos, Ana Maria Nogales; Venketasubramanian, Narayanaswamy; Vidavalur, Ramesh; Vijayakumar, Lakshmi; Villalpando, Salvador; Violante, Francesco S.; Vlassov, Vasiliy Victorovich; Wagner, Joseph A.; Wagner, Gregory R.; Wallin, Mitchell T.; Wang, Linhong; Watkins, David A.; Weichenthal, Scott; Weiderpass, Elisabete; Weintraub, Robert G.; Werdecker, Andrea; Westerman, Ronny; White, Richard A.; Wijeratne, Tissa; Wilkinson, James D.; Williams, Hywel C.; Wiysonge, Charles Shey; Woldeyohannes, Solomon Meseret; Wolfe, Charles D. A.; Won, Sungho; Wong, John Q.; Woolf, Anthony D.; Xavier, Denis; Xiao, Qingyang; Xu, Gelin; Yakob, Bereket; Yalew, Ayalnesh Zemene; Yan, Lijing L.; Yano, Yuichiro; Yaseri, Mehdi; Ye, Pengpeng; Yebyo, Henock Gebremedhin; Yip, Paul; Yirsaw, Biruck Desalegn; Yonemoto, Naohiro; Yonga, Gerald; Younis, Mustafa Z.; Yu, Shicheng; Zaidi, Zoubida; Zaki, Maysaa El Sayed; Zannad, Faiez; Zavala, Diego E.; Zeeb, Hajo; Zeleke, Berihun M.; Zhang, Hao; Zodpey, Sanjay; Zonies, David; Zuhlke, Liesl Joanna; Vos, Theo; Lopez, Alan D.; Murray, Christopher J. L.

    2016-01-01

    Background Improving survival and extending the longevity of life for all populations requires timely, robust evidence on local mortality levels and trends. The Global Burden of Disease 2015 Study (GBD 2015) provides a comprehensive assessment of all-cause and cause-specific mortality for 249 causes

  13. Recoil-range studies of heavy products of multinucleon transfer from /sup 18/O to /sup 245/Cm and /sup 249/Cf

    Energy Technology Data Exchange (ETDEWEB)

    McFarland, R.M.

    1982-09-01

    Recoil range distributions were measured for alpha and spontaneous fission activities made in the bombardment of /sup 245/Cm and /sup 249/Cf with /sup 18/O from 6.20 MeV/nucleon down to the interaction barrier. The shape of the distributions indicates tht transfers of up to four protons take place via a combination of quasi-elastic (QET) and deep inelastic (DIT) mechanisms, rather than complete fusion-de-excitation (CF) or massive transfer (MT). Angular distributions constructed from recoil range distributions, assuming QET/DIT, indicate that the QET component contributes more significantly to the heavy product residue cross section than the DIT, even though primary cross sections are expected to be higher for DIT than for QET. This may be explained qualitatively as a result of the high excitation energies associated with DIT; the very negative Q/sub gg/ of projectile stripping for these systems combined with the lower expected optimal Q/sub rxn/ of QET compared to DIT can give QET products comparatively low excitation.

  14. Mutant p53 Gains Its Function via c-Myc Activation upon CDK4 Phosphorylation at Serine 249 and Consequent PIN1 Binding.

    Science.gov (United States)

    Liao, Peng; Zeng, Shelya X; Zhou, Xiang; Chen, Tianjian; Zhou, Fen; Cao, Bo; Jung, Ji Hoon; Del Sal, Giannino; Luo, Shiwen; Lu, Hua

    2017-11-23

    TP53 missense mutations significantly influence the development and progression of various human cancers via their gain of new functions (GOF) through different mechanisms. Here we report a unique mechanism underlying the GOF of p53-R249S (p53-RS), a p53 mutant frequently detected in human hepatocellular carcinoma (HCC) that is highly related to hepatitis B infection and aflatoxin B1. A CDK inhibitor blocks p53-RS's nuclear translocation in HCC, whereas CDK4 interacts with p53-RS in the G1/S phase of the cells, phosphorylates it, and enhances its nuclear localization. This is coupled with binding of a peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 (PIN1) to p53-RS, but not the p53 form with mutations of four serines/threonines previously shown to be crucial for PIN1 binding. As a result, p53-RS interacts with c-Myc and enhances c-Myc-dependent rDNA transcription key for ribosomal biogenesis. These results unveil a CDK4-PIN1-p53-RS-c-Myc pathway as a novel mechanism for the GOF of p53-RS in HCC. Copyright © 2017 Elsevier Inc. All rights reserved.

  15. Crystal structure of apatite type Ca2.49Nd7.51(SiO46O1.75

    Directory of Open Access Journals (Sweden)

    Thu Hoai Le

    2016-02-01

    Full Text Available The title compound, Ca2+xNd8–x(SiO46O2–0.5x (x = 0.49, was synthesized at 1873 K and rapidly quenched to room temperature. Its structure has been determined using single-crystal X-ray diffraction and compared with results reported using neutron and X-ray powder diffraction from samples prepared by slow cooling. The single-crystal structure from room temperature data was found to belong to the space group P63/m and has the composition Ca2.49Nd7.51(SiO46O1.75 [dicalcium octaneodymium hexakis(orthosilicate dioxide], being isotypic with natural apatite and the previously reported Ca2Nd8(SiO46O2 and Ca2.2Nd7.8(SiO46O1.9. The solubility limit of calcium in the equilibrium state at 1873 K was found to occur at a composition of Ca2+xNd8–x(SiO46O2–0.5x, where x = 0.49.

  16. Measurement of the total cross section difference Δσ L in np transmission at 1.19, 2.49 and 3.65 GeV

    Science.gov (United States)

    Adiasevich, B. P.; Antonenko, V. G.; Averichev, S. A.; Azhgirey, L. S.; Ball, J.; Bazhanov, N. A.; Benda, B.; Borisov, N. S.; Borzunov, Yu. T.; Bunyatova, E. I.; Burinov, V. F.; Chernykh, E. V.; Dolgii, S. A.; Durand, G.; Dzyubak, A. P.; Fedorov, A. N.; Fimushkin, V. V.; Fontaine, J. M.; Glagolev, V. V.; Golovanov, L. B.; Grosnick, D. P.; Gurevich, G. M.; Hill, D. A.; Karpunin, A. V.; Kasprzyk, T. E.; Khachaturov, B. A.; Kirillov, A. D.; Kochelev, N. I.; Kovalenko, A. D.; Kovalev, A. I.; Kulikov, M. V.; Ladygin, V. P.; Lazarev, A. B.; Lehar, F.; de Lesquen, A.; Liburg, M. Yu.; Lopiano, D.; Lukhanin, A. A.; Maniakov, P. K.; Matafonov, V. N.; Matyushevsky, E. A.; Mgebrishvili, G.; Mironov, S. V.; Neganov, A. B.; Nikolaevsky, G. P.; Nomofilov, A. A.; Pilipenko, Yu. K.; Pisarev, I. L.; Piskunov, N. M.; Plis, Yu. A.; Polunin, Yu. P.; Polyakov, V. V.; Prokofiev, A. N.; Ronzhin, D. A.; Rukoyatkin, P. A.; Sans, J. L.; Sharov, V. I.; Shilov, S. N.; Shishov, Yu. A.; Shutov, V. B.; Sorokin, P. V.; Spinka, H. M.; Starikov, A. Yu.; Stoletov, G. D.; Strokovsky, E. A.; Strunov, L. N.; Svetov, A. L.; Teterin, V. V.; Topalov, S. V.; Trautman, V. Yu.; Tsvinev, A. P.; Usov, Yu. A.; Vikhrov, V. V.; Volkov, V. I.; Yershov, A. A.; Yershov, V. P.; Zaporozhets, S. A.; Zhdanov, A. A.

    1996-03-01

    Results of the total cross section difference Δσ L in a np transmission experiment at 1.19, 2.49 and 3.65 GeV incident neutron beam kinetic energies are presented. Measurements were performed at the Synchrophasotron of the Laboratory of High Energies of the Joint Institute for Nuclear Research in Dubna. Results were obtained with a polarized beam of free quasi-monochromatic neutrons passing through the new Dubna frozen spin proton target. The beam and target polarizations were oriented longitudinally. The present results were obtained at the highest energies of free polarized neutrons that can be reached at present. They extend the energy range of existing results from PSI, LAMPF and Saclay measured between 0.066 and 1.10 GeV. The new results are compared with Δσ L( pn) data determined as a difference between Δσ L( pd) and Δσ L( pp) ANL-ZGS measurements. The values of Δσ L for the isospin state I=0 were deduced using known pp data.

  17. Global, regional, and national life expectancy, all-cause mortality, and cause-specific mortality for 249 causes of death, 1980-2015 : a systematic analysis for the Global Burden of Disease Study 2015

    OpenAIRE

    Wang, Haidong; Naghavi, Mohsen; Allen, Christine; Barber, Ryan M; Bhutta, Zulfiqar A; Carter, Austin; Casey, Daniel C.; Fiona J Charlson; Chen, Alan Zian; Coates, Matthew M; Coggeshall, Megan; Dandona, Lalit; Dicker, Daniel J; Erskine, Holly E; Ferrari, Alize J

    2016-01-01

    Summary\\ud Background Improving survival and extending the longevity of life for all populations requires timely, robust evidence\\ud on local mortality levels and trends. The Global Burden of Disease 2015 Study (GBD 2015) provides a comprehensive\\ud assessment of all-cause and cause-specifi c mortality for 249 causes in 195 countries and territories from 1980 to 2015.\\ud These results informed an in-depth investigation of observed and expected mortality patterns based on\\ud sociodemographic m...

  18. Separation of Transplutonium Elements from Neutron Irradiated Americium-241

    National Research Council Canada - National Science Library

    UENO, Kaoru; WATANABE, Kenju; SAGAWA, Chiaki; ISHIMORI, Tomitaro

    1974-01-01

    .... The ratios of the amounts present of these isotopes were determined by mass spectrometry. It was not possible to identify 249Bk in the berkelium fraction owing to the interference from other β-ray emitting nuclides. In the californium fraction, both spontaneous fission and a-activities due to 250, 252 were observed.

  19. Identification of a novel BRCA1 nucleotide 4803delCC/c.4684delCC mutation and a nucleotide 249T>A/c.130T>A (p.Cys44Ser) mutation in two Greenlandic Inuit families

    DEFF Research Database (Denmark)

    Hansen, Thomas van Overeem; Jønson, Lars; Albrechtsen, Anders

    2010-01-01

    Germ-line mutations in the tumour suppressor proteins BRCA1 and BRCA2 predispose to breast and ovarian cancer. We have recently identified a Greenlandic Inuit BRCA1 nucleotide 234T>G/c.115T>G (p.Cys39Gly) founder mutation, which at that time was the only disease-causing BRCA1/BRCA2 mutation...... identified in this population. Here, we describe the identification of a novel disease-causing BRCA1 nucleotide 4803delCC/c.4684delCC mutation in a Greenlandic Inuit with ovarian cancer. The mutation introduces a frameshift and a premature stop at codon 1572. We have also identified a BRCA1 nucleotide 249T......>A/c.130T>A (p.Cys44Ser) mutation in another Greenlandic individual with ovarian cancer. This patient share a 1-2 Mb genomic fragment, containing the BRCA1 gene, with four Danish families harbouring the same mutation, suggesting that the 249T>A/c.130T>A (p.Cys44Ser) mutation originates from a Danish...

  20. Production of {sup 256}Lr in the {sup 249,250,251}Cf + {sup 11}B, {sup 243}Am + {sup 18}O, and {sup 248}Cm + {sup 14}N reactions

    Energy Technology Data Exchange (ETDEWEB)

    Sato, N.; Sato, T.K.; Asai, M. [Japan Atomic Energy Agency, Ibaraki (Japan). Advanced Science Research Center; and others

    2014-04-01

    Production cross-sections of the isotope {sup 256}Lr in the {sup 249,250,251}Cf + {sup 11}B, {sup 243}Am + {sup 18}O, and {sup 248}Cm + {sup 14}N reactions were measured using a He/KCl gas-jet transport system and a rotating wheel a-particle detection apparatus. The α-particle energy of {sup 256}Lr was distributed from 8.3 to 8.7 MeV and its half-life, T{sub 1/2}, was measured to be 28 ± 1 s. The maximum cross sections in the {sup 249}Cf({sup 11}B, 4n){sup 256}Lr and {sup 243}Am({sup 18}O, 5n){sup 256}Lr reactions were determined to be 122 ± 36 nb at the beam energy of 63 MeV and 26 ± 7 nb at 96 MeV, respectively. In the {sup 248}Cm({sup 14}N, 6n){sup 256}Lr reaction, the cross section was measured to be 27 ± 10 nb at 91 MeV. (orig.)

  1. Automated absolute activation analysis with californium-252 sources

    Energy Technology Data Exchange (ETDEWEB)

    MacMurdo, K.W.; Bowman, W.W.

    1978-09-01

    A 100-mg /sup 252/Cf neutron activation analysis facility is used routinely at the Savannah River Laboratory for multielement analysis of many solid and liquid samples. An absolute analysis technique converts counting data directly to elemental concentration without the use of classical comparative standards and flux monitors. With the totally automated pneumatic sample transfer system, cyclic irradiation-decay-count regimes can be pre-selected for up to 40 samples, and samples can be analyzed with the facility unattended. An automatic data control system starts and stops a high-resolution gamma-ray spectrometer and/or a delayed-neutron detector; the system also stores data and controls output modes. Gamma ray data are reduced by three main programs in the IBM 360/195 computer: the 4096-channel spectrum and pertinent experimental timing, counting, and sample data are stored on magnetic tape; the spectrum is then reduced to a list of significant photopeak energies, integrated areas, and their associated statistical errors; and the third program assigns gamma ray photopeaks to the appropriate neutron activation product(s) by comparing photopeak energies to tabulated gamma ray energies. Photopeak areas are then converted to elemental concentration by using experimental timing and sample data, calculated elemental neutron capture rates, absolute detector efficiencies, and absolute spectroscopic decay data. Calculational procedures have been developed so that fissile material can be analyzed by cyclic neutron activation and delayed-neutron counting procedures. These calculations are based on a 6 half-life group model of delayed neutron emission; calculations include corrections for delayed neutron interference from /sup 17/O. Detection sensitivities of < or = 400 ppB for natural uranium and 8 ppB (< or = 0.5 (nCi/g)) for /sup 239/Pu were demonstrated with 15-g samples at a throughput of up to 140 per day. Over 40 elements can be detected at the sub-ppM level.

  2. Metastable charge-transfer state of californium(iii) compounds.

    Science.gov (United States)

    Liu, Guokui; Cary, Samantha K; Albrecht-Schmitt, Thomas E

    2015-06-28

    Among a series of anomalous physical and chemical properties of Cf(iii) compounds revealed by recent investigations, the present work addresses the characteristics of the optical spectra of An(HDPA)3·H2O (An = Am, Cm, and Cf), especially the broadband photoluminescence from Cf(HDPA)3·H2O induced by ligand-to-metal charge transfer (CT). As a result of strong ion-ligand interactions and the relative ease of reducing Cf(iii) to Cf(ii), a CT transition occurs at low energy (transfer state undergoes radiative and non-radiative relaxations. Broadening of the CT transition arises from strong vibronic coupling and hole-charge interactions in the valence band. The non-radiative relaxation of the metastable CT state results from a competition between phonon-relaxation and thermal tunneling that populates the excited states of Cf(iii).

  3. Measurement of the total cross section difference {Delta}{sigma} {sub L} in np transmission at 1.19, 2.49 and 3.65 GeV

    Energy Technology Data Exchange (ETDEWEB)

    Adiasevich, B.P. [Rossijskij Nauchnyj Tsentr ``Kurchatovskij Inst.``, Moscow (Russian Federation); Antonenko, V.G. [Rossijskij Nauchnyj Tsentr ``Kurchatovskij Inst.``, Moscow (Russian Federation); Averichev, S.A. [Joint Inst. for Nuclear Research, Dubna (Russian Federation). Lab. of High Energy; Azhgirey, L.S. [Laboratory of Nuclear Problems, JINR, 141980 Dubna, Moscow Region (Russian Federation); Ball, J. [Laboratoire National SATURNE, CNRS/IN2P3 and CEA/DSM, CE Saclay, F-91191 Gif sur Yvette Cedex (France); Bazhanov, N.A. [Petersburg Nuclear Physics Institute, 188350, Gatchina (Russian Federation); Benda, B. [CEA-DAPNIA, CE Saclay, F-91191 Gif sur Yvette Cedex (France); Borisov, N.S. [Laboratory of Nuclear Problems, JINR, 141980 Dubna, Moscow Region (Russian Federation); Borzunov, Yu.T. [Joint Inst. for Nuclear Research, Dubna (Russian Federation). Lab. of High Energy; Bunyatova, E.I. [Laboratory of Nuclear Problems, JINR, 141980 Dubna, Moscow Region (Russian Federation); Burinov, V.F. [Laboratory of Nuclear Problems, JINR, 141980 Dubna, Moscow Region (Russian Federation); Chernykh, E.V. [Joint Inst. for Nuclear Research, Dubna (Russian Federation). Lab. of High Energy; Dolgii, S.A. [Joint Inst. for Nuclear Research, Dubna (Russian Federation). Lab. of High Energy; Durand, G. [CEA-DAPNIA, CE Saclay, F-91191 Gif sur Yvette Cedex (France); Dzyubak, A.P. [Kharkov Institute of Physics and Technology, Academicheskaya str. 1, 310108 Kharkov (Ukraine); Fedorov, A.N. [Laboratory of Particle Physics, JINR, 141980 Dubna, Moscow Region (Russian Federation); Fimushkin, V.V. [Joint Inst. for Nuclear Research, Dubna (Russian Federation). Lab. of High Energy; Fontaine, J.M. [Laboratoire National SATURNE, CNRS/IN2P3 and CEA/DSM, CE Saclay, F-91191 Gif sur Yvette Cedex (France); Glagolev, V.V. [Joint Inst. for Nuclear Research, Dubna (Russian Federation). Lab. of High Energy; Golovanov, L.B.

    1996-06-01

    Results of the total cross section difference {Delta}{sigma} {sub L} in a np transmission experiment at 1.19, 2.49 and 3.65 GeV incident neutron beam kinetic energies are presented. Measurements were performed at the Synchrophasotron of the Laboratory of High Energies of the Joint Institute for Nuclear Research in Dubna. Results were obtained with a polarized beam of free quasi-monochromatic neutrons passing through the new Dubna frozen spin proton target. The beam and target polarizations were oriented longitudinally. The present results were obtained at the highest energies of free polarized neutrons that can be reached at present. They extend the energy range of existing results from PSI, LAMPF and Saclay measured between 0.066 and 1.10 GeV. The new results are compared with {Delta}{sigma} {sub L} (pn) data determined as a difference between {Delta}{sigma} {sub L} (pd) and {Delta}{sigma} {sub L} (pp) ANL-ZGS measurements. The values of {Delta}{sigma} {sub L} for the isospin state I=0 were deduced using known pp data. (orig.). With 5 figs., 7 tabs.

  4. 46 CFR 249.7 - Approval.

    Science.gov (United States)

    2010-10-01

    ... ADMINISTRATION, DEPARTMENT OF TRANSPORTATION REGULATIONS AFFECTING SUBSIDIZED VESSELS AND OPERATORS APPROVAL OF... country, and on the principle of reciprocal non-discrimination. MARAD will not approve access to the U.S... applicant's home country. (b) MARAD will publish in the Federal Register each Notice of Application received...

  5. 7 CFR 249.6 - Participant eligibility.

    Science.gov (United States)

    2010-01-01

    ... Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS SENIOR FARMERS' MARKET NUTRITION PROGRAM (SFMNP) Participant Eligibility... congregate nutrition services are provided, as categorically eligible to receive SFMNP benefits. (2...

  6. 249-IJBCS-Article-Dr Adomou Aristide

    African Journals Online (AJOL)

    Dr Gatsing

    La présente étude s'inscrit dans le cadre de l'évaluation des ressources biologiques de la forêt marécageuse de Lokoli en république du Bénin en vue de définir les stratégies pour sa conservation durable. Le SIG a permis de réaliser la carte de végétation de la forêt qui a servi de base pour la collecte de données.

  7. 7 CFR 249.2 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... health; and (ii) Encourage participants to build healthful eating patterns, and to take action for good... distribution point (such as a local senior center) or through some type of home delivery network. Community.... Fiscal year means the period of 12 calendar months beginning October 1 of any calendar year and ending...

  8. 32 CFR 249.3 - Definitions.

    Science.gov (United States)

    2010-07-01

    ...”), whether performed by universities or industry or (b) funded by budget Category 6.2 (“Exploratory Development”) and performed on-campus at a university. The research shall not be considered fundamental in... disclosing performance characterics of military systems or manufacturing technologies that are unique and...

  9. 32 CFR 249.4 - Policy.

    Science.gov (United States)

    2010-07-01

    ... engineering performed under contract or grant at colleges, universities, and non-government laboratories is... release promotes mutual security or advances the interests of an international military agreement or...

  10. Publications | Page 249 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Unsafe sexual activities of these migrants in India, such as frequent visits to brothels, lead to a. ... The Special Programme for Research and Training in Tropical Diseases (TDR) of the WHO developed the “eco-bio-social” concept, combining ecological, biological, and social perspectives “to better understand transmission ...

  11. 249 Marriage Counselling in Multicultural Society, Nigerian ...

    African Journals Online (AJOL)

    User

    2012-01-24

    Jan 24, 2012 ... can be applied in marriage in the society with different culture, beliefs, norms and environment. This is because ... problems facing the multicultural counselling which include cultural bias among counsellor, lack of .... recognize that counselling techniques may be culture-bound. They should be able to send ...

  12. Reference: 249 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available sis of amylopectin in Arabidopsis thaliana leaves. 3 398-412 16045475 2005 Aug The Plant journal Ball Stev...en|Berbezy Pierre|Chatterjee Manash|Colonna Paul|D'Hulst Christophe|Delvall辿 David|

  13. 14 CFR 249.4 - Photographic copies.

    Science.gov (United States)

    2010-01-01

    ... easily read and that can be reproduced in paper similar in size to an original without loss of clarity or... having personal knowledge of these facts. Where the microfilm is computer output, the microfilm...

  14. Solution of the Skyrme-Hartree-Fock-Bogolyubov equations in the Cartesian deformed harmonic-oscillator basis.. (VII) HFODD (v2.49t): A new version of the program

    Science.gov (United States)

    Schunck, N.; Dobaczewski, J.; McDonnell, J.; Satuła, W.; Sheikh, J. A.; Staszczak, A.; Stoitsov, M.; Toivanen, P.

    2012-01-01

    We describe the new version (v2.49t) of the code HFODD which solves the nuclear Skyrme-Hartree-Fock (HF) or Skyrme-Hartree-Fock-Bogolyubov (HFB) problem by using the Cartesian deformed harmonic-oscillator basis. In the new version, we have implemented the following physics features: (i) the isospin mixing and projection, (ii) the finite-temperature formalism for the HFB and HF + BCS methods, (iii) the Lipkin translational energy correction method, (iv) the calculation of the shell correction. A number of specific numerical methods have also been implemented in order to deal with large-scale multi-constraint calculations and hardware limitations: (i) the two-basis method for the HFB method, (ii) the Augmented Lagrangian Method (ALM) for multi-constraint calculations, (iii) the linear constraint method based on the approximation of the RPA matrix for multi-constraint calculations, (iv) an interface with the axial and parity-conserving Skyrme-HFB code HFBTHO, (v) the mixing of the HF or HFB matrix elements instead of the HF fields. Special care has been paid to using the code on massively parallel leadership class computers. For this purpose, the following features are now available with this version: (i) the Message Passing Interface (MPI) framework, (ii) scalable input data routines, (iii) multi-threading via OpenMP pragmas, (iv) parallel diagonalization of the HFB matrix in the simplex-breaking case using the ScaLAPACK library. Finally, several little significant errors of the previous published version were corrected. New version program summaryProgram title:HFODD (v2.49t) Catalogue identifier: ADFL_v3_0 Program summary URL:http://cpc.cs.qub.ac.uk/summaries/ADFL_v3_0.html Program obtainable from: CPC Program Library, Queen's University, Belfast, N. Ireland Licensing provisions: GNU General Public Licence v3 No. of lines in distributed program, including test data, etc.: 190 614 No. of bytes in distributed program, including test data, etc.: 985 898 Distribution

  15. Global, regional, and national life expectancy, all-cause mortality, and cause-specific mortality for 249 causes of death, 1980-2015: a systematic analysis for the Global Burden of Disease Study 2015.

    Science.gov (United States)

    2016-10-08

    Improving survival and extending the longevity of life for all populations requires timely, robust evidence on local mortality levels and trends. The Global Burden of Disease 2015 Study (GBD 2015) provides a comprehensive assessment of all-cause and cause-specific mortality for 249 causes in 195 countries and territories from 1980 to 2015. These results informed an in-depth investigation of observed and expected mortality patterns based on sociodemographic measures. We estimated all-cause mortality by age, sex, geography, and year using an improved analytical approach originally developed for GBD 2013 and GBD 2010. Improvements included refinements to the estimation of child and adult mortality and corresponding uncertainty, parameter selection for under-5 mortality synthesis by spatiotemporal Gaussian process regression, and sibling history data processing. We also expanded the database of vital registration, survey, and census data to 14 294 geography-year datapoints. For GBD 2015, eight causes, including Ebola virus disease, were added to the previous GBD cause list for mortality. We used six modelling approaches to assess cause-specific mortality, with the Cause of Death Ensemble Model (CODEm) generating estimates for most causes. We used a series of novel analyses to systematically quantify the drivers of trends in mortality across geographies. First, we assessed observed and expected levels and trends of cause-specific mortality as they relate to the Socio-demographic Index (SDI), a summary indicator derived from measures of income per capita, educational attainment, and fertility. Second, we examined factors affecting total mortality patterns through a series of counterfactual scenarios, testing the magnitude by which population growth, population age structures, and epidemiological changes contributed to shifts in mortality. Finally, we attributed changes in life expectancy to changes in cause of death. We documented each step of the GBD 2015 estimation

  16. Neutron Protection Factor Determination and Validation for a Vehicle Surrogate Using a Californium Fission Source

    Science.gov (United States)

    2017-06-01

    a 4 mm x 4 mm (0.157" x 0.157") LiI(Eu) crystal with 96% enrichment of lithium -6. The crystal is connected to a photomultiplier tube (PMT) which...32 Figure 17. Lithium -6 Iodide, Europium Doped Scintillation Detector. Source: [27...Alamos National Laboratory LiI(Eu) Lithium Iodide Europium Doped LLD Low Level Discriminator LLNL Lawrence Livermore National Laboratory MASH Monte

  17. ¿Serían la Guardia, Tutela y Curatela Bienes Jurídicos Penales? Un Análisis Crítico de los Arts. 248 y 249 del CP a la Luz de la Exclusiva Protección de Bienes Jurídicos

    Directory of Open Access Journals (Sweden)

    Gerson Faustino Rosa

    2015-12-01

    Full Text Available El presente trabajo tiene por objeto el análisis crítico y la explotación de un importante problema político-criminal de la actualidad: la criminalización de conductas que afrontan la guarda, la tutela y la curatela en el Código Penal, en sus artículos 248 y 249, lo que ya no tiene sentido ante la actual función del sistema penal, criticándose la actividad desenfrenada del Poder Legislativo, que produce ley espenales que no protegen bien jurídico alguno,oque salvaguardan bienes pasibles de protección por otras esferas del Derecho, valiéndose de la fuerza simbólico-comunicativa del Derecho Penal de forma desnecesaria, ampliando demasiadamente el alcance de la pena criminal, hasta el punto de vulgarizar todo el sistema jurídico penalenrazón de su uso indiscriminado. Paraello, enprimer plano,este estudio trata de la política criminal relativa a la libre planificación familiar, criticando la intervención estatal en cuestiones familiares, como ocurre en el Código Penal de 1940, destacando la necesidad de respetarse los principios de intervención mínima y de proporcionalidad antes de que el legislador se valga de la injerencia penal para la protección de cualquier bien jurídico. Más adelante, se presenta la importancia del bien jurídico-penal, con énfasis en la familia como bien jurídico categorial, especialmente la guardia, tutela y curatela, supuestamente lesionadas por los delitos de los artículos 248 y 249 del Código Penal. Así, se analizan brevemente los tipos penales citados, criticándose dicha criminalización, teniéndose en cuenta que tales tipos son subsidiarios, perfectamente prescindibles en el ordenamiento jurídico-penal y pasibles de salvaguardia por el Derecho Civil, que en la solución de los conflictos familiares se muestra mucho más eficaz que la intervención penal.

  18. Quality Circles: Applications in Vocational Education. Information Series No. 249.

    Science.gov (United States)

    Lloyd, Russell F.; Rehg, Virgil R.

    A strategy for increasing worker participation in an effort to remedy the problems of declining productivity and quality is the quality circles concept. The quality circles process involves small groups of employees who meet voluntarily on a regular basis to identify, analyze, and develop solutions to problems and to implement the solutions when…

  19. Dicty_cDB: VSH249 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available o Acid sequence lgtrdppcxvdprrprxawakklhfnnsnsy*nvwfyi*rpfsstsr*n*rwfkrpkntr wwwwwwwwyfskwwcspww*RILNVVLTLFC...wakklhfnnsnsy*nvwfyi*rpfsstsr*n*rwfkrpkntr wwwwwwwwyfskwwcspww*RILNVVLTLFCYNSIIIIKSNKIIIFGSSSILKKK--- ---QKN...vflqmvvlplvvkdsqcsfnfillqfdnyy*ik*nyyiwfifyfkkk--- ---kklhfnnsnsy*nvwfyi*rpfsstsr*n*rwfkrpkntrwwwwwwwwyfskww

  20. Dicty_cDB: VSI249 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available /VSB8-B/VSB825Q.Seq.d/ 278 5e-74 SLE471 (SLE471Q) /CSM/SL/SLE4-C/SLE471Q.Seq.d/ 2...egetative cDNA clone:VS... 278 3e-71 2 ( AU061502 ) Dictyostelium discoideum slug cDNA, clone SLE471. 256 2e...-64 2 ( AU035001 ) Dictyostelium discoideum slug cDNA, clone SLE471. 168 2e-38 2 ( BJ438537 ) Dictyostelium

  1. 7 CFR 2.49 - Administrator, Rural Housing Service.

    Science.gov (United States)

    2010-01-01

    ... wage and labor standards applicable to covered work; and emergency procurement powers; (iii) Section 104(i)(11) of the Act (42 U.S.C. 9604(i)(11)), with respect to the reduction of exposure to..., as amended (42 U.S.C. 7401 et seq.); (v) Noise Control Act of 1972, as amended (42 U.S.C. 4901 et seq...

  2. Dicty_cDB: VFE249 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Translated Amino Acid sequence ff*th*HINNIYLSIHTPKVFILMAEITISIENENFIQVNLQPDQTVEDLKRRVEFETTI LVNNQVLTLDG...NQYASESNIQTLIGLGCSRDKAIRLLTQAKGNVDVAA Frame B: ff*th*HINNIYLSIHTPKVFILMAEITISIENENFIQVNLQPDQTVEDLKRRVEFETTI LVNNQVLTLDG

  3. Dicty_cDB: SFG249 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 1e-10 EF564002_1( EF564002 |pid:none) Phytophthora ramorum cellulose syn... 66 2e-09 EF563993_1( EF563993...3e-09 EF564001_1( EF564001 |pid:none) Phytophthora ramorum cellulose syn... 65 5e-09 EF563994_1( EF563994...1e-08 EF564004_1( EF564004 |pid:none) Phytophthora ramorum cellulose syn... 63 2e-08 protein update 2009

  4. 7 CFR 249.24 - Data safeguarding procedures.

    Science.gov (United States)

    2010-01-01

    ... Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS SENIOR FARMERS' MARKET NUTRITION PROGRAM (SFMNP) Miscellaneous Provisions... authority) that administer food, nutrition, or other assistance programs that serve persons categorically...

  5. 7 CFR 249.17 - Management evaluations and reviews.

    Science.gov (United States)

    2010-01-01

    ....17 Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS SENIOR FARMERS' MARKET NUTRITION PROGRAM (SFMNP... SFMNP and the WIC Farmers' Market Nutrition Program are in operation, these reviews may be coordinated...

  6. 7 CFR 249.23 - Records and reports.

    Science.gov (United States)

    2010-01-01

    ... representatives of FNS of the Comptroller General of the United States to inspect, audit, and copy. Any reports... reports. State agencies must submit financial and SFMNP performance data on a yearly basis as specified by... programs. (c) Source documentation. To be acceptable for audit purposes, all financial and SFMNP...

  7. Dicty_cDB: SFF249 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 67E10.y2 949 - Juvenile leaf and shoot cDNA from Steve Moose Zea mays cDNA, mRNA sequence. 42 5e-13 4 CA2696... mRNA sequence. 42 1e-12 4 BI478599 |BI478599.1 949067E10.x1 949 - Juvenile leaf and shoot cDNA from Steve M

  8. Maternal and perinatal mortality figures in 249 South African ...

    African Journals Online (AJOL)

    Objective. To detennine maternal and perinatal mortalrty ratios in a large number of South African hospitals and assess the differences in mortality figures among the main ethnic groups. Design. Questionnaire survey involving confidential reports on maternal and perinatal deaths submitted over the 5-year period 1988 ...

  9. Dicty_cDB: CFD249 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available QWPARNHATALRAGTVSFYLSPKMTSDAPADPSQDVFFQNSIHSSPFGNC--- ---YPQRPSREEFQREERQRDQEEQAIRRKRQNDEYLELQREKEREQMQRDIERKAAAEE ...QWPARNHATALRAGTVSFYLSPKMTSDAPADPSQDVFFQNSIHSSPFGNC--- ---YPQRPSREEFQREERQRDQEEQAIRRKRQNDEYLELQREKEREQMQRDIERKAAAEE

  10. 40 CFR 180.249 - Alachlor; tolerances for residues.

    Science.gov (United States)

    2010-07-01

    ... 0.02 Horse, meat 0.02 Milk 0.02 Peanut 0.5 Poultry, fat 0.02 Poultry, meat byproducts 0.02 Poultry, meat 0.02 Sheep, fat 0.02 Sheep, meat byproducts 0.02 Sheep, meat 0.02 Sorghum grain, forage 2.0...

  11. All projects related to | Page 249 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    2012-04-01

    Research on how the interactions between and among institutions can affect developing countries' ability to implement regulatory goals and reforms will shed light on the neglected field of law and development. Start Date: April 1, 2012. End Date: January 1, 2015. Topic: INSTITUTION BUILDING, EVALUATION ...

  12. Dicty_cDB: SHJ249 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available |AX251183.1 Sequence 151 from Patent WO0168912. 50 2e-05 3 BD452704 |BD452704.1 Diagnosis of Diseases... |BD460593.1 Diagnosis of Diseases Associated with Cell Cycle. 36 0.011 4 dna upd

  13. Dicty_cDB: SSC249 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available fo... 199 4e-50 AJ278864_1( AJ278864 |pid:none) Digitalis lanata partial mRNA for ... 192 4e-48 FJ941827_1(...dismutase... 187 1e-46 AJ278863_1( AJ278863 |pid:none) Digitalis lanata partial mRNA for ... 187 2e-46 protein

  14. 48 CFR 52.249-14 - Excusable Delays.

    Science.gov (United States)

    2010-10-01

    ... under its terms if the failure arises from causes beyond the control and without the fault or negligence of the Contractor. Examples of these causes are (1) acts of God or of the public enemy, (2) acts of the Government in either its sovereign or contractual capacity, (3) fires, (4) floods, (5) epidemics...

  15. 48 CFR 2152.249-70 - Renewal and termination.

    Science.gov (United States)

    2010-10-01

    ... the Contractor for any increased costs of performance that result from the Government's failure to..., FEDERAL EMPLOYEES GROUP LIFE INSURANCE FEDERAL ACQUISITION REGULATION CLAUSES AND FORMS PRECONTRACT... Services” clause at 2152.237-70. The Contractor is not required to continue performance subsequent to OPM's...

  16. 14 CFR 249.3 - Preservation of records.

    Science.gov (United States)

    2010-01-01

    ... accurate. This statement shall be executed by a person having personal knowledge of the facts contained in... in readable form without loss of clarity. Authorized representatives of the DOT shall be given...

