WorldWideScience

Sample records for californium 248

  1. Accurate determination of Curium and Californium isotopic ratios by inductively coupled plasma quadrupole mass spectrometry (ICP-QMS) in 248Cm samples for transmutation studies

    Energy Technology Data Exchange (ETDEWEB)

    Gourgiotis, A.; Isnard, H.; Aubert, M.; Dupont, E.; AlMahamid, I.; Cassette, P.; Panebianco, S.; Letourneau, A.; Chartier, F.; Tian, G.; Rao, L.; Lukens, W.

    2011-02-01

    The French Atomic Energy Commission has carried out several experiments including the mini-INCA (INcineration of Actinides) project for the study of minor-actinide transmutation processes in high intensity thermal neutron fluxes, in view of proposing solutions to reduce the radiotoxicity of long-lived nuclear wastes. In this context, a Cm sample enriched in {sup 248}Cm ({approx}97 %) was irradiated in thermal neutron flux at the High Flux Reactor (HFR) of the Laue-Langevin Institute (ILL). This work describes a quadrupole ICP-MS (ICP-QMS) analytical procedure for precise and accurate isotopic composition determination of Cm before sample irradiation and of Cm and Cf after sample irradiation. The factors that affect the accuracy and reproducibility of isotopic ratio measurements by ICP-QMS, such as peak centre correction, detector dead time, mass bias, abundance sensitivity and hydrides formation, instrumental background, and memory blank were carefully evaluated and corrected. Uncertainties of the isotopic ratios, taking into account internal precision of isotope ratio measurements, peak tailing, and hydrides formations ranged from 0.3% to 1.3%. This uncertainties range is quite acceptable for the nuclear data to be used in transmutation studies.

  2. Californium-252 progress, report No. 7, April 1971

    Energy Technology Data Exchange (ETDEWEB)

    1971-12-31

    This report contains discusses of the following topics on Californium-252: First sales of californium-252; encapsulation services discussed; three new participants in market evaluation program; summer training programs to use californium; Californium-252 shipping casks available; Californium-252 questions and answers, radiotherapy; neutron radiography; natural resources exploration; nuclear safeguards; process control; dosimetry; neutron radiography; neutron shielding; and nuclear safeguards.

  3. Historical review of californium-252 discovery and development

    Science.gov (United States)

    Stoddard, D. H.

    This paper discusses the discovery and history of californium 252. This isotope may be synthesized by irradiating plutonium 239, plutonium 242, americium 243, or curium 244 with neutrons in a nuclear reactor. Various experiments and inventions involving (252)Cf conducted at the Savannah River Plant are discussed. The evolution of radiotherapy using californium 252 is reviewed.

  4. Californium-252: a remarkable versatile radioisotope

    Energy Technology Data Exchange (ETDEWEB)

    Osborne-Lee, I.W.; Alexander, C.W.

    1995-10-10

    A product of the nuclear age, Californium-252 ({sup 252}Cf) has found many applications in medicine, scientific research, industry, and nuclear science education. Californium-252 is unique as a neutron source in that it provides a highly concentrated flux and extremely reliable neutron spectrum from a very small assembly. During the past 40 years, {sup 252}Cf has been applied with great success to cancer therapy, neutron radiography of objects ranging from flowers to entire aircraft, startup sources for nuclear reactors, fission activation for quality analysis of all commercial nuclear fuel, and many other beneficial uses, some of which are now ready for further growth. Californium-252 is produced in the High Flux Isotope Reactor (HFIR) and processed in the Radiochemical Engineering Development Center (REDC), both of which are located at the Oak Ridge National Laboratory (ORNL) in Oak Ridge, Tennessee. The REDC/HFIR facility is virtually the sole supplier of {sup 252}Cf in the western world and is the major supplier worldwide. Extensive exploitation of this product was made possible through the {sup 252}Cf Market Evaluation Program, sponsored by the United States Department of Energy (DOE) [then the Atomic Energy Commission (AEC) and later the Energy Research and Development Administration (ERDA)]. This program included training series, demonstration centers, seminars, and a liberal loan policy for fabricated sources. The Market Evaluation Program was instituted, in part, to determine if large-quantity production capability was required at the Savannah River Laboratory (SRL). Because of the nature of the product and the means by which it is produced, {sup 252}Cf can be produced only in government-owned facilities. It is evident at this time that the Oak Ridge research facility can meet present and projected near-term requirements. The production, shipment, and sales history of {sup 252}Cf from ORNL is summarized herein.

  5. Production, Distribution, and Applications of Californium-252 Neutron Sources

    Energy Technology Data Exchange (ETDEWEB)

    Balo, P.A.; Knauer, J.B.; Martin, R.C.

    1999-10-03

    The radioisotope {sup 252}Cf is routinely encapsulated into compact, portable, intense neutron sources with a 2.6-year half-life. A source the size of a person's little finger can emit up to 10{sup 11} neutrons/s. Californium-252 is used commercially as a reliable, cost-effective neutron source for prompt gamma neutron activation analysis (PGNAA) of coal, cement, and minerals, as well as for detection and identification of explosives, laud mines, and unexploded military ordnance. Other uses are neutron radiography, nuclear waste assays, reactor start-up sources, calibration standards, and cancer therapy. The inherent safety of source encapsulations is demonstrated by 30 years of experience and by U.S. Bureau of Mines tests of source survivability during explosions. The production and distribution center for the U. S Department of Energy (DOE) Californium Program is the Radiochemical Engineering Development Center (REDC) at Oak Ridge National Laboratory (ORNL). DOE sells The radioisotope {sup 252}Cf is routinely encapsulated into compact, portable, intense neutron sources with a 2.6- year half-life. A source the size of a person's little finger can emit up to 10 neutrons/s. Californium-252 is used commercially as a reliable, cost-effective neutron source for prompt gamma neutron activation analysis (PGNAA) of coal, cement, and minerals, as well as for detection and identification of explosives, laud mines, and unexploded military ordnance. Other uses are neutron radiography, nuclear waste assays, reactor start-up sources, calibration standards, and cancer therapy. The inherent safety of source encapsulations is demonstrated by 30 years of experience and by U.S. Bureau of Mines tests of source survivability during explosions. The production and distribution center for the U. S Department of Energy (DOE) Californium Program is the Radiochemical Engineering Development Center (REDC) at Oak Ridge National Laboratory(ORNL). DOE sells {sup 252}Cf to commercial

  6. Unusual structure, bonding and properties in a californium borate

    Energy Technology Data Exchange (ETDEWEB)

    Polinski, Matthew J.; Garner, Edward B.; Maurice, Rémi; Planas, Nora; Stritzinger, Jared T.; Parker, T. Gannon; Cross, Justin N.; Green, Thomas D.; Alekseev, Evgeny V.; Van Cleve, Shelley M.; Depmeier, Wulf; Gagliardi, Laura; Shatruk, Michael; Knappenberger, Kenneth L.; Liu, Guokui; Skanthakumar, S.; Soderholm, Lynda; Dixon, David A.; Albrecht-Schmitt, Thomas E.