  17. Dicty_cDB: VSG249 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Botrytis cinerea strain T4 cDNA library under conditions of nitrogen deprivation. 84 2e-14 2 AL116009...Botrytis cinerea strain T4 cDNA library under conditions of nitrogen deprivation. 84 2e-14 2 AL115603...Botrytis cinerea strain T4 cDNA library under conditions of nitrogen deprivation. 84 2e-14 2 AL112083...Botrytis cinerea strain T4 cDNA library under conditions of nitrogen deprivation. 84 2e-14 2 AL112069...Botrytis cinerea strain T4 cDNA library under conditions of nitrogen deprivation. 84 2e-14 2 AL111042

  18. Dicty_cDB: VFL249 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available n clp-1; EC=3.4.22.-; &L2... 51 7e-05 BC169895_1( BC169895 |pid:none) Xenopus laevis calpain, mRNA (cDNA... ...51 9e-05 BC169897_1( BC169897 |pid:none) Xenopus laevis calpain, mRNA (cDNA... 51 9e-05 AB016726_1( AB016726

  19. Dicty_cDB: AFL249 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CQENGLVPIVEPEILMDGNHTVEQSAEVTEKVLAAVFKA LNDHHILLEGALLKPNMVVNGTDCPIKATSEQIGKFTVRTLQRTVPPALTGVVFLSGGQT...CQENGLVPIVEPEILMDGNHTVEQSAEVTEKVLAAVFKA LNDHHILLEGALLKPNMVVNGTDCPIKATSEQIGKFTVRTLQRTVPPALTGVVFLSGGQT

  20. Measurements of the neutron capture cross sections and incineration potentials of minor-actinides in high thermal neutron fluxes: Impact on the transmutation of nuclear wastes; Mesures des sections efficaces de capture et potentiels d'incineration des actinides mineurs dans les hauts flux de neutrons: Impact sur la transmutation des dechets

    Energy Technology Data Exchange (ETDEWEB)

    Bringer, O

    2007-10-15

    This thesis comes within the framework of minor-actinide nuclear transmutation studies. First of all, we have evaluated the impact of minor actinide nuclear data uncertainties within the cases of {sup 241}Am and {sup 237}Np incineration in three different reactor spectra: EFR (fast), GT-MHR (epithermal) and HI-HWR (thermal). The nuclear parameters which give the highest uncertainties were thus highlighted. As a result of fact, we have tried to reduce data uncertainties, in the thermal energy region, for one part of them through experimental campaigns in the moderated high intensity neutron fluxes of ILL reactor (Grenoble). These measurements were focused onto the incineration and transmutation of the americium-241, the curium-244 and the californium-249 isotopes. Finally, the values of 12 different cross sections and the {sup 241}Am isomeric branching ratio were precisely measured at thermal energy point. (author)

  1. Teaching Children to be Mathematicians vs. Teaching About Mathematics. Artificial Intelligence Memo Number 249.

    Science.gov (United States)

    Papert, Seymour

    Children will become more proficient in mathematics if they do mathematics rather than merely learn about mathematics. Once educators overcome the misconception that the average student can't do math, they can develop new mathematical activities for children, such as those invented by the staff of the Artificial Intelligence Laboratory at…

  2. Association analyses of 249,796 individuals reveal 18 new loci associated with body mass index

    NARCIS (Netherlands)

    Speliotes, Elizabeth K.; Willer, Cristen J.; Berndt, Sonja I.; Monda, Keri L.; Thorleifsson, Gudmar; Jackson, Anne U.; Allen, Hana Lango; Lindgren, Cecilia M.; Luan, Jian'an; Maegi, Reedik; Randall, Joshua C.; Vedantam, Sailaja; Winkler, Thomas W.; Qi, Lu; Workalemahu, Tsegaselassie; Heid, Iris M.; Steinthorsdottir, Valgerdur; Stringham, Heather M.; Weedon, Michael N.; Wheeler, Eleanor; Wood, Andrew R.; Ferreira, Teresa; Weyant, Robert J.; Segre, Ayellet V.; Estrada, Karol; Liang, Liming; Nemesh, James; Park, Ju-Hyun; Gustafsson, Stefan; Kilpelaenen, Tuomas O.; Yang, Jian; Bouatia-Naji, Nabila; Esko, Tonu; Feitosa, Mary F.; Kutalik, Zoltan; Mangino, Massimo; Raychaudhuri, Soumya; Scherag, Andre; Smith, Albert Vernon; Welch, Ryan; Zhao, Jing Hua; Aben, Katja K.; Absher, Devin M.; Amin, Najaf; Dixon, Anna L.; Fisher, Eva; Glazer, Nicole L.; Goddard, Michael E.; Heard-Costa, Nancy L.; Hoesel, Volker; Hottenga, Jouke-Jan; Johansson, Asa; Johnson, Toby; Ketkar, Shamika; Lamina, Claudia; Li, Shengxu; Moffatt, Miriam F.; Myers, Richard H.; Narisu, Narisu; Perry, John R. B.; Peters, Marjolein J.; Preuss, Michael; Ripatti, Samuli; Rivadeneira, Fernando; Sandholt, Camilla; Scott, Laura J.; Timpson, Nicholas J.; Tyrer, Jonathan P.; van Wingerden, Sophie; Watanabe, Richard M.; White, Charles C.; Wiklund, Fredrik; Barlassina, Christina; Chasman, Daniel I.; Cooper, Matthew N.; Jansson, John-Olov; Lawrence, Robert W.; Pellikka, Niina; Prokopenko, Inga; Shi, Jianxin; Thiering, Elisabeth; Alavere, Helene; Alibrandi, Maria T. S.; Almgren, Peter; Arnold, Alice M.; Aspelund, Thor; Atwood, Larry D.; Balkau, Beverley; Balmforth, Anthony J.; Bennett, Amanda J.; Ben-Shlomo, Yoav; Bergman, Richard N.; Bergmann, Sven; Biebermann, Heike; Blakemore, Alexandra I. F.; Boes, Tanja; Bonnycastle, Lori L.; Bornstein, Stefan R.; Brown, Morris J.; Buchanan, Thomas A.; Busonero, Fabio; Campbell, Harry; Cappuccio, Francesco P.; Cavalcanti-Proenca, Christine; Chen, Yii-Der Ida; Chen, Chih-Mei; Chines, Peter S.; Clarke, Robert; Coin, Lachlan; Connell, John; Day, Ian N. M.; den Heijer, Martin; Duan, Jubao; Ebrahim, Shah; Elliott, Paul; Elosua, Roberto; Eiriksdottir, Gudny; Erdos, Michael R.; Eriksson, Johan G.; Facheris, Maurizio F.; Felix, Stephan B.; Fischer-Posovszky, Pamela; Folsom, Aaron R.; Friedrich, Nele; Freimer, Nelson B.; Fu, Mao; Gaget, Stefan; Gejman, Pablo V.; Geus, Eco J. C.; Gieger, Christian; Gjesing, Anette P.; Goel, Anuj; Goyette, Philippe; Grallert, Harald; Graessler, Juergen; Greenawalt, Danielle M.; Groves, Christopher J.; Gudnason, Vilmundur; Guiducci, Candace; Hartikainen, Anna-Liisa; Hassanali, Neelam; Hall, Alistair S.; Havulinna, Aki S.; Hayward, Caroline; Heath, Andrew C.; Hengstenberg, Christian; Hicks, Andrew A.; Hinney, Anke; Hofman, Albert; Homuth, Georg; Hui, Jennie; Igl, Wilmar; Iribarren, Carlos; Isomaa, Bo; Jacobs, Kevin B.; Jarick, Ivonne; Jewell, Elizabeth; John, Ulrich; Jorgensen, Torben; Jousilahti, Pekka; Jula, Antti; Kaakinen, Marika; Kajantie, Eero; Kaplan, Lee M.; Kathiresan, Sekar; Kettunen, Johannes; Kinnunen, Leena; Knowles, Joshua W.; Kolcic, Ivana; Koenig, Inke R.; Koskinen, Seppo; Kovacs, Peter; Kuusisto, Johanna; Kraft, Peter; Kvaloy, Kirsti; Laitinen, Jaana; Lantieri, Olivier; Lanzani, Chiara; Launer, Lenore J.; Lecoeur, Cecile; Lehtimaeki, Terho; Lettre, Guillaume; Liu, Jianjun; Lokki, Marja-Liisa; Lorentzon, Mattias; Luben, Robert N.; Ludwig, Barbara; Manunta, Paolo; Marek, Diana; Marre, Michel; Martin, Nicholas G.; McArdle, Wendy L.; McCarthy, Anne; McKnight, Barbara; Meitinger, Thomas; Melander, Olle; Meyre, David; Midthjell, Kristian; Montgomery, Grant W.; Morken, Mario A.; Morris, Andrew P.; Mulic, Rosanda; Ngwa, Julius S.; Nelis, Mari; Neville, Matt J.; Nyholt, Dale R.; O'Donnell, Christopher J.; O'Rahilly, Stephen; Ong, Ken K.; Oostra, Ben; Pare, Guillaume; Parker, Alex N.; Perola, Markus; Pichler, Irene; Pietilaeinen, Kirsi H.; Platou, Carl G. P.; Polasek, Ozren; Pouta, Anneli; Rafelt, Suzanne; Raitakari, Olli; Rayner, Nigel W.; Ridderstrale, Martin; Rief, Winfried; Ruokonen, Aimo; Robertson, Neil R.; Rzehak, Peter; Salomaa, Veikko; Sanders, Alan R.; Sandhu, Manjinder S.; Sanna, Serena; Saramies, Jouko; Savolainen, Markku J.; Scherag, Susann; Schipf, Sabine; Schreiber, Stefan; Schunkert, Heribert; Silander, Kaisa; Sinisalo, Juha; Siscovick, David S.; Smit, Jan H.; Soranzo, Nicole; Sovio, Ulla; Stephens, Jonathan; Surakka, Ida; Swift, Amy J.; Tammesoo, Mari-Liis; Tardif, Jean-Claude; Teder-Laving, Maris; Teslovich, Tanya M.; Thompson, John R.; Thomson, Brian; Toenjes, Anke; Tuomi, Tiinamaija; van Meurs, Joyce B. J.; van Ommen, Gert-Jan; Vatin, Vincent; Viikari, Jorma; Visvikis-Siest, Sophie; Vitart, Veronique; Vogel, Carla I. G.; Voight, Benjamin F.; Waite, Lindsay L.; Wallaschofski, Henri; Walters, G. Bragi; Widen, Elisabeth; Wiegand, Susanna; Wild, Sarah H.; Willemsen, Gonneke; Witte, Daniel R.; Witteman, Jacqueline C.; Xu, Jianfeng; Zhang, Qunyuan; Zgaga, Lina; Ziegler, Andreas; Zitting, Paavo; Beilby, John P.; Farooqi, I. Sadaf; Hebebrand, Johannes; Huikuri, Heikki V.; James, Alan L.; Kaehoenen, Mika; Levinson, Douglas F.; Macciardi, Fabio; Nieminen, Markku S.; Ohlsson, Claes; Palmer, Lyle J.; Ridker, Paul M.; Stumvoll, Michael; Beckmann, Jacques S.; Boeing, Heiner; Boerwinkle, Eric; Boomsma, Dorret I.; Caulfield, Mark J.; Chanock, Stephen J.; Collins, Francis S.; Cupples, L. Adrienne; Smith, George Davey; Erdmann, Jeanette; Froguel, Philippe; Greonberg, Henrik; Gyllensten, Ulf; Hall, Per; Hansen, Torben; Harris, Tamara B.; Hattersley, Andrew T.; Hayes, Richard B.; Heinrich, Joachim; Hu, Frank B.; Hveem, Kristian; Illig, Thomas; Jarvelin, Marjo-Riitta; Kaprio, Jaakko; Karpe, Fredrik; Khaw, Kay-Tee; Kiemeney, Lambertus A.; Krude, Heiko; Laakso, Markku; Lawlor, Debbie A.; Metspalu, Andres; Munroe, Patricia B.; Ouwehand, Willem H.; Pedersen, Oluf; Penninx, Brenda W.; Peters, Annette; Pramstaller, Peter P.; Quertermous, Thomas; Reinehr, Thomas; Rissanen, Aila; Rudan, Igor; Samani, Nilesh J.; Schwarz, Peter E. H.; Shuldiner, Alan R.; Spector, Timothy D.; Tuomilehto, Jaakko; Uda, Manuela; Uitterlinden, Andre; Valle, Timo T.; Wabitsch, Martin; Waeber, Gerard; Wareham, Nicholas J.; Watkins, Hugh; Wilson, James F.; Wright, Alan F.; Zillikens, M. Carola; Chatterjee, Nilanjan; McCarroll, Steven A.; Purcell, Shaun; Schadt, Eric E.; Visscher, Peter M.; Assimes, Themistocles L.; Borecki, Ingrid B.; Deloukas, Panos; Fox, Caroline S.; Groop, Leif C.; Haritunians, Talin; Hunter, David J.; Kaplan, Robert C.; Mohlke, Karen L.; O'Connell, Jeffrey R.; Peltonen, Leena; Schlessinger, David; Strachan, David P.; van Duijn, Cornelia M.; Wichmann, H-Erich; Frayling, Timothy M.; Thorsteinsdottir, Unnur; Abecasis, Goncalo R.; Barroso, Ines; Boehnke, Michael; Stefansson, Kari; North, Kari E.; McCarthy, Mark I.; Hirschhorn, Joel N.; Ingelsson, Erik; Loos, Ruth J. F.

    2010-01-01

    Obesity is globally prevalent and highly heritable, but its underlying genetic factors remain largely elusive. To identify genetic loci for obesity susceptibility, we examined associations between body mass index and similar to 2.8 million SNPs in up to 123,865 individuals with targeted follow up of

  3. Association analyses of 249,796 individuals reveal 18 new loci associated with body mass index

    NARCIS (Netherlands)

    E.K. Speliotes (Elizabeth); C.J. Willer (Cristen); S.I. Berndt (Sonja); K.L. Monda (Keri); G. Thorleifsson (Gudmar); A.U. Jackson (Anne); H.L. Allen; C.M. Lindgren (Cecilia); J. Luan; R. Mägi (Reedik); J.C. Randall (Joshua); S. Vedantam (Sailaja); T.W. Winkler (Thomas); L. Qi (Lu); T. Workalemahu (Tsegaselassie); I.M. Heid (Iris); V. Steinthorsdottir (Valgerdur); H.M. Stringham (Heather); E. Wheeler (Eleanor); A.R. Wood (Andrew); T. Ferreira (Teresa); R.J. Weyant (Robert); A.V. Segrè (Ayellet); K. Eestrada (Karol); L. Liang (Liming); J. Nemesh (James); J.H. Park; S. Gustafsson (Stefan); T.O. Kilpeläinen (Tuomas); J. Yang (Joanna); N. Bouatia-Naji (Nabila); T. Eesko (Tõnu); M.F. Feitosa (Mary Furlan); Z. Kutalik (Zoltán); M. Mangino (Massimo); S. Raychaudhuri (Soumya); A. Scherag (Andre); A.V. Smith (Albert Vernon); R.P. Welch (Ryan); J.H. Zhao (Jing Hua); K.K.H. Aben (Katja); D. Absher (Devin); N. Amin (Najaf); A.L. Dixon (Anna); E. Fisher (Eeva); N.L. Glazer (Nicole); M.E. Goddard (Michael); N.L. Heard-Costa (Nancy); V. Hoesel (Volker); J.J. Hottenga (Jouke Jan); A. Johansson (Åsa); T. Johnson (Toby); S. Ketkar (Shamika); C. Lamina (Claudia); S. Li (Shengxu); M.F. Moffatt (Miriam); R.H. Myers (Richard); N. Narisu (Narisu); J.R.B. Perry (John); M.J. Peters (Marjolein); M. Preuss (Michael); S. Ripatti (Samuli); F. Rivadeneira Ramirez (Fernando); C. Sandholt (Camilla); L.J. Scott (Laura); N.J. Timpson (Nicholas); J.P. Tyrer (Jonathan); S. van Wingerden (Sophie); C.C. White (Charles); F. Wiklund (Fredrik); C. Barlassina (Christina); D.I. Chasman (Daniel); M.N. Cooper (Matthew); J.O. Jansson; R.W. Lawrence (Robert); N. Pellikka (Niina); I. Prokopenko (Inga); J. Shi (Jianxin); E. Thiering (Eelisabeth); H. Alavere (Helene); M.T.S. Alibrandi (Maria); P. Almgren (Peter); A.M. Arnold (Alice); T. Aspelund (Thor); L.D. Atwood (Larry); B. Balkau (Beverley); A.J. Balmforth (Anthony); A.J. Bennett (Amanda); Y. Ben-Shlomo; R.N. Bergman (Richard); S.M. Bergmann (Sven); H. Biebermann (Heike); A.I.F. Blakemore (Alexandra); T. Boes (Tanja); L.L. Bonnycastle (Lori); S.R. Bornstein (Stefan); M.J. Brown (Morris); T.A. Buchanan (Thomas); F. Busonero; H. Campbell (Harry); F.P. Cappuccio (Francesco); C. Cavalcanti-Proença (Christine); Y.D.I. Chen (Yii-Der Ida); C.-M. Chen (Chih-Mei); P.S. Chines (Peter); R. Clarke; L. Coin (Lachlan); J. Connell (John); I.N.M. Day (Ian); M. den Heijer (Martin); J. Duan (Jubao); S. Eebrahim (Shah); P. Eelliott (Paul); R. Eelosua (Roberto); G. Eeiriksdottir (Gudny); M.R. Eerdos (Micheal); J.G. Eeriksson (Johan); M.F. Facheris (Maurizio); S.B. Felix (Stephan); P. Fischer-Posovszky (Pamela); A.R. Folsom (Aaron); N. Friedrich (Nele); N.B. Freimer (Nelson); M. Fu (Mao); S. Gaget (Stefan); P.V. Gejman (Pablo); E.J. Geus (Eeco); C. Gieger (Christian); A.P. Gjesing (Anette); A. Goel (Anuj); P. Goyette (Philippe); H. Grallert (Harald); J. Gräßler (Jürgen); D. Greenawalt (Danielle); C.J. Groves (Christopher); V. Gudnason (Vilmundur); C. Guiducci (Candace); A.L. Hartikainen; N. Hassanali (Neelam); A.S. Hall (Alistair); A.S. Havulinna (Aki); C. Hayward (Caroline); A.C. Heath (Andrew); C. Hengstenberg (Christian); A.A. Hicks (Andrew); A. Hinney (Anke); A. Hofman (Albert); G. Homuth (Georg); J. Hui (Jennie); W. Igl (Wilmar); C. Iribarren (Carlos); B. Isomaa (Bo); K.B. Jacobs (Kevin); I. Jarick (Ivonne); E. Jewell (Eelizabeth); U. John (Ulrich); T. Jørgensen (Torben); P. Jousilahti (Pekka); A. Jula (Antti); M. Kaakinen (Marika); E. Kajantie (Eero); R.C. Kaplan (Robert); S. Kathiresan (Sekar); J. Kettunen (Johannes); L. Kinnunen (Leena); J.W. Knowles (Joshua); I. Kolcic (Ivana); I.R. König (Inke); S. Koskinen (Seppo); P. Kovacs (Peter); J. Kusisto (Johanna); P. Kraft (Peter); K. Kvaløy (Kirsti); J. Laitinen (Jaana); O. Lantieri (Olivier); C. Lanzani (Chiara); L.J. Launer (Lenore); C. Lecoeur (Cécile); T. Lehtimäki (Terho); G. Lettre (Guillaume); J. Liu (Jianjun); M.L. Lokki; M. Lorentzon (Mattias); R.N. Luben (Robert); B. Ludwig (Barbara); P. Manunta (Paolo); D. Marek (Diana); M. Marre (Michel); N.G. Martin (Nicholas); W.L. McArdle (Wendy); M.I. McCarthy (Mark); B. McKnight (Barbara); T. Meitinger (Thomas); O. Melander (Olle); D. Meyre (David); K. Midthjell (Kristian); G.W. Montgomery (Grant); M.A. Morken (Mario); A.D. Morris (Andrew); R. Mulic (Rosanda); J.S. Ngwa; M. Nelis (Mari); M.J. Neville (Matthew); D.R. Nyholt (Dale); C.J. O'Ddonnell (Christopher); S. O'Rahilly (Stephen); K. Ong (Ken); B.A. Oostra (Ben); G. Paré (Guillaume); A.N. Parker (Alex); M. Perola (Markus); I. Pichler (Irene); K.H. Pietilainen (Kirsi Hannele); C.P. Platou (Carl); O. Polasek (Ozren); A. Pouta (Anneli); S. Rafelt (Suzanne); O. Raitakari (Olli); N.W. Rayner (Nigel William); M. Ridderstråle (Martin); W. Rief (Winfried); A. Ruokonen (Aimo); N.R. Robertson (Neil); P. Rzehak (Peter); V. Salomaa (Veikko); A.R. Sanders (Alan); M.S. Sandhu (Manjinder); S. Sanna (Serena); J. Saramies (Jouko); M.J. Savolainen (Markku); S. Schipf (Sabine); S. Schreiber (Stefan); H. Schunkert (Heribert); K. Silander (Kaisa); J. Sinisalo (Juha); D.S. Siscovick (David); J.H. Smit (Jan); N. Soranzo (Nicole); U. Sovio (Ulla); J. Stephens (Jonathan); I. Surakka (Ida); A.J. Swift (Amy); M.L. Tammesoo; J.-C. Tardif (Jean-Claude); M. Teder-Laving (Maris); T.M. Teslovich (Tanya); J.R. Thompson (John); B. Thomson (Brian); A. Tönjes (Anke); T. Tuomi (Tiinamaija); J.B.J. van Meurs (Joyce); G.J. van OMen; V. Vatin (Vincent); J. Viikari (Jorma); S. Visvikis-Siest (Sophie); V. Vitart (Veronique); C.I. Vogel (Carla); B.F. Voight (Benjamin); L. Waite (Lindsay); H. Wallaschofski (Henri); G.B. Walters (Bragi); E. Widen (Elisabeth); S. Wiegand (Susanna); S.H. Wild (Sarah); G.A.H.M. Willemsen (Gonneke); D.R. Witte (Deniel); J.C.M. Witteman (Jacqueline); J. Xu (Jianfeng); Q. Zhang (Qunyuan); L. Zgaga (Lina); A. Ziegler (Andreas); P. Zitting (Paavo); J.P. Beilby (John); I.S. FarOqi (Ssadaf); J. Hebebrand (Johannes); H.V. Huikuri (Heikki); A. James (Alan); M. Kähönen (Mika); D.F. Levinson (Douglas); F. MacCiardi (Fabio); M.S. Nieminen (Markku); C. Ohlsson (Claes); C. Palmer (Cameron); P.M. Ridker (Paul); M. Stumvoll (Michael); J.S. Beckmann (Jacques); H. Boeing (Heiner); E.A. Boerwinkle (Eric); D.I. Boomsma (Dorret); M. Caulfield (Mark); S.J. Chanock (Stephen); F.S. Collins (Francis); L.A. Cupples (Adrienne); J. Eerdmann (Jeanette); P. Frogue (Philippe); H. Grönberg (Henrik); U. Gyllensten (Ulf); T. Hansen (Torben); T.B. Harris (Tamara); A.T. Hattersley (Andrew); R.B. Hayes (Richard); J. Heinrich (Joachim); F.B. Hu (Frank); K. Hveem (Kristian); T. Illig (Thomas); M.R. Järvelin; J. Kaprio (Jaakko); F. Karpe (Fredrik); K-T. Khaw (Kay-Tee); L.A.L.M. Kiemeney (Bart); H. Krude; M. Laakso (Markku); D.A. Lawlor (Debbie); A. Metspalu (Andres); P. Munroe (Patricia); W.H. Ouwehand (Willem); O. Pedersen (Oluf); B.W.J.H. Penninx (Brenda); P.P. Pramstaller (Peter Paul); T. Quertermous (Thomas); T. Reinehr (Thomas); A. Rissanen (Aila); I. Rudan (Igor); N.J. Samani (Nilesh); P.E.H. Schwarz (Peter); A.R. Shuldiner (Alan); T.D. Spector (Timothy); J. Tuomilehto (Jaakko); M. Uda (Manuela); A.G. Uitterlinden (André); T.T. Valle (Timo); M. Wabitsch (Martin); G. Waeber (Gérard); N.J. Wareham (Nick); H. Watkins (Hugh); J.F. Wilson (James); A.F. Wright (Alan); M.C. Zillikens (Carola); N. ChatterjE (Nilanjan); S.A. McCarroll (Steve); S. Purcell (Shaun); E.E. Schadt (Eric); P.M. Visscher (Peter); T.L. Assimes (Themistocles); I.B. Borecki (Ingrid); P. Deloukas (Panagiotis); C.S. Fox (Caroline); L. Groop (Leif); T. Haritunians (Talin); D.J. Hunter (David); K.L. Mohlke (Karen); J.R. O'ConneL (Jeffrey); L. Peltonen (Leena Johanna); D. SchleSinger (David); D.P. Strachan (David); R.M. Watanabe (Richard); C.M. van Duijn (Cornelia); H.E. Wichmann (Heinz Erich); T.M. Frayling (Timothy); U. Thorsteinsdottir (Unnur); G.R. Abecasis (Gonçalo); M. Boehnke (Michael); K. StefanSon (Kari); K.E. North (Kari); M.I. McArthy (Mark); J.N. Hirschhorn (Joel); E. IngelSon (Erik); R.J.F. Loos (Ruth); M.N. Weedon (Michael)

    2010-01-01

    textabstractObesity is globaLy prevalent and highly heritable, but its underlying genetic factors remain largely elusive. To identify genetic loci for obesity susceptibility, we examined aSociations betwEn body maS index and ĝ̂1/42.8 miLion SNPs in up to 123,865 individuals with targeted foLow up of

  4. : tous les projets | Page 249 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Le nombre d'enfants aux prises avec des difficultés mentales est important et augmente à un rythme alarmant en Inde. Date de début : 23 septembre 2011. End Date: 29 octobre 2012. Sujet: MENTAL DISEASES, MENTALLY DISABLED, CHILDREN, INFORMATION TECHNOLOGY, COMPUTERS, COMPUTER PROGRAMS.

  5. Association analyses of 249,796 individuals reveal 18 new loci associated with body mass index

    DEFF Research Database (Denmark)

    Speliotes, Elizabeth K; Willer, Cristen J; Berndt, Sonja I

    2010-01-01

    Obesity is globally prevalent and highly heritable, but its underlying genetic factors remain largely elusive. To identify genetic loci for obesity susceptibility, we examined associations between body mass index and ~ 2.8 million SNPs in up to 123,865 individuals with targeted follow up of 42 SN...

  6. 249 The Effect of Inter-tribal Post Election Violence Conflict Trauma ...

    African Journals Online (AJOL)

    User

    result of inter-ethnic conflicts on academic performance among secondary school students in Mt Elgon District, ... Are students who were affected by the inter-tribal conflict likely to seek assistance in counseling? ... traumatic events (PTEs) and posttraumatic stress disorder (PTSD) which indicated that female participants ...

  7. Yadav et al., Afr J Tradit Complement Altern Med. (2014) 11(2):249 ...

    African Journals Online (AJOL)

    cadewumi

    Fawcett, 1960) uric acid (Fossati, 1980)) and creatinine (Bowers,. 1980). Liver function was assessed by monitoring bilirubin (modified Jendrassik and Grof's method, 1938), serum glutamate oxaloacetate transaminase (SGOT) and serum glutamate ...

  8. Page 1 Studies in the Fl ral Morphology of the Marantaceae—II 249 ...

    Indian Academy of Sciences (India)

    Vascular anatomy of the flower of Schumannianthus virgatus Rolfe, with special reference to the labellum,”. Canadian J. Bot., 1966, 44, 1365–70. ABBREVIATIONS USED. D, carpellary dorsal; DOS, carpellary dorsal-cum-outer staminal strand; IS, inner staminal strand; L. labellum; MS, median bundle of a sepal; N, nectary; ...

  9. 78 FR 12140 - Agency Information Collection; Activity Under OMB Review; Part 249 Preservation of Records

    Science.gov (United States)

    2013-02-21

    ..., industry and other governmental parties to comment on the continuing need for and usefulness of BTS.... FOR FURTHER INFORMATION CONTACT: Jeff Gorham, Office of Airline Information, RTS-42, Room E34, RITA...., Director, Office of Airline Information. BILLING CODE 4910-HY-P ...

  10. Association analyses of 249,796 individuals reveal eighteen new loci associated with body mass index

    Science.gov (United States)

    Speliotes, Elizabeth K.; Willer, Cristen J.; Berndt, Sonja I.; Monda, Keri L.; Thorleifsson, Gudmar; Jackson, Anne U.; Allen, Hana Lango; Lindgren, Cecilia M.; Luan, Jian’an; Mägi, Reedik; Randall, Joshua C.; Vedantam, Sailaja; Winkler, Thomas W.; Qi, Lu; Workalemahu, Tsegaselassie; Heid, Iris M.; Steinthorsdottir, Valgerdur; Stringham, Heather M.; Weedon, Michael N.; Wheeler, Eleanor; Wood, Andrew R.; Ferreira, Teresa; Weyant, Robert J.; Segré, Ayellet V.; Estrada, Karol; Liang, Liming; Nemesh, James; Park, Ju-Hyun; Gustafsson, Stefan; Kilpeläinen, Tuomas O.; Yang, Jian; Bouatia-Naji, Nabila; Esko, Tõnu; Feitosa, Mary F.; Kutalik, Zoltán; Mangino, Massimo; Raychaudhuri, Soumya; Scherag, Andre; Smith, Albert Vernon; Welch, Ryan; Zhao, Jing Hua; Aben, Katja K.; Absher, Devin M.; Amin, Najaf; Dixon, Anna L.; Fisher, Eva; Glazer, Nicole L.; Goddard, Michael E.; Heard-Costa, Nancy L.; Hoesel, Volker; Hottenga, Jouke-Jan; Johansson, Åsa; Johnson, Toby; Ketkar, Shamika; Lamina, Claudia; Li, Shengxu; Moffatt, Miriam F.; Myers, Richard H.; Narisu, Narisu; Perry, John R.B.; Peters, Marjolein J.; Preuss, Michael; Ripatti, Samuli; Rivadeneira, Fernando; Sandholt, Camilla; Scott, Laura J.; Timpson, Nicholas J.; Tyrer, Jonathan P.; van Wingerden, Sophie; Watanabe, Richard M.; White, Charles C.; Wiklund, Fredrik; Barlassina, Christina; Chasman, Daniel I.; Cooper, Matthew N.; Jansson, John-Olov; Lawrence, Robert W.; Pellikka, Niina; Prokopenko, Inga; Shi, Jianxin; Thiering, Elisabeth; Alavere, Helene; Alibrandi, Maria T. S.; Almgren, Peter; Arnold, Alice M.; Aspelund, Thor; Atwood, Larry D.; Balkau, Beverley; Balmforth, Anthony J.; Bennett, Amanda J.; Ben-Shlomo, Yoav; Bergman, Richard N.; Bergmann, Sven; Biebermann, Heike; Blakemore, Alexandra I.F.; Boes, Tanja; Bonnycastle, Lori L.; Bornstein, Stefan R.; Brown, Morris J.; Buchanan, Thomas A.; Busonero, Fabio; Campbell, Harry; Cappuccio, Francesco P.; Cavalcanti-Proença, Christine; Chen, Yii-Der Ida; Chen, Chih-Mei; Chines, Peter S.; Clarke, Robert; Coin, Lachlan; Connell, John; Day, Ian N.M.; den Heijer, Martin; Duan, Jubao; Ebrahim, Shah; Elliott, Paul; Elosua, Roberto; Eiriksdottir, Gudny; Erdos, Michael R.; Eriksson, Johan G.; Facheris, Maurizio F.; Felix, Stephan B.; Fischer-Posovszky, Pamela; Folsom, Aaron R.; Friedrich, Nele; Freimer, Nelson B.; Fu, Mao; Gaget, Stefan; Gejman, Pablo V.; Geus, Eco J.C.; Gieger, Christian; Gjesing, Anette P.; Goel, Anuj; Goyette, Philippe; Grallert, Harald; Gräßler, Jürgen; Greenawalt, Danielle M.; Groves, Christopher J.; Gudnason, Vilmundur; Guiducci, Candace; Hartikainen, Anna-Liisa; Hassanali, Neelam; Hall, Alistair S.; Havulinna, Aki S.; Hayward, Caroline; Heath, Andrew C.; Hengstenberg, Christian; Hicks, Andrew A.; Hinney, Anke; Hofman, Albert; Homuth, Georg; Hui, Jennie; Igl, Wilmar; Iribarren, Carlos; Isomaa, Bo; Jacobs, Kevin B.; Jarick, Ivonne; Jewell, Elizabeth; John, Ulrich; Jørgensen, Torben; Jousilahti, Pekka; Jula, Antti; Kaakinen, Marika; Kajantie, Eero; Kaplan, Lee M.; Kathiresan, Sekar; Kettunen, Johannes; Kinnunen, Leena; Knowles, Joshua W.; Kolcic, Ivana; König, Inke R.; Koskinen, Seppo; Kovacs, Peter; Kuusisto, Johanna; Kraft, Peter; Kvaløy, Kirsti; Laitinen, Jaana; Lantieri, Olivier; Lanzani, Chiara; Launer, Lenore J.; Lecoeur, Cecile; Lehtimäki, Terho; Lettre, Guillaume; Liu, Jianjun; Lokki, Marja-Liisa; Lorentzon, Mattias; Luben, Robert N.; Ludwig, Barbara; Manunta, Paolo; Marek, Diana; Marre, Michel; Martin, Nicholas G.; McArdle, Wendy L.; McCarthy, Anne; McKnight, Barbara; Meitinger, Thomas; Melander, Olle; Meyre, David; Midthjell, Kristian; Montgomery, Grant W.; Morken, Mario A.; Morris, Andrew P.; Mulic, Rosanda; Ngwa, Julius S.; Nelis, Mari; Neville, Matt J.; Nyholt, Dale R.; O’Donnell, Christopher J.; O’Rahilly, Stephen; Ong, Ken K.; Oostra, Ben; Paré, Guillaume; Parker, Alex N.; Perola, Markus; Pichler, Irene; Pietiläinen, Kirsi H.; Platou, Carl G.P.; Polasek, Ozren; Pouta, Anneli; Rafelt, Suzanne; Raitakari, Olli; Rayner, Nigel W.; Ridderstråle, Martin; Rief, Winfried; Ruokonen, Aimo; Robertson, Neil R.; Rzehak, Peter; Salomaa, Veikko; Sanders, Alan R.; Sandhu, Manjinder S.; Sanna, Serena; Saramies, Jouko; Savolainen, Markku J.; Scherag, Susann; Schipf, Sabine; Schreiber, Stefan; Schunkert, Heribert; Silander, Kaisa; Sinisalo, Juha; Siscovick, David S.; Smit, Jan H.; Soranzo, Nicole; Sovio, Ulla; Stephens, Jonathan; Surakka, Ida; Swift, Amy J.; Tammesoo, Mari-Liis; Tardif, Jean-Claude; Teder-Laving, Maris; Teslovich, Tanya M.; Thompson, John R.; Thomson, Brian; Tönjes, Anke; Tuomi, Tiinamaija; van Meurs, Joyce B.J.; van Ommen, Gert-Jan; Vatin, Vincent; Viikari, Jorma; Visvikis-Siest, Sophie; Vitart, Veronique; Vogel, Carla I. G.; Voight, Benjamin F.; Waite, Lindsay L.; Wallaschofski, Henri; Walters, G. Bragi; Widen, Elisabeth; Wiegand, Susanna; Wild, Sarah H.; Willemsen, Gonneke; Witte, Daniel R.; Witteman, Jacqueline C.; Xu, Jianfeng; Zhang, Qunyuan; Zgaga, Lina; Ziegler, Andreas; Zitting, Paavo; Beilby, John P.; Farooqi, I. Sadaf; Hebebrand, Johannes; Huikuri, Heikki V.; James, Alan L.; Kähönen, Mika; Levinson, Douglas F.; Macciardi, Fabio; Nieminen, Markku S.; Ohlsson, Claes; Palmer, Lyle J.; Ridker, Paul M.; Stumvoll, Michael; Beckmann, Jacques S.; Boeing, Heiner; Boerwinkle, Eric; Boomsma, Dorret I.; Caulfield, Mark J.; Chanock, Stephen J.; Collins, Francis S.; Cupples, L. Adrienne; Smith, George Davey; Erdmann, Jeanette; Froguel, Philippe; Grönberg, Henrik; Gyllensten, Ulf; Hall, Per; Hansen, Torben; Harris, Tamara B.; Hattersley, Andrew T.; Hayes, Richard B.; Heinrich, Joachim; Hu, Frank B.; Hveem, Kristian; Illig, Thomas; Jarvelin, Marjo-Riitta; Kaprio, Jaakko; Karpe, Fredrik; Khaw, Kay-Tee; Kiemeney, Lambertus A.; Krude, Heiko; Laakso, Markku; Lawlor, Debbie A.; Metspalu, Andres; Munroe, Patricia B.; Ouwehand, Willem H.; Pedersen, Oluf; Penninx, Brenda W.; Peters, Annette; Pramstaller, Peter P.; Quertermous, Thomas; Reinehr, Thomas; Rissanen, Aila; Rudan, Igor; Samani, Nilesh J.; Schwarz, Peter E.H.; Shuldiner, Alan R.; Spector, Timothy D.; Tuomilehto, Jaakko; Uda, Manuela; Uitterlinden, André; Valle, Timo T.; Wabitsch, Martin; Waeber, Gérard; Wareham, Nicholas J.; Watkins, Hugh; Wilson, James F.; Wright, Alan F.; Zillikens, M. Carola; Chatterjee, Nilanjan; McCarroll, Steven A.; Purcell, Shaun; Schadt, Eric E.; Visscher, Peter M.; Assimes, Themistocles L.; Borecki, Ingrid B.; Deloukas, Panos; Fox, Caroline S.; Groop, Leif C.; Haritunians, Talin; Hunter, David J.; Kaplan, Robert C.; Mohlke, Karen L.; O’Connell, Jeffrey R.; Peltonen, Leena; Schlessinger, David; Strachan, David P.; van Duijn, Cornelia M.; Wichmann, H.-Erich; Frayling, Timothy M.; Thorsteinsdottir, Unnur; Abecasis, Gonçalo R.; Barroso, Inês; Boehnke, Michael; Stefansson, Kari; North, Kari E.; McCarthy, Mark I.; Hirschhorn, Joel N.; Ingelsson, Erik; Loos, Ruth J.F.

    2010-01-01

    Obesity is globally prevalent and highly heritable, but the underlying genetic factors remain largely elusive. To identify genetic loci for obesity-susceptibility, we examined associations between body mass index (BMI) and ~2.8 million SNPs in up to 123,865 individuals, with targeted follow-up of 42 SNPs in up to 125,931 additional individuals. We confirmed 14 known obesity-susceptibility loci and identified 18 new loci associated with BMI (P<5×10−8), one of which includes a copy number variant near GPRC5B. Some loci (MC4R, POMC, SH2B1, BDNF) map near key hypothalamic regulators of energy balance, and one is near GIPR, an incretin receptor. Furthermore, genes in other newly-associated loci may provide novel insights into human body weight regulation. PMID:20935630

  11. 48 CFR 1652.249-72 - FEHBP termination for default-negotiated benefits contracts.

    Science.gov (United States)

    2010-10-01

    ... if the failure to perform the contract arises from causes beyond the control and without the fault or negligence of the Carrier. Examples of such causes include (1) acts of God or of the public enemy, (2) acts of the Government in either its sovereign or contractual capacity, (3) fires, (4) floods, (5...

  12. 48 CFR 52.249-10 - Default (Fixed-Price Construction).

    Science.gov (United States)

    2010-10-01

    ... under this clause, if— (1) The delay in completing the work arises from unforeseeable causes beyond the control and without the fault or negligence of the Contractor. Examples of such causes include (i) acts of..., (v) floods, (vi) epidemics, (vii) quarantine restrictions, (viii) strikes, (ix) freight embargoes, (x...

  13. 48 CFR 52.249-8 - Default (Fixed-Price Supply and Service).

    Science.gov (United States)

    2010-10-01

    ... Contractor shall not be liable for any excess costs if the failure to perform the contract arises from causes beyond the control and without the fault or negligence of the Contractor. Examples of such causes include... contractual capacity, (3) fires, (4) floods, (5) epidemics, (6) quarantine restrictions (7) strikes, (8...

  14. 48 CFR 52.249-9 - Default (Fixed-Price Research and Development).

    Science.gov (United States)

    2010-10-01

    ... Contractor shall not be liable for any excess costs if the failure to perform the contract arises from causes beyond the control and without the fault or negligence of the Contractor. Examples of such causes include... contractual capacity, (3) fires, (4) floods, (5) epidemics, (6) quarantine restrictions, (7) strikes, (8...

  15. 7 CFR 249.10 - Coupon, market, and CSA program management.

    Science.gov (United States)

    2010-01-01

    ... classroom settings, telephone conferences, videoconferences, and web-based training modules. (8) Authorized... ensuring on-site monitoring, conducting further investigation, and sanctioning of such farmers, farmers... the identity of the reviewer(s) or the integrity of the investigation. (iii) In instances where the...

  16. 249 The study examined the effect of climate change on the health ...

    African Journals Online (AJOL)

    Osondu

    The study examined the effect of climate change on the health of rural farmers in Offa, Kwara. State. Nigeria. For the purpose of achieving the objectives of the study Ninety-eight (98) respondents were randomly sampled from ten wards. Data were collected through interview scheduled couple with a well structured ...

  17. 14 CFR 249.20 - Preservation of records by certificated air carriers.

    Science.gov (United States)

    2010-01-01

    ... ledgers 3 years. (b) Indexes to general and subsidiary ledgers Do. 2. Journals and journal vouchers: (a) General and subsidiary journals, and journal vouchers 3 years. (b) Papers forming a part of, or necessary to explain, journal entries; entry numbers Do. 3. Voucher distribution registers or their equivalent...

  18. A retrospective study of californium-252 neutron brachytherapy combined with EBRT versus 3D-CRT in the treatment of esophageal squamous cell cancer.

    Science.gov (United States)

    Wang, Qifeng; Li, Tao; Lang, Jinyi; Wang, Jie; Wang, Jian; Liu, Huiming; Jia, Xitang; Liu, Bo; Wang, C-K Chris

    2015-10-24

    We conducted a retrospective analysis on 884 patients who were diagnosed with esophageal squamous cell carcinoma (ESCC) and treated with either the neutron brachytherapy in combination with external beam radiotherapy (NBT + EBRT) or 3-dimensional conformal radiation therapy (3D-CRT) to determine the differences in efficacy and morbidity between the two treatment groups. The 884 ESCC patients treated with either NBT + EBRT or 3D-CRT between 2002 and 2012 were retrospectively reviewed and analyzed. Multivariable Cox regression was used to compare oncologic outcomes of the two groups of patients in the context of other clinically relevant variables. The acute and chronic toxicities associated with the two groups were compared using Fisher exact and log-rank tests, respectively. Among the 884 patients, 545 received NBT + EBRT and 339 received 3D-CRT (i.e. EBRT-only). The age range is 39-95 years (median 66). The follow-up time range is 3-145 months (median 32). The analysis shows that the NBT + EBRT group has higher overall survival rate and local control rate than that of the 3D-CRT group. The acute toxicity effects were acceptable for both groups of patients with the NBT + EBRT group showing higher rates of leukopenia and thrombocytopenia and the 3D-CRT group showing higher rates on fistula and massive bleeding. The patients treated with NBT + EBRT showed better oncologic outcomes than those treated with 3D-CRT. The toxicity effects were acceptable for both groups with the NBT + EBRT group showing higher rates on the acute effects and the 3D-CRT group showing higher rates on the late effects.

  19. Accurate determination of Curium and Californium isotopic ratios by inductively coupled plasma quadrupole mass spectrometry (ICP-QMS) in 248Cm samples for transmutation studies

    Energy Technology Data Exchange (ETDEWEB)

    Gourgiotis, A.; Isnard, H.; Aubert, M.; Dupont, E.; AlMahamid, I.; Cassette, P.; Panebianco, S.; Letourneau, A.; Chartier, F.; Tian, G.; Rao, L.; Lukens, W.

    2011-02-01

    The French Atomic Energy Commission has carried out several experiments including the mini-INCA (INcineration of Actinides) project for the study of minor-actinide transmutation processes in high intensity thermal neutron fluxes, in view of proposing solutions to reduce the radiotoxicity of long-lived nuclear wastes. In this context, a Cm sample enriched in {sup 248}Cm ({approx}97 %) was irradiated in thermal neutron flux at the High Flux Reactor (HFR) of the Laue-Langevin Institute (ILL). This work describes a quadrupole ICP-MS (ICP-QMS) analytical procedure for precise and accurate isotopic composition determination of Cm before sample irradiation and of Cm and Cf after sample irradiation. The factors that affect the accuracy and reproducibility of isotopic ratio measurements by ICP-QMS, such as peak centre correction, detector dead time, mass bias, abundance sensitivity and hydrides formation, instrumental background, and memory blank were carefully evaluated and corrected. Uncertainties of the isotopic ratios, taking into account internal precision of isotope ratio measurements, peak tailing, and hydrides formations ranged from 0.3% to 1.3%. This uncertainties range is quite acceptable for the nuclear data to be used in transmutation studies.

  20. Radiological Characterization Technical Report on Californium-252 Sealed Source Transuranic Debris Waste for the Off-Site Source Recovery Project at Los Alamos National Laboratory

    Energy Technology Data Exchange (ETDEWEB)

    Feldman, Alexander [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2014-04-24

    This document describes the development and approach for the radiological characterization of Cf-252 sealed sources for shipment to the Waste Isolation Pilot Plant. The report combines information on the nuclear material content of each individual source (mass or activity and date of manufacture) with information and data on the radionuclide distributions within the originating nuclear material. This approach allows for complete and accurate characterization of the waste container without the need to take additional measurements. The radionuclide uncertainties, developed from acceptable knowledge (AK) information regarding the source material, are applied to the summed activities in the drum. The AK information used in the characterization of Cf-252 sealed sources has been qualified by the peer review process, which has been reviewed and accepted by the Environmental Protection Agency.

  1. Report to the DOE nuclear data committee. [EV RANGE 10-100; CROSS SECTIONS; PHOTONEUTRONS; NEUTRONS; GAMMA RADIATION; COUPLED CHANNEL THEORY; DIFFERENTIAL CROSS SECTIONS; MEV RANGE 01-10; ; CAPTURE; GAMMA SPECTRA; THERMAL NEUTRONS; COMPUTER CALCULATIONS; DECAY; FISSION PRODUCTS; FISSION YIELD; SHELL MODELS; NUCLEAR DATA COLLECTIONS

    Energy Technology Data Exchange (ETDEWEB)

    Struble, G.L.; Haight, R.C.

    1981-03-01

    Topics covered include: studies of (n, charged particle) reactions with 14 to 15 MeV neutrons; photoneutron cross sections for /sup 15/N; neutron radiative capture; Lane-model analysis of (p,p) and (n,n) scattering on the even tin isotopes; neutron scattering cross sections for /sup 181/Ta, /sup 197/Au, /sup 209/Bi, /sup 232/Th, and /sup 238/U inferred from proton scattering and charge exchange cross sections; neutron-induced fission cross sections of /sup 245/Cm and /sup 242/Am; fission neutron multiplicities for /sup 245/Cm and /sup 242/Am; the transport of 14 MeV neutrons through heavy materials 150 < A < 208; /sup 249/Cm energy levels from measurement of thermal neutron capture gamma rays; /sup 231/Th energy levels from neutron capture gamma ray and conversion electron spectroscopy; new measurements of conversion electron binding energies in berkelium and californium; nuclear level densities; relative importance of statistical vs. valence neutron capture in the mass-90 region; determination of properties of short-lived fission products; fission yield of /sup 87/Br and /sup 137/I from 15 nuclei ranging from /sup 232/Th to /sup 249/Cf; evaluation of charged particle data for the ECPL library; evaluation of secondary charged-particle energy and angular distributions for ENDL; and evaluated nuclear structure libraries derived from the table of isotopes. (GHT)

  2. Are taxonomists required to bend to the will of bioinformatics? A response to Johnson (Skaphion 2:49)

    Science.gov (United States)

    Author names on the end of a species epithet are essential to stable taxonomy. These names are absolutely required in the case of homonymy, but they are also useful for obtaining original descriptions, locating type depositories, and determining the quality of a species concept. In this paper I ar...

  3. Intake assessment of the food additives nitrite (E 249 and E 250) and nitrate (E 251 and E 252)

    NARCIS (Netherlands)

    Sprong RC; Niekerk EM; Beukers MH; VVH; V&Z

    2017-01-01

    Nitrate and nitrite are authorised as preservatives in certain food products, such as salami, ham (nitrite) and cheese (nitrate). They prevent food spoilage and protect the consumer against food-borne pathogens. Next to that, nitrate and nitrite play a role in food colour retention and contribute to

  4. 75 FR 19880 - Safety Zone; BW PIONEER at Walker Ridge 249, Outer Continental Shelf FPSO, Gulf of Mexico

    Science.gov (United States)

    2010-04-16

    ... shuttle tanker will connect its bow to the FPSO BW PIONEER and its stern to an attendant tug that will.... Basis and Purpose The Coast Guard is establishing a safety zone of 500 meters around the stern of the...) around the stern of the FPSO when it is moored to the turret buoy is a safety zone. If the FPSO detaches...

  5. 17 CFR 240.13a-11 - Current reports on Form 8-K (§ 249.308 of this chapter).

    Science.gov (United States)

    2010-04-01

    ... American Depositary Receipts for securities of any foreign issuer, or investment companies required to file... such investment companies are required to file notice of a blackout period pursuant to § 245.104 of..., every registrant subject to § 240.13a-1 shall file a current report on Form 8-K within the period...

  6. Sacchi, Livio (2004. Tokyo: City and Architecture. 249 p. ISBN: 0-7893-1212-3. Nueva York: Universe Publishing.

    Directory of Open Access Journals (Sweden)

    Fermin Ernesto Flores Quiroz

    2016-12-01

    Full Text Available The book by the Italian author Livio Sacchi, focuses on the analysis on the spatial development of the city of Tokyo and the way in which the socioeconomic processes of the 19th and 20th centuries influenced the conformation of the urban structure on which millions of Tokyo citizens develop their daily life. During the text, the author underlines the impact of the modern architectural movement on the urban landscape of Tokyo. Furthermore, it is important to mention that this work serves as a translator for the western readers, because it deciphers the social and spatial characteristics that constitute the most populous city in the world.

  7. SU-E-T-249: Neutron Model Upgrade for Radiotherapy Patients Monitoring Using a New Online Detector

    Energy Technology Data Exchange (ETDEWEB)

    Irazola, L; Sanchez Doblado, F. [Departamento de Fisiologia Medica y Biofisica, Universidad de Sevilla (Spain); Servicio de Radiofisica, Hospital Universitario Virgen Macarena, Sevilla (Spain); Lorenzoli, M; Pola, A. [Politecnico di Milano, Departimento di Ingegneria Nuclear, Milano (Italy); Terron, J.A. [Servicio de Radiofisica, Hospital Universitario Virgen Macarena, Sevilla (Spain); Bedogni, R. [Laboratori Nazionali di Frascati, Istituto Nazionale di Fisica Nucleare (INFN) (Italy); Sanchez Nieto, B. [Instituto de Fisica, Pontificia Universidad Catolica de Chile, Santiago (Chile); Romero-Exposito, M. [Departamento de Fisica, Universitat Autonoma de Barcelona (Spain)

    2014-06-01

    Purpose: The purpose of this work is to improve the existing methodology to estimate neutron equivalent dose in organs during radiotherapy treatments, based on a Static Random Access Memory neutron detector (SRAMnd) [1]. This is possible thanks to the introduction of a new digital detector with improved characteristics, which is able to measure online the neutron fluence rate in the presence of an intense photon background [2]. Its reduced size, allows the direct estimation of doses in specific points inside an anthropomorphic phantom (NORMA) without using passive detectors as TLD or CR-39. This versatility will allow not only to improve the existing models (generic abdomen and H and N [1]) but to generate more specific ones for any technique. Methods: The new Thermal Neutron Rate Detector (TNRD), based on a diode device sensitized to thermal neutrons, have been inserted in 16 points of the phantom. These points are distributed to infer doses to specific organs. Simultaneous measurements of these devices and a reference one, located in front of the gantry, have been performed for the mentioned generic treatments, in order to improve the existing model. Results: These new devices have shown more precise since they agree better with Monte Carlo simulations. The comparison of the thermal neutron fluence, measured with TNRD, and the existing models, converted from events to fluence, shows an average improvement of (3.90±3.37) % for H and N and (12.61±9.43) % for abdomen, normalized to the maximum value. Conclusion: This work indicates the potential of these new devices for more precise neutron equivalent dose estimation in organs, as a consequence of radiotherapy treatments. The simplicity of the process makes possible to establish more specific models that will provide a better dose estimation. References[1] Phys Med Biol 2012; 57:6167–6191.[2] A new active thermal neutron detector. Radiat. Prot. Dosim. (in press)

  8. Knockdown by shRNA identifies S249C mutant FGFR3 as a potential therapeutic target in bladder cancer

    OpenAIRE

    Tomlinson, Darren C.; Hurst, Carolyn D; Knowles, Margaret A.

    2007-01-01

    More than 60% of low-grade non-invasive papillary urothelial cell carcinomas contain activating point mutations of FGFR3. The phenotypic consequences of constitutive activation of FGFR3 in bladder cancer have not been elucidated and further studies are required to confirm the consequences of inhibiting receptor activity in urothelial cells. We measured FGFR3 transcript levels and demonstrated that transcript levels were significantly more abundant in low-stage and grade tumours. We identified...

  9. SU-F-T-249: Application of Human Factors Methods: Usability Testing in the Radiation Oncology Environment

    Energy Technology Data Exchange (ETDEWEB)

    Warkentin, H [Cross Cancer Institute, Edmonton, AB (Canada); Bubric, K [Alberta Health Services, Calgary, AB (Canada); Giovannetti, H [Jack Ady Cancer Centre, Lethbridge, AB (Canada); Graham, G [Tom Baker Cancer Centre, Calgary, AB (Canada); Clay, C [Central Alberta Cancer Centre, Red Deer, AB (Canada)

    2016-06-15

    Purpose: As a quality improvement measure, we undertook this work to incorporate usability testing into the implementation procedures for new electronic documents and forms used by four affiliated radiation therapy centers. Methods: A human factors specialist provided training in usability testing for a team of medical physicists, radiation therapists, and radiation oncologists from four radiotherapy centers. A usability testing plan was then developed that included controlled scenarios and standardized forms for qualitative and quantitative feedback from participants, including patients. Usability tests were performed by end users using the same hardware and viewing conditions that are found in the clinical environment. A pilot test of a form used during radiotherapy CT simulation was performed in a single department; feedback informed adaptive improvements to the electronic form, hardware requirements, resource accessibility and the usability testing plan. Following refinements to the testing plan, usability testing was performed at three affiliated cancer centers with different vault layouts and hardware. Results: Feedback from the testing resulted in the detection of 6 critical errors (omissions and inability to complete task without assistance), 6 non-critical errors (recoverable), and multiple suggestions for improvement. Usability problems with room layout were detected at one center and problems with hardware were detected at one center. Upon amalgamation and summary of the results, three key recommendations were presented to the document’s authors for incorporation into the electronic form. Documented inefficiencies and patient safety concerns related to the room layout and hardware were presented to administration along with a request for funding to purchase upgraded hardware and accessories to allow a more efficient workflow within the simulator vault. Conclusion: By including usability testing as part of the process when introducing any new document or procedure into clinical use, associated risks can be identified and mitigated before patient care and clinical workflow are impacted.

  10. Book Review: Philosophy and geometry: theoretical and historical issues. Lorenzo Magnani, Kluwer Academic Publishers, Dordrecht, 2001, pp. xix + 249, US 88. ISBN 0-792-36933-5

    Science.gov (United States)

    Torretti, Roberto

    The best philosophers have been fascinated with geometry ever since the inception of both traditions in 5th century Greece. They have perceived the apparent certainty of geometrical propositions as an intimation that an equally secure knowledge can be had on a subject of the greatest practical concern, viz., the principles of morals. They also have sought to find-as is their wont-reasons for that certainty. This search has given rise to the theoretical and historical issues magisterially reviewed in this book by Lorenzo Magnani. He focuses his attention especially on Kant (Chapters 2 and 3), Poincaré (Chapter 5) and Husserl (Chapter 7.2), and on their original and importantly different ways of explaining the true nature and source of geometrical truth. Despite their diversity, all three can be said to share a trait that is rarely emphasized and which Magnani brings out in full force in his study of Kant. Chapter 2 is called "Geometry: the Model of Knowledge", and his detailed and very able presentation of Kant's philosophy of geometry in this chapter and the next stresses the paradigmatic role of geometrical knowledge in Kant's conception of science. This role is even clearer in the case of Poincaré, whose conventionalism was rooted in his view of geometry but was eventually extended to all the foundations of physics. An enterprising scholar might even try to make a similar point with regard to Husserl, whose views on the establishment of objectivity and science appear to fit geometry better than any other branch of knowledge.

  11. Cause-specific mortality for 249 causes in Brazil and states during 1990–2015: a systematic analysis for the global burden of disease study 2015

    Directory of Open Access Journals (Sweden)

    Elisabeth B. França

    2017-11-01

    Full Text Available Abstract Background Reliable data on cause of death (COD are fundamental for planning and resource allocation priorities. We used GBD 2015 estimates to examine levels and trends for the leading causes of death in Brazil from 1990 to 2015. Methods We describe the main analytical approaches focused on both overall and specific causes of death for Brazil and Brazilian states. Results There was an overall improvement in life expectancy at birth from 1990 to 2015, but with important heterogeneity among states. Reduced mortality due to diarrhea, lower respiratory infections, and other infectious diseases contributed the most for increasing life expectancy in most states from the North and Northeast regions. Reduced mortality due to cardiovascular diseases was the highest contributor in the South, Southeast, and Center West regions. However, among men, intentional injuries reduced life expectancy in 17 out of 27 states. Although age-standardized rates due to ischemic heart disease (IHD and cerebrovascular disease declined over time, these remained the leading CODs in the country and states. In contrast, leading causes of premature mortality changed substantially - e.g., diarrheal diseases moved from 1st to 13th and then the 36th position in 1990, 2005, and 2015, respectively, while violence moved from 7th to 1st and to 2nd. Overall, the total age-standardized years of life lost (YLL rate was reduced from 1990 to 2015, bringing the burden of premature deaths closer to expected rates given the country’s Socio-demographic Index (SDI. In 1990, IHD, stroke, diarrhea, neonatal preterm birth complications, road injury, and violence had ratios higher than the expected, while in 2015 only violence was higher, overall and in all states, according to the SDI. Conclusions A widespread reduction of mortality levels occurred in Brazil from 1990 to 2015, particularly among children under 5 years old. Major shifts in mortality rates took place among communicable, maternal, neonatal, and nutritional disorders. The mortality profile has shifted to older ages with increases in non-communicable diseases as well as premature deaths due to violence. Policymakers should address health interventions accordingly.

  12. Cause-specific mortality for 249 causes in Brazil and states during 1990-2015: a systematic analysis for the global burden of disease study 2015.

    Science.gov (United States)

    França, Elisabeth B; Passos, Valéria Maria de Azeredo; Malta, Deborah Carvalho; Duncan, Bruce B; Ribeiro, Antonio Luiz P; Guimarães, Mark D C; Abreu, Daisy M X; Vasconcelos, Ana Maria N; Carneiro, Mariângela; Teixeira, Renato; Camargos, Paulo; Melo, Ana Paula S; Queiroz, Bernardo L; Schmidt, Maria Inês; Ishitani, Lenice; Ladeira, Roberto Marini; Morais-Neto, Otaliba L; Bustamante-Teixeira, Maria Tereza; Guerra, Maximiliano R; Bensenor, Isabela; Lotufo, Paulo; Mooney, Meghan; Naghavi, Mohsen

    2017-11-22

    Reliable data on cause of death (COD) are fundamental for planning and resource allocation priorities. We used GBD 2015 estimates to examine levels and trends for the leading causes of death in Brazil from 1990 to 2015. We describe the main analytical approaches focused on both overall and specific causes of death for Brazil and Brazilian states. There was an overall improvement in life expectancy at birth from 1990 to 2015, but with important heterogeneity among states. Reduced mortality due to diarrhea, lower respiratory infections, and other infectious diseases contributed the most for increasing life expectancy in most states from the North and Northeast regions. Reduced mortality due to cardiovascular diseases was the highest contributor in the South, Southeast, and Center West regions. However, among men, intentional injuries reduced life expectancy in 17 out of 27 states. Although age-standardized rates due to ischemic heart disease (IHD) and cerebrovascular disease declined over time, these remained the leading CODs in the country and states. In contrast, leading causes of premature mortality changed substantially - e.g., diarrheal diseases moved from 1st to 13th and then the 36th position in 1990, 2005, and 2015, respectively, while violence moved from 7th to 1st and to 2nd. Overall, the total age-standardized years of life lost (YLL) rate was reduced from 1990 to 2015, bringing the burden of premature deaths closer to expected rates given the country's Socio-demographic Index (SDI). In 1990, IHD, stroke, diarrhea, neonatal preterm birth complications, road injury, and violence had ratios higher than the expected, while in 2015 only violence was higher, overall and in all states, according to the SDI. A widespread reduction of mortality levels occurred in Brazil from 1990 to 2015, particularly among children under 5 years old. Major shifts in mortality rates took place among communicable, maternal, neonatal, and nutritional disorders. The mortality profile has shifted to older ages with increases in non-communicable diseases as well as premature deaths due to violence. Policymakers should address health interventions accordingly.

  13. 17 CFR 249.220f - Form 20-F, registration of securities of foreign private issuers pursuant to section 12(b) or (g...

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Form 20-F, registration of securities of foreign private issuers pursuant to section 12(b) or (g), annual and transition reports...-F, registration of securities of foreign private issuers pursuant to section 12(b) or (g), annual...

  14. Increased acquired dyschromatopsia among solvent-exposed workers: an epidemiology study on 249 employees of an aluminum-foil printing factory.

    Science.gov (United States)

    Gonzalez, M; Velten, M; Cantineau, A

    1998-07-01

    To analyze the effects on color vision of chronic exposure to mixtures of solvents including ethyl acetate, ethanol, and ketones among the workers of a large factory specializing in the manufacture of photoengraved aluminum packaging. We analyzed a group of 129 subjects who had been exposed to solvents for more than 3 years (mean age 40 years, range 25 59 years) and a nonexposed group of 120 subjects (mean age 41 years, range 21-57 years). The two groups had a similar length of service (17 and 19 years on average, respectively). The exposed subjects consumed more tobacco and alcohol than the nonexposed workers. The study involved administration of the Lanthony D-15 desaturated test. The subjects were classified as having or not having dyschromatopsia on the basis of Lanthony's criteria and the chromatic confusion index (CCI) was calculated according to Bowman's method. After observation of the work stations and analysis of an occupational questionnaire the findings were used to construct a cumulative exposure index covering the whole of each subject's working life. Air samples were taken at each work station and in each production sector to determine current exposure. The average cumulative exposure index was 194 (median 174, range 27-513). The average hygienic effect index (according to ACGIH recommendations), regularly used for atmospheres containing mixtures of products, varied between 12% and 27% of the occupational limit values permitted under French legislation. As regards color vision, 23% of the exposed group had dyschromatopsia, as did 13% of the nonexposed group, with the odds ratio (OR) adjusted for age and consumption of tobacco and alcohol being 1.99 (1.02, 3.89). The analysis of the dose-response relationship according to the cumulative exposure index showed an OR of 1.59 for the lowly exposed group (index 174) as compared with the nonexposed group. Subjects with complex color vision loss (n=23) had a significantly higher cumulative exposure index than those with blue-yellow loss (n=23; 232 versus 155; P=0.04). The CCI was on average higher in the exposed group, but the difference between the two groups was not significant. The results of this study are in favor of an increased risk for impairment of chromatic discrimination among workers exposed to mixtures of solvents including mainly ethyl acetate, ethanol, and ketones.

  15. SU-E-J-249: Characterization of Gynecological Tumor Heterogeneity Using Texture Analysis in the Context of An 18F-FDG PET Adaptive Protocol

    Energy Technology Data Exchange (ETDEWEB)

    Nawrocki, J [Duke University Medical Physics Graduate Program, Durham, NC (United States); Chino, J; Craciunescu, O [Duke University Medical Center Department of Radiation Oncology, Durham, NC (United States); Das, S [University of North Carolina School of Medicine, Chapel Hill, NC (United States)

    2015-06-15

    Purpose: We propose a method to examine gynecological tumor heterogeneity using texture analysis in the context of an adaptive PET protocol in order to establish if texture metrics from baseline PET-CT predict tumor response better than SUV metrics alone as well as determine texture features correlating with tumor response during radiation therapy. Methods: This IRB approved protocol included 29 women with node positive gynecological cancers visible on FDG-PET treated with EBRT to the PET positive nodes. A baseline and intra-treatment PET-CT was obtained. Tumor outcome was determined based on RECIST on posttreatment PET-CT. Primary GTVs were segmented using 40% threshold and a semi-automatic gradient-based contouring tool, PET Edge (MIM Software Inc., Cleveland, OH). SUV histogram features, Metabolic Volume (MV), and Total Lesion Glycolysis (TLG) were calculated. Four 3D texture matrices describing local and regional relationships between voxel intensities in the GTV were generated: co-occurrence, run length, size zone, and neighborhood difference. From these, 39 texture features were calculated. Prognostic power of baseline features derived from gradientbased and threshold GTVs were determined using the Wilcoxon rank-sum test. Receiver Operating Characteristics and logistic regression was performed using JMP (SAS Institute Inc., Cary, NC) to find probabilities of predicting response. Changes in features during treatment were determined using the Wilcoxon signed-rank test. Results: Of the 29 patients, there were 16 complete responders, 7 partial responders, and 6 non-responders. Comparing CR/PR vs. NR for gradient-based GTVs, 7 texture values, TLG, and SUV kurtosis had a p < 0.05. Threshold GTVs yielded 4 texture features and TLG with p < 0.05. From baseline to intra-treatment, 14 texture features, SUVmean, SUVmax, MV, and TLG changed with p < 0.05. Conclusion: Texture analysis of PET imaged gynecological tumors is an effective method for early prognosis and should be used complimentary to SUV metrics, especially when using gradient based segmentation.

  16. Characterization of the in vitro expressed autoimmune rippling muscle disease immunogenic domain of human titin encoded by TTN exons 248-249

    Energy Technology Data Exchange (ETDEWEB)

    Zelinka, L. [Biomedical Sciences Program, Kent State University, Kent, OH (United States); McCann, S.; Budde, J.; Sethi, S.; Guidos, M.; Giles, R. [Center for Applied Chemical Biology, Department of Biological Sciences, Youngstown State University, One University Plaza, Youngstown, OH 44555 (United States); Walker, G.R., E-mail: grwalker@ysu.edu [Center for Applied Chemical Biology, Department of Biological Sciences, Youngstown State University, One University Plaza, Youngstown, OH 44555 (United States); Biomedical Sciences Program, Kent State University, Kent, OH (United States)

    2011-08-05

    Highlights: {yields} Affinity purification of the autoimmune rippling muscle disease immunogenic domain of titin. {yields} Partial sequence analysis confirms that the peptides is in the I band region of titin. {yields} This region of the human titin shows high degree of homology to mouse titin N2-A. -- Abstract: Autoimmune rippling muscle disease (ARMD) is an autoimmune neuromuscular disease associated with myasthenia gravis (MG). Past studies in our laboratory recognized a very high molecular weight skeletal muscle protein antigen identified by ARMD patient antisera as the titin isoform. These past studies used antisera from ARMD and MG patients as probes to screen a human skeletal muscle cDNA library and several pBluescript clones revealed supporting expression of immunoreactive peptides. This study characterizes the products of subcloning the titin immunoreactive domain into pGEX-3X and the subsequent fusion protein. Sequence analysis of the fusion gene indicates the cloned titin domain (GenBank ID: (EU428784)) is in frame and is derived from a sequence of N2-A spanning the exons 248-250 an area that encodes the fibronectin III domain. PCR and EcoR1 restriction mapping studies have demonstrated that the inserted cDNA is of a size that is predicted by bioinformatics analysis of the subclone. Expression of the fusion protein result in the isolation of a polypeptide of 52 kDa consistent with the predicted inferred amino acid sequence. Immunoblot experiments of the fusion protein, using rippling muscle/myasthenia gravis antisera, demonstrate that only the titin domain is immunoreactive.

  17. Ship Trackline along which Continuous Resistivity Profile Data was Collected in the Potomac River/Chesapeake Bay on Sept., 6, 2006 on USGS Cruise 06018 (RESGPSLNS_JD249.SHP)

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — In order to test hypotheses about groundwater flow under and into Chesapeake Bay, geophysical surveys were conducted by U.S. Geological Survey (USGS) scientists on...

  18. Summary Health Statistics for U.S. Adults: National Health Interview Survey, 2009. Data from the National Health Interview Survey. Vital and Health Statistics. Series 10, Number 249. DHHS Publication No. (PHS) 2011-1577

    Science.gov (United States)

    Pleis, J. R.; Ward, B. W.; Lucas, J. W.

    2010-01-01

    Objectives: This report presents health statistics from the 2009 National Health Interview Survey (NHIS) for the civilian noninstitutionalized adult population, classified by sex, age, race and ethnicity, education, family income, poverty status, health insurance coverage, marital status, and place and region of residence. Estimates are presented…

  19. Thermosalinograph data of the Hawaii Ocean Time-series (HOT) program in the North Pacific 100 miles north of Oahu, Hawaii for cruises HOT249-258 during 2013 (NODC Accession 0125648)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The HOT program makes repeated observations of the physics, biology and chemistry at a site approximately 100 km north of Oahu, Hawaii. The program began in 1988....

  20. CTD data of the Hawaii Ocean Time-series (HOT) program in the North Pacific 100 miles north of Oahu, Hawaii for cruises HOT249-258 during 2013 (NODC Accession 0125647)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The HOT program makes repeated observations of the physics, biology and chemistry at a site approximately 100 km north of Oahu, Hawaii. The program began in 1988....

  1. Measurement of the total cross section difference {Delta}{sigma}{sub L} in np transmission at 1.19, 2.49 and 3.65 GeV

    Energy Technology Data Exchange (ETDEWEB)

    Averichev, S.A. [Joint Inst. for Nuclear Research, Dubna (Russian Federation). Lab. of High Energy; Azhgirey, L.S. [Joint Inst. for Nuclear Research, Dubna (Russian Federation). Lab. of Nuclear Problems; Benda, B. [CEA Centre d`Etudes de Saclay, 91 - Gif-sur-Yvette (France). Dept. d`Astrophysique, de la Physique des Particules, de la Physique Nucleaire et de l`Instrumentation Associee; Adiasevich, B.P. [Russian Research Centre Kurchatov Inst., Moscow (Russian Federation); Ball, J. [Laboratoire National Saturne - Centre d`Etudes Nucleaires de Saclay, 91 - Gif-sur-Yvette (France); Bazhanov, N.A. [AN SSSR, Leningrad (Russian Federation). Inst. Yadernoj Fiziki; Dzyubak, A.P. [AN Ukrainskoj SSR, Kharkov (Ukraine). Fiziko-Tekhnicheskij Inst.; Fedorov, A.N. [Joint Inst. for Nuclear Research, Dubna (Russian Federation). Lab. of Particle Physics; Grosnick, D.P. [Argonne National Lab., IL (United States). High Energy Physics Div.; Gurevich, G.M. [AN SSSR, Moscow (Russian Federation). Inst. Yadernykh Issledovanij] [and others

    1996-01-01

    Results of the total cross section difference {Delta}{sigma}{sub L} in a np transmission experiment are presented. Results were obtained with a polarized beam of free quasi-monochromatic neutrons passing through the new Dubna frozen spin proton target. The beam and target polarizations were oriented longitudinally. The new results are compared with {Delta}{sigma}{sub L}(pn) data determined as a difference between {Delta}{sigma}{sub L}(pd) and {Delta}{sigma}{sub L}(pp) ANL-ZGS measurements. The values of {Delta}{sigma}{sub L} for the isospin state I=0 were deduced using known pp data. (author). Submitted to Zeitschrift fuer Physik, C (DE); 51 refs.

  2. Assessment of dietary exposure to annatto (E160b), nitrites (E249-250), sulphites (E220-228) and tartaric acid (E334) in the French population: the second French total diet study.

    Science.gov (United States)

    Bemrah, N; Vin, K; Sirot, V; Aguilar, F; Ladrat, A-C; Ducasse, C; Gey, J-L; Rétho, C; Nougadere, A; Leblanc, J-C

    2012-01-01

    The results of the assessment of the dietary exposure to annatto, nitrites, tartaric acid and sulphites within the framework of the second French total diet study (TDS) are reported. These 4 additives were selected from the Bemrah et al. study [Bemrah N, Leblanc JC, Volatier JL. 2008. Assessment of dietary exposure in the French population to 13 selected food colours, preservatives, antioxidants, stabilizers, emulsifiers and sweeteners. Food Addit Contam B. 1(1):2-14] on 13 food additives which identified a possible health risk for annatto, sulphites and nitrites and a lack of data for tartaric acid. Among the composite samples selected for the whole TDS, 524 were analysed for additives (a sample was analysed for a given additive when it was identified as a major contributor for this additive only): 130 for tartaric acid, 135 for nitrites, 59 for annatto and 200 for sulphites. Estimated concentrations (minimum lower bound to maximum upper bound) vary nationally from 0 to 9 mg/kg for annatto, 0 to 420 mg/kg for tartaric acid, 0 to 108 mg/kg for sulphites and 0 to 3.4 mg/kg for nitrites. Based on the analytical results, the dietary exposure was calculated for adults and children, separately, using lower bound and upper bound assumptions. The European ADIs for these 4 additives were not exceeded except for the dietary exposure for sulphites among 2.9% of the adult population, where the major contributors were alcoholic drinks and especially wine under both hypotheses (lower and upper bound).

  3. Niskin bottle data of the Hawaii Ocean Time-series (HOT) program in the North Pacific 100 miles north of Oahu, Hawaii for cruises HOT249-258 during 2013 (NODC Accession 0125579)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The HOT program makes repeated observations of the physics, biology and chemistry at a site approximately 100 km north of Oahu, Hawaii. Two stations are visited...

  4. Navigation and Bathymetry Points of Ship Position During Continuous Resistivity Profile Data Collection in the Potomac River/Chesapeake Bay on Sept. 6, 2006 on USGS Cruise 06018 (RESGPSPNTS_JD249.SHP)

    Data.gov (United States)

    U.S. Geological Survey, Department of the Interior — In order to test hypotheses about groundwater flow under and into Chesapeake Bay, geophysical surveys were conducted by U.S. Geological Survey (USGS) scientists on...

  5. Multibeam collection for TN249: Multibeam data collected aboard Thomas G. Thompson from 2010-05-10 to 2010-06-14, Dutch Harbor, AK to Dutch Harbor, AK

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set is part of a larger set of data called the Multibeam Bathymetry Database (MBBDB) where other similar data can be found at...

  6. Funkcjonalna interpretacja tekstów historycznych. Dwa typy prolepsy w języku greckim na przykładzie Medei Eurypidesa (248–249) i Ewangelii wg św. Jana (12, 12–13)

    OpenAIRE

    Sobotka, Piotr

    2013-01-01

    The two parts of the article analyse the possibilities of a functional interpretation, in terms of the theme-rheme devision, of ancient texts. The author discusses examples from Classical Greek and Latin as well as New Testament Greek, especially their word order, grammatical and lexical features. On this basis he proposes an analytical approach to the description of the linguistic values connected on some degree with the communicative structure of these examples. The contextual p...

  7. İÖ 24-9. yüzyıllar arası Önasya’nın kadın yöneticileri

    OpenAIRE

    Erdan, Emre

    2015-01-01

    Tarihöncesi çağlardan günümüze, toplumsal rolü farklılıklar gösteren kadınların 35-40 binyıl öncesinden itibaren kutsal olarak kabul edilmeye başlandığı arkeolojik buluntular aracılığı ile doğrulanabilmektedir. Söz konusu Paleolitik Çağ’dan başlayan ve doğurganlık ile ilişkilendirilen kadının kutsal yönü, özellikle Anadolu toplumları açısından süreklilik arz etmiştir. Neolitik Çağ içerisinde, Çatalhöyük ve Höyücek gibi merkezler aracılığı ile net olarak takip edilebilen inanç sistemi “ana tan...