    2014-03-23

    The participation of the valence orbitals of actinides in bonding has been debated for decades. Recent experimental and computational investigations demonstrated the involvement of 6p, 6d and/or 5f orbitals in bonding. However, structural and spectroscopic data, as well as theory, indicate a decrease in covalency across the actinide series, and the evidence points to highly ionic, lanthanide-like bonding for late actinides. Here we show that chemical differentiation between californium and lanthanides can be achieved by using ligands that are both highly polarizable and substantially rearrange on complexation. A ligand that suits both of these desired properties is polyborate. We demonstrate that the 5f, 6d and 7p orbitals are all involved in bonding in a Cf(III) borate, and that large crystal-field effects are present. Synthetic, structural and spectroscopic data are complemented by quantum mechanical calculations to support these observations.

  7. 21 CFR 558.248 - Erythromycin thiocyanate.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 6 2010-04-01 2010-04-01 false Erythromycin thiocyanate. 558.248 Section 558.248... for Use in Animal Feeds § 558.248 Erythromycin thiocyanate. (a) Approvals. Type A medicated articles... considerations. The levels of antibiotic are expressed in terms of erythromycin master standard. One gram of...

  8. Biomedical neutron research at the Californium User Facility for neutron science

    Energy Technology Data Exchange (ETDEWEB)

    Martin, R.C. [Oak Ridge National Lab., TN (United States); Byrne, T.E. [Roane State Community College, Harriman, TN (United States); Miller, L.F. [Univ. of Tennessee, Knoxville, TN (United States)

    1997-04-01

    The Californium User Facility for Neutron Science has been established at Oak Ridge National Laboratory (ORNL). The Californium User Facility (CUF) is a part of the larger Californium Facility, which fabricates and stores compact {sup 252}Cf neutron sources for worldwide distribution. The CUF can provide a cost-effective option for research with {sup 252}Cf sources. Three projects at the CUF that demonstrate the versatility of {sup 252}Cf for biological and biomedical neutron-based research are described: future establishment of a {sup 252}Cf-based neutron activation analysis system, ongoing work to produce miniature high-intensity, remotely afterloaded {sup 252}Cf sources for tumor therapy, and a recent experiment that irradiated living human lung cancer cells impregnated with experimental boron compounds to test their effectiveness for boron neutron capture therapy.

  9. Dicty_cDB: CHF248 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHF248 (Link to dictyBase) - - - Contig-U16511-1 CHF248P (Link to Original site) CHF...248F 148 CHF248Z 605 CHF248P 733 - - Show CHF248 Library CH (Link to library) Clone ID CHF... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CH/CHF2-B/CHF248Q.Seq.d/ Representative seq. ID CHF...248P (Link to Original site) Representative DNA sequence >CHF248 (CHF248Q) /CSM/CH/CHF2-B/CHF2...ce (All Frames) Frame A: cq***ihfflyfffik*ni*xh*isnnii*yykkkiyflsnlrkkk--- ---nqx

  10. 7 CFR 248.9 - Nutrition education.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Nutrition education. 248.9 Section 248.9 Agriculture... Nutrition education. (a) Goals. Nutrition education shall emphasize the relationship of proper nutrition to.... (b) Requirement. The State agency shall integrate nutrition education into FMNP operations and may...

  11. 7 CFR 248.13 - FMNP income.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false FMNP income. 248.13 Section 248.13 Agriculture... FMNP income. Program income means gross income the State agency earns from grant supported activities... property. The State agency shall retain Program income earned during the agreement period and use it for...

  12. 7 CFR 946.248 - Assessment rate.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 8 2010-01-01 2010-01-01 false Assessment rate. 946.248 Section 946.248 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Marketing Agreements and Orders; Fruits, Vegetables, Nuts), DEPARTMENT OF AGRICULTURE IRISH POTATOES GROWN IN WASHINGTON Rules and Regulations Modification of...

  13. 7 CFR 248.12 - FMNP costs.

    Science.gov (United States)

    2010-01-01

    ... Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS WIC FARMERS' MARKET NUTRITION PROGRAM (FMNP) State Agency Provisions § 248.12... associated with the provision of nutrition education which meets the requirements of § 248.9 of this part. (2...

  14. Dicty_cDB: SLB248 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLB248 (Link to dictyBase) - - - Contig-U11187-1 SLB248E (Link to Original site) SLB...248F 669 SLB248Z 697 SLB248P 1366 SLB248E 1348 Show SLB248 Library SL (Link to library) Clone ID SLB...ginal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLB2-B/SLB248Q.Seq.d/ Representative seq. ID SLB...248E (Link to Original site) Representative DNA sequence >SLB248 (SLB248Q) /CSM/SL/SLB2-B/SLB...icant alignments: (bits) Value SLB248 (SLB248Q) /CSM/SL/SLB2-B/SLB248Q.Seq.d/ 2555 0.0 SHD890 (SHD890Q) /CSM

  15. Dicty_cDB: CHR248 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHR248 (Link to dictyBase) - - - Contig-U11892-1 - (Link to Original site) - - CHR...248Z 620 - - - - Show CHR248 Library CH (Link to library) Clone ID CHR248 (Link to dicty...iol.tsukuba.ac.jp/CSM/CH/CHR2-B/CHR248Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >CHR248 (CHR248Q) /CSM/CH/CHR2-B/CHR248Q.Seq.d/ XXXXXXXXXXTAAATGG...DSLSKVVNVSILQA*klvvntrllpfqhvvvnliikkfxivxgs fkapqlhryaqxvvkxalqnvqqti Translated

  16. Apparatus for the measurement of total body nitrogen using prompt neutron activation analysis with californium-252.

    Science.gov (United States)

    Mackie, A; Hannan, W J; Smith, M A; Tothill, P

    1988-01-01

    Details of clinical apparatus designed for the measurement of total body nitrogen (as an indicator of body protein), suitable for the critically ill, intensive-care patient are presented. Californium-252 radio-isotopic neutron sources are used, enabling a nitrogen measurement by prompt neutron activation analysis to be made in 40 min with a precision of +/- 3.2% for a whole body dose equivalent of 0.145 mSv. The advantages of Californium-252 over alternative neutron sources are discussed. A comparison between two irradiation/detection geometries is made, leading to an explanation of the geometry adopted for the apparatus. The choice of construction and shielding materials to reduce the count rate at the detectors and consequently to reduce the pile-up contribution to the nitrogen background is discussed. Salient features of the gamma ray spectroscopy system to reduce spectral distortion from pulse pile-up are presented.

  17. Safety Analysis Report for Packaging (SARP) of the Oak Ridge National Laboratory TRU Californium Shipping Container

    Energy Technology Data Exchange (ETDEWEB)

    Box, W.D.; Shappert, L.B.; Seagren, R.D.; Klima, B.B.; Jurgensen, M.C.; Hammond, C.R.; Watson, C.D.

    1980-01-01

    An analytical evaluation of the Oak Ridge National Laboratory TRU Californium Shipping Container was made in order to demonstrate its compliance with the regulations governing off-site shipment of packages that contain radioactive material. The evaluation encompassed five primary categories: structural integrity, thermal resistance, radiation shielding, nuclear criticality safety, and quality assurance. The results of this evaluation demonstrate that the container complies with the applicable regulations.

  18. Nuclear Data Sheets for A = 248

    Energy Technology Data Exchange (ETDEWEB)

    Martin, M.J.

    2014-11-15

    Detailed level schemes, decay schemes, and the experimental data on which they are based are presented for all nuclei with mass number A=248. The experimental reaction and decay data are evaluated; inconsistencies and discrepancies are noted; and adopted values are given for various level properties (including spin and parity, halflife, and configuration), γ properties (including energy, intensity, and multipole character) and α properties (including energy, intensity, and hindrance factor). This evaluation replaces the A=248 evaluation published by A. Akovali in Nuclear Data Sheets 87, 249 (1999)

  19. 7 CFR 248.6 - Recipient eligibility.

    Science.gov (United States)

    2010-01-01

    ... Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS WIC FARMERS' MARKET NUTRITION PROGRAM (FMNP) Recipient Eligibility § 248.6... participants such as pregnant and breastfeeding women. States may also preclude groups of low priority persons...

  20. 7 CFR 248.7 - Nondiscrimination.

    Science.gov (United States)

    2010-01-01

    ..., infants, and children are certified for participation in the WIC Program, the Department has determined... CHILD NUTRITION PROGRAMS WIC FARMERS' MARKET NUTRITION PROGRAM (FMNP) Recipient Eligibility § 248.7... the Civil Rights Act of 1964, title IX of the Education Amendments of 1972, section 504 of the...

  1. 7 CFR 248.2 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... CHILD NUTRITION PROGRAMS WIC FARMERS' MARKET NUTRITION PROGRAM (FMNP) General § 248.2 Definitions. For... section 17(m) of the Child Nutrition Act of 1966 (CNA), (42 U.S.C. 1786(m)), as amended by section 501 of... WIC Farmers' Market Nutrition Program authorized by section 17(m) of the Child Nutrition Act of 1966...

  2. 7 CFR 248.3 - Administration.

    Science.gov (United States)

    2010-01-01

    ... Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS WIC FARMERS' MARKET NUTRITION PROGRAM (FMNP) General § 248.3 Administration. (a... nutrition education in coordination with the WIC Program, coupon and market management, fiscal reporting...

  3. 7 CFR 248.11 - Financial management system.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Financial management system. 248.11 Section 248.11... § 248.11 Financial management system. (a) Disclosure of expenditures. The State agency shall maintain a financial management system which provides accurate, current and complete disclosure of the financial status...

  4. 25 CFR 248.3 - Identification of eligible users.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Identification of eligible users. 248.3 Section 248.3 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR FISH AND WILDLIFE USE OF COLUMBIA RIVER INDIAN IN-LIEU FISHING SITES § 248.3 Identification of eligible users. For the purpose of identification...

  5. 7 CFR 58.248 - Nonfat dry milk.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Nonfat dry milk. 58.248 Section 58.248 Agriculture... Products Bearing Usda Official Identification § 58.248 Nonfat dry milk. (a) Nonfat dry milk in commercial....S. Standard Grade. (b) Regular nonfat dry milk in consumer size packages which bears an official...

  6. CD248 facilitates tumor growth via its cytoplasmic domain

    Directory of Open Access Journals (Sweden)

    Janssens Tom

    2011-05-01

    Full Text Available Abstract Background Stromal fibroblasts participate in the development of a permissive environment for tumor growth, yet molecular pathways to therapeutically target fibroblasts are poorly defined. CD248, also known as endosialin or tumor endothelial marker 1 (TEM1, is a transmembrane glycoprotein expressed on activated fibroblasts. We recently showed that the cytoplasmic domain of CD248 is important in facilitating an inflammatory response in a mouse model of arthritis. Others have reported that CD248 gene inactivation in mice results in dampened tumor growth. We hypothesized that the conserved cytoplasmic domain of CD248 is important in regulating tumor growth. Methods Mice lacking the cytoplasmic domain of CD248 (CD248CyD/CyD were generated and evaluated in tumor models, comparing the findings with wild-type mice (CD248WT/WT. Results As compared to the response in CD248WT/WT mice, growth of T241 fibrosarcomas and Lewis lung carcinomas was significantly reduced in CD248CyD/CyD mice. Tumor size was similar to that seen with CD248-deficient mice. Conditioned media from CD248CyD/CyD fibroblasts were less effective at supporting T241 fibrosarcoma cell survival. In addition to our previous observation of reduced release of activated matrix metalloproteinase (MMP-9, CD248CyD/CyD fibroblasts also had impaired PDGF-BB-induced migration and expressed higher transcripts of tumor suppressor factors, transgelin (SM22α, Hes and Hey1. Conclusions The multiple pathways regulated by the cytoplasmic domain of CD248 highlight its potential as a therapeutic target to treat cancer.

  7. 47 CFR 90.248 - Wildlife and ocean buoy tracking.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 5 2010-10-01 2010-10-01 false Wildlife and ocean buoy tracking. 90.248... SERVICES PRIVATE LAND MOBILE RADIO SERVICES Non-Voice and Other Specialized Operations § 90.248 Wildlife... tracking of, and the telemetry of scientific data from, ocean buoys and animal wildlife. (b) Transmitters...

  8. 31 CFR 248.4 - Undertaking of indemnity.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Undertaking of indemnity. 248.4 Section 248.4 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) FISCAL... in the circumstances set forth below, a corporate surety authorized by the Secretary of the Treasury...

  9. 24 CFR 248.223 - Alternative State strategy.