  8. Avaliação nutricional da casca de soja integral ou moída, ensilada ou não, para suínos em fase de crescimento - DOI: 10.4025/actascianimsci.v29i1.249 Nutritional evaluation of whole or grinder soybean hull, ensilaged or not, for growing pigs - DOI: 10.4025/actascianimsci.v29i1.249

    Directory of Open Access Journals (Sweden)

    Cleber Rogério Ribeiro

    2007-11-01

    Full Text Available Foi conduzido um experimento com 11 suínos híbridos, machos castrados, com peso vivo de 41,42 ± 0,99 kg. Os animais foram alojados individualmente em gaiolas de metabolismo e distribuídos em um delineamento experimental inteiramente casualizado, com parcelas subdivididas, com quatro tratamentos em esquema fatorial 2 x 2 (moagem x ensilagem. Os alimentos avaliados foram: a casca de soja (CS integral (CSI, CS moída (CSM, silagem de CSI (SCSI e silagem de CSM (SCSM, que substituíram, com base na matéria seca (MS, 25% da ração referência e resultaram em quatro rações teste, sendo adicionado um inoculante enzimático microbiano nas silagens. Houve diferença somente para o CDPB em relação ao processamento da CS (ensilada = 68,08% e não ensilada = 59,44%. Conclui-se que a moagem e/ou ensilagem da CS, não tem efeito sobre a digestibilidade da MS, da MO, da EB, bem como sobre a metabolizabilidade da energia bruta. A ensilagem aumenta a digestibilidade da PB da casca de soja.An experiment was carried out using 11 crossbred pigs, barrows with body weight of 41.42 ± 0.99 kg. Pigs were allotted in metabolism cages, in a complete randomized design, in a split-plot design, with four treatments in a 2 x 2 (grinding x ensilage factorial and two replicates. Soybean hull (SH in the whole form (WSH, ground SH (GSH, WSH silage (WSHS and GSH silage (GSHS, that replaced (based on dry matter 25% of the reference diet, were evaluated resulting in four test diets. Enzymatic microbial inoculants were included in the silages production. Crude protein digestibility coefficient of soybean hull ensilage (68.08% was higher than no silage (59.44%, regardless grinding. Results showed that grinding and/or ensilage do not modify dry matter, organic matter, and gross energy digestibility, as well as energy metabolism. The ensilage process increases the crude protein digestibility coefficient of soybean hull, regardless grinding.

  9. Protein (Viridiplantae): 359495295 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available D: LOW QUALITY PROTEIN: valencene synthase Vitis vinifera MSTQVSASSLAQIPKPKNRPVANYHPNIWGDQFISYIPEDKVTRACKEEQ...24:4279 3398:4279 71240:1195 91827:1195 71275:2879 91834:249 403667:249 3602:249 3603:249 29760:249 PREDICTE

  10. Developments for transactinide chemistry experiments behind the gas-filled separator TASCA

    Energy Technology Data Exchange (ETDEWEB)

    Even, Julia

    2011-12-13

    Topic of this thesis is the development of experiments behind the gas-filled separator TASCA (TransActinide Separator and Chemistry Apparatus) to study the chemical properties of the transactinide elements. In the first part of the thesis, the electrodepositions of short-lived isotopes of ruthenium and osmium on gold electrodes were studied as model experiments for hassium. From literature it is known that the deposition potential of single atoms differs significantly from the potential predicted by the Nernst equation. This shift of the potential depends on the adsorption enthalpy of therndeposited element on the electrode material. If the adsorption on the electrode-material is favoured over the adsorption on a surface made of the same element as the deposited atom, the electrode potential is shifted to higher potentials. This phenomenon is called underpotential deposition. Possibilities to automatize an electro chemistry experiment behind the gas-filled separator were explored for later studies with transactinide elements. The second part of this thesis is about the in-situ synthesis of transition-metal-carbonyl complexes with nuclear reaction products. Fission products of uranium-235 and californium-249 were produced at the TRIGA Mainz reactor and thermalized in a carbon-monoxide containing atmosphere. The formed volatile metal-carbonyl complexes could be transported in a gas-stream. Furthermore, short-lived isotopes of tungsten, rhenium, osmium, and iridium were synthesised at the linear accelerator UNILAC at GSI Helmholtzzentrum fuer Schwerionenforschung, Darmstadt. The recoiling fusion products were separated from the primary beam and the transfer products in the gas-filled separator TASCA. The fusion products were stopped in the focal plane of TASCA in a recoil transfer chamber. This chamber contained a carbon-monoxide - helium gas mixture. The formed metal-carbonyl complexes could be transported in a gas stream to various experimental setups. All

  11. Discovery of isotopes of the transuranium elements with 93≤Z≤98

    Energy Technology Data Exchange (ETDEWEB)

    Fry, C.; Thoennessen, M., E-mail: thoennessen@nscl.msu.edu

    2013-01-15

    One hundred and five isotopes of the transuranium elements neptunium, plutonium, americium, curium, berkelium, and californium have been observed so far; the discovery of these isotopes is described. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  12. Neutron-Activated Gamma-Emission: Technology Review

    Science.gov (United States)

    2012-01-01

    flux sources developed for boron neutron capture therapy ( BNCT ), found to be an experimental success in cancer treatment (26). 30 Improved flux on...achievable Am americium API associated particle imaging B boron Be beryllium BNCT boron neutron capture therapy C carbon Cf californium Cl

  13. ORF Alignment: NC_003366 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ELISIKEKTKIM 180 ... Query: 249 PTAIDELIKEDRVNVKVLKTNEQWYGVTYKEDKESVRDSLKNLSKKIYPDDLWE 302 ... PTAIDELIK...EDRVNVKVLKTNEQWYGVTYKEDKESVRDSLKNLSKKIYPDDLWE Sbjct: 241 PTAIDELIKEDRVNVKVLKTNEQWYGVTYKEDKESVRDSLKNLSKKIYPDDLWE 294

  14. Dietary exposure to benzoates (E210-E213), parabens (E214-E219), nitrites (E249-E250), nitrates (E251-E252), BHA (E320), BHT (E321) and aspartame (E951) in children less than 3 years old in France.

    Science.gov (United States)

    Mancini, F R; Paul, D; Gauvreau, J; Volatier, J L; Vin, K; Hulin, M

    2015-01-01

    This study aimed to estimate the exposure to seven additives (benzoates, parabens, nitrites, nitrates, BHA, BHT and aspartame) in children aged less than 3 years old in France. A conservative approach, combining individual consumption data with maximum permitted levels, was carried out for all the additives. More refined estimates using occurrence data obtained from products' labels (collected by the French Observatory of Food Quality) were conducted for those additives that exceeded the acceptable daily intake (ADI). Information on additives' occurrence was obtained from the food labels. When the ADI was still exceeded, the exposure estimate was further refined using measured concentration data, if available. When using the maximum permitted level (MPL), the ADI was exceeded for benzoates (1.94 mg kg(-1) bw day(-1)), nitrites (0.09 mg kg(-1) bw day(-1)) and BHA (0.39 mg kg(-1) bw day(-1)) in 25%, 54% and 20% of the entire study population respectively. The main food contributors identified with this approach were current foods as these additives are not authorised in specific infant food: vegetable soups and broths for both benzoates and BHA, delicatessen and meat for nitrites. The exposure estimate was significantly reduced when using occurrence data, but in the upper-bound scenario the ADI was still exceeded significantly by the age group 13-36 months for benzoates (2%) and BHA (1%), and by the age group 7-12 months (16%) and 13-36 months (58%) for nitrites. Measured concentration data were available exclusively for nitrites and the results obtained using these data showed that the nitrites' intake was below the ADI for all the population considered in this study. These results suggest that refinement of exposure, based on the assessment of food levels, is needed to estimate the exposure of children to BHA and benzoates for which the risk of exceeding the ADI cannot be excluded when using occurrence data.

  15. Carmen Bobes Naves, La metáfora, Madrid, Gredos, Collection : Biblioteca románica hispánica. 2, Estudios y ensayos, 2004, 227 p. ISBN : 84 -249 -2709 -5 br.

    OpenAIRE

    Coll Sansalvador, Andreu

    2010-01-01

    Dans la lignée de ses nombreux travaux de linguistique et de théorie littéraire, Carmen Bobes Naves, professeur émérite de l'Université d'Oviedo à qui on doit l'introduction et la promotion des études de sémiotique en Espagne, nous livre un petit ouvrage intitulé La metáfora, publié dans la célèbre collection Biblioteca Románica Hispánica. S'inscrivant dans le style très caractéristique de son auteur, La metáfora affiche un souci simultané de vulgarisation théorique et de précision conceptuel...

  16. Retraction Notice to ;Fabrication, electromagnetic characteristics of microwave absorbers containing Li0.35Zn0.3Fe2.35O4 micro-belts, nickel-coated carbon fibers; [J. Magn. Magn. Mater. 345 (2013) 249-254

    Science.gov (United States)

    Zhao, Bin; Wang, Qilei; Zhang, Cunrui

    2017-08-01

    This article has been retracted: please see Elsevier Policy on Article Withdrawal This article has been retracted at the request of the Editor-in-Chief. The authors have plagiarized part of a paper that had already appeared in Ceram. Int., 39 (2013) 2317-2322,

  17. Struggling to Improve Our Understanding of Nursing Student Information Needs. A review of: Gannon‐Leary, Pat, Graham Walton, Raffik Cader, Julie Derbyshire, and Ann Smith. “Use of Evidence by Nursing Students: An Interdisciplinary Study.” Library & Information Science Research 28.2 (Mar. 2006: 249‐64.

    Directory of Open Access Journals (Sweden)

    Michael Corkett

    2007-06-01

    Full Text Available Objective – To identify the sources used by student nurses when undertaking a health needs analysis of particular client groups, and to determine students’ ease in accessing source materials.Design – Case series, incorporating citation analysis and focus groups.Setting – Honours Nursing Studies program (Adult Branch, Northumbria University, Newcastle upon Tyne, United Kingdom.Subjects – Citation analysis: 40 students undertaking health needs analysis assignment. Focus groups: 2 groups of 8 students.Methods – Subjects for the citation analysis were not randomly selected. Citation analysis was performed and references tabulated using a previously piloted proforma. Distribution of references between sources was measured using quantitative analysis. Focus groups consisted of self selecting volunteers from the student cohort undertaking the assignment. Issues of potential bias/coercion relating to research team members being group participant tutors were addressed. Results were analysed through the categorisation of key themes.Main results – The mean number of sources cited per assignment was 16. More than half( 56% of the sources were published after 1999. Twenty‐nine percent of citations were published between 1996 and 1999, and 12% between 1990 and 1995. Only small percentages were published in the 1980s (2% and 1970s (1%. Journals (37% formed the largest body of references, followed by books at 27%. UK government publications accounted for 14% of total references; Web based resources totalled 12%. Students acknowledged the importance of supporting assignments with references. Government publications were recognised as high quality pieces of evidence. Difficulty was experienced extrapolating evidence from different care settings and moving outside of usual parameters. Students indicated that statistical data was hard to find. Those without home Internet facilities had greater difficulty in accessing information than students with such facilities. Support from information professionals was received, but quality was variable.Conclusion – Doubts exist as to whether opportunities for student learning to inform educators are being fully exploited. Upon completion of assignments students are arguably in a better position to debate subjects more deeply and so advance understanding. Potential for peer group development may be lost. Collaboration between nursing academics and information professionals offers potential for nursing students and health professionals to advance their exploitation and evaluation of information resources.

  18. Solid-State Neutron Multiplicity Counting System Using Commercial Off-the-Shelf Semiconductor Detectors

    Energy Technology Data Exchange (ETDEWEB)

    Rozhdestvenskyy, S. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

    2017-08-09

    This work iterates on the first demonstration of a solid-state neutron multiplicity counting system developed at Lawrence Livermore National Laboratory by using commercial off-the-shelf detectors. The system was demonstrated to determine the mass of a californium-252 neutron source within 20% error requiring only one-hour measurement time with 20 cm2 of active detector area.

  19. Cold valleys in the radioactive decay of 248−254Cf isotopes

    Indian Academy of Sciences (India)

    Geiger–Nuttal plots of log10(T1/2) vs. Q−1/2 for 48−52Ca emitting from various californium isotopes. Acknowledgement. One of the authors (KPS) would like to thank University Grants Commis- sion, Govt. of India for the financial support under project No. MRP(S)-. 352/2005(X Plan)/KLKA 002/UGC-SWRO. References.

  20. Directed evolution of the periodic table: probing the electronic structure of late actinides.

    Science.gov (United States)

    Marsh, M L; Albrecht-Schmitt, T E

    2017-07-25

    Recent investigations of the coordination chemistry and physical properties of berkelium (Z = 97) and californium (Z = 98) have revealed fundamental differences between post-curium elements and lighter members of the actinide series. This review highlights these developments and chronicles key findings and concepts from the last half-century that have helped usher in a new understanding of the evolution of electronic structure in the periodic table.

  1. Open Source: Potential in Latin America for Radiological Weapons

    Science.gov (United States)

    2010-03-01

    terrorist group would need to acquire a radioactive isotope with a relatively short half-life. 36,37 As an aside, the IAEA verified that depleted...cns.miis.edu/npr/pdfs/123salama.pdf (accessed March 3, 2010), Useful RDD isotopes include cobalt-60, strontium-90, yttrium-90, iridium-192, cesium-137...plutonium-238, radium -226, americium-241, and californium-252. 37 Hansell and Salama, “Does intent equal capability?,” 640-641. 38 Internation Atomic

  2. Gclust Server: 76570 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available 76570 HSA_8923040 Cluster Sequences Related Sequences(249) 580 NP_060102.1 collabor...elated sequences Related Sequences(249) Sequence length 580 Representative annotation NP_060102.1 collabor

  3. Gclust Server: 154467 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available 154467 CEL_Y48E1B.12_17537265 Cluster Sequences - 249 csc-1: Chromosome Segregation and Cytokines...ces - Sequence length 249 Representative annotation csc-1: Chromosome Segregation and Cytokines

  4. ORF Alignment: NC_006840 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available MLHWPDSMMTYLTGDAILFSNDAFGQHYCDERLFNDEVDQTELM 180 ... Query: 249 YQEDRITIFYDSMSNNTRMMAD...AIAQGIHDVDPAVAVKVFNVSRQDKNDILTSVFRSKGI 308 ... YQEDRITIFYDSMSNNTRMMADAIAQGIHDVDPAVAVKVFNVSRQDKNDILT...SVFRSKGI Sbjct: 241 YQEDRITIFYDSMSNNTRMMADAIAQGIHDVDPAVAVKVFNVSRQDKNDILTSVFRSKGI 300 ...

  5. ORF Alignment: NC_005125 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available t: 121 GVKAFEPGLLARANRGILYVDEVNLLDDHLVDVLLDSAASGWNTVEREGISVRHPARFVL 180 ... Query: 249 ELTRRIAKAQQLLKKTEVSDDLQLKIAQVCSEL...DVDGLRGDIVTDRAARALAAFEGRGRV 308 ... ELTRRIAKAQQLLKKTEVSDDLQLKIAQVCSELDVDGLRGDIVTDRAARALAAFEG...RGRV Sbjct: 241 ELTRRIAKAQQLLKKTEVSDDLQLKIAQVCSELDVDGLRGDIVTDRAARALAAFEGRGRV 300 ...

  6. Gclust Server: 202209 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available 202209 TET_249.m00048 Cluster Sequences - 87 hypothetical protein chr_0_8254705_249; no annotation 1...00e-40 0.0 11.11 0.0 0.0 0.0 0.0 Show 202209 Cluster ID 202209 Sequence ID TET_249.m00048 Link to cluster

  7. Gclust Server: 201204 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available 201204 TET_249.m00037 Cluster Sequences - 64 hypothetical protein chr_0_8254705_249; no annotation 1...00e-99 0.0 11.11 0.0 0.0 0.0 0.0 Show 201204 Cluster ID 201204 Sequence ID TET_249.m00037 Link to cluster

  8. Ajayaghosh, Dr Ayyappanpillai

    Indian Academy of Sciences (India)

    ... Group, National Institute for Interdisciplinary Science &, Technology, Industrial Estate Post, Thiruvananthapuram 695 019, Kerala Contact: Office: (0471) 249 3599, 2490324. Residence: (0471) 249 1592. Mobile: 94460 59059. Fax: (0471) 249 1712. Email: ajayaghosh@niist.res.in. YouTube; Twitter; Facebook; Blog ...

  9. Gclust Server: 201208 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available 201208 TET_249.m00038 Cluster Sequences - 43 hypothetical protein chr_0_8254705_249...; no annotation 1 1.00e-16 0.0 11.11 0.0 0.0 0.0 0.0 Show 201208 Cluster ID 201208 Sequence ID TET_249.m0003

  10. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFC249 (Link to dictyBase) - - - Contig-U16272-1 VFC249P (Link... to Original site) VFC249F 500 VFC249Z 585 VFC249P 1085 - - Show VFC249 Library VF (Link to library) Clone ID VFC249 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16272-1 Original site URL http://dict...te 2004.12.25 Homology vs DNA Score E Sequences producing significant alignments: (bits) Value N L08391 |L08391.1 Dict...0.00 mNt: 0.00 m3a: 0.00 m3b: 0.00 m_ : 1.00 88.0 %: cytoplasmic 8.0 %: mitochondrial 4.0 %: nuclear >> predict

  11. PROCEEDINGS OF THE SYMPOSIUM COMMEMORATING THE 25th ANNIVERSARY OF ELEMENTS 97 and 98 HELD ON JAN. 20, 1975

    Energy Technology Data Exchange (ETDEWEB)

    Seaborg, Glenn T.; Street Jr., Kenneth; Thompson, Stanley G.; Ghiorso, Albert

    1976-07-01

    This volume includes the talks given on January 20, 1975, at a symposium in Berkeley on the occasion of the celebration of the 25th anniversary of the discovery of berkelium and californium. Talks were given at this symposium by the four people involved in the discovery of these elements and by a number of people who have made significant contributions in the intervening years to the investigation of their nuclear and chemical properties. The papers are being published here, without editing, in the form in which they were submitted by the authors in the months following the anniversary symposium, and they reflect rather faithfully the remarks made on that occasion.

  12. Composition containing transuranic elements for use in the homeopathic treatment of aids

    Energy Technology Data Exchange (ETDEWEB)

    Lustig, D.

    1996-04-18

    A homeopathic remedy consisting of a composition containing one or more transuranic elements, particularly plutonium, for preventing and treating acquired immunodeficiency syndrome (AIDS) in humans, as well as seropositivity for human immunodeficiency virus (HIV). Said composition is characterized in that it uses any chemical or isotopic form of one or more transuranic elements (neptunium, plutonium, americium, curium, berkelium, californium or einsteinium), particularly plutonium, said form being diluted and dynamized according to conventional homeopathic methods, particularly the so-called Hahnemann and Korsakov methods, and provided preferably but not exclusively in the form of lactose and/or saccharose globules or granules impregnated with the active principle of said composition. (author).

  13. Advanced development of the spectrum sciences Model 5005-TF, single-event test fixture

    Energy Technology Data Exchange (ETDEWEB)

    Ackermann, M.R.; Browning, J.S. (Sandia National Labs., Albuquerque, NM (USA)); Hughlock, B.W. (Boeing Aerospace and Electronics Co., Seattle, WA (USA)); Lum, G.K. (Lockheed Missiles and Space Co., Sunnyvale, CA (USA)); Tsacoyeanes, W.C. (Draper (Charles Stark) Lab., Inc., Cambridge, MA (USA)); Weeks, M.D. (Spectrum Sciences, Inc., Santa Clara, CA (USA))

    1990-09-01

    This report summarizes the advanced development of the Spectrum Sciences Model 5005-TF, Single-Event Test Fixture. The Model 5005-TF uses a Californium-252 (Cf-252) fission-fragment source to test integrated circuits and other devices for the effects of single-event phenomena. Particle identification methods commonly used in high-energy physics research and nuclear engineering have been incorporated into the Model 5005-TF for estimating the particle charge, mass, and energy parameters. All single-event phenomena observed in a device under test (DUT) are correlated with an identified fission fragment, and its linear energy transfer (LET) and range in the semiconductor material of the DUT.

  14. TOWARD AN IMPROVED UNDERSTANDING OF STRUCTURE AND MAGNETISM IN NEPTUNIUM AND PLUTONIUM PHOSPHONATES AND SULFONATES

    Energy Technology Data Exchange (ETDEWEB)

    Albrecht-Schmitt, Thomas

    2012-03-01

    This grant supported the exploratory synthesis of new actinide materials with all of the actinides from thorium to californium with the exceptions of protactinium and berkelium. We developed detailed structure-property relationships that allowed for the identification of novel materials with selective ion-exchange, selective oxidation, and long-range magnetic ordering. We found novel bonding motifs and identified periodic trends across the actinide series. We identified structural building units that would lead to desired structural features and novel topologies. We also characterized many different spectroscopic trends across the actinide series. The grant support the preparation of approximately 1200 new compounds all of which were structurally characterized.

  15. Detection of rare earth elements in Powder River Basin sub-bituminous coal ash using laser-induced breakdown spectroscopy (LIBS)

    Energy Technology Data Exchange (ETDEWEB)

    Tran, Phuoc [National Energy Technology Lab. (NETL), Pittsburgh, PA, (United State; Mcintyre, Dustin [National Energy Technology Lab. (NETL), Pittsburgh, PA, (United State

    2015-10-01

    We reported our preliminary results on the use of laser-induced breakdown spectroscopy to analyze the rare earth elements contained in ash samples from Powder River Basin sub-bituminous coal (PRB-coal). We have identified many elements in the lanthanide series (cerium, europium, holmium, lanthanum, lutetium, praseodymium, promethium, samarium, terbium, ytterbium) and some elements in the actinide series (actinium, thorium, uranium, plutonium, berkelium, californium) in the ash samples. In addition, various metals were also seen to present in the ash samples

  16. AcEST: DK960659 [AcEST

    Lifescience Database Archive (English)

    Full Text Available = +1 Query: 70 MPPCLEPSEIXXXXXXXXXXXXXAASSLAPWIGPLGLSPNSVGQDVS*DTAKEWKGLLVT 249 MPP L+PS+I AASSLAP IGPLGL+P .../70 (67%) Frame = +1 Query: 70 MPPCLEPSEIXXXXXXXXXXXXXAASSLAPWIGPLGLSPNSVGQDVS*DTAKEWKGLLVT 249 MPP L+PS+I A..., Positives = 47/70 (67%) Frame = +1 Query: 70 MPPCLEPSEIXXXXXXXXXXXXXAASSLAPWIGPLGLSPNSVGQDVS*DTAKEWKGLLVT ...70 (50%), Positives = 45/70 (64%) Frame = +1 Query: 70 MPPCLEPSEIXXXXXXXXXXXXXAAS...: 70 MPPCLEPSEIXXXXXXXXXXXXXAASSLAPWIGPLGLSPNSVGQDVS*DTAKEWKGLLVT 249 MPP +P+EI A

  17. ORF Alignment: NC_000911 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ALVETVCKLIGQGHRVVLVSSGAIGVGCSRLGLTE 60 ... Query: 129 FELGVIAIVNENDTVAIDELKFGDNDTLSALVASLVEADWLFLLTDVDRLYSSDPRL...DPD 188 ... FELGVIAIVNENDTVAIDELKFGDNDTLSALVASLVEADWLFLLTDVDRLYSSDPRLDPD S...bjct: 121 FELGVIAIVNENDTVAIDELKFGDNDTLSALVASLVEADWLFLLTDVDRLYSSDPRLDPD 180 ... Query: 249 AILQGANLGTQFEA 262 ... AILQGANLGTQFEA Sbjct: 241 AILQGANLGTQFEA 254

  18. ORF Alignment: NC_002695 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available MLHWPDSMMTYLTGDAILFSNDAFGQHYCDERLFNDEVDQTELM 180 ... Query: 249 YQEDRITIFYDTMSNNTRMMAD...AIAQGIAETDPRVAVDRLSTRLQDAGFEMSLSLKAK 306 ... YQEDRITIFYD+MSNNTRMMADAIAQGI + DP VAV ... ++ ... QD ... ++ ... ...+++K Sbjct: 241 YQEDRITIFYDSMSNNTRMMADAIAQGIHDVDPAVAVKVFNVSRQDKNDILTSVFRSK 298

  19. ORF Alignment: NC_002655 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available MLHWPDSMMTYLTGDAILFSNDAFGQHYCDERLFNDEVDQTELM 180 ... Query: 249 YQEDRITIFYDTMSNNTRMMAD...AIAQGIAETDPRVAVDRLSTRLQDAGFEMSLSLKAK 306 ... YQEDRITIFYD+MSNNTRMMADAIAQGI + DP VAV ... ++ ... QD ... ++ ... ...+++K Sbjct: 241 YQEDRITIFYDSMSNNTRMMADAIAQGIHDVDPAVAVKVFNVSRQDKNDILTSVFRSK 298

  20. ORF Alignment: NC_003911 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available XXXXXVTITGRRAEVLEQVATEGLHPMAMDVRHE 60 ... MHLNGKHALV ... VTITGRRAEVLEQVATEGLHPMA...MDVRHE Sbjct: 1 ... MHLNGKHALVTGGGTGIGLAIAQALAAEGAQVTITGRRAEVLEQVATEGLHPMAMDVRHE 60 ... Que...nase ... [Silicibacter pomeroyi DSS-3] ... Length = 249 ... Query: 1 ... MHLNGKHALVXXXXXXXXXXXXXXXX

  1. 76 FR 33419 - Nationally Recognized Statistical Rating Organizations

    Science.gov (United States)

    2011-06-08

    ... (``Rule 17g-10'') and 17 CFR 249b.400 (``Form ABS Due Diligence-15E''). Finally, the Commission, with... (``Rule 314 of Regulation S-T'') and 17 CFR 249.1400 (``Form ABS 15G''), and proposing new rule 17 CFR 240... be retained.\\18\\ As a result, the various retention and production requirements of paragraphs (c), (d...

  2. NCBI nr-aa BLAST: CBRC-DDIS-02-0127 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DDIS-02-0127 ref|XP_001642280.1| hypothetical protein Kpol_249p2 [Vanderwaltoz...yma polyspora DSM 70294] gb|EDO14422.1| hypothetical protein Kpol_249p2 [Vanderwaltozyma polyspora DSM 70294] XP_001642280.1 7e-67 43% ...

  3. GETDB: 104829 [GETDB

    Lifescience Database Archive (English)

    Full Text Available table - 1 249 Link to cluster table 249 1 Request - many scattered cells. fb, tr, epi sh. weak expression...clusters 1 Stock Request Request - Embryonic Expression many scattered cells. Larval GFP fb, tr, epi Larval X-gal

  4. Review of: Islam, Migration and Integration: The Age of Securitization

    DEFF Research Database (Denmark)

    Vinding, Niels Valdemar

    2010-01-01

    Islam, Migration and Integration: The Age of Securitization. By Ayhan Kaya. (Migration, Minorities and Citizenship). Houndmills, Basingstoke: Palgrave Macmillan, 2009. Pp. xiv+249. Hbk 978-0-230-51679-3. £55.......Islam, Migration and Integration: The Age of Securitization. By Ayhan Kaya. (Migration, Minorities and Citizenship). Houndmills, Basingstoke: Palgrave Macmillan, 2009. Pp. xiv+249. Hbk 978-0-230-51679-3. £55....

  5. 78 FR 9929 - Current Traumatic Brain Injury State Implementation Partnership Grantees; Non-Competitive One...

    Science.gov (United States)

    2013-02-12

    ... HUMAN SERVICES Health Resources and Services Administration Current Traumatic Brain Injury State... State Departments of Health, Rehabilitation, Human Services, Education, Transportation, or Labor. This...,000 Oregon State Department of Education H21MC06769 OR 249,999 249,999 Texas Health & Human Services...

  6. Iron-substituted AB5-type MH electrode

    Indian Academy of Sciences (India)

    substituted AB5-type MH electrode. SUMITA SRIVASTAVAa,∗ and R K UPADHYAYAb. aDepartment of Physics, Government P.G. College, Uttarkashi 249 193, India. bDepartment of Physics, Government P.G. College, Rishikesh 249 201, India.

  7. Medusae from the sea around Laccadive group of islands (7 degrees-18 degrees N/69 degrees-76 degrees E)

    Digital Repository Service at National Institute of Oceanography (India)

    Santhakumari, V.

    stream_size 7 stream_content_type text/plain stream_name 2_Workshop_Scient_Result_FORV_Sagar_Sampada_Proc_1996_249.pdf.txt stream_source_info 2_Workshop_Scient_Result_FORV_Sagar_Sampada_Proc_1996_249.pdf.txt Content-Encoding ISO-8859...

  8. 76 FR 315 - Sisters Ranger District; Deschutes National Forest; Oregon; Popper Vegetation Management Project

    Science.gov (United States)

    2011-01-04

    ... Leader, Sisters Ranger District, Pine Street and Highway 20, POB 249, Sisters, Oregon 97759, or submit to... INFORMATION CONTACT: Michael Keown, Team Leader, Sisters Ranger District, Pine Street and Highway 20, POB 249... wildlife species and other ecological processes. These no treatment areas include nesting, roosting, and...

  9. 77 FR 46773 - Proposed Collection; Comment Request

    Science.gov (United States)

    2012-08-06

    ..., 17 CFR 249.240f and 17 CFR 249.306). ] In interactive data format, financial statement information...-the-shelf software. The specified financial information already is and will continue to be required to... registration statements under the Securities Act of 1933 (15 U.S.C. 77a et seq.) and reports under the...

  10. Analysis of the complex between amyloid beta peptides and mitochondrial enzyme 17beta-HSD in cerebrospinal fluid

    Czech Academy of Sciences Publication Activity Database

    Krištofíková, Z.; Hegnerová, Kateřina; Bocková, Markéta; Vaisocherová, Hana; Bartoš, A.; Říčný, J.; Řípová, D.; Homola, J.

    2008-01-01

    Roč. 275, podzim (2008), s. 249-249 ISSN 1742-464X. [EUROPTRODE /9./. Dublin, 30.03.2008-02.04.2008] Institutional research plan: CEZ:AV0Z20670512 Keywords : surface plasmon resonance * alzheimer disease * 17beta-HSD10 Subject RIV: JB - Sensors, Measurment, Regulation Impact factor: 3.139, year: 2008

  11. A gas secondary electron detector

    CERN Document Server

    Drouart, A; Alamanos, N; Auger, F; Besson, P; Bougamont, E; Bourgeois, P; Lobo, G; Pollacco, E C; Riallot, M

    2002-01-01

    A new Secondary Electron gas Detector (SED) is under development to be used in conjunction with an emissive foil to detect low energy heavy ions as an alternative to micro-channel plates. It could measure position and time of flight. Secondary electrons are accelerated to 10 keV so that they can cross through the 0.9 mu m Mylar entrance window. The electrons then are multiplied in the isobutane gas of the detector at 4-10 Torr. A time resolution of 150 ps and a spatial resolution of 3 mm have been obtained by using californium fission fragments on a prototype detector of 7x7 cm sup 2. The advantage of the SED against MCP is that its size is not limited. Our final goal is to build a large size detector (15x40 cm sup 2) that will operate at the focal plane of the VAMOS magnetic spectrometer at GANIL.

  12. Environmental assessment of the thermal neutron activation explosive detection system for concourse use at US airports

    Energy Technology Data Exchange (ETDEWEB)

    Jones, C.G.

    1990-08-01

    This document is an environmental assessment of a system designed to detect the presence of explosives in checked airline baggage or cargo. The system is meant to be installed at the concourse or lobby ticketing areas of US commercial airports and uses a sealed radioactive source of californium-252 to irradiate baggage items. The major impact of the use of this system arises from direct exposure of the public to scattered or leakage radiation from the source and to induced radioactivity in baggage items. Under normal operation and the most likely accident scenarios, the environmental impacts that would be created by the proposed licensing action would not be significant. 44 refs., 19 figs., 18 tabs.

  13. Chelation and stabilization of berkelium in oxidation state +IV

    Science.gov (United States)

    Deblonde, Gauthier J.-P.; Sturzbecher-Hoehne, Manuel; Rupert, Peter B.; An, Dahlia D.; Illy, Marie-Claire; Ralston, Corie Y.; Brabec, Jiri; de Jong, Wibe A.; Strong, Roland K.; Abergel, Rebecca J.

    2017-09-01

    Berkelium (Bk) has been predicted to be the only transplutonium element able to exhibit both +III and +IV oxidation states in solution, but evidence of a stable oxidized Bk chelate has so far remained elusive. Here we describe the stabilization of the heaviest 4+ ion of the periodic table, under mild aqueous conditions, using a siderophore derivative. The resulting Bk(IV) complex exhibits luminescence via sensitization through an intramolecular antenna effect. This neutral Bk(IV) coordination compound is not sequestered by the protein siderocalin—a mammalian metal transporter—in contrast to the negatively charged species obtained with neighbouring trivalent actinides americium, curium and californium (Cf). The corresponding Cf(III)-ligand-protein ternary adduct was characterized by X-ray diffraction analysis. Combined with theoretical predictions, these data add significant insight to the field of transplutonium chemistry, and may lead to innovative Bk separation and purification processes.

  14. The CARIBU EBIS control and synchronization system

    Science.gov (United States)

    Dickerson, Clayton; Peters, Christopher

    2015-01-01

    The Californium Rare Isotope Breeder Upgrade (CARIBU) Electron Beam Ion Source (EBIS) charge breeder has been built and tested. The bases of the CARIBU EBIS electrical system are four voltage platforms on which both DC and pulsed high voltage outputs are controlled. The high voltage output pulses are created with either a combination of a function generator and a high voltage amplifier, or two high voltage DC power supplies and a high voltage solid state switch. Proper synchronization of the pulsed voltages, fundamental to optimizing the charge breeding performance, is achieved with triggering from a digital delay pulse generator. The control system is based on National Instruments realtime controllers and LabVIEW software implementing Functional Global Variables (FGV) to store and access instrument parameters. Fiber optic converters enable network communication and triggering across the platforms.

  15. Off-line commissioning of EBIS and plans for its integration into ATLAS and CARIBU

    Energy Technology Data Exchange (ETDEWEB)

    Ostroumov, P. N., E-mail: ostroumov@anl.gov; Barcikowski, A.; Dickerson, C. A.; Mustapha, B.; Perry, A.; Sharamentov, S. I.; Vondrasek, R. C.; Zinkann, G. [Argonne National Laboratory, Argonne, Illinois 60439 (United States)

    2016-02-15

    An Electron Beam Ion Source Charge Breeder (EBIS-CB) has been developed at Argonne to breed radioactive beams from the CAlifornium Rare Isotope Breeder Upgrade (CARIBU) facility at Argonne Tandem Linac Accelerator System (ATLAS). The EBIS-CB will replace the existing ECR charge breeder to increase the intensity and significantly improve the purity of reaccelerated radioactive ion beams. The CARIBU EBIS-CB has been successfully commissioned offline with an external singly charged cesium ion source. The performance of the EBIS fully meets the specifications to breed rare isotope beams delivered from CARIBU. The EBIS is being relocated and integrated into ATLAS and CARIBU. A long electrostatic beam transport system including two 180° bends in the vertical plane has been designed. The commissioning of the EBIS and the beam transport system in their permanent location will start at the end of this year.

  16. Populations of selected microbial and fungal species growing on the surface of rape seeds following treatment with desiccants or plant growth regulators.

    Science.gov (United States)

    Frac, Magdalena; Jezierska-Tys, Stefania; Tys, Jerzy

    2010-01-01

    The aim of this study was to determine the effects of desiccants and plant growth regulators on selected microbial species affecting rape seeds, with special emphasis on the growth of fungi and identification of the genus and species composition. The experimental material in the study was seeds of winter rape cv. Californium that were collected from the field during combine harvest. The chemical agents applied, both desiccants and growth regulators, generally decreased the populations of bacteria occurring on the surface of rape seeds. The responses of fungi depended upon the type of agent applied and were manifested as either stimulation or inhibition of the growth of the fungal species. The fungi isolated from the surface of rape seeds were characteristic of those found in the field environment (Cladosporium and Penicillium) and typical for those present on the surface of rape seeds (Alternaria).

  17. Reliability of semiconductor and gas-filled diodes for over-voltage protection exposed to ionizing radiation

    Directory of Open Access Journals (Sweden)

    Stanković Koviljka

    2009-01-01

    Full Text Available The wide-spread use of semiconductor and gas-filled diodes for non-linear over-voltage protection results in a variety of possible working conditions. It is therefore essential to have a thorough insight into their reliability in exploitation environments which imply exposure to ionizing radiation. The aim of this paper is to investigate the influence of irradiation on over-voltage diode characteristics by exposing the diodes to californium-252 combined neutron/gamma radiation field. The irradiation of semiconductor over-voltage diodes causes severe degradation of their protection characteristics. On the other hand, gas-filled over-voltage diodes exhibit a temporal improvement of performance. The results are presented with the accompanying theoretical interpretations of the observed changes in over-voltage diode behaviour, based on the interaction of radiation with materials constituting the diodes.

  18. Triton and alpha-particle contribution from LiF converter for neutron dosimeter

    CERN Document Server

    Camacho, M E; Balcazar, M

    1999-01-01

    A personnel neutron dosimeter prototype based on chemical and electrochemical etched CR-39 detector, combined with LiF converter, has been calibrated using an ICRP-like phantom, under a heavy-water moderated Californium source neutron spectra; A conversion factor of 1.052+-126 spots cm sup - sup 2 mSv sup - sup 1 was obtained. The sealing properties of the detector holder showed a ten-fold reduction in radon background when it was tested in a high radon atmosphere. A convenient mechanical shock resistance was achieved in LiF converters by sintering to 11 tons pressure LiF powder at 650 deg. C, during one hour.