    Science.gov (United States)

    2010-04-01

    ... Preservation Act of 1987 § 248.223 Alternative State strategy. (a) The Commissioner may approve a State strategy providing for State approval of plans of action that involve termination of low income... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Alternative State strategy. 248.223...

  10. 7 CFR 248.17 - Management evaluations and reviews.

    Science.gov (United States)

    2010-01-01

    ..., DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS WIC FARMERS' MARKET NUTRITION PROGRAM (FMNP) Monitoring..., evaluation of management, accountability, certification, nutrition education, financial management systems... 7 Agriculture 4 2010-01-01 2010-01-01 false Management evaluations and reviews. 248.17 Section 248...

  11. Application of TSH bioindicator for studying the biological efficiency of neutrons from californium-252 source

    Energy Technology Data Exchange (ETDEWEB)

    Cebulska-Wasilewska, A.; Rekas, K. [Institute of Nuclear Physics, Cracow (Poland); Kim, J.K. [Korea Atomic Energy Research Inst., Taejon (Korea, Republic of)

    1997-12-31

    The effectiveness of neutrons from a Californium-252 source in the induction of various abnormalities in the Tradescantia clone 4430 stamen hair cells (TSH-assay) was studied. The special attention was paid to check whether any enhancement in effects caused by process of boron neutron capture is visible in the cells enriched with boron ions. Two chemicals (borax and BSH) were applied to introduce boron-10 ions into cells. Inflorescence, normal or pretreated with chemicals containing boron, were irradiated in the air with neutrons from a Cf-252 source at KAERI, Taejon, Korea. To estimate the relative biological effectiveness (RBE) in the induction of gene mutations of the neutron beam under the study, Tradescantia inflorescences, without any chemical pretreatment, were irradiated with various doses of X-rays. The ranges of radiation doses used were 0-0.1 Gy in neutrons and 0-0.5 Gy in X-rays. After the time needed to complete the postirradiation repair Tradescantia cuttings were transferred to Cracow, where screening of gene and lethal; mutations, cell cycle alterations in somatic cells have been done, and dose response relationships were figured. The maximal RBE values were estimated in the range of 4.6-6.8. Alterations of RBE value were observed; from 6.8 to 7.8 in the case of plants pretreated with 240 ppm of B-10 from borax, and 4.6 to 6.1 in the case of 400 ppm of B-10 from BSH. Results showed a slight, although statistically insignificant increase in biological efficacy of radiation from the Cf-252 source in samples pretreated with boron containing chemicals. (author)

  12. Study of the shielding for spontaneous fission sources of Californium-252; Estudio de blindaje para fuentes de fision espontanea de Californio-252

    Energy Technology Data Exchange (ETDEWEB)

    Davila R, I

    1991-06-15

    A shielding study is made to attenuate, until maximum permissible levels, the neutrons radiation and photons emitted by spontaneous fission coming from a source of Californium-252. The compound package by a database (Library DLC-23) and the ANISNW code is used, in it version for personal computer. (Author)

  13. 17 CFR 248.127 - Renewal of opt out elections.

    Science.gov (United States)

    2010-04-01

    ... (CONTINUED) REGULATIONS S-P AND S-AM Regulation S-AM: Limitations on Affiliate Marketing § 248.127 Renewal of... expires, you may not make marketing solicitations to a consumer who previously opted out, unless: (i) The... stating that the notice is provided by “all of the ABC companies,” “the ABC banking, credit card...

  14. 48 CFR 52.248-1 - Value Engineering.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Value Engineering. 52.248... Value Engineering. As prescribed in 48.201, insert the following clause: Value Engineering (OCT 2010) (a) General. The Contractor is encouraged to develop, prepare, and submit value engineering change proposals...

  15. Firming up the Foundations: Reflections on Verifying the 248 ...

    African Journals Online (AJOL)

    Firming up the Foundations: Reflections on Verifying the 248 Quotations in a Historical Dict ionary, with Reference to "A Dictionary of South African English on ... In addition to this, the article looks at the necessarily systematic nature of quotation handling and the main types of considerations determining methodology (for ...

  16. 7 CFR 248.1 - General purpose and scope.

    Science.gov (United States)

    2010-01-01

    ... Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS WIC FARMERS' MARKET NUTRITION PROGRAM (FMNP) General § 248.1 General... Special Supplemental Nutrition Program for Women, Infants and Children (WIC) or are on the waiting list...

  17. 7 CFR 248.21 - Procurement and property management.

    Science.gov (United States)

    2010-01-01

    ... 248.21 Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS WIC FARMERS' MARKET NUTRITION PROGRAM (FMNP) Miscellaneous... includes, but is not limited to, disputes, claims, protests of award, source evaluation, or other matters...

  18. Cold valleys in the radioactive decay of 248−254Cf isotopes

    Indian Academy of Sciences (India)

    Geiger–Nuttal plots of log10(T1/2) vs. Q−1/2 for 48−52Ca emitting from various californium isotopes. Acknowledgement. One of the authors (KPS) would like to thank University Grants Commis- sion, Govt. of India for the financial support under project No. MRP(S)-. 352/2005(X Plan)/KLKA 002/UGC-SWRO. References.

  19. Simulation and design of an electron beam ion source charge breeder for the californium rare isotope breeder upgrade

    Directory of Open Access Journals (Sweden)

    Clayton Dickerson

    2013-02-01

    Full Text Available An electron beam ion source (EBIS will be constructed and used to charge breed ions from the californium rare isotope breeder upgrade (CARIBU for postacceleration into the Argonne tandem linear accelerator system (ATLAS. Simulations of the EBIS charge breeder performance and the related ion transport systems are reported. Propagation of the electron beam through the EBIS was verified, and the anticipated incident power density within the electron collector was identified. The full normalized acceptance of the charge breeder with a 2 A electron beam, 0.024π  mm mrad for nominal operating parameters, was determined by simulating ion injection into the EBIS. The optics of the ion transport lines were carefully optimized to achieve well-matched ion injection, to minimize emittance growth of the injected and extracted ion beams, and to enable adequate testing of the charge bred ions prior to installation in ATLAS.

  20. Extraction of Trivalent Actinides and Lanthanides from Californium Campaign Rework Solution Using TODGA-based Solvent Extraction System

    Energy Technology Data Exchange (ETDEWEB)

    Benker, Dennis [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Delmau, Laetitia Helene [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Dryman, Joshua Cory [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States)

    2017-07-01

    This report presents the studies carried out to demonstrate the possibility of quantitatively extracting trivalent actinides and lanthanides from highly acidic solutions using a neutral ligand-based solvent extraction system. These studies stemmed from the perceived advantage of such systems over cationexchange- based solvent extraction systems that require an extensive feed adjustment to make a low-acid feed. The targeted feed solutions are highly acidic aqueous phases obtained after the dissolution of curium targets during a californium (Cf) campaign. Results obtained with actual Cf campaign solutions, but highly diluted to be manageable in a glove box, are presented, followed by results of tests run in the hot cells with Cf campaign rework solutions. It was demonstrated that a solvent extraction system based on the tetraoctyl diglycolamide molecule is capable of quantitatively extracting trivalent actinides from highly acidic solutions. This system was validated using actual feeds from a Cf campaign.

  1. Beyond Californium-A Neutron Generator Alternative for Dosimetry and Instrument Calibration in the U.S.

    Science.gov (United States)

    Piper, Roman K; Mozhayev, Andrey V; Murphy, Mark K; Thompson, Alan K

    2017-09-01

    Evaluations of neutron survey instruments, area monitors, and personal dosimeters rely on reference neutron radiations, which have evolved from the heavy reliance on (α,n) sources to a shared reliance on (α,n) and the spontaneous fission neutrons of californium-252 (Cf). Capable of producing high dose equivalent rates from an almost point source geometry, the characteristics of Cf are generally more favorable when compared to the use of (α,n) and (γ,n) sources or reactor-produced reference neutron radiations. Californium-252 is typically used in two standardized configurations: unmoderated, to yield a fission energy spectrum; or with the capsule placed within a heavy-water moderating sphere to produce a softened spectrum that is generally considered more appropriate for evaluating devices used in nuclear power plant work environments. The U.S. Department of Energy Cf Loan/Lease Program, a longtime origin of affordable Cf sources for research, testing and calibration, was terminated in 2009. Since then, high-activity sources have become increasingly cost-prohibitive for laboratories that formerly benefited from that program. Neutron generators, based on the D-T and D-D fusion reactions, have become economically competitive with Cf and are recognized internationally as important calibration and test standards. Researchers from the National Institute of Standards and Technology and the Pacific Northwest National Laboratory are jointly considering the practicality and technical challenges of implementing neutron generators as calibration standards in the U.S. This article reviews the characteristics of isotope-based neutron sources, possible isotope alternatives to Cf, and the rationale behind the increasing favor of electronically generated neutron options. The evaluation of a D-T system at PNNL has revealed characteristics that must be considered in adapting generators to the task of calibration and testing where accurate determination of a dosimetric quantity is

  2. Californium-252 Brachytherapy Combined With External-Beam Radiotherapy for Cervical Cancer: Long-Term Treatment Results

    Energy Technology Data Exchange (ETDEWEB)

    Lei Xin; Qian Chengyuan; Qing Yi; Zhao Kewei; Yang Zhengzhou; Dai Nan; Zhong Zhaoyang; Tang Cheng; Li Zheng; Gu Xianqing; Zhou Qian; Feng Yan; Xiong Yanli; Shan Jinlu [Cancer Center, Research Institute of Surgery and Daping Hospital, Third Military Medical University, Chongqing (China); Wang Dong, E-mail: dongwang64@hotmail.com [Cancer Center, Research Institute of Surgery and Daping Hospital, Third Military Medical University, Chongqing (China)

    2011-12-01

    Purpose: To observe, by retrospective analysis, the curative effects and complications due to californium-252 ({sup 252}Cf) neutron intracavitary brachytherapy (ICBT) combined with external-beam radiotherapy (EBRT) in the treatment of cervical cancer. Methods and Materials: From February 1999 to December 2007, 696 patients with cervical cancer (Stages IB to IIIB) were treated with {sup 252}Cf-ICBT in combination of EBRT. Of all, 31 patients were at Stage IB, 104 at IIA, 363 at IIB, 64 at IIIA, and 134 at IIIB. Californium-252 ICBT was delivered at 7-12 Gy per insertion per week, with a total dose of 29-45 Gy to reference point A in three to five insertions. The whole pelvic cavity was treated with 8-MV X-ray external irradiation at 2 Gy per fraction, four times per week. After 16-38 Gy of external irradiation, the center of the whole pelvic field was blocked with a 4-cm-wide lead shield, with a total external irradiation dose of 44-56 Gy. The total treatment course was 5 to 6 weeks. Results: Overall survival rate at 3 and 5 years for all patients was 76.0% and 64.9%, respectively. Disease-free 3- and 5-year survival rates of patients were 71.2% and 58.4%, respectively. Late complications included vaginal contracture and adhesion, radiation proctitis, radiation cystitis, and inflammatory bowel, which accounted for 5.8%, 7.1%, 6.2%, and 4.9%, respectively. Univariate analysis results showed significant correlation of stage, age, histopathologic grade, and lymph node status with overall survival. Cox multiple regression analysis showed that the independent variables were stage, histopathologic grade, tumor size, and lymphatic metastasis in all patients. Conclusion: Results of this series suggest that the combined use of {sup 252}Cf-ICBT with EBRT is an effective method for treatment of cervical cancer.

  3. 24 CFR 248.121 - Annual authorized return and aggregate preservation rents.

    Science.gov (United States)

    2010-04-01

    ... aggregate preservation rents. 248.121 Section 248.121 Housing and Urban Development Regulations Relating to... authorized return and aggregate preservation rents. (a) Annual authorized return. For each eligible low... rents. For each eligible low income housing project appraised under § 248.111, the Commissioner shall...

  4. 9 CFR 354.248 - Scope and applicability of rules of practice.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Scope and applicability of rules of practice. 354.248 Section 354.248 Animals and Animal Products FOOD SAFETY AND INSPECTION SERVICE... Maintenance of Sanitary Conditions and Precautions Against Contamination of Products § 354.248 Scope and...

  5. 48 CFR 52.248-2 - Value Engineering-Architect-Engineer.

    Science.gov (United States)

    2010-10-01

    ...-Architect-Engineer. 52.248-2 Section 52.248-2 Federal Acquisition Regulations System FEDERAL ACQUISITION... Clauses 52.248-2 Value Engineering—Architect-Engineer. As prescribed in 48.201(f), insert the following clause: Value Engineering—Architect-Engineer (MAR 1990) (a) General. The Contractor shall (1) perform...

  6. 31 CFR 248.2 - Delegation of authority to issue substitute checks.

    Science.gov (United States)

    2010-07-01

    ... substitute checks. 248.2 Section 248.2 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) FISCAL SERVICE, DEPARTMENT OF THE TREASURY FINANCIAL MANAGEMENT SERVICE ISSUE OF SUBSTITUTES OF... Authority § 248.2 Delegation of authority to issue substitute checks. Pursuant to authority contained in...