  19. Study of reproducibility of measurements with the spectrometer of Bonner multispheres

    Energy Technology Data Exchange (ETDEWEB)

    Azevedo, G.A.; Pereira, W.W.; Patrao, K.C.S.; Fonseca, E.S., E-mail: geisadeazevedo@gmail.com, E-mail: walsan@ird.gov.br, E-mail: karla@ird.gov.br, E-mail: evaldo@ird.gov.br [Instituto de Radionprotecao e Dosimetria (IRD/CNEN-RJ), Rio de Janeiro, RJ (Brazil)

    2013-07-01

    This work aims to study the metrological behavior of the Bonner Multisphere Spectrometer (BMS) of the LN / LNMRI / IRD - Laboratorio Metrologia de Neutrons / Laboratorio Nacional de Metrologia e Radiacao Ionizante / Instituto de Radioprotecao e Dosimetria, for measurements in repeatability and reproducibility conditions. Initially, a simulation was done by applying the Monte Carlo method, using the MCNP code and respecting the ISO 8529-1 (2001), using the sources of Californium ({sup 252} Cf), Americium-Beryllium ({sup 241} AmBe) and californium in heavy water (Cf + D{sub 2}O), all located at a distance of 100 cm from the neutron detector ({sup 6}Li (Eu) - crystal scintillator). In this program, the counting of neutrons that are captured by the detector was made. The source is located in the center of a sphere of radius 300 cm. Analyzes the impact of these neutrons in a point of the sphere wall, which in this case acted as a neutron detector and from there, it is estimated the number of neutrons that collide in the whole sphere. The purpose is to obtain the neutron count for different energy bands in a solid field of neutrons, since they have a spectrum ranging from a low to a high energy that can also vary within a particular environment. Wishes to obtain new fields with different sources and moderators materials to be used as new reference fields. Measurements are being conducted for these fields, with the aim of analyzing the variability conditions of the measurement (repeatability and reproducibility) in LEN - Laboratorio de Espectrometria de Neutrons of the LN/LMNRI/IRD. Thus, the spectrometer will be used to improve both the knowledge of the spectrum as the standard of neutrons of the lab, proving that a spectrometry is essential for correct measurement.

  20. Disease: H01357 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available .01.002 ... PMID:20672788 (drug) ... AUTHORS ... Usatine RP, Riojas M ... TITLE ... Diagnosis and management of contact dermatitis. ... JOURNAL ... Am Fam Physician 82:249-55 (2010) ...

  1. The genus Surirella (Bacillariophyta) in the sub-Antarctic and maritime Antarctic region

    Czech Academy of Sciences Publication Activity Database

    Van de Vijver, B.; Cocquyt, Ch.; De Haan, M.; Kopalová, Kateřina; Zidarova, R.

    2013-01-01

    Roč. 28, č. 1 (2013), s. 93-108 ISSN 0269-249X Institutional support: RVO:67985939 Keywords : Bacillariophyta * Surirella * Bacillariophyta Subject RIV: EF - Botanics Impact factor: 1.000, year: 2013

  2. Morphology and taxonomy of an almost forgotten fossil diatom Gaillonella sculpta EHRENBERG (Bacillariophyceae)

    Czech Academy of Sciences Publication Activity Database

    Usoltseva, M.; Houk, Václav

    2016-01-01

    Roč. 31, č. 1 (2016), s. 39-49 ISSN 0269-249X Institutional support: RVO:67985939 Keywords : Miocene * Gaillonella * Pseudoaulacosira * taxonomy * valve ultrastructure. * Bacillariophyceae Subject RIV: EF - Botanics Impact factor: 1.677, year: 2016

  3. Aulacoseira kruegeriana (Bacillariophyta, Coscinodiscophyceae): a new centric diatom from high-elevation Andean streams of Bolivia

    Czech Academy of Sciences Publication Activity Database

    Morales, E. A.; Rivera, S. F.; Rubin, S. D. C.; Vis, M. L.; Houk, Václav

    2015-01-01

    Roč. 30, č. 3 (2015), s. 269-277 ISSN 0269-249X Institutional support: RVO:67985939 Keywords : centric diatom s * taxonomy * valve ultrastructure Subject RIV: EF - Botanics Impact factor: 1.868, year: 2015

  4. ClEST cluster :Cl_singleton1575 [ClEST

    Lifescience Database Archive (English)

    Full Text Available Cl_singleton1575 calpain Cimex lectularius nuclear gene 249 GAGACACCACTTGTGAGACTGAGGAACCCATGGGGAAAAG...AAGCTTTACAAACAAAACAGCCA fw16050 1 PREDICTED: calpain-1 catalytic subunit-like [Acyrthosiphon pisum] XP_001944347

  5. Partial genetic characterization of Sedlec virus (Orthobunyavirus, Bunyaviridae)

    Czech Academy of Sciences Publication Activity Database

    Bakonyi, T.; Kolodziejek, J.; Rudolf, Ivo; Berčič, R.; Nowotny, N.; Hubálek, Zdeněk

    2013-01-01

    Roč. 19, October (2013), s. 244-249 ISSN 1567-1348 Institutional support: RVO:68081766 Keywords : Sedlec virus * Leanyer virus * Simbu group * Orthobunyavirus * Acrocephalus Subject RIV: EE - Microbiology, Virology Impact factor: 3.264, year: 2013

  6. A numerical study of two different specimen fixtures for the modified compact tension test – their influence on concrete fracture parameters

    Czech Academy of Sciences Publication Activity Database

    Holušová, Táňa; Seitl, Stanislav; Cifuentes, H.; Canteli, A.

    2016-01-01

    Roč. 10, č. 35 (2016), s. 242-249 ISSN 1971-8993 Institutional support: RVO:68081723 Keywords : Modified Compact Tension Test * Fracture Parameters * Cementitious Composites * FEM Subject RIV: JL - Materials Fatigue, Friction Mechanics

  7. The Role of Personalities in Passing-Down the Tradition within the System of Culture

    Czech Academy of Sciences Publication Activity Database

    Pospíšilová, Jana; Stefanović-Banović, Milesa

    LXV, č. 2 (2017), s. 249-254 ISSN 0350-0861 Institutional support: RVO:68378076 Keywords : Personalities * Ethnology * Tradition * System of Culture Subject RIV: AC - Archeology, Anthropology, Ethnology

  8. Pseudorca crassidens (Owen), ein Beitrag zur vergleichenden Anatomie der Cetaceen

    NARCIS (Netherlands)

    Slijper, E.J.

    1939-01-01

    INHALTSÜ BERSICHT Abschnitt 1 Einleitung; Material .... 243 I Strandung .... 243 II Material .... 244 Abschnitt 2 Nomenklatur; Geographische Verbreitung; Lebensweise .... 245 I Nomenklatur .... 245 II Geographische Verbreitung .... 246 III Lebensweise .... 249 Abschnitt 3 Äussere Form; Wachstum ....

  9. Vocal signals in a tropical avian species, the redvented bulbul ...

    Indian Academy of Sciences (India)

    Author Affiliations. Anil Kumar1 2 Dinesh Bhatt1. Department of Zoology and Environmental Science, Gurukul Kangri University, Haridwar 249 404, India; Desert Regional Station, Zoological Survey of India, Jodhpur 342 005, India ...

  10. Aggarwal, Dr Rakesh

    Indian Academy of Sciences (India)

    Specialization: Immunisation, Public Health, Gastrointestinal & Liver Diseases, Viral Hepatitis, Epidemiology and Health Economics Address: Department of Gastroenterology, Sanjay Gandhi Postgraduate Institute of Medical Sciences, Raebareli Road, Lucknow 226 014, U.P.. Contact: Office: (0522) 249 4431. Residence: ...

  11. Ionic conductivity study of Lil-Ga2S3-GeS2 chalcogenide glasses using a random – walk approach

    Czech Academy of Sciences Publication Activity Database

    Patil, S. D.; Konale, M. S.; Kolář, J.; Shimakawa, K.; Zima, Vítězslav; Wágner, T.

    2015-01-01

    Roč. 87, č. 3 (2015), s. 249-259 ISSN 0033-4545 Institutional support: RVO:61389013 Keywords : chalcogenide glasses * impedance spectroscopy * ionic conductivity Subject RIV: CA - Inorganic Chemistry Impact factor: 2.615, year: 2015

  12. Disease: H00213 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available by deficiency of alkaline phosphatase activity and characterized by defective bone and teeth mineralization.... Inherited metabolic disease ALPL; alkaline phosphatase [HSA:249] [KO:K01077] ... reduced serum ALP activity

  13. African Journal of Sustainable Development - Vol 6, No 1 (2016)

    African Journals Online (AJOL)

    Health-Sector Performance in Post-Independent Nigeria: A Comparative Impact Analysis of Two Regimes · EMAIL FULL TEXT EMAIL FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. W F Ohioze, I U Uwazie, 249-266 ...

  14. Consumer response to packaging design

    NARCIS (Netherlands)

    Steenis, Nigel D.; Herpen, van Erica; Lans, van der Ivo A.; Ligthart, Tom N.; Trijp, van Hans C.M.

    2017-01-01

    Building on theories of cue utilization, this paper investigates whether and how packaging sustainability influences consumer perceptions, inferences and attitudes towards packaged products. A framework is tested in an empirical study among 249 students using soup products varying in packaging

  15. A new temperature-dependent equation of state of solids

    Indian Academy of Sciences (India)

    Author Affiliations. Kamal Kapoor1 Anuj Kumar2 Narsingh Dass1. Physics Department, College of Engineering Roorkee, Roorkee 247 667, India; Physics Department, Gurukul Kangri Vishwavidyalaya, Haridwar 249 404, India ...

  16. The how of WOW: a guide to giving a speech that will positively blow 'em away

    National Research Council Canada - National Science Library

    Carlson, Tony

    2005-01-01

    ... Your Speech 249 Appendix D- How About the ROI? 265 Index 269 ... 11182$ CNTS 01-19-05 10:15:57 PS PAGE vi AcknowledgmentsAcknowledgments In the general chatter after a major speech given by a client ...

  17. Voice, dialogicality and identity construction in textual

    African Journals Online (AJOL)

    Kate H

    contrasting text types; namely Lonmin Corporate Social Responsibility (CSR) reports and transcripts of verbal ... Keywords: Marikana, critical discourse analysis, neoliberalism, corporate social responsibility, oral testimonies, Van ...... Corporate Communications: An International Journal 15(3):249-262. Breeze, R. 2013.

  18. Disease: H00156 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available osity. Clin Exp Nephrol 11:174-9 (2007) PMID:15630634 Smelt AH, de Beer F Apolipoprotein E and familial dysbetalipoproteinemia: clini...cal, biochemical, and genetic aspects. Semin Vasc Med 4:249-57 (2004) ...

  19. relationships between vegetation composition and environmental

    African Journals Online (AJOL)

    Preferred Customer

    CIAT-TSBF) ... Guebas et al., 2002) and it affects biological ...... communities, species richness and their environmental correlates in the sandy heaths of. Little Desert National Park, Victoria. Australian. Journal of Ecology 24(3):249–257. 10.

  20. African Journal of Biomedical Research - Vol 18, No 3 (2015)

    African Journals Online (AJOL)

    Simultaneous Occurrence of Periodontal and Skin Abscesses in a Nigerian Girl: Case Report · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. EB Dosumu, OO Bankole, OO Dosumu, 249-255 ...

  1. 1983 walrus harvest, health, and welfare study at Gambell, Alaska: Progress report

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — The total documented harvest during the period of observation in 1983 was 642 walruses. This included 249 adult males (38.8%), 203 adult females (31.6%), and 190...

  2. EST Table: BB985913 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available ar to putative lysosomal glucocerebrosidase [Tribolium castaneum] 10/08/28 30 %/249 aa FBpp0129766|DereGG112...EDICTED: similar to putative lysosomal glucocerebrosidase [Tribolium castaneum] BB985877 MSV3 ...

  3. Variation in the PTEN-induced putative kinase 1 gene associated ...

    Indian Academy of Sciences (India)

    -transfer. Results from gene mapping and genetic variation analysis have indicated ... if they were receiving anti-diabetic treatment by oral hypo- glycemic agents and insulin. Another 249 glucose tolerant normal subjects were recruited from ...

  4. 78 FR 4469 - Biweekly Notice; Applications and Amendments to Facility Operating Licenses and Combined Licenses...

    Science.gov (United States)

    2013-01-22

    ..., Pilgrim Nuclear Power Station (Pilgrim), Plymouth County, Massachusetts Entergy Nuclear Vermont Yankee...--193; IP2--271; IP3--248; Palisades-- ] 249; Pilgrim--239; RBS--178; VY--253; and Waterford--240...

  5. Temperature, salinity, oxygen, nutrients and productivity profile data from THOMAS G. THOMPSON Cruise 001, 19651014 to 19651207 in the Caribbean Sea and the northeastern tropical Pacific Ocean (NODC Accession 7100507)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This accession contains a copy of University of Washington Department of Oceanography Technical Report No. 249, Physical, chemical, and productivity data from a...

  6. Commentary: How relevant are the concepts of species diversity and ...

    Indian Academy of Sciences (India)

    2005-10-10

    Oct 10, 2005 ... Author Affiliations. Laishangbam Sanjit1 Dinesh Bhatt1. Avian Biodiversity and Bioacoustics Lab, Department of Zoology and Environmental Sciences, Gurukula Kangri University, Haridwar 249 404, India ...

  7. Mohanty, Prof. Bedangadas

    Indian Academy of Sciences (India)

    Specialization: Dark Matter, Experimental High Energy Physics, Phase Diagram of Quantum Chromodynamics Address: School of Physical Sciences, National Institute of Science Education & Research, Jatni, Khordha 752 050, Orissa Contact: Office: (0674) 249 4266. Residence: (0671) 230 0596. Mobile: 88955 84872

  8. Recension: Efectos personales del divorcio respecto de los hijos – Review: Personal Effects of Divorce in Relation to Children

    Directory of Open Access Journals (Sweden)

    Teresa Dupla Marin

    2013-05-01

    Full Text Available Recension: Carmen López‐Rendo Rodríguez, Efectos personales del divorcio respecto de los hijos, De Roma al Codigo civil español, RIDROM (online 9, 2012, Pág. 249–270Review: Carmen López‐Rendo Rodríguez, Personal Effects of Divorce in Relation to Children, from Classical Rome to the Spanish Civil Code, RIDROM (online 9, 2012, pp. 249–270

  9. Prevalence of Hepatitis E Virus Infection in Children in the Northeast of Spain▿

    Science.gov (United States)

    Buti, Maria; Plans, Pere; Domínguez, Angela; Jardi, Rossend; Frias, Francisco Rodriguez; Esteban, Rafael; Salleras, Luis; Plasencia, Antoni

    2008-01-01

    The prevalence of immunoglobulin G (IgG) anti-hepatitis E virus (anti-HEV) antibodies was studied with a representative sample of 1,249 healthy children aged between 6 and 15 years. IgG anti-HEV antibodies were detected in 57 (4.6%) of the 1,249 samples analyzed, suggesting that some children are exposed to HEV in early childhood. PMID:18321881

  10. Significance of mangrove swamps for aquaculture

    Digital Repository Service at National Institute of Oceanography (India)

    Wafar, S.; Untawale, A.G.

    stream_size 9 stream_content_type text/plain stream_name I.O_21_Century_Linkage_Networking_1998_249.pdf.txt stream_source_info I.O_21_Century_Linkage_Networking_1998_249.pdf.txt Content-Encoding ISO-8859-1 Content-Type text.../plain; charset=ISO-8859-1 ...

  11. GETDB: 113515 [GETDB

    Lifescience Database Archive (English)

    Full Text Available Ser Link to clone table - 1 2063 Link to cluster table 2063 1 Request - pns (ch subset) gut sg, fb, mt - lethal - comment1:A, D, com...wn as - Original Comments comment1:A, D, comment2:49D2-D3, P and lethal on 2nd ch, lethal on 3rd ch Disc (Im...ment2:49D2-D3, P and lethal on 2nd ch, lethal on 3rd ch

  12. Environmentally Controlled Infrared Spectroscopy System for Fundamental Studies of Polymer Electrolyte Membranes

    Science.gov (United States)

    2015-10-15

    and experimental vibrational spectroscopy of ionomers. Presented at the 249th ACS National Meeting & Exposition, Denver, CO, March 22-26, 2015. PMSE ...hydration, for quantum dot preparation. Presented at the 249th ACS National Meeting & Exposition, Denver, CO, March 22-26, 2015. PMSE 476. Romeo...Presented at the 250th ACS National Meeting & Exposition, Boston, MA, August 16-20, 2015. PMSE 388. Vong, A.; Kendrick, I.; Doan, J.; Smotkin, E. S

  13. HIV-1 Thai B strain has spread out of former plasma donors into general population through sexual contact in Henan, China.

    Science.gov (United States)

    Li, Lin; Sun, Guoqing; Zhong, Ping; Han, Jingwan; Li, Tianyi; Jia, Dijing; Liu, Yongjian; Sun, Changrong; Wang, Zhe; Li, Hanping; Wang, Xiaolin; Li, Jingyun

    2016-04-01

    Henan, China is characterized by the outbreak of HIV epidemic of Thai B strain in former plasma donors in 1990s. After the forbidden of paid blood donation, whether Thai B strain will spread out of former plasma donors into sexual transmitted population is unknown. To answer the question, phylogenetic analysis was used to explore relationships of HIV strains circulating in those two populations in the study. HIV-1 sero-positive drug-naïve patients infected through sexual contact were enrolled into the study. Full length gag and pol genes were amplified with nested RT-PCR followed by sequencing and phylogenetic analysis. The genotypes of anti-HIV drug resistance were also analyzed with available pol genes. HIV subtypes were determined in 249 individuals from 288 participants. Subtype B was dominant (202/249, 81.1%), followed by CRF01_AE (25/249, 10.0%), CRF07_BC (14/249, 5.6%), C (4/249, 1.6%), URF (3/249, 1.2%), and CRF08_BC (1/249, 0.4%). Most of subtype B strains belong to Thailand B lineage. All of Thai B strains identified in sexual transmitted population intermixed with those from former blood donors in phylogenetic tree, suggesting close phylogenetic relationship between strains epidemic in those two populations. TDR was identified in 9.9% individuals. Thai B strain has spread out of former blood donors in Henan province. The finding will contribute to understanding the distribution and evolution of HIV-1 in Henan province and also provide clue to behavior change intervention. © 2015 Wiley Periodicals, Inc.

  14. Actinide targets for the synthesis of super-heavy elements

    Energy Technology Data Exchange (ETDEWEB)

    Roberto, J.B., E-mail: robertojb@ornl.gov; Alexander, C.W.; Boll, R.A.; Burns, J.D.; Ezold, J.G.; Felker, L.K.; Hogle, S.L.; Rykaczewski, K.P.

    2015-12-15

    Since 2000, six new super-heavy elements with atomic numbers 113 through 118 have been synthesized in hot fusion reactions of {sup 48}Ca beams on actinide targets. These target materials, including {sup 242}Pu, {sup 244}Pu, {sup 243}Am, {sup 245}Cm, {sup 248}Cm, {sup 249}Cf, and {sup 249}Bk, are available in very limited quantities and require specialized production and processing facilities resident in only a few research centers worldwide. This report describes the production and chemical processing of heavy actinide materials for super-heavy element research, current availabilities of these materials, and related target fabrication techniques. The impact of actinide materials in super-heavy element discovery is reviewed, and strategies for enhancing the production of rare actinides including {sup 249}Bk, {sup 251}Cf, and {sup 254}Es are described.

  15. Differential expression of carotenoid biosynthetic pathway genes in two contrasting tomato genotypes for lycopene content.

    Science.gov (United States)

    Pandurangaiah, Shilpa; Ravishankar, Kundapura V; Shivashankar, Kodthalu S; Sadashiva, Avverahally T; Pillakenchappa, Kavitha; Narayanan, Sunil Kumar

    2016-06-01

    Tomato (Solanum lycopersicum L.) is one of the model plant to study carotenoid biosynthesis. In the present study, the fruit carotenoid content were quantified at different developmental stages for two contrasting genotypes, viz. IIHR-249-1 and IIHR-2866 by UPLC. Lycopene content was high in IIHR-249-1 (19.45 mg/100 g fresh weight) compared to IIHR-2866 (1.88 mg/100 g fresh weight) at the ripe stage. qPCR was performed for genes that are involved in the carotenoid biosynthetic pathway to study the difference in lycopene content in fruits of both the genotypes. The expression of Phytoene synthase (PSY) increased by 36-fold and Phytoene desaturase (PDS) increased by 14-fold from immature green stage to ripe stage in IIHR-249-1. The expression of Chloroplast lycopene beta-cyclase (LCY-B) and Chromoplast lycopene beta cyclase (CYC-B) decreased gradually from the initial stage to the ripe stage in IIHR-249-1. IIHR 249-1 showed 3- and 1.8-fold decrease in gene expression for Chloroplast lycopene beta-cyclase (LCY-B) and Chromoplast lycopene beta-cyclase (CYC-B) .The F2 hybrids derived from IIHR-249-1 and IIHR-2866 were analysed at the ripe stage for lycopene content. The gene expression of Chloroplast lycopene beta-cyclase (LCY-B) and Chromoplast lycopene beta-cyclase (CYC-B) in high and low lycopene lines from F2 progenies also showed the decrease in transcript levels of both the genes in high lycopene F2 lines. We wish to suggest that the differential expression of lycopene beta-cyclases can be used in marker-assisted breeding.

  16. Activation of skeletal muscle AMPK promotes glucose disposal and glucose lowering in non-human primates and mice

    DEFF Research Database (Denmark)

    Cokorinos, Emily C; Delmore, Jake; Reyes, Allan R

    2017-01-01

    for AMPK β1-containing complexes, PF-249. In cells and animals, both compounds were effective at activating AMPK in hepatocytes, but only PF-739 was capable of activating AMPK in skeletal muscle. In diabetic mice, PF-739, but not PF-249, caused a rapid lowering of plasma glucose levels that was diminished...... in the absence of skeletal muscle, but not liver, AMPK heterotrimers and was the result of an increase in systemic glucose disposal with no impact on hepatic glucose production. Studies of PF-739 in cynomolgus monkeys confirmed translation of the glucose lowering and established activation of AMPK in skeletal...

  17. CX3CR1 is a modifying gene of survival and progression in amyotrophic lateral sclerosis.

    Directory of Open Access Journals (Sweden)

    Alan Lopez-Lopez

    Full Text Available The objective of this study was to investigate the association of functional variants of the human CX3CR1 gene (Fractalkine receptor with the risk of Amyotrophic Lateral Sclerosis (ALS, the survival and the progression rate of the disease symptoms in a Spanish ALS cohort. 187 ALS patients (142 sporadic [sALS] and 45 familial and 378 controls were recruited. We investigated CX3CR1 V249I (rs3732379 and T280M (rs3732378 genotypes and their haplotypes as predictors of survival, the progression rate of the symptoms (as measured by ALSFRS-R and FVC decline and the risk of suffering ALS disease. The results indicated that sALS patients with CX3CR1 249I/I or 249V/I genotypes presented a shorter survival time (42.27 ± 4.90 than patients with 249V/V genotype (67.65 ± 7.42; diff -25.49 months 95%CI [-42.79,-8.18]; p = 0.004; adj-p = 0.018. The survival time was shorter in sALS patients with spinal topography and CX3CR1 249I alleles (diff =  -29.78 months; 95%CI [-49.42,-10.14]; p = 0.003. The same effects were also observed in the spinal sALS patients with 249I-280M haplotype (diff =  -27.02 months; 95%CI [-49.57, -4.48]; p = 0.019. In the sALS group, the CX3CR1 249I variant was associated with a faster progression of the disease symptoms (OR = 2.58; 95IC% [1.32, 5.07]; p = 0.006; adj-p = 0.027. There was no evidence for association of these two CX3CR1 variants with ALS disease risk. The association evidenced herein is clinically relevant and indicates that CX3CR1 could be a disease-modifying gene in sALS. The progression rate of the disease's symptoms and the survival time is affected in patients with one or two copies of the CX3CR1 249I allele. The CX3CR1 is the most potent ALS survival genetic factor reported to date. These results reinforce the role of the immune system in ALS pathogenesis.

  18. Gclust Server: 58251 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available 58251 CEL_F37C4.4_25148845 Cluster Sequences - 249 F37C4.4a 2 1.00e-99 0.0 0.0 0.0 ...0.0 0.0 12.5 Show 58251 Cluster ID 58251 Sequence ID CEL_F37C4.4_25148845 Link to cluster sequences Cluster ...Sequences Link to related sequences - Sequence length 249 Representative annotation F37C4.4a Number of Sequences 2 Homologs 2 Clus...ungi) (8species) (%) 12.5 Number of Sequences for each species CEL: 2 Species not appearing in this clus

  19. Dicty_cDB: Contig-U11300-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Expect(3) = e-155 Identities = 230/249 (92%), Positives = 231/249 (92%) Frame = +3 Query: 1128 QAYNQ...(185), Expect(3) = e-155 Identities = 38/54 (70%), Positives = 39/54 (72%) Frame = +1 Query: 1867 KKNQGII... Expect(3) = e-155 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = +2 Query: 1049 NQCTNL...Expect(2) = 7e-96 Identities = 140/142 (98%), Positives = 141/142 (99%) Frame = +1 Query: 313 MSLDLS... Expect(2) = 7e-96 Identities = 56/106 (52%), Positives = 64/106 (60%), Gaps = 3/106 (2%) Frame = +3

  20. Applicability of Superconducting Interconnection Technology for High Speed ICs and Systems

    Science.gov (United States)

    1992-10-01

    and Van Duyer, "Fields and Waves in Communications Electronics", John Wiley & Sons, New York 1965, pp. 249-252, 286-293 and 444-446. 2. Fred E. Gardiol...Electronics", John Wiley & Sons, New York 1965, pp. 249-252, 286-293 and 444-446. 2. Fred E. Gardiol, "Lossy Transmission Lines", Artech House, Inc...program "HiQ" from Bimillennium Corp., 101 Albright Way, Los Gatos, CA 95030, (800) 488-8662, running on either a Mackintosh Ifx or a Powerbook 170 was used

  1. PRKAG3 and CAST genetic polymorphisms and quality traits of dry-cured hams--II. Associations in French dry-cured ham Jambon de Bayonne and their dependence on salt reduction.

    Science.gov (United States)

    Santé-Lhoutellier, V; Robert, N; Martin, J F; Gou, P; Hortós, M; Arnau, J; Diestre, A; Candek-Potokar, M

    2012-12-01

    This study aimed to evaluate the effects of PRKAG3 Ile199Val and CAST Arg249Lys and CAST Ser638Arg polymorphisms on the quality traits of the French dry-cured ham Jambon de Bayonne and their interaction with salt reduction. Significant (p<0.05) and suggestive associations (p<0.10) between the polymorphisms and several quality traits of dry-cured ham, mainly related to processing and textural properties, were found. PRKAG3 Ile/Val and CAST 249Lys/638Arg presented the highest scores for sensory and processing properties, whatever the salt content. Copyright © 2012 Elsevier Ltd. All rights reserved.

  2. Antibody-Mediated BRCC36 Silencing: A Novel Approach for Targeted Breast Cancer Therapy

    Science.gov (United States)

    2009-06-01

    Hejna J, Grompe M, D’Andrea AD. 2001. Interaction of the Fanconi anemia proteins and BRCA1 in a common pathway. Mol Cell 7(2):249-62. Houghtaling...Interaction of the Fanconi anemia proteins and BRCA1 in a common pathway. Mol Cell 7: 249-62. Houghtaling S, Newell A, Akkari Y, Taniguchi T, Olson S...following UV radiation in human breast cancer cells. Oncogene 21(29):4481-9. Boulton SJ, Martin JS, Polanowska J, Hill DE , Gartner A, Vidal M. 2004

  3. Physical Challenges Associated with Deployment-Related Injuries

    Science.gov (United States)

    2011-04-06

    was categorized into: underweight (គ.5), healthy (18.5–24.9), overweight (25.0–29.9), and obese (≥30.0) [21]. Vocational Outcomes. The vocational...Cohort of US Military Medical Students. J Am Board Fam Med 2008, 21:165–167. 21. Centers for Disease Control and Prevention. Division of Nutrition ... underweight (គ.5), healthy (18.5–24.9), overweight (25.0–29.9), and obese (≥30.0). bClinically significant increase in BMI.[27] Characteristics Body mass

  4. Strategic Analysis of the 2014 Wounded Warrior Project Annual Alumni Survey: A Way Forward

    Science.gov (United States)

    2015-01-01

    Underweight Normal weight Overweight Obese 0.4 17.0 39.5 42.6 Summary xv below 18.5 is underweight , 18.5 to 24.9 is a normal weight, 25.0 to 29.9 is...Wellness program, WWP addresses issues of fitness, nutrition , and wellness by enabling Alumni to participate in activities, such as adaptive sports, yoga...Prevention (CDC) con- siders a BMI below 18.5 underweight , 18.5 to 24.9 a normal weight, 25.0 to 29.9 overweight, and 30 or greater obese (CDC, 2012

  5. Compensated bismuth-loaded plastic scintillators for neutron detection using low-energy pseudo-spectroscopy

    Energy Technology Data Exchange (ETDEWEB)

    Dumazert, Jonathan, E-mail: jonathan.dumazert@cea.fr [CEA, LIST, Laboratoire Capteurs Architectures Electroniques, 91191 Gif-sur-Yvette (France); Coulon, Romain; Bertrand, Guillaume H.V.; Normand, Stéphane [CEA, LIST, Laboratoire Capteurs Architectures Electroniques, 91191 Gif-sur-Yvette (France); Méchin, Laurence [CNRS, UCBN, Groupe de Recherche en Informatique, Image, Automatique et Instrumentation de Caen, 14050 Caen (France); Hamel, Matthieu [CEA, LIST, Laboratoire Capteurs Architectures Electroniques, 91191 Gif-sur-Yvette (France)

    2016-05-21

    Gadolinium-covered modified plastic scintillators show a high potential for the deployment of cost-effective neutron detectors. Taking advantage of the low-energy photon and electron signature of thermal neutron captures in gadolinium-155 and gadolinium-157 however requires a background correction. In order to display a trustable rate, dual compensation schemes appear as an alternative to Pulse Shape Discrimination. This paper presents the application of such a compensation scheme to a two-bismuth loaded plastic scintillator system. A detection scintillator interacts with incident photon and fast neutron radiations and is covered with a gadolinium converter to become thermal neutron-sensitive as well. In the meantime, an identical compensation scintillator, covered with terbium, solely interacts with the photon and fast neutron part of incident radiations. After the acquisition and the treatment of the counting signals from both sensors, a hypothesis test determines whether the resulting count rate after subtraction falls into statistical fluctuations or provides a robust image of neutron activity. A laboratory prototype is tested under both photon and neutron radiations, allowing us to investigate the performance of the overall compensation system. The study reveals satisfactory results in terms of robustness to a cesium-137 background and in terms of sensitivity in presence of a californium-252 source.

  6. Systematic studies of the fundamental chemistry of pyrochlore oxides. An{sub 2}Zr{sub 2}O{sub 7} [An=Pu, Am, Cm, Bk and Cf

    Energy Technology Data Exchange (ETDEWEB)

    Haire, R.G.; Assefa, Z. [Oak Ridge National Laboratory, Oak Ridge, TN (United States); Raison, P.E. [Commissariat a l' Energie Atomique, CEA-Cadarache DRN/DEC/SPUA/LACA (France)

    2002-11-01

    Our efforts to pursue the fundamental science of actinide pyrochlore oxides, An{sub 2}Zr{sub 2}O{sub 7}, (An=plutonium through californium), are presented. We have addressed their structural and chemical behavior via X-ray diffraction, Raman spectroscopy and by considering the pseudo-oxidation potentials of the actinides. The structure, fundamental chemistry, ionic radii and the electronic configuration of the specific actinide involved in these oxide systems all have a significant impact on their science. We are also exploring a calculational approach based on valence-bond relationships to assess the position of the oxygen atoms located at the general crystallographic position. The oxygen position is important regarding the chemical behavior and thermal stability of these materials. Also considered is the structural stability of the materials regarding self-irradiation, and with some compounds, their resistance towards oxidation. These aspects will be discussed using a systematic evaluation of the five-actinide systems together with comparable lanthanide systems studied. (author)

  7. 1982 US-CEC neutron personnel dosimetry intercomparison study

    Energy Technology Data Exchange (ETDEWEB)

    Swaja, R.E.; Sims, C.S.; Greene, R.T.; Schraube, H.; Burger, G.

    1983-11-01

    A neutron personnel dosimetry intercomparison study was conducted during April 19-23, 1982, as a joint effort between the United States and the Commission of European Communities. Dosimeters from 48 participating agencies were mounted on cylindrical phantoms and exposed to a range of low-level dose equivalents (0.48-13.91 mSv neutron and 0.02-1.32 mSv gamma) in nine different radiation fields. Exposure conditions considered in this study included four mixed-field spectra produced using the Health Physics Research Reactor, four monoenergetic neutron fields generated by accelerators, and one 15-cm D/sub 2/O-moderated californium source spectrum. In general, neutron results reported by the participating agencies were consistent with expected dosimeter performance based on energy response characteristics of the detection systems. Albedo dosimeters, which were the most popular neutron monitoring systems used in this study, provided the best overall accuracy for all exposure conditions. Film, Cr-39 recoil track, and Th-232 fission track systems generally underestimated dose equivalents relative to reference values. Associated gamma measurements showed that TLD monitors produced more accurate results than film dosimeters although both systems overestimated gamma dose equivalents in mixed radiation fields. 24 references, 10 figures, 19 tables.

  8. Application of the backward extrapolation method to pulsed neutron sources

    Energy Technology Data Exchange (ETDEWEB)

    Talamo, Alberto; Gohar, Yousry

    2018-01-01

    Particle detectors operated in pulse mode are subjected to the dead-time effect. When the average of the detector counts is constant over time, correcting for the dead-time effect is simple and can be accomplished by analytical formulas. However, when the average of the detector counts changes over time it is more difficult to take into account the dead-time effect. When a subcritical nuclear assembly is driven by a pulsed neutron source, simple analytical formulas cannot be applied to the measured detector counts to correct for the dead-time effect because of the sharp change of the detector counts over time. This work addresses this issue by using the backward extrapolation method. The latter can be applied not only to a continuous (e.g. californium) external neutron source but also to a pulsed external neutron source (e.g. by a particle accelerator) driving a subcritical nuclear assembly. The backward extrapolation method allows to obtain from the measured detector counts both the dead-time value and the real detector counts.

  9. The cross sections of fusion-evaporation reactions: the most promising route to superheavy elements beyond Z=118

    Science.gov (United States)

    Jadambaa, Khuyagbaatar

    2017-11-01

    The synthesis of superheavy elements beyond oganesson (Og), which has atomic number Z = 118, is currently one of the main topics in nuclear physics. An absence of sufficient amounts of target material with atomic numbers heavier than californium (Z = 98) forces the use of projectiles heavier than 48Ca (Z = 20), which has been successfully used for the discoveries of elements with Z = 114 - 118 in complete fusion reactions. Experimental cross sections of 48Ca with actinide targets behave very differently to "cold" and "hot" fusion-evaporation reactions, where doubly-magic lead and deformed actinides are used as targets, respectively. The known cross sections of these reactions have been analysed compared to calculated fission barriers. It has been suggested that observed discrepancies between the cross sections of 48Ca-induced and other fusionevaporation reactions originate from the shell structure of the compound nucleus, which lies in the island of the stability. Besides scarcely known data on other reactions involving heavier projectiles, the most promising projectile for the synthesis of the elements beyond Og seems to be 50Ti. However, detailed studies of 50Ti, 54Cr, 58Fe and 64Ni-induced reactions are necessary to be performed in order to fully understand the complexities of superheavy element formation.

  10. Activation analysis of ITER blanket first wall

    Energy Technology Data Exchange (ETDEWEB)

    Lopatkin, A.; Muratov, V. [RDIPE (NIKIET), Moscow (Russian Federation)

    1998-09-01

    To analyze the activation of ITER blanket structural components, the authors have prepared the AUCDAS code that calculates changes in nuclide concentrations and radioactivity characteristics during neutron irradiation and during cooling. UCDAS takes into account all neutron reactions and decay types, the prepared library of constants contains nuclear data of nuclides from hydrogen to californium. A comparative analysis of the results as obtained using UCDAS code and the widely known FISPACT code is given. The analysis of decay heat, gas generation and activity of ITER blanket first wall`s structural components was carried out. The beryllium coating, copper alloy and stainless steel were analysed. Calculations were performed for the first plasma burning pulse, 6 months and 1 year of operation in accordance with the ITER scenario. The materials recommended by ITER central team and their Russian analogs were considered: TGR and B1 (beryllium coating), GlidCop AL-25 Ds and Br-MKX (copper alloy), 316LN-IG and 12Cr18Ni10Ti (stainless steel). It has been demonstrated that there is a difference in all of the considered characteristics between the above materials. It is caused by impurities which are present in the materials. The report also considers the accumulation of gases (H, D, T, He{sup 3}, He{sup 4}) in the above materials. Besides, the change in the activity of irradiated materials during the cooling of up to 10{sup 7} years was calculated. (orig.) 7 refs.

  11. Toward achieving flexible and high sensitivity hexagonal boron nitride neutron detectors

    Science.gov (United States)

    Maity, A.; Grenadier, S. J.; Li, J.; Lin, J. Y.; Jiang, H. X.