  7. 17 CFR 248.11 - Limits on redisclosure and reuse of information.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Limits on redisclosure and reuse of information. 248.11 Section 248.11 Commodity and Securities Exchanges SECURITIES AND EXCHANGE... Safeguarding Personal Information Limits on Disclosures § 248.11 Limits on redisclosure and reuse of...

  8. 37 CFR 2.48 - Office does not issue duplicate registrations.

    Science.gov (United States)

    2010-07-01

    ... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Office does not issue duplicate registrations. 2.48 Section 2.48 Patents, Trademarks, and Copyrights UNITED STATES PATENT AND TRADEMARK OFFICE, DEPARTMENT OF COMMERCE RULES OF PRACTICE IN TRADEMARK CASES The Written Application § 2.48...

  9. Actinide production from xenon bombardments of curium-248

    Energy Technology Data Exchange (ETDEWEB)

    Welch, R.B.

    1985-01-01

    Production cross sections for many actinide nuclides formed in the reaction of /sup 129/Xe and /sup 132/Xe with /sup 248/Cm at bombarding energies slightly above the coulomb barrier were determined using radiochemical techniques to isolate these products. These results are compared with cross sections from a /sup 136/Xe + /sup 248/Cm reaction at a similar energy. When compared to the reaction with /sup 136/Xe, the maxima in the production cross section distributions from the more neutron deficient projectiles are shifted to smaller mass numbers, and the total cross section increases for the production of elements with atomic numbers greater than that of the target, and decreases for lighter elements. These results can be explained by use of a potential energy surface (PES) which illustrates the effect of the available energy on the transfer of nucleons and describes the evolution of the di-nuclear complex, an essential feature of deep-inelastic reactions (DIR), during the interaction. The other principal reaction mechanism is the quasi-elastic transfer (QE). Analysis of data from a similar set of reactions, /sup 129/Xe, /sup 132/Xe, and /sup 136/Xe with /sup 197/Au, aids in explaining the features of the Xe + Cm product distributions, which are additionally affected by the depletion of actinide product yields due to deexcitation by fission. The PES is shown to be a useful tool to predict the general features of product distributions from heavy ion reactions.

  10. Qualification tests of 248 photomultiplier tubes for XENON1T

    Energy Technology Data Exchange (ETDEWEB)

    Rauch, Ludwig [Max-Planck-Institut fuer Kernphysik, Heidelberg (Germany)

    2016-07-01

    The dark matter direct-detection experiment XENON1T employs photosensors with high detection efficiencies to obtain a low energy threshold of the detector enabling a search for small WIMP masses. In addition, the tube is designed for a low intrinsic radioactivity to minimize the background of the experiment. The expected sensitivity of the dark matter interaction cross sections to the xenon nucleon reaches 2 x 10{sup 47} cm{sup 2} with a particle with mass of 50 GeV/c{sup 2}. This talk presents the setups and test procedures of the 248 installed photomultiplier tubes (PMTs) for XENON1T in order to decide whether they fulfil the experiment's requirements. In addition, an analysis of the performance of the used PMTs is presented and the implications for a dark matter search are outlined.

  11. Long-term effects of an intracavitary treatment with californium-252 on normal tissue. [Swine, /sup 226/Ra

    Energy Technology Data Exchange (ETDEWEB)

    Sullivan, M.F.; Beamer, J.L.; Mahony, T.D.; Cross, F.T.; Lund, J.E.; Endres, G.W.R.

    1976-01-01

    About one hundred fifty swine were exposed to either radium-226 or californium-252 sources in the uterine cervix to determine an RBE for both acute and long-term effects. That value for early changes in the tissues at risk in the treatment of cervical cancer was between 6.2 and 6.8. The incidence of complications increased with time after exposure, especially among animals treated with /sup 252/Cf. Analysis of rectal injury showed that ulceration occurred frequently within a year postexposure at doses between 1600 and 2400 rad calculated at 2 cm lateral to the source midline. Fat necrosis and smooth muscle atrophy, resulting in a local rectal stricture, were delayed changes observed in some animals. The lower ureter was the site for a greater frequency of complications than the GI tract. Ureteral stricture often occurred at doses of 1200 rad from /sup 252/Cf and 7000 rad from /sup 226/Ra. Observation of delayed effects in the uterine-cervix in animals held up to 4 years postexposure indicate that the RBE for /sup 252/Cf may be increased to a value as high as 18, while repair may have even decreased it to about 5.6 in the rectum. Fifty swine are still being observed for long-term effects after doses above 800 rad from /sup 252/Cf and 5000 rad from /sup 226/Ra.

  12. 7 CFR 248.8 - Level of benefits and eligible foods.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Level of benefits and eligible foods. 248.8 Section... Benefits § 248.8 Level of benefits and eligible foods. (a) General. State agencies shall identify in the... limited to: honey, maple syrup, cider, nuts and seeds, eggs, cheese, meat and seafood. Locally grown shall...

  13. 7 CFR 248.22 - Nonprocurement debarment/suspension, drug-free workplace, and lobbying restrictions.

    Science.gov (United States)

    2010-01-01

    ... workplace, and lobbying restrictions. 248.22 Section 248.22 Agriculture Regulations of the Department of.../suspension, drug-free workplace, and lobbying restrictions. The State agency shall ensure compliance with the... lobbying (7 CFR part 3018), where applicable. ...

  14. 24 CFR 248.161 - Mandatory sale of housing in excess of the Federal cost limit.

    Science.gov (United States)

    2010-04-01

    ... to purchase the project for a sale price less than the transfer preservation value of the project... fide offer in § 248.101, except for the requirement that the sale price equal the transfer preservation... any eligible low income housing for which the transfer preservation rent determined under § 248.121...

  15. Ab initio full-potential study of mechanical properties and magnetic phase stability of californium monopnictides (CfN and CfP)

    Energy Technology Data Exchange (ETDEWEB)

    Amari, S., E-mail: siham_amari@yahoo.fr [Faculté des Sciences de la Nature et de la Vie, Université Hassiba Benbouali, Chlef, 02000 (Algeria); Bouhafs, B. [Laboratoire de Modélisation et Simulation en Sciences des Matériaux, Université Djillali Liabès de Sidi Bel-Abbés, Sidi Bel-Abbés, 22000 (Algeria)

    2016-09-15

    Based on the first-principles methods, the structural, elastic, electronic, properties and magnetic ordering of californium monopnictides CfX (X = P) have been studied using the full-potential augmented plane wave plus local orbitals (FP-L/APW + lo) method within the framework of density functional theory (DFT). The electronic exchange correlation energy is described by generalized gradient approximation GGA and GGA+U (U is the Hubbard correction). The GGA+U method is applied to the rare-earth 5f states. We have calculated the lattice parameters, bulk modulii and the first pressure derivatives of the bulk modulii. The elastic properties of the studied compounds are only investigated in the most stable calculated phase. In order to gain further information, we have calculated Young’s modulus, shear modulus, anisotropy factor and Kleinman parameter by the aid of the calculated elastic constants. The results mainly show that californium monopnictides CfX (X = P) have an antiferromagnetic spin ordering. Density of states (DOS) and charge densities for both compounds are also computed in the NaCl (B1) structure.