    2017-07-01

    Hexagonal boron nitride (h-BN) detectors have demonstrated the highest thermal neutron detection efficiency to date among solid-state neutron detectors at about 51%. We report here the realization of h-BN neutron detectors possessing one order of magnitude enhancement in the detection area but maintaining an equal level of detection efficiency of previous achievement. These 3 mm × 3 mm detectors were fabricated from 50 μm thick freestanding and flexible 10B enriched h-BN (h-10BN) films, grown by metal organic chemical vapor deposition followed by mechanical separation from sapphire substrates. Mobility-lifetime results suggested that holes are the majority carriers in unintentionally doped h-BN. The detectors were tested under thermal neutron irradiation from californium-252 (252Cf) moderated by a high density polyethylene moderator. A thermal neutron detection efficiency of ˜53% was achieved at a bias voltage of 200 V. Conforming to traditional solid-state detectors, the realization of h-BN epilayers with enhanced electrical transport properties is the key to enable scaling up the device sizes. More specifically, the present results revealed that achieving an electrical resistivity of greater than 1014 Ωṡcm and a leakage current density of below 3 × 10-10 A/cm2 is needed to fabricate large area h-BN detectors and provided guidance for achieving high sensitivity solid state neutron detectors based on h-BN.

  12. Design of the low energy beam transport line between CARIBU and the EBIS charge breeder

    Energy Technology Data Exchange (ETDEWEB)

    Perry, A., E-mail: aperry4@hawk.iit.edu [Argonne National Laboratory, Argonne, IL 60439, USA and Illinois Institute of Technology, Chicago, IL 60616 (United States); Ostroumov, P. N.; Barcikowski, A.; Dickerson, C.; Kondrashev, S. A.; Mustapha, B.; Savard, G. [Argonne National Laboratory, Argonne, IL 60439 (United States)

    2015-01-09

    An Electron Beam Ion Source Charge Breeder (EBIS-CB) has been developed to breed radioactive beams from the CAlifornium Rare Isotope Breeder Upgrade (CARIBU) facility at ATLAS. The EBIS-CB will replace the existing ECR charge breeder to increase the intensity and improve the purity of reaccelerated radioactive ion beams. The EBIS-CB is in the final stage of off-line commissioning. Currently, we are developing a low energy beam transport (LEBT) system to transfer CARIBU beams to the EBIS-CB. As was originally planned, an RFQ cooler-buncher will precede the EBIS-CB. Recently, it was decided to include a multi-reflection time-of-flight (MR-TOF) mass-spectrometer following the RFQ. MR-TOF is a relatively new technology used to purify beams with a mass-resolving power up to 3×10{sup 5} as was demonstrated in experiments at CERN/ISOLDE. Very high purity singly-charged radioactive ion beams will be injected into the EBIS for charge breeding and due to its inherent properties, the EBIS-CB will maintain the purity of the charge bred beams. Possible contamination of residual gas ions will be greatly suppressed by achieving ultra-high vacuum in the EBIS trap. This paper will present and discuss the design of the LEBT and the overall integration of the EBIS-CB into ATLAS.

  13. Analysis of patents on mining technology

    Energy Technology Data Exchange (ETDEWEB)

    Menyailo, N.I.; Grishchenko, A.N.; Ratner, M.V.; Kobylyanskii, A.Ya.; Tyshlek, E.G.

    1987-09-01

    Analyses the current work being carried out with the aim of developing and perfecting coal mining technology with regard to improving safety and working conditions (equipment is currently responsible for 6.3% of all hazards in coal mines) by examining patents of class ES 21 S produced in the USSR, USA, UK, FRG, Japan and France between 1970-1984. By far the majority of patents is concerned with improving technology and productivity and a disappointing number deals with safety matters (only 7.2% of the patents for new cutter loader designs deal with dust suppression systems and most of these come from the FRG; no patents for powered mining complexes deal with the problem of noise and vibration reduction). The patents with the most direct relevance to health and safety concern remote control devices for mining equipment, in particular, devices based on radioactive isotopes (e.g. cesium-137, americum-241, selenium-75, californium-252) but measures for monitoring them and protecting against them are not found.

  14. MinT: Middleware for Cooperative Interaction of Things

    Directory of Open Access Journals (Sweden)

    Soobin Jeon

    2017-06-01

    Full Text Available This paper proposes an Internet of Things (IoT middleware called Middleware for Cooperative Interaction of Things (MinT. MinT supports a fully distributed IoT environment in which IoT devices directly connect to peripheral devices easily construct a local or global network, and share their data in an energy efficient manner. MinT provides a sensor abstract layer, a system layer and an interaction layer. These enable integrated sensing device operations, efficient resource management, and active interconnection between peripheral IoT devices. In addition, MinT provides a high-level API to develop IoT devices easily for IoT device developers. We aim to enhance the energy efficiency and performance of IoT devices through the performance improvements offered by MinT resource management and request processing. The experimental results show that the average request rate increased by 25% compared to Californium, which is a middleware for efficient interaction in IoT environments with powerful performance, an average response time decrease of 90% when resource management was used, and power consumption decreased by up to 68%. Finally, the proposed platform can reduce the latency and power consumption of IoT devices.

  15. MinT: Middleware for Cooperative Interaction of Things

    Science.gov (United States)

    Jeon, Soobin; Jung, Inbum

    2017-01-01

    This paper proposes an Internet of Things (IoT) middleware called Middleware for Cooperative Interaction of Things (MinT). MinT supports a fully distributed IoT environment in which IoT devices directly connect to peripheral devices easily construct a local or global network, and share their data in an energy efficient manner. MinT provides a sensor abstract layer, a system layer and an interaction layer. These enable integrated sensing device operations, efficient resource management, and active interconnection between peripheral IoT devices. In addition, MinT provides a high-level API to develop IoT devices easily for IoT device developers. We aim to enhance the energy efficiency and performance of IoT devices through the performance improvements offered by MinT resource management and request processing. The experimental results show that the average request rate increased by 25% compared to Californium, which is a middleware for efficient interaction in IoT environments with powerful performance, an average response time decrease of 90% when resource management was used, and power consumption decreased by up to 68%. Finally, the proposed platform can reduce the latency and power consumption of IoT devices. PMID:28632182

  16. An Account of Oak Ridge National Laboratory's Thirteen Research Reactors

    Energy Technology Data Exchange (ETDEWEB)

    Rosenthal, Murray Wilford [ORNL

    2009-08-01

    The Oak Ridge National Laboratory has built and operated 13 nuclear reactors in its 66-year history. The first was the graphite reactor, the world's first operational nuclear reactor, which served as a plutonium production pilot plant during World War II. It was followed by two aqueous-homogeneous reactors and two red-hot molten-salt reactors that were parts of power-reactor development programs and by eight others designed for research and radioisotope production. One of the eight was an all-metal fast burst reactor used for health physics studies. All of the others were light-water cooled and moderated, including the famous swimming-pool reactor that was copied dozens of times around the world. Two of the reactors were hoisted 200 feet into the air to study the shielding needs of proposed nuclear-powered aircraft. The final reactor, and the only one still operating today, is the High Flux Isotope Reactor (HFIR) that was built particularly for the production of californium and other heavy elements. With the world's highest flux and recent upgrades that include the addition of a cold neutron source, the 44-year-old HFIR continues to be a valuable tool for research and isotope production, attracting some 500 scientific visitors and guests to Oak Ridge each year. This report describes all of the reactors and their histories.

  17. Neutron Detector Signal Processing to Calculate the Effective Neutron Multiplication Factor of Subcritical Assemblies

    Energy Technology Data Exchange (ETDEWEB)

    Talamo, Alberto [Argonne National Lab. (ANL), Argonne, IL (United States). Nuclear Engineering Division; Gohar, Yousry [Argonne National Lab. (ANL), Argonne, IL (United States). Nuclear Engineering Division

    2016-06-01

    This report describes different methodologies to calculate the effective neutron multiplication factor of subcritical assemblies by processing the neutron detector signals using MATLAB scripts. The subcritical assembly can be driven either by a spontaneous fission neutron source (e.g. californium) or by a neutron source generated from the interactions of accelerated particles with target materials. In the latter case, when the particle accelerator operates in a pulsed mode, the signals are typically stored into two files. One file contains the time when neutron reactions occur and the other contains the times when the neutron pulses start. In both files, the time is given by an integer representing the number of time bins since the start of the counting. These signal files are used to construct the neutron count distribution from a single neutron pulse. The built-in functions of MATLAB are used to calculate the effective neutron multiplication factor through the application of the prompt decay fitting or the area method to the neutron count distribution. If the subcritical assembly is driven by a spontaneous fission neutron source, then the effective multiplication factor can be evaluated either using the prompt neutron decay constant obtained from Rossi or Feynman distributions or the Modified Source Multiplication (MSM) method.

  18. Fast neutron tomography with real-time pulse-shape discrimination in organic scintillation detectors

    Energy Technology Data Exchange (ETDEWEB)

    Joyce, Malcolm J., E-mail: m.joyce@lancaster.ac.uk [Department of Engineering, Lancaster University, Lancaster, Lancashire LA1 4YW (United Kingdom); Agar, Stewart [Department of Engineering, Lancaster University, Lancaster, Lancashire LA1 4YW (United Kingdom); Aspinall, Michael D. [Hybrid Instruments Ltd., Gordon Manley Building, Lancaster Environment Centre, Lancaster University, Lancaster LA1 4YW (United Kingdom); Beaumont, Jonathan S.; Colley, Edmund; Colling, Miriam; Dykes, Joseph; Kardasopoulos, Phoevos; Mitton, Katie [Department of Engineering, Lancaster University, Lancaster, Lancashire LA1 4YW (United Kingdom)

    2016-10-21

    A fast neutron tomography system based on the use of real-time pulse-shape discrimination in 7 organic liquid scintillation detectors is described. The system has been tested with a californium-252 source of dose rate 163 μSv/h at 1 m and neutron emission rate of 1.5×10{sup 7} per second into 4π and a maximum acquisition time of 2 h, to characterize two 100×100×100 mm{sup 3} concrete samples. The first of these was a solid sample and the second has a vertical, cylindrical void. The experimental data, supported by simulations with both Monte Carlo methods and MATLAB®, indicate that the presence of the internal cylindrical void, corners and inhomogeneities in the samples can be discerned. The potential for fast neutron assay of this type with the capability to probe hydrogenous features in large low-Z samples is discussed. Neutron tomography of bulk porous samples is achieved that combines effective penetration not possible with thermal neutrons in the absence of beam hardening.

  19. Report on the workshop "Decay spectroscopy at CARIBU: advanced fuel cycle applications, nuclear structure and astrophysics". 14-16 April 2011, Argonne National Laboratory, USA.

    Energy Technology Data Exchange (ETDEWEB)

    Kondev, F.; Carpenter, M.P.; Chowdhury, P.; Clark, J.A.; Lister, C.J.; Nichols, A.L.; Swewryniak, D. (Nuclear Engineering Division); (Univ. of Massachusetts); (Univ. of Surrey)

    2011-10-06

    A workshop on 'Decay Spectroscopy at CARIBU: Advanced Fuel Cycle Applications, Nuclear Structure and Astrophysics' will be held at Argonne National Laboratory on April 14-16, 2011. The aim of the workshop is to discuss opportunities for decay studies at the Californium Rare Isotope Breeder Upgrade (CARIBU) of the ATLAS facility with emphasis on advanced fuel cycle (AFC) applications, nuclear structure and astrophysics research. The workshop will consist of review and contributed talks. Presentations by members of the local groups, outlining the status of relevant in-house projects and availabile equipment, will also be organized. time will also be set aside to discuss and develop working collaborations for future decay studies at CARIBU. Topics of interest include: (1) Decay data of relevance to AFC applications with emphasis on reactor decay heat; (2) Discrete high-resolution gamma-ray spectroscopy following radioactive decya and related topics; (3) Calorimetric studies of neutron-rich fission framgents using Total ABsorption Gamma-Ray Spectrometry (TAGS) technique; (4) Beta-delayed neutron emissions and related topics; and (5) Decay data needs for nuclear astrophysics.

  20. The cross sections of fusion-evaporation reactions: the most promising route to superheavy elements beyond Z=118

    Directory of Open Access Journals (Sweden)

    Jadambaa Khuyagbaatar

    2017-01-01

    Full Text Available The synthesis of superheavy elements beyond oganesson (Og, which has atomic number Z = 118, is currently one of the main topics in nuclear physics. An absence of sufficient amounts of target material with atomic numbers heavier than californium (Z = 98 forces the use of projectiles heavier than 48Ca (Z = 20, which has been successfully used for the discoveries of elements with Z = 114 - 118 in complete fusion reactions. Experimental cross sections of 48Ca with actinide targets behave very differently to “cold” and “hot” fusion-evaporation reactions, where doubly-magic lead and deformed actinides are used as targets, respectively. The known cross sections of these reactions have been analysed compared to calculated fission barriers. It has been suggested that observed discrepancies between the cross sections of 48Ca-induced and other fusionevaporation reactions originate from the shell structure of the compound nucleus, which lies in the island of the stability. Besides scarcely known data on other reactions involving heavier projectiles, the most promising projectile for the synthesis of the elements beyond Og seems to be 50Ti. However, detailed studies of 50Ti, 54Cr, 58Fe and 64Ni-induced reactions are necessary to be performed in order to fully understand the complexities of superheavy element formation.

  1. Intracavitary moderator balloon combined with (252)Cf brachytherapy and boron neutron capture therapy, improving dosimetry in brain tumour and infiltrations.

    Science.gov (United States)

    Brandão, S F; Campos, T P R

    2015-07-01

    This article proposes a combination of californium-252 ((252)Cf) brachytherapy, boron neutron capture therapy (BNCT) and an intracavitary moderator balloon catheter applied to brain tumour and infiltrations. Dosimetric evaluations were performed on three protocol set-ups: (252)Cf brachytherapy combined with BNCT (Cf-BNCT); Cf-BNCT with a balloon catheter filled with light water (LWB) and the same set-up with heavy water (HWB). Cf-BNCT-HWB has presented dosimetric advantages to Cf-BNCT-LWB and Cf-BNCT in infiltrations at 2.0-5.0 cm from the balloon surface. However, Cf-BNCT-LWB has shown superior dosimetry up to 2.0 cm from the balloon surface. Cf-BNCT-HWB and Cf-BNCT-LWB protocols provide a selective dose distribution for brain tumour and infiltrations, mainly further from the (252)Cf source, sparing the normal brain tissue. Malignant brain tumours grow rapidly and often spread to adjacent brain tissues, leading to death. Improvements in brain radiation protocols have been continuously achieved; however, brain tumour recurrence is observed in most cases. Cf-BNCT-LWB and Cf-BNCT-HWB represent new modalities for selectively combating brain tumour infiltrations and metastasis.

  2. Intracavitary moderator balloon combined with 252Cf brachytherapy and boron neutron capture therapy, improving dosimetry in brain tumour and infiltrations

    Science.gov (United States)

    Brandão, S F

    2015-01-01

    Objective: This article proposes a combination of californium-252 (252Cf) brachytherapy, boron neutron capture therapy (BNCT) and an intracavitary moderator balloon catheter applied to brain tumour and infiltrations. Methods: Dosimetric evaluations were performed on three protocol set-ups: 252Cf brachytherapy combined with BNCT (Cf-BNCT); Cf-BNCT with a balloon catheter filled with light water (LWB) and the same set-up with heavy water (HWB). Results: Cf-BNCT-HWB has presented dosimetric advantages to Cf-BNCT-LWB and Cf-BNCT in infiltrations at 2.0–5.0 cm from the balloon surface. However, Cf-BNCT-LWB has shown superior dosimetry up to 2.0 cm from the balloon surface. Conclusion: Cf-BNCT-HWB and Cf-BNCT-LWB protocols provide a selective dose distribution for brain tumour and infiltrations, mainly further from the 252Cf source, sparing the normal brain tissue. Advances in knowledge: Malignant brain tumours grow rapidly and often spread to adjacent brain tissues, leading to death. Improvements in brain radiation protocols have been continuously achieved; however, brain tumour recurrence is observed in most cases. Cf-BNCT-LWB and Cf-BNCT-HWB represent new modalities for selectively combating brain tumour infiltrations and metastasis. PMID:25927876

  3. Investigation of Workplace-like Calibration Fields via a Deuterium-Tritium (D-T) Neutron Generator.

    Science.gov (United States)

    Mozhayev, Andrey V; Piper, Roman K; Rathbone, Bruce A; McDonald, Joseph C

    2017-04-01

    Radiation survey meters and personal dosimeters are typically calibrated in reference neutron fields based on conventional radionuclide sources, such as americium-beryllium (Am-Be) or californium-252 (Cf), either unmodified or heavy-water moderated. However, these calibration neutron fields differ significantly from the workplace fields in which most of these survey meters and dosimeters are being used. Although some detectors are designed to yield an approximately dose-equivalent response over a particular neutron energy range, the response of other detectors is highly dependent upon neutron energy. This, in turn, can result in significant over- or underestimation of the intensity of neutron radiation and/or personal dose equivalent determined in the work environment. The use of simulated workplace neutron calibration fields that more closely match those present at the workplace could improve the accuracy of worker, and workplace, neutron dose assessment. This work provides an overview of the neutron fields found around nuclear power reactors and interim spent fuel storage installations based on available data. The feasibility of producing workplace-like calibration fields in an existing calibration facility has been investigated via Monte Carlo simulations. Several moderating assembly configurations, paired with a neutron generator using the deuterium tritium (D-T) fusion reaction, were explored.

  4. Production of medical radioisotopes in the ORNL High Flux Isotope Reactor (HFIR) for cancer treatment and arterial restenosis therapy after PTCA

    Energy Technology Data Exchange (ETDEWEB)

    Knapp, F.F. Jr.; Beets, A.L.; Mirzadeh, S.; Alexander, C.W.; Hobbs, R.L.

    1998-06-01

    The High Flux Isotope Reactor (HFIR) at the Oak Ridge National Laboratory (ORNL) represents an important resource for the production of a wide variety of medical radioisotopes. In addition to serving as a key production site for californium-252 and other transuranic elements, important examples of therapeutic radioisotopes which are currently routinely produced in the HFIR for distribution include dysprosium-166 (parent of holmium-166), rhenium-186, tin-117m and tungsten-188 (parent of rhenium-188). The nine hydraulic tube (HT) positions in the central high flux region permit the insertion and removal of targets at any time during the operating cycle and have traditionally represented a major site for production of medical radioisotopes. To increase the irradiation capabilities of the HFIR, special target holders have recently been designed and fabricated which will be installed in the six Peripheral Target Positions (PTP), which are also located in the high flux region. These positions are only accessible during reactor refueling and will be used for long-term irradiations, such as required for the production of tin-117m and tungsten-188. Each of the PTP tubes will be capable of housing a maximum of eight HT targets, thus increasing the total maximum number of HT targets from the current nine, to a total of 57. In this paper the therapeutic use of reactor-produced radioisotopes for bone pain palliation and vascular brachytherapy and the therapeutic medical radioisotope production capabilities of the ORNL HFIR are briefly discussed.

  5. Psychosocial issues in palliative care

    African Journals Online (AJOL)

    Repro

    MAIN TOPIC. C M E May 2003 Vol.21 No.5 249. Ever since the original concept of total pain, with its physical, emotional, social and spiritual components, the demands of palliative care have been met by expand- ing expertise. Palliative care is a team effort and its impact is unique in that it results from a combination of skills.

  6. Gclust Server: 91662 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available Sequences(249) 221 binding-protein-dependent transport systems inner membrane component 1 1.00e-25 0.0 0.0 0.0...annotation binding-protein-dependent transport systems inner membrane component Number of Sequences 1

  7. Indications, output and types of eyelid surgeries in a tertiary eye care ...

    African Journals Online (AJOL)

    Eyelid surgeries were performed on 237 eyes of 221 persons, 121(54.8%) were males. Mean age was 30.3 ± 17.8 years. Eyelid lacerations, chalazia, and eyelid tumours accounted for 30%, 25.8%, 21% of all morbidities respectively. 249 eyelid surgeries were performed, 246 (98.8%) as minor procedures and 3(1.2%) as ...

  8. Legon Journal of the Humanitie_2.cdr

    African Journals Online (AJOL)

    user

    French. (1732: 249). The Lower Guinea coastal languages indigenous to the areas where Europeans had recorded a Portuguese Creole language should be included as an ingredient of the ... constructions discussed in this section support a case for the ..... vowel in modern Fante are either omitted or changed into a.

  9. Hemoglobin, Growth, and Attention of Infants in Southern Ethiopia

    Science.gov (United States)

    Aubuchon-Endsley, Nicki L.; Grant, Stephanie L.; Berhanu, Getenesh; Thomas, David G.; Schrader, Sarah E.; Eldridge, Devon; Kennedy, Tay; Hambidge, Michael

    2011-01-01

    Male and female infants from rural Ethiopia were tested to investigate relations among hemoglobin (Hb), anthropometry, and attention. A longitudinal design was used to examine differences in attention performance from 6 (M = 24.9 weeks, n = 89) to 9 months of age (M = 40.6 weeks, n = 85), differences hypothesized to be related to changes in iron…

  10. 78 FR 4766 - Adoption of Updated EDGAR Filer Manual

    Science.gov (United States)

    2013-01-23

    ... From the Federal Register Online via the Government Publishing Office SECURITIES AND EXCHANGE COMMISSION 17 CFR Parts 232, 239, 249, 269, 274 Adoption of Updated EDGAR Filer Manual AGENCY: Securities and.... Along with the adoption of the Filer Manual, we are amending Rule 301 of Regulation S-T to provide for...

  11. Re-examination of a Sphaerotermia and a Gaillonella (Bacillariophyceae) from the Ehrenberg Collection, Berlin (Germany)

    Czech Academy of Sciences Publication Activity Database

    Houk, Václav

    2010-01-01

    Roč. 25, č. 2 (2010), s. 293-306 ISSN 0269-249X Institutional research plan: CEZ:AV0Z60050516 Keywords : centric diatom s * valve morphology * taxonomy Subject RIV: EF - Botanics Impact factor: 1.030, year: 2010

  12. Morphology and ultrastructure of the freshwater fossil diatom Aulacoseira campylosira (Ehrenberg) comb. nov. from Ehrenberg type material

    Czech Academy of Sciences Publication Activity Database

    Houk, Václav

    2010-01-01

    Roč. 25, č. 2 (2010), s. 307-321 ISSN 0269-249X R&D Projects: GA ČR GA205/05/0204 Institutional research plan: CEZ:AV0Z60050516 Keywords : centric diatom s * morphology * taxonomy Subject RIV: EF - Botanics Impact factor: 1.030, year: 2010

  13. Observations of taxa of Melosira sensu lato among the slides from the Grunow Diatom Collection in Vienna (Austria). Part 1

    Czech Academy of Sciences Publication Activity Database

    Houk, Václav; Klee, R.; Passauer, U.

    2007-01-01

    Roč. 22, č. 1 (2007), s. 57-80 ISSN 0269-249X R&D Projects: GA ČR GA205/05/0204 Institutional research plan: CEZ:AV0Z60050516 Keywords : diatom s * taxonomy * revision Subject RIV: EF - Botanics Impact factor: 0.673, year: 2007

  14. Four new non-marine diatom taxa from the Subantactic and Antarctic Regions

    Czech Academy of Sciences Publication Activity Database

    Van de Vijver, B.; Sterken, M.; Vyverman, W.; Mataloni, G.; Nedbalová, L.; Kopalová, K.; Elster, Josef; Verleyen, E.; Sabbe, K.

    2010-01-01

    Roč. 25, č. 2 (2010), s. 431-443 ISSN 0269-249X R&D Projects: GA MŠk ME 945 Institutional research plan: CEZ:AV0Z60050516 Keywords : South Shetland islands * East Antarctica * diatom s Subject RIV: EF - Botanics Impact factor: 1.030, year: 2010

  15. An evaluation of selected Neidium species from the Antarctic Region

    Czech Academy of Sciences Publication Activity Database

    Hamilton, P. B.; De Haan, M.; Kopalová, Kateřina; Zidarova, R.; Van de Vijver, B.

    2014-01-01

    Roč. 29, č. 1 (2014), s. 27-40 ISSN 0269-249X R&D Projects: GA MŠk ME 934; GA MŠk ME 945 Institutional support: RVO:67985939 Keywords : Bacillariophyta * biogeography * Neidium Subject RIV: EF - Botanics Impact factor: 1.746, year: 2014

  16. SUBSURFACE IMAGING IN CENTRAL NORTHERN NIGERIA

    African Journals Online (AJOL)

    2007-06-05

    Jun 5, 2007 ... Application of seismic refraction tomography. . . length of 1 second. Processing. The raw data (Figure 1a) was subjected to. 249 spectrum to determine the dominate frequency of the seismic signal. Bandpass. filter of 4 to lOOHz to get rid of any undesired unset. The gain filter was applied to enhance the ...

  17. Effects of attractiveness and status in dating desire in homosexual and heterosexual men and women

    NARCIS (Netherlands)

    Ha, P.T.; Berg, J.E.M. van den; Engels, R.C.M.E.; Lichtwarck-Aschoff, A.

    2012-01-01

    The present study examined partner preferences of homosexual and heterosexual men and woman, focusing on attractiveness and status. Homosexual (N = 591 men; M age = 28.87 years, SD = 10.21; N = 249 women; M age = 33.36 years, SD = 13.12) and heterosexual participants (N = 346 men; M age = 39.74

  18. Blood lipids and prostate cancer

    DEFF Research Database (Denmark)

    Bull, Caroline J; Bonilla, Carolina; Holly, Jeff M P

    2016-01-01

    Genetic risk scores were used as unconfounded instruments for specific lipid traits (Mendelian randomization) to assess whether circulating lipids causally influence prostate cancer risk. Data from 22,249 prostate cancer cases and 22,133 controls from 22 studies within the international PRACTICAL...

  19. Postmoderne kerk-wees in die lig van publieke teologie – eenheid ...

    African Journals Online (AJOL)

    UPuser

    grondslag te dien om weer hoop te vind en tot kennis te kom in 'n veranderde wêreld (kyk De Reuver 2004:249). Die vraag is of postmoderne denke net 'n uitloper is van laat moderniteit, 'n soort verlengstuk van die moderne gees (kyk Habermas 1987;. Taylor 1989, 1991, 1999:13-37; Wellmer 1991; Thornhill 2000) en of dit.

  20. QTL Information Table: 107 [Q-TARO

    Lifescience Database Archive (English)

    Full Text Available tification and mapping of yield and yield related QTLs from an Indian accession of Oryza rufipogon. BMC Genet 6, 33. ... ...F1(test cross) IR 58025A O. rufipogon (IC 22015) B RM194 RM249 pha Marri, P.R., Sarla, N., Reddy, L.V., and Siddiq, E.A. (2005). Iden

  1. Global Journal of Pure and Applied Sciences - Vol 23, No 2 (2017)

    African Journals Online (AJOL)

    Phytotoxic analysis of the impact of transmission oil contaminated soil on germination and growth of oat (Avena sativa) seedlings under different soil moisture conditions · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. O.O. Alonge, C.C. Ogbaga, F.M. Mairami, 249- ...

  2. 17 CFR 232.104 - Unofficial PDF copies included in an electronic submission.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Unofficial PDF copies included... Filing Requirements § 232.104 Unofficial PDF copies included in an electronic submission. (a) An... (§ 249.101 of this chapter) or a Form D (§ 239.500 of this chapter), may include one unofficial PDF copy...

  3. Psychiatric Residents' Needs for Education about Informed Consent, Principles of Ethics and Professionalism, and Caring for Vulnerable Populations: Results of a Multisite Survey

    Science.gov (United States)

    Jain, Shaili; Lapid, Maria I.; Dunn, Laura B.; Roberts, Laura Weiss

    2011-01-01

    Objective: The authors examined psychiatric residents' perceived needs for education in informed consent, principles of ethics and professionalism, and treating vulnerable populations. Method: A written survey was distributed to psychiatric residents (N = 249) at seven U.S. residency programs in 2005. The survey contained 149 questions in 10…

  4. FA

    African Journals Online (AJOL)

    spamer

    biology (Harvey and Pagel 1991), the method is seldom used in ecology. A comparative method can lead to an empirical ... Biological productivity of an ecosystem can be estimated in many ways, through planktonic ..... strength in fish populations: an update of the match/mis- match hypothesis. Adv. mar. Biol. 26: 249–293.

  5. An Isolator in Image Guide.

    Science.gov (United States)

    1982-05-11

    used to search for 3. Muller’s method is an improvement on Newton’s method. For more detail one should refer to Peter Henrici , "Elements of Numerical...247 ... C IS NOT KNUWN. FOR MORE DETAIL ABOUI MULLER’S METHOD 248 .. C SEE ’ELEMENTS OF NUMERICAL ANALYSIS’ BY PETER HENRICI , 249 .. C JOHN UILEY A

  6. An integrated catalog of reference genes in the human gut microbiome

    NARCIS (Netherlands)

    Li, J.; Jia, H.; Cai, X.; Zhong, H.; Feng, Q.; Sunagawa, S.; Arumugam, M.; Kultima, J.R.; Prifti, E.; Nielsen, T.; Juncker, A.S.; Manichanh, C.; Chen, B.; Zhang, W.; Levenez, F.; Xu, X.; Xiao, L.; Liang, S.; Zhang, D.; Zhang, Z.; Chen, W.; Zhao, H.; Al-Aama, J.Y.; Edris, S.; Yang, H.; Hansen, H.; Nielsen, H.B.; Brunak, S.; Kristiansen, K.; Guarner, F.; Pedersen, O.; Doré, J.; Ehrlich, S.D.; Bork, P.; Wang, J.; Vos, de W.M.; Tims, S.; Zoetendal, E.G.; Kleerebezem, M.

    2014-01-01

    Many analyses of the human gut microbiome depend on a catalog of reference genes. Existing catalogs for the human gut microbiome are based on samples from single cohorts or on reference genomes or protein sequences, which limits coverage of global microbiome diversity. Here we combined 249 newly

  7. Subjektivní blahobyt v České republice a střední Evropě: makro- a mikro-determinanty

    Czech Academy of Sciences Publication Activity Database

    Večerník, Jiří

    2014-01-01

    Roč. 62, č. 2 (2014), s. 249-270 ISSN 0032-3233 R&D Projects: GA ČR(CZ) GAP404/11/1521 Institutional support: RVO:68378025 Keywords : subjective well - being * life satisfaction * Central Europe Subject RIV: AO - Sociology, Demography Impact factor: 0.650, year: 2014

  8. Chikungunya Arthritis Mechanisms in the Americas (CAMA): A cross sectional analysis of chikungunya arthritis patients 22 months post infection demonstrates a lack of viral persistence in synovial fluid

    Science.gov (United States)

    2017-06-30

    Chronic obstructive pulmonary disease Diabetes Hypertension Depression 1 (4.0%) 0 0 0 0 1 (4.0%) 7 (28.0%) 1 (4.0%) 0 1...Zoonotic Diseases. 2015;15(4): 241-249. 469 (19) Asgari S. Epigenetic modifications underlying symbiont-host interactions. Adv Genet . 2014;86: 253-276

  9. Child maltreatment and trajectories of personality and behavioral functioning: Implications for the development of personality disorder

    OpenAIRE

    Kim, Jungmeen; Cicchetti, Dante; Rogosch, Fred A.; Manly, Jody Todd

    2009-01-01

    This study investigated the longitudinal impact of maltreatment parameters on personality processes and maladjustment and prospective relationships between personality trajectory classes and subsequent maladjustment outcomes. The sample involved maltreated (n = 249) and nonmaltreated (n = 200) children followed longitudinally between ages 6 – 10. Growth mixture modeling indicated multifinality in personality development depending on the risk status (i.e., maltreated vs. nonmaltreated). Two tr...

  10. 76 FR 20771 - Self-Regulatory Organizations; Chicago Board Options Exchange, Incorporated; Notice of Filing and...

    Science.gov (United States)

    2011-04-13

    ... exercise settlement value has been fixed eliminates potential confusion and thereby protects investors and... regular index options, with one general exception: The exercise settlement value is based on the index value derived from the closing prices of component stocks.\\7\\ \\6\\ See CBOE Rule 24.9(e). \\7\\ See supra...

  11. AcEST: DK957364 [AcEST

    Lifescience Database Archive (English)

    Full Text Available N=CAT2... 249 5e-66 sp|P49317|CATA3_NICPL Catalase isozyme 3 OS=Nicotiana plumbagini... 248 1e-65 sp|O24339|CATA_SOLAP...KFYT 128 >sp|O24339|CATA_SOLAP Catalase OS=Soldanella alpina PE=2 SV=1 Length = 492 Score = 247 bits (631),

  12. Gclust Server: 91929 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available 91929 S96_Syncc9605_0412 Cluster Sequences Related Sequences(249) 328 hypothetical ...protein 1 1.00e-16 0.0 0.0 4.0 0.0 0.0 0.0 Show 91929 Cluster ID 91929 Sequence ID S96_Syncc9605_0412 Link t

  13. A survey for piroplasmids in horses and Bactrian camels in North-Eastern Mongolia

    Czech Academy of Sciences Publication Activity Database

    Sloboda, M.; Jirků, Milan; Lukešová, D.; Qablan, M.; Batsukh, Z.; Fiala, Ivan; Horin, P.; Modrý, David; Lukeš, Julius

    2011-01-01

    Roč. 179, 1-3 (2011), 246-249 ISSN 0304-4017 R&D Projects: GA ČR GA523/09/1972 Institutional research plan: CEZ:AV0Z60220518 Keywords : Piroplasmosis * Babesia * Theileria * Horse * Bactrian camel * Dog Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.579, year: 2011

  14. INCREASING THE THERMOSTABILITY OF A NEUTRAL PROTEASE BY REPLACING POSITIVELY CHARGED AMINO-ACIDS IN THE N-TERMINAL TURN OF ALPHA-HELICES

    NARCIS (Netherlands)

    Eijsink, Vincent G H; VRIEND, Gerrit; van den Burg, Bertus; van der Zee, J Rob; Venema, Gerard

    The 247-260 and 289-299 alpha-helices of Bacillus subtilis neutral protease have a lysine in their N-terminal turn. These lysines were replaced by Ser or Asp in order to improve electrostatic interactions with the alpha-helix dipole. After replacing Lys by Ser at positions 249 or 290, the

  15. Estimating sawmill processing capacity for Tongass timber: 2009 and 2010 Update

    Science.gov (United States)

    Susan J. Alexander; Daniel J. Parrent

    2012-01-01

    In spring and summer of 2010 and 2011, sawmill production capacity and wood utilization information was collected from major wood manufacturers in southeast Alaska. The estimated mill capacity in southeast Alaska for calendar year (CY) 2009 was 249,350 thousand board feet (mbf) (log scale), and for CY 2010 was 155,850 mbf (log scale), including idle sawmills. Mill...

  16. Effect of fibre and digestible energy levels on growth performance ...

    African Journals Online (AJOL)

    A seventy-day feeding trial was conducted to investigate the effect of dietary fibre and digestible energy (DE) level on growth performance, apparent nutrient digestibility and caecal fermentation of growing rabbits. The experiment was laid out in a 3 × 3 factorial arrangement of 3 levels of fibre (low (249 – 258 g/kg NDF, 149 ...

  17. The retention of community service officers for an additional year at ...

    African Journals Online (AJOL)

    Original Research: The retention of community service officers. 249. Vol 51 No 3. SA Fam Pract ... at the same DH in July 2003. This was followed by a quantitative survey of CS officers doing ... mentoring, teamwork, professional development opportunities, medical equipment and accommodation. This article has been peer ...

  18. AcEST: DK946532 [AcEST

    Lifescience Database Archive (English)

    Full Text Available FV Structural polyprotein OS=Barmah forest virus... 29 6.3 >sp|Q12594|DMAW_CLAFS ...+ + + C++ PPS S L HF Sbjct: 218 HCAVSTTHQTPDWFPLLCVQSPPSTSPFLGHF 249 >sp|P89946|POLS_BFV Structural polyprotein OS=Barmah forest

  19. Effect of long term cropping hybrid sorrel (Rumex patientia x Rumex tianshanicus) on soil biota

    Czech Academy of Sciences Publication Activity Database

    Heděnec, Petr; Novotný, D.; Usťak, S.; Honzík, R.; Váňa, V.; Petříková, V.; Frouz, Jan

    2015-01-01

    Roč. 78, July (2015), s. 92-98 ISSN 0961-9534 R&D Projects: GA MŠk(CZ) 7E08081 Institutional support: RVO:60077344 Keywords : basal soil respiration * composition of soil biota * hybrid sorrel * microbial biomass C * specific microbial respiration (qCO2) Subject RIV: DF - Soil Science Impact factor: 3.249, year: 2015

  20. Journal of Genetics, Volume 86, 2007

    Indian Academy of Sciences (India)

    between B. rapa and Orychophragmus violaceus by rapid chro- mosome evolution and introgression. 249 amyloidosis. ABCC6 is unlikely to be a modifier gene for familial Mediter- ranean fever severity (Research note). 293 aneuploidy. Human oocyte chromosome analyses need a standardized pre- sentation of the results ...

  1. Revisiting perceptual compensation for effects of reverberation in speech identifcation

    DEFF Research Database (Denmark)

    Nielsen, Jens Bo; Dau, Torsten

    2010-01-01

    in the human auditory system [Watkins (2005). J. Acoust. Soc. Am. 118, 249-262]. In the present study, the reverberant test-word was embedded in additional non-reverberant carriers, such as white noise, speech-shaped noise and amplitude modulated noise. In addition, a reference condition was included where...