  16. Low-Dose-Rate Californium-252 Neutron Intracavitary Afterloading Radiotherapy Combined With Conformal Radiotherapy for Treatment of Cervical Cancer

    Energy Technology Data Exchange (ETDEWEB)

    Zhang Min [Department of Oncology, Armed Police Hospital of Hangzhou, Hangzhou, Zhejiang Province (China); Xu Hongde [Cancer Center, Armed Police Hospital of Hangzhou, Hangzhou, Zhejiang Province (China); Pan Songdan; Lin Shan; Yue Jianhua [Department of Oncology, Armed Police Hospital of Hangzhou, Hangzhou, Zhejiang Province (China); Liu Jianren, E-mail: liujianren0571@hotmail.com [Second Affiliated Hospital, School of Medicine, Zhejiang University, Hangzhou, Zhejiang Province (China)

    2012-07-01

    Purpose: To study the efficacy of low-dose-rate californium-252 ({sup 252}Cf) neutron intracavitary afterloading radiotherapy (RT) combined with external pelvic RT for treatment of cervical cancer. Methods and Materials: The records of 96 patients treated for cervical cancer from 2006 to 2010 were retrospectively reviewed. For patients with tumors {<=}4 cm in diameter, external beam radiation was performed (1.8 Gy/day, five times/week) until the dose reached 20 Gy, and then {sup 252}Cf neutron intracavitary afterloading RT (once/week) was begun, and the frequency of external beam radiation was changed to four times/week. For patients with tumors >4 cm, {sup 252}Cf RT was performed one to two times before whole-pelvis external beam radiation. The tumor-eliminating dose was determined by using the depth limit of 5 mm below the mucosa as the reference point. In all patients, the total dose of the external beam radiation ranged from 46.8 to 50 Gy. For {sup 252}Cf RT, the dose delivered to point A was 6 Gy/fraction, once per week, for a total of seven times, and the total dose was 42 Gy. Results: The mean {+-} SD patient age was 54.7 {+-} 13.7 years. Six patients had disease assessed at stage IB, 13 patients had stage IIA, 49 patients had stage IIB, 3 patients had stage IIIA, 24 patients had stage IIIB, and 1 patient had stage IVA. All patients obtained complete tumor regression (CR). The mean {+-} SD time to CR was 23.5 {+-} 3.4 days. Vaginal bleeding was fully controlled in 80 patients within 1 to 8 days. The mean {+-} SD follow-up period was 27.6 {+-} 12.7 months (range, 6-48 months). Five patients died due to recurrence or metastasis. The 3-year survival and disease-free recurrence rates were 89.6% and 87.5 %, respectively. Nine patients experienced mild radiation proctitis, and 4 patients developed radiocystitis. Conclusions: Low-dose-rate {sup 252}Cf neutron RT combined with external pelvic RT is effective for treating cervical cancer, with a low incidence of

  17. Determination of the 243,246,248Cm thermal neutron induced fission cross sections

    Science.gov (United States)

    Serot, O.; Wagemans, C.; Vermote, S.; Heyse, J.; Soldner, T.; Geltenbort, P.

    2005-11-01

    The minor actinide waste produced in nuclear power plants contains various Cm-isotopes, and transmutation scenarios require improved fission cross section data. The available thermal neutron induced fission cross section data for 243Cm, 246Cm and 248Cm are not very accurate, so new cross section measurements have been performed at the high flux reactor of the ILL in Grenoble (France) under better experimental conditions (highly enriched samples, very intense and clean neutron beam). The measurements were performed at a neutron energy of 5.38 meV, yielding fission cross section values of (1240±28)b for 243Cm, (25±47)mb for 246Cm and (685±84)mb for 248Cm. From these results, thermal fission cross section values of (572±14)b; (12±25)mb and (316±43)mb have been deduced for 243Cm, 246Cm and 248Cm, respectively.

  18. Targeting endosialin/CD248 through antibody-mediated internalization results in impaired pericyte maturation and dysfunctional tumor microvasculature.

    Science.gov (United States)

    Rybinski, Katherine; Imtiyaz, Hongxia Z; Mittica, Barrie; Drozdowski, Brian; Fulmer, James; Furuuchi, Keiji; Fernando, Shawn; Henry, Marianne; Chao, Qimin; Kline, Brad; Albone, Earl; Wustner, Jason; Lin, JianMin; Nicolaides, Nicholas C; Grasso, Luigi; Zhou, Yuhong

    2015-09-22

    Over-expression of endosialin/CD248 (herein referred to as CD248) has been associated with increased tumor microvasculature in various tissue origins which makes it an attractive anti-angiogenic target. In an effort to target CD248, we have generated a human CD248 knock-in mouse line and MORAb-004, the humanized version of the mouse anti-human CD248 antibody Fb5. Here, we report that MORAb-004 treatment significantly impacted syngeneic tumor growth and tumor metastasis in the human CD248 knock-in mice. In comparison with untreated tumors, MORAb-004 treated tumors displayed overall shortened and distorted blood vessels. Immunofluorescent staining of tumor sections revealed drastically more small and dysfunctional vessels in the treated tumors. The CD248 levels on cell surfaces of neovasculature pericytes were significantly reduced due to its internalization. This reduction of CD248 was also accompanied by reduced α-SMA expression, depolarization of pericytes and endothelium, and ultimately dysfunctional microvessels. These results suggest that MORAb-004 reduced CD248 on pericytes, impaired tumor microvasculature maturation and ultimately suppressed tumor development.

  19. 17 CFR 248.123 - Contents of opt out notice; consolidated and equivalent notices.

    Science.gov (United States)

    2010-04-01

    ... Marketing § 248.123 Contents of opt out notice; consolidated and equivalent notices. (a) Contents of opt out... ABC banking, credit card, insurance, and securities companies,” or by listing the name of each...,” “the ABC banking, credit card, insurance, and securities companies,” or by listing the name of each...