  2. Investigating Forest Inventory and Analysis-collected tree-ring data from Utah as a proxy for historical climate

    Science.gov (United States)

    R. Justin DeRose; W. Shih-Yu (Simon) Wang; John D. Shaw

    2012-01-01

    Increment cores collected as part of the periodic inventory in the Intermountain West were examined for their potential to represent growth and be a proxy for climate (precipitation) over a large region (Utah). Standardized and crossdated time-series created from pinyon pine (n=249) and Douglas-fir (n=274) increment cores displayed spatiotemporal patterns in growth...

  3. 76 FR 63419 - Endangered and Threatened Wildlife and Plants; 12-Month Petition Finding, Proposed Listing of...

    Science.gov (United States)

    2011-10-12

    ... Plants; 12-Month Petition Finding, Proposed Listing of Coqu[iacute] Llanero as Endangered, and... Threatened Wildlife and Plants; 12-Month Petition Finding, Proposed Listing of Coqu[iacute] Llanero as... (249 hectares) of a freshwater wetland for designation as critical habitat. The proposed critical...

  4. Illness Behavior and Transitional States: A Study of Outpatient Rates and Symptom Presentation in Relation to Troop Deployment during Peacetime. Types and Rates of Outpatient Sick Call Visits of Active Duty Soldiers and Their Family Members, June 1980 - May 1981

    Science.gov (United States)

    1982-10-27

    DEVIATION) (5.0) I AKN TIME AT POST, MONTHS 19.3 TDARD DEVIATION) (19.3) A-Wwab-f No. - - - - - - - -14- TABLE 6: NUMBER AND ANNUAL RATE PER 100 OF THE 20...Module OTHER AND UNCODABLE DOQ1-D249 Infective end Parasitf.c Diseases, Neoplasms, and Endocrine, Nutritional and Metabolic Diseases. D950-D999

  5. Interior Ballistics of Bore Systems and Solid Fuel Rockets

    Science.gov (United States)

    1974-02-01

    stvol’nykh sistem i porskhovykh raket Moscow, 1962, 249-25T, 305-10. Serebryakov, M. Ye. Russian USSR TD-Kane D D C FFR 13 1975 ULteStTCTEl On? D...improved. Polyhydrocarbons have better qualities at low temperature and long-time aging. These secondary qualities can be decisive, if the range of

  6. MIBG scans in patients with stage 4 neuroblastoma reveal two metastatic patterns, one is associated with MYCN amplification and in MYCN-amplified tumours correlates with a better prognosis

    NARCIS (Netherlands)

    G. Bleeker (Gitta); B.L.F. van Eck-Smit (Berthe); K. Zwinderman (Koos); R. Versteeg (Rogier); M.M. van Noesel (Max); B.L. Kam (Boen); G.J. Kaspers (Gertjan J.); A. van Schie (Annelies); S.G. Kreissman (Susan G.); G. Yanik (Gregory); B. Hero (Barbara); M. Schmidt (Matthias); G. Laureys (Geneviève); B. Lambert (Bieke); I. Øra (Ingrid); J.H. Schulte (Johannes); H.N. Caron (Huib); G.A.M. Tytgat (Godelieve )

    2014-01-01

    textabstractMethods: Diagnostic 123I-MIBG scans from 249 patients (123 from a European and 126 from the COG cohort) were assessed for metastatic spread in 14 body segments and the form of the lesions: “focal” (clear margins distinguishable from adjacent background) or “diffuse”

  7. MIBG scans in patients with stage 4 neuroblastoma reveal two metastatic patterns, one is associated with MYCN amplification and in MYCN-amplified tumours correlates with a better prognosis

    NARCIS (Netherlands)

    Bleeker, Gitta; van Eck-Smit, Berthe L.; Zwinderman, Koos H.; Versteeg, Rogier; van Noesel, Max M.; Kam, Boen L.; Kaspers, Gertjan J.; van Schie, Annelies; Kreissman, Susan G.; Yanik, Gregory; Hero, Barbara; Schmidt, Matthias; Laureys, Geneviève; Lambert, Bieke; Øra, Ingrid; Schulte, Johannes H.; Caron, Huib N.; Tytgat, Godelieve A.

    2015-01-01

    Purpose The aim of this study was to find clinically relevant MIBG-avid metastatic patterns in patients with newly diagnosed stage 4 neuroblastoma. Methods Diagnostic I-123-MIBG scans from 249 patients (123 from a European and 126 from the COG cohort) were assessed for metastatic spread in 14 body

  8. Bulletin of Materials Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science. J Rakshit. Articles written in Bulletin of Materials Science. Volume 23 Issue 4 August 2000 pp 249-253 Nitride Ceramics. Optimization of time–temperature schedule for nitridation of silicon compact on the basis of silicon and nitrogen reaction kinetics · J Rakshit P K Das.

  9. Sobre la historia de la traducción en España

    Directory of Open Access Journals (Sweden)

    Manuel Bruña Cuevas

    2011-01-01

    Full Text Available A propósito de la obra de Francisco Lafarga y Luis Pegenaute (eds., Diccionario histórico de la traducción en España (Madrid, Gredos, 2009; 1232 páginas. ISBN: 978-84-249-3626-6.

  10. Download this PDF file

    African Journals Online (AJOL)

    ezra

    steadfastly conservative image, there is no reason to suppose that ... It is viewed that events or circumstances must be interpreted as threats to the .... Lack of job satisfaction. 3. 1.20. Total. 249 .... Engage in sports or physical exercise. 9. 3.61.

  11. Controlled Morphology of ZnO Nanorods for Electron Transport in Squaraine Bulk-Hetero Junction Solar Cells With Thick Active Layers

    NARCIS (Netherlands)

    Peukert, Andreas; Vaillant Roca, Lidice; Scherer, Michael; Lovrincic, Robert; Ramanan, Charusheela; Chanaewa, Alina; von Hauff, Elizabeth

    2017-01-01

    The influence of ZnO seed layer thickness in Squaraine (SQ) is investigated: PC71BM bulk heterojunction solar cells that incorporate ZnO nanorods. The thickness of the ZnO seed layer varies between 16–249 nm by changing the concentration of the precursor solution. With atomic force microscopy (AFM),

  12. Correlation between morphological characters and estimated bunch ...

    African Journals Online (AJOL)

    The methodology of multiple linear regression (MLR) was used to estimate bunch weight. The most significant variables that were measured included number of leaves at harvest, number of fruits per bunch, FW, FL, rachis weight (RW) and stalk length (SL), generating the following prediction equation: BW= -5.249 + ...

  13. Characterisation of antioxidant and antiproliferative acidic polysaccharides from Chinese wolfberry fruits

    NARCIS (Netherlands)

    He, N.W.; Yang, X.B.; Jiao, Y.D.; Tian, L.; Zhao, Y.

    2012-01-01

    Wolfberry fruit polysaccharides (WFPs) were isolated by hot-water extraction and ethanol precipitation. With HPLC analysis, WFPs were for the first time identified as acidic polysaccharides with galacturonic acid being the main component monosaccharide (24.9%), followed by galactose (21.3%),

  14. Self-Efficacy, Gender and Trait Anxiety as Moderators of Test Anxiety

    Science.gov (United States)

    Onyeizugbo, Euckay U.

    2010-01-01

    Introduction: Test anxiety inhibits students from performing according to their full potential in academic setting. Objectives: This study investigated self-efficacy, gender and trait anxiety as moderators of test anxiety. Method: Two hundred and forty nine (249) psychology majors drawn from a university in Eastern Nigeria participated in the…

  15. Birth weight and systolic blood pressure in adolescence and adulthood

    DEFF Research Database (Denmark)

    Gamborg, Michael; Byberg, Liisa; Rasmussen, Finn

    2007-01-01

    The authors investigated the shape, sex- and age-dependency, and possible confounding of the association between birth weight and systolic blood pressure (SBP) in 197,954 adults from 20 Nordic cohorts (birth years 1910-1987), one of which included 166,249 Swedish male conscripts. Random-effects m...

  16. ABA and Diverse Cultural and Linguistic Environments: A Welsh Perspective

    Science.gov (United States)

    Jones, E. W.; Hoerger, M.; Hughes, J. C.; Williams, B. M.; Jones, B.; Moseley, Y.; Hughes, D. R.; Prys, D.

    2011-01-01

    Gwynedd Local Education Authority (LEA) in North West Wales, UK, is funding a small-scale autism-specific specialist education service using ABA methodology. The program is available through the medium of Welsh, English or bilingually, depending on the individual needs of the child (Jones and Hoerger in Eur J Behav Anal 10:249-253,…

  17. amino acid derivatives

    Indian Academy of Sciences (India)

    VENU KANDULA

    tor ligands in small libraries of flavone derivatives synthesized by solution phase combinatorial chemistry. Biochem. Biophys. Res. Commun. 249 481. 8. Hoult J R S, Moroney M A and Paya M 1994. Actions of flavonoids and coumarins on lipoxygenase and cyclooxygenase Methods. Enzymol. 234 443. 9. Parmar V S ...

  18. Parental Academic Socialization: Effects of Home-Based Parental Involvement on Locus of Control across U.S. Ethnic Groups

    Science.gov (United States)

    Suizzo, Marie-Anne; Soon, Kokyung

    2006-01-01

    This study investigates the relations between three academic socialisation processes and late adolescents' internal locus of control. A sample of 249 college students from four ethnic groups completed three measures. Three factors explained 46.44% of the variance in academic socialisation, and the following differences were found: emotional…

  19. Quadrupole moments of low-lying baryons with spin

    Indian Academy of Sciences (India)

    ... spin − 3 2 + → 1 2 + transitions. Neetika Sharma Harleen Dahiya. Research Articles Volume 80 Issue 2 February 2013 pp 237-249 ... GP parameters pertaining to the two- and three-quark contributions. It is found that the CQM is successful in giving a quantitative and qualitative description of the quadrupole moments.

  20. "I Like to Plan Events": A Document Analysis of Essays Written by Applicants to a Public Relations Program

    Science.gov (United States)

    Taylor, Ronald E.

    2016-01-01

    A document analysis of 249 essays written during a 5-year period by applicants to a public relations program at a major state university in the southeast suggests that there are enduring reasons why students choose to major in public relations. Public relations is described as a major that allows for and encourages creative expression and that…

  1. EST Table: FS892927 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available er dense fiber protein 2 (Outer dense fiber of sperm tails protein 2) (84 kDa outer dense fiber protein) (Cenexin) [Tribolium castaneum] FS892927 ftes ... ...4311-PA 10/09/10 38 %/249 aa gi|91078946|ref|XP_974065.1| PREDICTED: similar to Out

  2. 1100-IJBCS-Article-Abiodoum Olounlade

    African Journals Online (AJOL)

    DR GATSING

    Assessment of Intake, Digestibility and the. Roles of Secondary Compounds. Nottingham University Press: Nottingham;. 235-249. Mara SP, Arruda JB, Fernandes PC, Viera M,. Fatima Das GF, Da Silva JRP. 1992. Chemistry of Zanthoxylum rhoifolium. A new secofuraquinoline alkaloids. Biochem. System Ecol., 20: 173-178.

  3. Bulletin of Materials Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science. Ashutosh Sharma. Articles written in Bulletin of Materials Science. Volume 31 Issue 3 June 2008 pp 249-261. Soft lithography meets self-organization: Some new developments in meso-patterning · Rabibrata Mukherjee Ashutosh Sharma Ganesh Patil Danish Faruqui Partho ...

  4. 1 Free radical scavenging activity of some fungi indigenous to ...

    African Journals Online (AJOL)

    Cheung, L., Cheung, P.C. K. & Ooi V.E. (2003) Antioxidant activity and total phenolics of edible mushroom extracts. Food Chemistry 81, 249–255. Jacobson, E., Hove, E. & Emery, H. (1995) Antioxidant function of melanin in black fungi. American Infection and Immunity 63, 4944-4945. Javanmardi, J., Stushnoff, C., Locke, ...

  5. Measurement of β-glucan and other nutritional characteristics in ...

    African Journals Online (AJOL)

    Maiara

    2013-10-23

    Oct 23, 2013 ... Cheung LM, Cheung PCK, Ooi VEC (2003). Antioxidant activity and total phenolics of edible mushroom extracts. Food Chem. 81:249-. 255. Colauto NB, Dias ES, Gimenes MA, Eira AF (2002). Genetic characterization of isolates of the basidiomycete Agaricus blazei by. RAPD. Braz. J. Microbiol. 33:131-133.

  6. Fatty acid profile and health lipid indices in the raw milk of ewes ...

    African Journals Online (AJOL)

    Daniel

    2016-08-02

    Aug 2, 2016 ... As expected, hemp seeds had the highest CP level (249 vs. 94 and 162 g/kg DM in the roughages), while grass hay and pasture had the highest content of cell wall components (NDF and ADF). All feeds, and the concentrate mixture in particular, were good sources of LA, but pasture and hemp seeds were ...

  7. The Cross-Cultural Interaction Inventory: Development of Overseas Criterion Measures and Items That Differentiate Between Successful and Unsuccessful Adjusters

    Science.gov (United States)

    1975-04-01

    satisfaction). (See Appendix E) Data Collection The BIAI and SVIB were completed by 249 Navy personnel (227 en - listed and 22 officers) stationed and/or...arrangements to doEl bomw’thing and follow through. D-7 +- too strong o -right on - - too weak 26. This person has at least one really "good Japanese

  8. AcEST: DK962938 [AcEST

    Lifescience Database Archive (English)

    Full Text Available _RUTGR Chalcone synthase 3 OS=Ruta graveolens GN=C... 249 1e-65 sp|Q9ZRR8|CHS1_CASGL Chalcone synthase OS=Ca...mine amara GN=CHS... 244 2e-64 sp|Q9FSB9|CHS1_RUTGR Chalcone synthase 1 OS=Ruta graveolens GN=C... 244 3e-64

  9. Main: AUXRETGA2GMGH3 [PLACE

    Lifescience Database Archive (English)

    Full Text Available AUXRETGA2GMGH3 S000235 7-Sep-2000 (last modified) seki TGA-box #2 in putative auxin-resonsive element (AUX...ear extracts; Hex-like element; E1 element=-249 to -203; E2 element=-241 to -224; Called G-box by Liu et al. (1997); TGA; AUXRE; aux

  10. Myths and Misconceptions in Popular Psychology: Comparing Psychology Students and the General Public

    Science.gov (United States)

    Furnham, Adrian; Hughes, David J.

    2014-01-01

    This study examined the prevalence of psychological myths and misconceptions among psychology students and within the general population. In total, 829 participants completed a 249-item questionnaire designed to measure a broad range of psychological myths. Results revealed that psychological myths and misconceptions are numerous and widely held.…

  11. 17 CFR 242.609 - Registration of securities information processors: form of application and amendments.

    Science.gov (United States)

    2010-04-01

    ... information processors: form of application and amendments. 242.609 Section 242.609 Commodity and Securities....609 Registration of securities information processors: form of application and amendments. (a) An application for the registration of a securities information processor shall be filed on Form SIP (§ 249.1001...

  12. Bulletin of Materials Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science. C P Vinod. Articles written in Bulletin of Materials Science. Volume 25 Issue 3 June 2002 pp 247-249 Experimental Techniques. A method employing STM for the estimation of relative changes in the work function of modified metal tips · R B Sharma C P Vinod G U Kulkarni.

  13. A Latent Class Analysis of Adolescent Gambling: Application of Resilience Theory

    Science.gov (United States)

    Goldstein, Abby L.; Faulkner, Breanne; Cunningham, Rebecca M.; Zimmerman, Marc A.; Chermack, Stephen; Walton, Maureen A.

    2013-01-01

    The current study examined the application of resilience theory to adolescent gambling using Latent Class Analysis (LCA) to establish subtypes of adolescent gamblers and to explore risk and promotive factors associated with gambling group membership. Participants were a diverse sample of 249 adolescents ages 14 to 18 (30.1 % female, 59.4 % African…

  14. The Role of Psychosocial Characteristics in Criminal Convictions among Cocaine and Gambling Clients in Treatment

    Science.gov (United States)

    Martin, Gina; Macdonald, Scott; Ishiguro, Sonya

    2013-01-01

    This study assessed the relative importance of problem gambling, cocaine use and selected psychosocial characteristics in predicting criminal convictions. A self-administered questionnaire was completed by clients when admitted to a treatment program for a primary problem with cocaine (n = 300), gambling (n = 199), or tobacco (n = 249). The…

  15. Pramana – Journal of Physics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Pramana – Journal of Physics. Harleen Dahiya. Articles written in Pramana – Journal of Physics. Volume 80 Issue 2 February 2013 pp 237-249 Research Articles. Quadrupole moments of low-lying baryons with spin − 1 2 + spin − 3 2 + and spin − 3 2 + → 1 2 + transitions · Neetika Sharma Harleen Dahiya.

  16. Pramana – Journal of Physics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Pramana – Journal of Physics. Neetika Sharma. Articles written in Pramana – Journal of Physics. Volume 80 Issue 2 February 2013 pp 237-249 Research Articles. Quadrupole moments of low-lying baryons with spin − 1 2 + spin − 3 2 + and spin − 3 2 + → 1 2 + transitions · Neetika Sharma Harleen Dahiya.

  17. Sadhana | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Sadhana. M Komaraiah. Articles written in Sadhana. Volume 36 Issue 2 April 2011 pp 223-249. In-plane anisotropy in tensile deformation and its influence on the drawability of Nimonic C–263 alloy sheets · K Ankamma D V V Satyanarayana G Chandramohan Reddy M Komaraiah N Eswara Prasad.

  18. The Relations between Student Motivational Beliefs and Cognitive Engagement in High School

    Science.gov (United States)

    Walker, Christopher O.; Greene, Barbara A.

    2009-01-01

    The authors examined relations among student perceptions of classroom achievement goals, self-efficacy, perceived instrumentality of classroom work, and sense of belonging within a classroom. Participants were 249 high school students. The authors also examined how cognitive engagement was predicted by those variables along with personal…

  19. Download this PDF file

    African Journals Online (AJOL)

    DR. AMINU

    According to the report of. National population commission (NPC) (2006). The state has total population of 3,950,249 about 85% of this population are farmers only about 15% are involve in other activities such as white-collar jobs, business e.t.c.

  20. Quasistatic normal-compliance contact problem of visco-elastic bodies with Coulomb friction implemented by QP and SGBEM

    Czech Academy of Sciences Publication Activity Database

    Vodička, R.; Mantič, V.; Roubíček, Tomáš

    2017-01-01

    Roč. 315, May (2017), s. 249-272 ISSN 0377-0427 Institutional support: RVO:61388998 Keywords : contact mechanics * evolution variational inequalities * numerical approximation Subject RIV: BA - General Mathematics Impact factor: 1.357, year: 2016 http://www.sciencedirect.com/science/article/pii/S037704271630499X

  1. The Human Breast Cancer Cell DNA Synthesome Can Serve as a Novel In Vitro Model System for Studying the Mechanisms of Action of Anticancer Drugs

    Science.gov (United States)

    2001-07-01

    on an Old Drug. Critical Reviews in Oncology/Hematology, 29: 249-255. of Pharmacognosy , P-12, 1992. RAO, K. V.; MCBRIDE, T. J.; OLESON, J. (1968) J... Pharmacognosy , P-12. SEKOWSKI, J. W. et al. (1998) Human Breast Cancer Cells Contain an Error- prone DNA Replication Apparatus. Cancer Research, 58

  2. Author Index Sādhanā Vol. 40, 2015

    Indian Academy of Sciences (India)

    mitigation: A practical design approach 1257. Abbas W see Abdeen M A M. 183 ... parametric form of fuzzy numbers. 35. Numerical solution of ..... S Umamaheswari. Runtime buffer management to improve the performance in irregular Network-on-Chip architecture. 1117. Sadeghi Nik A see Mosavi S M. 249. Saha A K.

  3. UN-EDITED VERSION

    Indian Academy of Sciences (India)

    49

    genome. 508 sequencing. Am. J. Hum. Genet. 93 249-263. 509. Kim KA, Wagle M, Tran K, Zhan X, Dixon MA, Liu S, Gros D, Korver W, Yonkovich S,. 510. Tomasevic N, Binnerts M and Abo A 2008 R-Spondin family members regulate the Wnt. 511.

  4. 78 FR 75395 - Self-Regulatory Organizations; Chicago Board Options Exchange, Incorporated; Order Granting...

    Science.gov (United States)

    2013-12-11

    ... series'' from the proposed rule language relating to Short Term Option Expiration Dates. II. Description... series expire (``Short Term Option Expiration Dates'') at one time; and (ii) state that additional series... proposed rule change also adds language to Rules 5.5(d) and 24.9(a)(2)(A) to state that additional series...

  5. AcEST: BP916463 [AcEST

    Lifescience Database Archive (English)

    Full Text Available o ... 35 0.19 sp|P55724|NOPP_RHISN Effector protein nopP OS=Rhizobium sp. (str... 34 0.24 sp|Q02817|MUC2_HUM...84 Q +M + DPS L+ TG P LT H P Sbjct: 249 VTGQATLFQ----ASSMKSADPSLRGQLSTPTGSPHLTTVHRP 287 >sp|P55724|NOPP_RHISN Effector

  6. 76 FR 2287 - Security-Based Swap Data Repository Registration, Duties, and Core Principles; Correction

    Science.gov (United States)

    2011-01-13

    ... From the Federal Register Online via the Government Publishing Office SECURITIES AND EXCHANGE COMMISSION 17 CFR Parts 240 and 249 RIN 3235-AK79 Security-Based Swap Data Repository Registration, Duties, and Core Principles; Correction Correction In proposed rule document C1-2010-29719 beginning on page...

  7. 75 FR 79320 - Security-Based Swap Data Repository Registration, Duties, and Core Principles

    Science.gov (United States)

    2010-12-20

    ... From the Federal Register Online via the Government Publishing Office SECURITIES AND EXCHANGE COMMISSION 17 CFR Parts 240 and 249 RIN 3235-AK79 Security-Based Swap Data Repository Registration, Duties, and Core Principles Correction In proposed rule document 2010-29719 beginning on page 77306 in the...

  8. Comments on the amplification of intrinsic fluctuations by chaotic dynamics

    Science.gov (United States)

    Nicolis, G.; Balakrishnan, V.

    1992-09-01

    The effect of intrinsic fluctuations in systems exhibiting deterministic chaos is analyzed. It is suggested that the conclusions of the recent series of papers by Fox and Keizer [Phys. Rev. Lett. 64, 249 (1990); Phys. Rev. A 41, 2969 (1990); 42, 1946 (1990); 43, 1709 (1991)] on the breakdown of the deterministic description need to be reassessed.

  9. Obstructive right paraduodenal hernia: A case report

    African Journals Online (AJOL)

    surgical management of paraduodenal hernia. Ann. Surg. 1968; 168: 249-254. 8. Surgery: Scientific principles and practice – Lipincott and Raven: Second edition, Lazar J. Greenfield. 1997. 9. Sinohara T., Okugawa K. and Furuta C. Volvulus of the small intestine caused by right paraduodenal hernia. J. Pediat. Surg. 2004 ...

  10. Physical mapping of 5S and 45S rDNA in Chrysanthemum and ...

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Genetics; Volume 91; Issue 2. Physical mapping of 5S and 45S rDNA in Chrysanthemum and related genera of the Anthemideae by FISH, and species relationships. Magdy Hussein Abd El-Twab Katsuhiko Kondo. Research Note Volume 91 Issue 2 August 2012 pp 245-249 ...

  11. Physical mapping of 5S and 45S rDNA in Chrysanthemum and ...

    Indian Academy of Sciences (India)

    2012-08-09

    Aug 9, 2012 ... [Abd El-Twab M. H. and Kondo K. 2012 Physical mapping of 5S and 45S rDNA in Chrysanthemum and related genera of the Anthemideae by FISH, and species relationships. J. Genet. 91, 245–249]. Introduction. The present study has shown that fluorescence in situ hybridization (FISH) physical mapping ...

  12. Gclust Server: 92020 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available 92020 PPT_81386 Cluster Sequences Related Sequences(249) 131 fgenesh1_pg.scaffold_94000083; no annotation...98e-01 14.29 0.0 0.0 0.0 0.0 0.0 Show 92020 Cluster ID 92020 Sequence ID PPT_81386 Link to cluster sequences

  13. Intergenerational Relationships in Cross-Cultural Comparison: How Social Networks Frame Intergenerational Relations between Mothers and Grandmothers in Japan, Korea, China, Indonesia, Israel, Germany, and Turkey

    Science.gov (United States)

    Nauck, Bernhard; Suckow, Jana

    2006-01-01

    The article explores the relevance of intergenerational relationships within the overall network of young mothers and grandmothers in seven societies: Japan, Korea, China, Indonesia, Turkey, Israel, and Germany. The empirical base is 2,945 named network members in 249 pairs of interviews of grandmothers and their daughters from a cross-cultural…

  14. First measurement of jet mass in Pb-Pb and p-Pb collisions at the LHC

    Czech Academy of Sciences Publication Activity Database

    Acharya, S.; Adamová, Dagmar; Bielčík, J.; Bielčíková, Jana; Brož, M.; Contreras, J. G.; Ferencei, Jozef; Hladký, Jan; Křížek, Filip; Kučera, Vít; Kushpil, Svetlana; Lavička, R.; Mareš, Jiří A.; Petráček, V.; Pospíšil, Jan; Šumbera, Michal; Vaňát, Tomáš; Závada, Petr

    2018-01-01

    Roč. 776, č. 1 (2018), s. 249-264 ISSN 0370-2693 R&D Projects: GA MŠk(CZ) LG15052 Institutional support: RVO:68378271 ; RVO:61389005 Keywords : heavy ion collisions * ALICE collaboration * induced gluon radiation Subject RIV: BF - Elementary Particles and High Energy Physics Impact factor: 4.807, year: 2016

  15. Ahmad T Reverse micellar synthesis and properties of nano ...

    Indian Academy of Sciences (India)

    Unknown

    Babita Devi R K see Lonibala R K. 327. Badami B V see Latthe P R. 249. Bagchi B see Saini S. 23. Bahadur D. Influence of fuel ratios on auto combustion synthesis of barium ferrite nano particles. 15. Baidya T see Gayen A. 47. Balaraman E see Kumara Swamy K C. 495. Banerjee A see Natarajan S. 525. Barman R.

  16. Generation of a Saturated Genetic Recombination Map for Avocado (Persea americana)

    Science.gov (United States)

    Two large mapping populations of avocado consisting of 1582 trees were genotyped with 5050 SNP markers from transcribed genes using an Illumina Infinium SNP chip. A Florida mapping population consisted of 527 progeny from 'Tonnage' x 'Simmonds' and 249 from 'Simmonds' x 'Tonnage'. A California map...

  17. African Journal for Physical Activity and Health Sciences - Vol 14 ...

    African Journals Online (AJOL)

    Physiological and biomedical responses of running with and without a stroller · EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. GA Brown, MP Rebok, ML Scott, J Harris, MK Colaluca, BS Shaw, I Shaw, 240-249. http://dx.doi.org/10.4314/ajpherd.v14i3.24806 ...

  18. Browse Title Index

    African Journals Online (AJOL)

    Items 101 - 150 of 249 ... Vol 28, No 2 (2008), Nursing students' use of language in communicating with isiZulu speaking clients in clinical settings in KwaZulu-Natal, Abstract. Charlotte Engelbrecht, Zethu Nkosi, Dorien Wentzel, Selverani Govender, Patricia McInerney. Vol 26, No 4 (2006), Of kings, jesters and fools: the ...

  19. Prevalence and associations of symptomatic renal papillary necrosis ...

    African Journals Online (AJOL)

    2015-11-12

    Nov 12, 2015 ... Pandya KK, Koshy M, Brown N, Presman D. Renal papillary necrosis in sickle cell hemoglobinopathies. J Urol 1976;115:497-501. 11. Alhwiesh A. An update on sickle cell nephropathy. Saudi J Kidney Dis Transpl. 2014;25:249-65. 12. Breyer MD, Hao C, Qi Z. Cyclooxygenase-2 selective inhibitors and the.

  20. Journal of Earth System Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Earth System Science. A K Patidar. Articles written in Journal of Earth System Science. Volume 115 Issue 2 April 2006 pp 249-256. Bedrock gorges in the central mainland Kachchh: Implications for landscape evolution · M G Thakkar B Goyal A K Patidar D M Maurya L S Chamyal · More Details ...

  1. AcEST: BP916777 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ndependent protochlorophyllide reduc... 30 4.2 sp|A5PK21|CKP2L_BOVIN Cytoskeleton-associated protein 2-like ...Sbjct: 206 FLPASHFTELPPIGPGTVIAPLQPYLHKTATQLRNERGCTVLSS 249 >sp|A5PK21|CKP2L_BOVIN Cytoskeleton-associated p

  2. Dieting, Dietary Restraint, and Binge Eating Disorder among Overweight Adolescents in Turkey

    Science.gov (United States)

    Bas, Murat; Bozan, Nuray; Cigerim, Nevin

    2008-01-01

    The purpose of this study was to determine the relationship among dieting, dietary restraint, disinhibition, hunger, and binge eating among overweight adolescent girls. Participants were 743 overweight adolescent girls between 16 and 19 years of age. The mean BMI was 24.9 [+ or -] 0.8 kg/[m[superscript 2] in the low-restraint group and 25.1 [+ or…

  3. Afican Health Sciences Vol 9 No 4.pmd

    African Journals Online (AJOL)

    Administrator

    Background: Early diagnosis of cancer allows an opportunity for timely treatment while disease burden is in its earliest stages. .... 249. Table 2: Overall lag time of patients with respect to demographic and clinical characteristics. Patient characteristics. No of Patients. Lag time (weeks) ... the child to a church respectively.

  4. AUTHOR INDEX

    Indian Academy of Sciences (India)

    Unknown

    nanotubes. 341. Rakshit J. Optimization of time–temperature schedule for nitridation of silicon compact on the basis of silicon and nitrogen reaction kinetics. 249. Ramachandra C ... Sinha Amar. A CCD area detector for X-ray diffraction under high pressure for rotating anode source. 151. Sirdeshmukh D B see Subhadra K G.

  5. Orthostatic hypotension does not predict recurrent falling in a nursing home population

    NARCIS (Netherlands)

    Hartog, L. C.; Cimzar-Sweelssen, M.; Knipscheer, A.; Groenier, K. H.; Kleefstra, N.; Bilo, H. J. G.; Van Hateren, Kornelis J. J.

    2017-01-01

    Objective: Most studies regard orthostatic hypotension (OH) as a causal factor for falls. However, the evidence is lacking for this assumption. We aimed to investigate the relationship between orthostatic hypotension and fall incidents in nursing home residents. Methods: A total of 249 patients was

  6. Comparison of inhibitory mold agar to Sabouraud dextrose agar as a primary medium for isolation of fungi.

    Science.gov (United States)

    Scognamiglio, Theresa; Zinchuk, Riva; Gumpeni, Pramod; Larone, Davise H

    2010-05-01

    Clinical specimens cultured on two selective fungal media, inhibitory mold agar (IMA) and Sabouraud dextrose agar (SDA), were compared with respect to recovery of fungi. Of the 840 fungal isolates recovered, 69.3% grew on both IMA and SDA; 24.9% grew only on IMA; and 5.8% grew only on SDA, showing that IMA is superior (P=0.003).

  7. Full-wave solution of short impulses in inhomogeneous plasma

    Indian Academy of Sciences (India)

    physics pp. 249–268. Full-wave solution of short impulses in inhomogeneous plasma. ORSOLYA E FERENCZ. Space Research Group, Eötvös University, Geophysical Department, H-1518, Budapest,. P.O. Box 32, Hungary ...... lightning, traveling through the ionosphere up to the magnetosphere (whistler pre- cursors).

  8. 48 CFR 49.402-1 - The Government's right.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false The Government's right. 49... MANAGEMENT TERMINATION OF CONTRACTS Termination for Default 49.402-1 The Government's right. Under contracts containing the Default clause at 52.249-8, the Government has the right, subject to the notice requirements...

  9. Engineering Transgenic Plants for the Sustained Containment and In Situ Treatment of Energetic Materials

    Science.gov (United States)

    2009-06-01

    170 Phenylethylamine .016 .566 -.249 .180 -.216 .203 .081 Putrescine -.594 .068 .247 .301 -.066 .201 -.019 SERDP Final Technical Report ER...Methyl-D-glucoside 0.503 carbohydrate 4-Hydroxy Benzoic Acid-0.502 carboxylic acid L-asparagine -0.576 amino acid Putrescine -0.594 amine L

  10. Reasons For Preference Of Delivery In Spiritual Church-Based ...

    African Journals Online (AJOL)

    Results: Various reasons for preferring church delivery included: Spiritual protection against satanic attacks and safe delivery in 975 (36.8%) lack of funds in 629(30.5%), harsh attitude of health workers in 249 (12.1%), convenience in 212 (10.3%), faith in God and previous delivery in church 83 (4.0%) each help and good ...

  11. Phytotoxic triterpene saponis from Bellis longifolia, an endemic plant of Crete

    Science.gov (United States)

    In continuation of our research on discovery of bioactive compounds from plants we have screened extracts of 65 plant species of the Cretan flora for their phytotoxic activity. All plants were extracted successively with CH2Cl2, MeOH and H2O. Phytotoxicity evaluation of the 249 generated extracts wa...

  12. Data of evolutionary structure change: 1DFFA-3CMDB [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1DFFA-3CMDB 1DFF 3CMD A B ---SVLQVLHIPDERLRKVAKPVE-EVNAEIQRIVDDMF...Chain> 3CMD B 3CMDB ...line> THR CA 218 GLY CA 249 ILE CA 245 3CMD... B 3CMDB.../line> ARG CA 294 ALA CA 297 LEU CA 260 3CMD

  13. Bringing China In: International Order and the Role of the Great Powers

    Science.gov (United States)

    2013-06-01

    Von Braun: Dreamer of Space, Engineer of War (New York: A.A. Knopf, 2007), 249. 32 Phase III started when the inaccurately named Chinese...34 Foreign Affairs 91, no. 5 (2012): 32-47. Neufeld, Michael J. Von Braun : Dreamer of Space, Engineer of War. New York: A.A. Knopf, 2007. Obama

  14. National Defense Authorization Act for Fiscal Year 2014

    Science.gov (United States)

    2013-06-20

    Chief Information Officer ............... 248 Naval Reactors ................................................................................... 249... Fusion Cen- tre and the joint Planning Operations Centre to cooperate on mis- sile defense. We propose to develop a transparency regime based upon a... conceptual , developmental, and operational prototyping. The committee urges the Rapid Fielding program to spearhead efforts to find innovative

  15. East and Central African Journal of Surgery Volume 15 Number 2 ...

    African Journals Online (AJOL)

    DELL

    least one surgical intervention done prior to referral. The overall trend is showing some decrement. The main reason for referral was for better surgical intervention (249). Referral for. MRI which accounted for 16 of ... It also necessitates hard currency, finding good hospitals, lodging…etc; which are significant challenges for ...

  16. 2010-IJBCS-Article-Bruno Djossa

    African Journals Online (AJOL)

    hp

    the changes to producer and consumer surplus induced by the decrease ... In this climate change context and manmade threats on pollinators .... Cocoa. Theobroma cacao fruit. 54,6. 51,87 (95). Coconut. Cocos nucifera nut. 998,55. 249,64 (25). Cola nut. Cola nitida nut. 204,75. 133,09 (65). Cotton/ lint. Gossypium spp. fibre.

  17. Saksa Raudtee läheb täna uuele katsele / Katri Soe

    Index Scriptorium Estoniae

    Soe, Katri

    2008-01-01

    Saksa valitsuskoalitsioon hakkab arutama Saksa Raudtee börsilemineku kompromissplaani, mille järgi läheb sügisel börsile 24,9% Deutsche Bahn AG transpordi ja logistikaosast, infrastruktuur jääb riigile

  18. Improved detectability of barbiturates in high-performance liquid chromatography by pre-column labelling and ultraviolet detection

    NARCIS (Netherlands)

    Hulshoff, A.; Roseboom, H.; Renema, J.

    1979-01-01

    2-Naphthacyl derivatives of barbiturates are formed in acetone at 30° within 30 min, in an essentially quantitative manner, using caesium carbonate as a catalyst. These derivatives absorb UV radiation strongly at 254 nm. Using a variable-wavelength detector set at 249 nm, 1 ng of

  19. 44 East and Central African Journal of Surgery Volume 12 Number 2 ...

    African Journals Online (AJOL)

    Josephine Nakato

    results. Acta Otorhinolaryngol Ital, 2004, 24: 2-7. 9. Vartiainen E and Nuutinen J. Long-term hearing results of one-stage tympanoplasty for chronic otitis media European Archives of Oto-Rhino-Laryngology 1992, 249, 6: 329-331. 10. Shinohara T, Gyo K., Saiki T. Yanagihara N. Ossiculoplasty using hydroxyapatite protheses:.

  20. All projects related to | Page 2 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Total Funding: CA$ 249,188.00. Closing the gender gap in financial inclusion: Advancing the business case. Project. Financial inclusion is an enabler for women's economic empowerment. Region: North and Central America, South America, United States. Program: Employment and Growth. Total Funding: CA$ 568,600.00.

  1. December 2016

    African Journals Online (AJOL)

    FOBUR

    Mycotoxin contamination of food products is an established nexus linking ineffective agricultural practices with. 6 ... contaminants on food products obtained from. 1. 2,. 3. 4. 5 several markets in Niger and Kogi states in ... HCC patients using cell free DNA in plasma for p53 gene codon 249 G – T mutation. In this study, none.

  2. Metabolic and hormonal responses of growing modern meat type chickens to fasting

    Science.gov (United States)

    The present study compared the effects of fasting on circulating concentrations of glucose, insulin and glucagon in male and female modern meat-type chickens (Ross 708) at three ages (19 d, 33 d and 47 d). Plasma concentrations of glucose were reduced by fasting with reductions of 24.9% (19-d-old),...

  3. AcEST: BP919402 [AcEST

    Lifescience Database Archive (English)

    Full Text Available M930|MATK_PAUTO Maturase K OS=Paulownia tomentosa GN=matK P... 30 3.9 sp|Q6EIJ9|MATK_FRECA Maturase K OS=Fre... K PC Sbjct: 249 FYGKVERLVNVFGKVKDFQENLWLVKEPC 277 >sp|Q8M930|MATK_PAUTO Maturase K OS=Paulo

  4. program in Tigray Region

    African Journals Online (AJOL)

    The role of men in fertility and family planning program in Tigray Region 249 the Ethiopian and particularly, ... were carried out using chi-Square and two sample hypothesis testing for the'ideal mean number of children desired (confidence interval, P-value). ..... encouraging communicationand joint decision making on ...

  5. Bulletin of Materials Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science. P K Das. Articles written in Bulletin of Materials Science. Volume 23 Issue 4 August 2000 pp 249-253 Nitride Ceramics. Optimization of time–temperature schedule for nitridation of silicon compact on the basis of silicon and nitrogen reaction kinetics · J Rakshit P K Das.

  6. Evaluation of flooring produced from small diameters logs of Eucalyptus sp. clones

    Directory of Open Access Journals (Sweden)

    José Reinaldo Moreira da Silva

    2010-12-01

    Full Text Available This study evaluated two Eucalyptus clones, MN 249 and MN 89, for the flooring production using small diameters logs. It was considered the wood physical properties - NBR 7190/97 (ABNT, 1997 and simulation of the product in service (ASTM D 2394/83 with two thicknesses, 8 and 14 mm. The basic density of the clone 89 NM was the highest one (0,615 g/cm3. The contractions were more pronounced in clone NM 249, however, the anisotropy coefficient of this clone was small. In the simulation tests, the floor produced by clone MN 249 presented the lowest deformation rate. The floor of 8 mm, in addition to the differences between clones, there was significant interaction between the positions for the indentation test caused by loads applied in small areas. The deformations obtained for the floor with 14 mm thickness, produced with the MN clone 89, were higher than those found in the literature for the indentation load applied on a small area test. The clone MN 249 presented the best results in both thicknesses.

  7. EST Table: FS906744 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available ophila yakuba] gb|EDW91502.1| GE13850 [Drosophila yakuba] 10/09/12 67 %/249 aa FBpp0085738|SdhA-PC 10/08/29 ...66 %/223 aa C03G5.1#CE03917#WBGene00015391#locus:sdha-1#succinate dehydrogenase flavoprotein subunit#status:

  8. Effect of atorvastatin in elderly patients with a recent stroke or transient ischemic attack

    DEFF Research Database (Denmark)

    Chaturvedi, S; Zivin, J; Breazna, A

    2009-01-01

    endpoint (fatal or nonfatal stroke) and secondary endpoints were analyzed, with calculation of the hazard ratio (HR) and p values from a Cox regression model. RESULTS: There were 2,249 patients in the elderly group and 2,482 in the younger group. The baseline LDL (133 mg/dL) and total cholesterol were...

  9. Acción del stimulate en el crecimiento y llenado de mazorcas en maíz (Zea mays L.)

    National Research Council Canada - National Science Library

    Norato Rodríguez Jesús

    1992-01-01

    ... (2.49 Ton/ha, superior al testigo).This study pertains to the modification of the normal behavior of growth and development of a regional genotype of Zea mays by spray with STIMULATE, which is a mixture of auxines, gibberellines and cytokinines...

  10. Gclust Server: 90491 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available Sequences Related Sequences(249) 224 peptide/opine/nickel uptake ABC transporter 1 1.00e-45 0.0 0.0 4.0...length 224 Representative annotation peptide/opine/nickel uptake ABC transporter Number of Sequences 1 Homologs

  11. RJHS 3(4b).cdr

    African Journals Online (AJOL)

    ABEOLUGBENGAS

    2013-08-08

    Aug 8, 2013 ... Methods: A cross-sectional study of 249 out of 300 hospital cleaners at the Federal Medical Centre Owo, was conducted. ..... 199(6):e631-9. 24. Kaur R, Kaur B, Walia L. Knowledge attitude and practice regarding universal precautions among nursing students. Nursing Midwifery. Res J. 2008; 4:115-27. 25.

  12. Adhikari SD Zero-sum problems with subgroup weights 259 ...

    Indian Academy of Sciences (India)

    Subbiah M. On short wave stability and sufficient conditions for stability in the extended. Rayleigh problem of hydrodynamic stability. 387. Sun Jitao see Ma Yajun. 249. Sury B see Adhikari S D. 259. Szal Bogdan. Embedding relations connected with str- ong approximation of Fourier series 563. Tao Jicheng see Dong Zhe.

  13. Higher-Order Thickness Expansions for Cylindrical Shells

    Science.gov (United States)

    1991-09-01

    Engblom, John J. and 0. 0. Ochoa. "Finite Element Formulation Including Inter - laminar Stress Calculations," Computers & Structures, 23: No. 2, 241-249... Teoria Plyt Sredniej Grubbosci (Technical Theory of Plates with Moderate Thickness)," Rozprawy Inzynierskie (English Translation, Pol- ska Akademia Nauk

  14. JOS JOURNAL 1

    African Journals Online (AJOL)

    Yanomami Indians in the State of Amazonas in. Brazil, where the prevalence of active trachoma. 36 was 24.9% in children. Similarly, in Morocco in the Zagora region, the prevalence of active. 32 trachoma was 22.1% in children. Active trachoma is usually present in areas of low rainfall and low atmospheric humidity coupled ...

  15. Journal of Chemical Sciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    pp 249-261 Inorganic and Analytical. Fac-mer equilibria of coordinated iminodiacetate (ida) in ternary Cu(ida)(H-1B) complex formation (B = imidazole, benzimidazole) in aqueous solution · Susmita Bandyopadhyay G N Mukherjee · More Details Abstract Fulltext PDF. pH potentiometric and spectrophotometric investigations ...

  16. Home births and postnatal practices in madagali, North-Eastern ...

    African Journals Online (AJOL)

    2012-06-28

    Jun 28, 2012 ... Department of Obstetrics and Gynecology and 1Community Medicine, University of Maiduguri Teaching. Hospital, Borno State, Nigeria. Original Article. Access this article online ..... Curr Opin Infect Dis 2010;3:249-54. 20. Buchmann E, Kritzinger M, Tembe R, Berry D. Home births in the Mosvold health ward ...

  17. 17 CFR 232.311 - Documents submitted in paper under cover of Form SE.

    Science.gov (United States)

    2010-04-01

    ... section, may be filed up to six business days prior to, or on the date of filing of, the electronic format... EXCHANGE COMMISSION REGULATION S-T-GENERAL RULES AND REGULATIONS FOR ELECTRONIC FILINGS Preparation of Electronic Submissions § 232.311 Documents submitted in paper under cover of Form SE. Form SE (§§ 239.64, 249...

  18. Gclust Server: 91788 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available Sequences(249) 135 indole-3-acetaldehyde dehydrogenase [Ustilago maydis] 1 1.00e-70 0.0 0.0 4.0 0.0 0.0 0.0 Show...annotation indole-3-acetaldehyde dehydrogenase [Ustilago maydis] Number of Sequences 1 Homologs 1 Clustering

  19. Journal of Biosciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Biosciences. Sameha Merzoug. Articles written in Journal of Biosciences. Volume 41 Issue 2 June 2016 pp 237-249 Article. Effects of quercetin on predator stress-related hematological and behavioral alterations in pregnant rats and their offspring · Mohamed L Toumi Sameha Merzoug Abdelkrim ...

  20. Intuitive visualizations of pitch and loudness in speech

    NARCIS (Netherlands)

    Schaefer, R.S.; Beijer, L.J.; Seuskens, W.L.J.B.; Rietveld, A.C.M.; Sadakata, M.

    2016-01-01

    Visualizing acoustic features of speech has proven helpful in speech therapy; however, it is as yet unclear how to create intuitive and fitting visualizations. To better understand the mappings from speech sound aspects to visual space, a large web-based experiment (n = 249) was performed to

  1. CONTRACTION CHARACTERISTICS AND MYOSIN HEAVY-CHAIN COMPOSITION OF RABBIT MASSETER MOTOR UNITS

    NARCIS (Netherlands)

    KWA, SHS; WEIJS, WA; JUCH, PJW

    1. We studied isometric twitch peak force (TPF) and twitch contraction time (TCT) of 249 motor units of the masseter muscle in 41 rabbits after extracellular electrical stimulation of single trigeminal motoneurons in the brain stem. In 41 of these units we determined the amount of tension decrease

  2. Browse Title Index

    African Journals Online (AJOL)

    Items 1 - 50 of 249 ... Vol 31, No 1 (2011), A bilingual dictionary for a specific user group: Supporting Setswana speakers in the production and reception of English, Abstract. DJ Prinsloo, U Heid ... Vol 25, No 3 (2005), Aspiration of English voiceless stop consonants in Southern Sotho: a case study, Abstract. D Wissing. Vol 36 ...

  3. keling hu

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Genetics. KELING HU. Articles written in Journal of Genetics. Volume 96 Issue 2 June 2017 pp 235-249 RESEARCH ARTICLE. Expression analysis of argonaute, Dicer-like, and RNA-dependent RNA polymerase genes in cucumber ( Cucumis sativus L.) in response to abiotic stress · DEFANG ...

  4. Prevalence and Nature of Sexual Assault among Female Students ...

    African Journals Online (AJOL)

    Most of the sexual assault reported (57.6%) occurred in the evenings and nights. In 35.6% of the cases, the respondents sustained extra-genital trauma, while others had psychological (24.9%) and genital trauma (15.6%). Conclusion: Sexual assault rate among female students in the University of Maiduguri is high and is ...

  5. Trend from cardiovascular to non-cardiovascular late mortality in patients with renal replacement therapy since childhood

    NARCIS (Netherlands)

    Vogelzang, Judith L.; van Stralen, Karlijn J.; Jager, Kitty J.; Groothoff, Jaap W.

    2013-01-01

    To evaluate transitions in causes of death in patients with renal replacement therapy (RRT) since childhood over time, we performed a 10-year extension of the Late Effects of Renal Insufficiency in Children (LERIC) study. The LERIC cohort consisted of all 249 Dutch patients, who were born before

  6. 1678-IJBCS-Article-Jacques Fatombi

    African Journals Online (AJOL)

    hp

    simulated groundwater via ozone technology. Desalination, 249(3): 1345-. 1349. Bawa LM, Djanéyé-Boundjou G, Soulémane. AG, Kpékpassi L. 2008. Etude de la clarification d'une eau de surface par une substance naturelle (les extraits de. Moringa oleifera Lam): Incidence sur la demande en chlore. Phys. Chem. News,.

  7. crushed concrete as a source of aggregate for new concrete

    African Journals Online (AJOL)

    Engr. Dr. F.O. Okafor

    KEYWORDS: Waste Concrete; Recycled Aggregate; Workability, Compressive Strength. ... better methods of solid waste disposal and probably energy ... Specific gravity. Water absorption, (%). Aggregate crushing value, (%). 2.65. 0.21. 22.52. 2.49. 3.67. 29.86. Grading (% by weight passing sieve size stated). 25.4 mm.

  8. The Research Laboratory of Electronics Progress Report Number 136, 1 January-31 December 1993

    Science.gov (United States)

    1994-06-01

    the previous four years for of gravitational lensing-the distortion of radio the Office of Solar System Exploration of the signals from distant radio...355 Energia Nucleare e Energie Alternative (Italy) 249 Geophysics 325 Energy transfer 133 Geraci, James R. 35, 37 Entin, Ilya 209, 225 Gold, Bernard 317

  9. West Nile Virus Temperature Sensitivity and Avian Virulence Are Modulated by NS1-2B Polymorphisms.

    Science.gov (United States)

    Dietrich, Elizabeth A; Langevin, Stanley A; Huang, Claire Y-H; Maharaj, Payal D; Delorey, Mark J; Bowen, Richard A; Kinney, Richard M; Brault, Aaron C

    2016-08-01

    West Nile virus (WNV) replicates in a wide variety of avian species, which serve as reservoir and amplification hosts. WNV strains isolated in North America, such as the prototype strain NY99, elicit a highly pathogenic response in certain avian species, notably American crows (AMCRs; Corvus brachyrhynchos). In contrast, a closely related strain, KN3829, isolated in Kenya, exhibits a low viremic response with limited mortality in AMCRs. Previous work has associated the difference in pathogenicity primarily with a single amino acid mutation at position 249 in the helicase domain of the NS3 protein. The NY99 strain encodes a proline residue at this position, while KN3829 encodes a threonine. Introduction of an NS3-T249P mutation in the KN3829 genetic background significantly increased virulence and mortality; however, peak viremia and mortality were lower than those of NY99. In order to elucidate the viral genetic basis for phenotype variations exclusive of the NS3-249 polymorphism, chimeric NY99/KN3829 viruses were created. We show herein that differences in the NS1-2B region contribute to avian pathogenicity in a manner that is independent of and additive with the NS3-249 mutation. Additionally, NS1-2B residues were found to alter temperature sensitivity when grown in avian cells.

  10. Włodzimierz Sobkowiak

    African Journals Online (AJOL)

    R.B. Ruthven

    Phonetics of EFL Dictionary Definitions. 2006,. 249 pp. ISBN 83-7177-450-8. Anglistyka. Poznań: Wydawnictwo Poz- nańskie. Price: 38 zł. I dream of dictionaries which would redress the anti-phonetic bias of current lexicography. — Sobkowiak 2006: 11. [A] phonetically uncontrolled defining vocabulary could breed a ...

  11. The Relationship between the Values of Primary School and Music Teacher Candidates and Their Cheating Attitudes

    Science.gov (United States)

    Saracaloglu, Asuman Seda; Gerçeker, Ceren Saygi; Aladag, Soner

    2018-01-01

    The aim of this research is to examine the relationship between the values of primary and music teacher candidates and their cheating attitudes in terms of different variables. The study group of the research is composed of 249 students who are studying at the Departments of Primary School Teaching and Music Education at Adnan Menderes University…

  12. Atherosclerosis and Nutrition with Special Reference to Populations ...

    African Journals Online (AJOL)

    ., Lewis, L. A., Mikkelson, B. and Kang-. Jey, H. (1971): S. Afr. J. Med. Sei., 2, 249. 20. Lee, K. T. (1971): Ibid., 2. 191. 21. Higginson, J. and Pep!er, W. J. (1954): J. Clin. Invest., 33, 1366. 22. Reef, H. and Isaacson, C. (1962): Circulation, 25, 66.

  13. Factors associated with the referral of anxious children to mental health care: the influence of family functioning, parenting, parental anxiety and child impairment

    NARCIS (Netherlands)

    Jongerden, L.; Simon, E.; Bodden, D.H.M.; Dirksen, C.D.; Bögels, S.M.

    2015-01-01

    This study aims to identify factors that predict the mental health care referral of anxious children. In total, 249 children and families, aged 8-13 years, participated: 73 children were referred with anxiety disorders to mental health care [mean (M) age =10.28, standard deviation (SD) =1.35], 176

  14. Factors associated with the referral of anxious children to mental health care: The influence of family functioning, parenting, parental anxiety and child impairment.

    NARCIS (Netherlands)

    Jongerden, L.; Simon, E.; Bodden, D.H.M.; Dirksen, C.D.; Bögels, Susan M.

    2015-01-01

    This study aims to identify factors that predict the mental health care referral of anxious children. In total, 249 children and families, aged 8–13 years, participated: 73 children were referred with anxiety disorders to mental health care [mean (M) age =10.28, standard deviation (SD) =1.35], 176

  15. Assessment of anaemia and iron status of school age children (aged ...

    African Journals Online (AJOL)

    -12 years in some rural communities in Nigeria as well as identify factors associated with anemia in the children. A total of 249 school children, 120 males and 129 females aged between 7-12 years were used in the study. Haemomoglobin ...

  16. Homeless in Galilee

    African Journals Online (AJOL)

    Test

    2011-06-07

    Jun 7, 2011 ... goods for their profit (Herzog 1994:249–250), deal with each other as children of this age with excesses of wealth that violate communal values and biblical law and Jesus contrasts them all with the children of light. The images of children of this age or of light reiterate the genitive of origin. Jesus' tag.

  17. A Spitzer View of Star Formation in the Cyngus X North Complex

    Science.gov (United States)

    2009-11-10

    tic sources (for example, active galactic nuclei or AGN) on the basis of magnitude and color cuts. Using these methods, we found 670 Class I, 7,249...1682 Hernández, J. 2005, Ph.D. dissertation, Universidad de Los Andes, Merida, Venezuela Hernández, J., Hartmann, L., Calvet, N., Jeffries, R. D

  18. Evaluation of rice offal as energy source for fattening Bunaji bulls ...

    African Journals Online (AJOL)

    249kg and age range of 2-3 years to evaluate the feeding value of raw or parboiled rice offal as energy source for bull fattening. Four bulls per treatment were allotted to five dietary treatments in a 2x2 factorial arrangement with a common control.

  19. Gclust Server: 62015 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available 62015 DPTM_GSPATP00018828001 Cluster Sequences Related Sequences(1) 249 no annotati...on 2 1.00e-45 0.0 11.11 0.0 0.0 0.0 0.0 Show 62015 Cluster ID 62015 Sequence ID DPTM_GSPATP00018828001 Link

  20. Extraction and identification of the hepatoprotective bio-active ...

    African Journals Online (AJOL)

    DR. NJ TONUKARI

    1College of Horticulture and Landscape Architecture, Hainan University, Haikou 570228, China. 2The Haikou Key Laboratory of Bioactive Substance and Functional Foods, Haikou ...... Toxicology 23:249-259. Gong YH (1986). 13C NMR Chemical shifts of natural organic compounds. Kunming: Yunnan Sci. Technol.

  1. 77 FR 13150 - Notice of Lodging of Third Amendment to Consent Decree Under the Clean Air Act

    Science.gov (United States)

    2012-03-05

    ... lodged with the United States District Court for the Southern District of Texas. Under the original Consent Decree, ConocoPhillips Company (``COPC'') agreed to implement innovative pollution control... coker quench water tank. COPC also will pay civil penalties of $249,000, $98,500, and $21,000 to resolve...

  2. 75 FR 3277 - Notice of Final Federal Agency Actions on State Highway 99 (Segment F-2) in Texas

    Science.gov (United States)

    2010-01-20

    .... 1251- 1342]; Land and Water Conservation Fund (LWCF) . 8. Executive Orders: E.O. 11990 Protection of... Texas AGENCY: Federal Highway Administration (FHWA), DOT. ACTION: Notice of limitation on claims for... Highway 249 to Interstate Highway 45 (I-45) in Harris County, Texas. Those actions grant licenses, permits...

  3. Safety in Numbers

    Science.gov (United States)

    2010-11-27

    Bicocca. Dipartimento di Informatica , Sistemistica e Comunicazione. Laboratorio di Test e Analisi del Software, Milano. Technical Report LTA:2004:05...Communications of the ACM, 1981. 24(9): pp. 563-573. 76. Thomas Reps, On the sequential nature of interprocedural program-analysis problems. Acta Informatica

  4. 75 FR 81966 - Stainless Steel Plate in Coils From Belgium: Extension of Time Limit for Preliminary Results of...

    Science.gov (United States)

    2010-12-29

    ... [Federal Register Volume 75, Number 249 (Wednesday, December 29, 2010)] [Notices] [Page 81966] [FR Doc No: 2010-32863] DEPARTMENT OF COMMERCE International Trade Administration [C-423-809] Stainless... countervailing duty order on stainless steel plate in coils from Belgium, covering the period January 1, 2009...

  5. Factors Associated with the Referral of Anxious Children to Mental Health Care: the Influence of Family Functioning, Parenting, Parental Anxiety and Child Impairment

    NARCIS (Netherlands)

    Jongerden, L.; Simon, E.; Bodden, D.H.M.; Dirksen, C.D.; Bögels, S.M.

    2015-01-01

    This study aims to identify factors that predict the mental health care referral of anxious children. In total, 249 children and families, aged 8-13 years, participated: 73 children were referred with anxiety disorders to mental health care [mean (M) age =10.28, standard deviation (SD) =1.35], 176

  6. State, Foreign Opeations, and Related Programs: FY2011 Budget and Appropriations

    Science.gov (United States)

    2010-08-19

    for global climate change, food security, and microfinance programs. The Administration also emphasized two new focus areas, adding neglected tropical...188 $249 +32% HIV/AIDS $5,609 $5,850 +4% Malaria $585 $680 +16% Maternal and Child Health $954 $983 +3% Microenterprise and Microfinance $168

  7. State, Foreign Operations, and Related Programs: FY2011 Budget and Appropriations

    Science.gov (United States)

    2011-04-22

    as did the request for global climate change, food security, and microfinance programs. The Administration also emphasized two new focus areas...188 $249 +32% HIV/AIDS $5,609 $5,850 +4% Malaria $585 $680 +16% Maternal and Child Health $954 $983 +3% Microenterprise and Microfinance $168

  8. Patchy charnockites from Jenapore, Eastern Ghats granulite belt, India

    Indian Academy of Sciences (India)

    R. Narasimhan (Krishtel eMaging) 1461 1996 Oct 15 13:05:22

    inclusion in rocks from the amphibolite-facies gneiss to charnockite progression in southern Karnataka, India: Direct evidence concerning the fluids of granulite meta- morphism; J. Metamorphic Geol. 2 249–264. Harley S L and Santosh M 1995 Wollastonite at Nuliyam,. Kerala, South India: a reassessment of CO2 infiltration.

  9. Browse Title Index - African Journals Online

    African Journals Online (AJOL)

    Items 1 - 50 of 249 ... Willem Odendaal, Charles Malcolm, Shazly Savahl, Roseline September. Vol 9, No 1 (2009), Ambiguous Encounters: A Relational Approach to Phenomenological Research, Abstract. L Finlay. Vol 13, No 1 (2013), An Account od Healing Depression Using Ayahuasca Plant Teacher Medicine in a Santo ...

  10. 75 FR 64752 - Submission for OMB Review; Comment Request

    Science.gov (United States)

    2010-10-20

    .... Extension: Form N-CSR, SEC File No. 270-512, OMB Control No. 3235-0570. Notice is hereby given that... extension of the previously approved collection of information discussed below. Form N-CSR (17 CFR 249.331... N-CSR is to be used for reports under Section 30(b)(2) of the Investment Company Act and Section 13...

  11. 78 FR 58351 - Submission for OMB Review; Comment Request

    Science.gov (United States)

    2013-09-23

    ... Extension: Form N-CSR; OMB Control No. 3235-0570, SEC File No. 270-512 Notice is hereby given that, pursuant... extension of the previously approved collection of information discussed below. Form N-CSR (17 CFR 249.331....) (``Exchange Act''). Specifically, Form N-CSR is to be used for reports under section 30(b)(2) of the...

  12. 75 FR 64120 - Technical Amendments to Forms N-CSR and N-SAR in Connection With the Comprehensive Iran Sanctions...

    Science.gov (United States)

    2010-10-19

    ... COMMISSION 17 CFR Parts 249 and 274 Technical Amendments to Forms N-CSR and N-SAR in Connection With the... adopting technical amendments to Forms N-CSR and N-SAR under the Securities Exchange Act of 1934 and the... Securities and Exchange Commission (``Commission'') is adopting technical amendments to Form N-CSR \\1\\ and...

  13. Bk and Cf chromatographic separation and ²⁴⁹Bk/²⁴⁸Cm and ²⁴⁹Cf/²⁴⁸Cm elemental ratios determination by inductively coupled plasma quadrupole mass spectrometry.

    Science.gov (United States)

    Gourgiotis, A; Isnard, H; Nonell, A; Aubert, M; Stadelmann, G; Dupont, E; AlMahamid, I; Tiang, G; Rao, L; Lukens, W; Cassette, P; Panebianco, S; Letourneau, A; Chartier, F

    2013-03-15

    The French Atomic Energy Commission has carried out several experiments for the study of minor-actinide transmutation processes in high intensity thermal neutron flux. In this context a Cm sample enriched in (248)Cm (∼97%) was irradiated in a thermal neutron flux at the High Flux Reactor (HFR) of the Laue-Langevin Institute (ILL). The precise and accurate determination of Cf isotope ratios and of (249)Bk/(248)Cm and (249)Cf/(248)Cm elemental ratios in the (248)Cm irradiated sample is crucial for the calculation of actinide neutron capture cross-sections. This work describes an analytical procedure for the separation and the isotope ratio measurement of Bk and Cf in the irradiated sample. The Bk and Cf separation is based on a lanthanides separation protocol previously developed by the laboratory. Well-defined retention times for Bk and Cf were obtained by coupling the Ionic Chromatography (IC) with an ICP-QMS. All conditions of element separation by IC and the different steps of the analytical protocol in order to obtain the isotopic and elemental ratios are presented. Relative uncertainties of Cf isotopic ratios range from 0.3% to 0.5% and the uncertainty of the (249)Bk/(248)Cm and (249)Cf/(248)Cm elemental ratios are respectively 6.1% and 3.2%. This level of uncertainty for both isotopic and elemental ratios is in perfect agreement with the requirement for transmutation studies. Copyright © 2012 Elsevier B.V. All rights reserved.

  14. Has climate change disrupted stratification patterns in Lake Victoria ...

    African Journals Online (AJOL)

    These data suggest that the impacts of warming on the thermal regime of African lakes may be highly variable and unpredictable and, in this case, may have reduced its threat to the fisheries. Keywords: deoxygenation, fisheries, global warming, thermocline. African Journal of Aquatic Science 2013, 38(3): 249–253 ...

  15. "Sa oled mul teine" : teisesusest eesti kultuuri eneseanalüüsis / Aare Pilv

    Index Scriptorium Estoniae

    Pilv, Aare, 1976-

    2008-01-01

    Kolmest eesti kultuuri eneseanalüüsi kontseptsioonist: "katkestus" (Hasso Krull), "eksistentsialistlik absurdiprojekt" (Jaan Undusk), "enesekolonisatsioon" (Tiit Hennoste). Poleemikat T. Hennoste enesekolonisatsiooni teooriaga (olulisim tekst selle kohta on 2006. a. avaldatud artikkel "Noor-Eesti kui lõpetamata enesekoloniseerimisprojekt"). Sisaldab bibliograafiat. Autorist lk. 249

  16. South African Journal of Animal Science - Vol 45, No 3 (2015)

    African Journals Online (AJOL)

    Proteomics approach as a new way to predict tenderness as compared to the classical South African Beef Carcass Classification System · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. KW Moloto, L Frylinck, PE Strydom, G Koorsen, 249-254 ...

  17. Beiträge zur Kenntnis der Pupillacea VII. Über zwei Wenig Bekannte Valloniidae

    NARCIS (Netherlands)

    Gittenberger, E.

    1977-01-01

    Spermodea spermatia (Da Silva e Castro) (Fig. 2) Helix spermatia J. da Silva e Castro, 1887: 249 (Locus typicus: "au bois de Bussaco", Bugaco, 40°22'N 8°21'W, etwa 15 km nnö. von Coimbra, Beira Litoral, Portugal — ? Syntypus: MHNG-Bgt2)). — A. Locard, 1899: 61. Helix (Acanthinula) spermatia — C. A.

  18. Bayero Journal of Pure and Applied Sciences - Vol 9, No 2 (2016)

    African Journals Online (AJOL)

    12Fe And Al13Fe icosahedral metallic alloys · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Mansur Sa'id, G. Babaji, 292 - 301. http://dx.doi.org/10.4314/bajopas.v9i2.49 ...

  19. Bulletin of Animal Health and Production in Africa - Vol 64, No 1 (2016)

    African Journals Online (AJOL)

    Particularité du traitement à l'acide formique de varroa destructor (Acari, Varroidae), parasite d'apis mellifera dans les conditions tunisiennes · EMAIL FULL TEXT EMAIL FULL TEXT DOWNLOAD FULL TEXT ... FULL TEXT DOWNLOAD FULL TEXT. Félix Meutchieye, Mathilde Sanglier, Mintsia Fokam Olivier, 249 - 264 ...

  20. Chakraborty, Prof. Ranajit

    Indian Academy of Sciences (India)

    Elected: 2006 Honorary. Chakraborty, Prof. Ranajit. Date of birth: 1946. Address: Director, Center for Computational Genomics, University of North Texas, HSC, 3500 Camp Bowie Blvd, CBH 249, Fort Worth, TX 76107, U.S.A.. Contact: Office: (+1-817) 735 2421. Fax: (+1-817) 735 5016. Email: ranajit.chakraborty@unthsc.

  1. Stones on a forgotten double-j stent: a case report of multiple stones ...

    African Journals Online (AJOL)

    Stones on a forgotten double-j stent: a case report of multiple stones casting a multi-fractured ureteral stent. Khaled Mursi, A Fayad, I Ghoneim, H El-Ghamrawy. Abstract. No Abstract. African Journal of Urology Vol. 11(3) 2005: 247-249. Full Text: EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT ...

  2. Financial Information Source, Knowledge, and Practices of College Students from Diverse Backgrounds

    Science.gov (United States)

    Mimura, Yoko; Koonce, Joan; Plunkett, Scott W.; Pleskus, Lindsey

    2015-01-01

    Using cross-sectional data, we examined the financial information sources, financial knowledge, and financial practices of young adults, many of whom are first generation college students, ethnic minorities, and immigrants or children of immigrants. Participants (n = 1,249) were undergraduate students at a large regional comprehensive university.…

  3. Cyberbullying Behaviors among Female College Students: Witnessing, Perpetration, and Victimization

    Science.gov (United States)

    Selkie, Ellen M.; Kota, Rajitha; Moreno, Megan

    2016-01-01

    Problem: Cyberbullying is common among adolescents, and emerging studies also describe this phenomenon in college students. Less is known about specific cyberbullying behaviors and roles in cyberbullying incidents experienced by college females. Methods: 249 female students from 4 colleges completed online surveys assessing involvement in 11…

  4. Kala töötlemine : [andmeid aastatest 1995-2004] / Maarja Purik

    Index Scriptorium Estoniae

    Purik, Maarja

    2005-01-01

    Ilmunud ka: Agriculture and the development of rural life : overview 2004/2005. - Tallinn, 2005, lk. 49-52. Kalatöötlemise osatähtsus toiduainetööstuses moodustas 2004. a. 11,9% ja ekspordis 24,9%. Tabelid. Diagrammid

  5. Belongingness and Suicidal Ideation in College Students

    Science.gov (United States)

    Ploskonka, Rachel A.; Servaty-Seib, Heather L.

    2015-01-01

    Objective: In this study, the relationships between 3 specific domains of belongingness (ie, family, peers, and academic institution) were examined with respect to suicidal ideation. Participants: A sample (N = 249) of undergraduate students was recruited from a large, midwestern university during the Spring 2013 semester. Methods: Multiple…

  6. Fire Safety Aspects of Polymeric Materials. Volume 3. Smoke and Toxicity (Combustion Toxicology of Polymers)

    Science.gov (United States)

    1978-01-01

    Possible Cancer Hazards.i’ Science. 195, pp 17 - 23. 1977. S K Brauman, N Fishman. A S. Broliy, and D. L Chamberlain, "Smoke Generation from the...Sidor and J. M. Peters, "Fire Fighting and Pulmon .ry Fun.tiin An Epidemiologic Study," American Review of Respiratory Diseases, 109, pp. 249-254

  7. Information Systems and Technology Sourcing Strategies and Performance of E-Retailers

    Science.gov (United States)

    Tsai, Juliana Yuh-Shun

    2012-01-01

    The e-Retail industry has grown rapidly over the last few years and is projected to continue its upward trend as consumers shift from traditional channels to online channels. In March 2010, Forrester Research forecasted that online retail sales will grow by 10% a year for the next 5 years and e-Retail sales will amount to $249 billion by 2014.…

  8. Sovereignty and Protective Zones in Space and the Appropriate Command and Control of Assets

    Science.gov (United States)

    2001-04-01

    of a past than a future. I reject that alternative. � Harold Brown The utilization of space to protect the national interests of the US is too...International Legal Aspects)“, Annals of Air and Space Law, vol. V (1980), pp.532. McDougal, Lasswell , Vlasic, Law and Public Order in Space, 1963, p.249

  9. Examining Intrinsic Thalamic Resting State Networks Using Graph Theory Analysis : Implications for mTBI detection

    Science.gov (United States)

    2012-08-01

    Lippincott, Williams and Wilkins, 2010. [14] E.R. Kandel , J.H. Schwartz, and T.M. Jessell, Principles of Neural Science, 4th ed., New York, NY, USA...Network homogeneity reveals decreased integrity of default-mode network in ADHD”, J Neuroscience Met. Vol. 169, no. 1, pp. 249-254, 2008. [25

  10. Implementeringsfaglighed- et nyt aspekt i lærerprofessionens faglighed?

    DEFF Research Database (Denmark)

    Lund, Jens Hansen; Hansen, Steen Juul; Madsen, Peter Hougaard

    2016-01-01

    -forskningens” resultater (Keiding og Qvortrup 2014:249). Fokus rettes endvidere mod de formelle fora på det suborganisatorisk niveau (Scott 2008:89). Denne del af skolens indre organisation er interessant og væsentlig af flere grunde: skolens indre organisation ser ganske forskellig ud fra skole til skole. De formelle...

  11. Iodine deficiency in pregnancy and the effects of maternal iodine supplementation on the offspring: a review

    NARCIS (Netherlands)

    Zimmermann, M.B.

    2009-01-01

    The World Health Organization (WHO) recently increased their recommended iodine intake during pregnancy from 200 to 250 µg/d and suggested that a median urinary iodine (UI) concentration of 150-249 µg/L indicates adequate iodine intake in pregnant women. Thyrotropin concentrations in blood collected

  12. GETDB: 103764 [GETDB

    Lifescience Database Archive (English)

    Full Text Available nstitute of Genetics. CyO Link to clone table - 1 726 Link to cluster table 726 1 Request - cns + pns - sg, cns - lethal - comment...1:A, comment2:49F9 - - - - Show 103764 DGRC Number 103764 L...gal sg, cns Adult GFP - Lethality lethal Also known as - Original Comments comment1:A, comment

  13. Categorizing moving objects into film genres: The effect of animacy attribution, emotional response, and the deviation from non-fiction

    NARCIS (Netherlands)

    Visch, V.T.; Tan, E.S.

    2009-01-01

    The reported study follows the footsteps of Heider, and Simmel (1944) [Heider, F., & Simmel, M. (1944). An experimental study of apparent behavior. American Journal of Psychology, 57, 243-249] and Michotte (1946/1963) [Michotte, A. (1963). The perception of causality (T.R. Miles & E. Miles, Trans.).

  14. Scrotal abnormalities and infertility in west African men: A ...

    African Journals Online (AJOL)

    Objective: To determine and compare the spectrum of scrotal abnormalities in fertile and sub-fertile west African men using scrotal US. Subjects and methods: The study examined 249 subjects over a period of 13 months. The subjects comprised 149 patients with diagnosis of male infertility, as well as 100 healthy ...

  15. Sex Differences in the Expression of Depression in Adolescents.

    Science.gov (United States)

    Baron, Pierre; Joly, Elisabeth

    1988-01-01

    Examination of 249 Quebec adolescents on the Beck Depression Inventory (BDI) revealed in 67.8 percent of the cases that depressed males show a symptomatology characterized by irritability, work inhibition, social withdrawal and sleep disturbance. Depressed females present symptoms characterized by body image distortion, weight loss, loss of…

  16. author's correction 1..1

    Indian Academy of Sciences (India)

    B Indian Academy of Sciences. Author's correction. Cullin-5 and cullin-2 play a role in the development of neuromuscular junction and the female germ line of Drosophila. Champakali Ayyub. J. Genet. 90, 239Y249. The correct figure 5A is as follows: Journal of Genetics, Vol. 90, No. 3, December 2011. 519.

  17. n kursus vir akademiese doeleindes

    African Journals Online (AJOL)

    AdvallCed level writing skills for colleges and universities ill Af,ica. Essex. Longman. Ur, Penny (1984). Teaching listening comprehension. Cambridge. Cambridge University Press. Van Parreren, Carel (1983). Primacy of receptive skills in foreign language learning. System,. 11/3, pp. 249-253. Wallace, Michael 1. (1980).

  18. The effect of heavy metals on peroxidase from Jerusalem artichoke ...

    African Journals Online (AJOL)

    STORAGESEVER

    2008-07-04

    Jul 4, 2008 ... In this study, peroxidase, a primer antioxidant enzyme, was partial purified with 2.49 fold and. 29.3% efficiency from ... concentration required for obtaining 50% of inhibition of peroxidase. The above ... Key words: Jerusalem artichoke, Helianthus tuberosus, peroxidase; enzyme, metal ions, inhibition.

  19. Moroccorp: tien miljoen woorden uit twee Marokkaans- Nederlandse ...

    African Journals Online (AJOL)

    . 463. Tabel 2: De twintig meest productieve chatters. Nickname. Aantal woorden. Manal. 160.258 koekje. 134.301. Aketoef. 108.481 lady_mamita. 85.482 kipsate. 84.435 groentebol. 78.249. KYRA. 72.585 nourdine. 71.264 meisjepraatveel.

  20. First-principle study on the effect of high Ag–2N co-doping on the ...

    Indian Academy of Sciences (India)

    acceptor co-doped ZnO, further theoretical studies are required ... atoms per unit cell. The 2 × 2 × 2 supercell of pure ZnO employed contained 32 atoms. The calculated lattice parame- ters for ZnO are a = 3.249 Å and c/a = 1.602, in good agree-.