  20. 17 CFR 248.125 - Reasonable and simple methods of opting out.

    Science.gov (United States)

    2010-04-01

    ... COMMISSION (CONTINUED) REGULATIONS S-P AND S-AM Regulation S-AM: Limitations on Affiliate Marketing § 248.125... consumer that you receive from an affiliate to make a marketing solicitation to the consumer about your... electronically mailed or processed at an Internet Web site, if the consumer agrees to the electronic delivery of...

  1. Cold valleys in the radioactive decay of 248− 254Cf isotopes

    Indian Academy of Sciences (India)

    Based on the concept of cold valley in cold fission and fusion, we have investigated the cluster decay process in 248-254Cf isotopes. In addition to alpha particle minima, other deep minima occur for S, Ar and Ca clusters. It is found that inclusion of proximity potential does not change the position of minima but minima ...

  2. 12 CFR 303.248 - Truth in Lending Act-Relief from reimbursement.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 4 2010-01-01 2010-01-01 false Truth in Lending Act-Relief from reimbursement... PRACTICE FILING PROCEDURES Other Filings § 303.248 Truth in Lending Act—Relief from reimbursement. (a) Scope. This section applies to requests for relief from reimbursement pursuant to the Truth in Lending...

  3. 17 CFR 248.13 - Exception to opt out requirements for service providers and joint marketing.

    Science.gov (United States)

    2010-04-01

    ... include marketing of your own products or services or marketing of financial products or services offered... one or more financial institutions jointly offer, endorse, or sponsor a financial product or service. ... Consumer Financial Information and Safeguarding Personal Information Exceptions § 248.13 Exception to opt...

  4. PCR-RFLP to Detect Codon 248 Mutation in Exon 7 of "p53" Tumor Suppressor Gene

    Science.gov (United States)

    Ouyang, Liming; Ge, Chongtao; Wu, Haizhen; Li, Suxia; Zhang, Huizhan

    2009-01-01

    Individual genome DNA was extracted fast from oral swab and followed up with PCR specific for codon 248 of "p53" tumor suppressor gene. "Msp"I restriction mapping showed the G-C mutation in codon 248, which closely relates to cancer susceptibility. Students learn the concepts, detection techniques, and research significance of point mutations or…

  5. Changes in gene expression by 193- and 248-nm excimer laser radiation in cultured human fibroblasts.

    Science.gov (United States)

    Rimoldi, D; Flessate, D M; Samid, D

    1992-09-01

    Tissue ablation by ultraviolet excimer lasers results in exposure of viable cells to subablative doses of radiation. To understand the potential biological consequences better, we have studied changes in gene expression in cultured human skin fibroblasts exposed to either 193- or 248-nm laser light. Northern blot analyses revealed that both treatments up-regulate a common set of genes, including interstitial collagenase, tissue inhibitor of metalloprotease, metallothionein, and the proto-oncogene c-fos. Dose-response and kinetic studies of collagenase induction by 193-nm radiation showed a maximal effect with 60 J/m2 and at approximately 24 h. The induction was still persistent 96 h later. In addition to the commonly affected genes, known to be activated also by conventional UV light (254 nm) and tumor-promoting phorbol esters, other genes were found to be selectively induced by the 193-nm radiation. The heat-shock hsp70 mRNA, undetectable in controls and in cultures irradiated at 248 nm, was transiently induced 8 h after exposure to 193-nm radiation. Furthermore, a selective up-regulation of collagen type I expression was observed. The results indicate that the 193- and 248-nm radiations by excimer lasers elicit specific and different cellular responses, in addition to an overlapping pathway of gene activation common also to UV radiation by germicidal lamps. The laser-induced genes could serve as molecular markers in evaluating cell injury in situ.

  6. Californium-252 neutron intracavity brachytherapy alone for T1N0 low-lying rectal adenocarcinoma: A definitive anal sphincter-preserving radiotherapy

    Science.gov (United States)

    Xiong, Yanli; Shan, Jinlu; Liu, Jia; Zhao, Kewei; Chen, Shu; Xu, Wenjing; Zhou, Qian; Yang, Mei; Lei, Xin

    2017-01-01

    This study evaluated the 4-year results of 32 patients with T1N0 low-lying rectal adenocarcinoma treated solely with californium-252 (Cf-252) neutron intracavity brachytherapy (ICBT). Patients were solicited into the study from January 2008 to June 2011. All the patients had refused surgery or surgery was contraindicated. The patients were treated with Cf-252 neutron ICBT using a novel 3.5-cm diameter off-axis 4-channel intrarectal applicator designed by the authors. The dose reference point was defined on the mucosa surface, with a total dose of 55–62 Gy-eq/4 f (13–16 Gy-eq/f/wk). All the patients completed the radiotherapy in accordance with our protocol. The rectal lesions regressed completely, and the acute rectal toxicity was mild (≤G2). The 4-year local control, overall survival, disease-free survival, and late complication (≥G2) rates were 96.9%, 90.6%, 87.5% and 15.6%, respectively. No severe late complication (≥G3) occurred. The mean follow-up was 56.1 ± 16.0 months. At the end of last follow-up, 29 patients remained alive. The mean survival time was 82.1 ± 2.7 months. Cf-252 neutron ICBT administered as the sole treatment (without surgery) for patients with T1N0 low-lying rectal adenocarcinoma is effective with acceptable late complications. Our study and method offers a definitive anal sphincter-preserving radiotherapy for T1N0 low-lying rectal adenocarcinoma patients. PMID:28094790

  7. The dusty aftermath of SN Hunt 248: merger-burst remnant?

    Science.gov (United States)

    Mauerhan, Jon C.; Van Dyk, Schuyler D.; Johansson, Joel; Fox, Ori D.; Filippenko, Alexei V.; Graham, Melissa L.

    2018-01-01

    SN Hunt 248 was classified as a non-terminal eruption (a supernova 'impostor') from a directly identified and highly variable cool hypergiant star. The 2014 outburst achieved peak luminosity equivalent to that of the historic eruption of luminous blue variable (LBV) η Car, and exhibited a multipeaked optical light curve which rapidly faded after ∼100 d. We report ultraviolet (UV) through optical observations of SN Hunt 248 with the Hubble Space Telescope (HST) about 1 yr after the outburst, and mid-infrared observations with the Spitzer Space Telescope before the burst and in decline. The HST data reveal a source which is a factor of ∼10 dimmer in apparent brightness than the faintest available measurement of the precursor star. The UV-optical spectral energy distribution (SED) requires a strong Balmer continuum, consistent with a hot B4-B5 photosphere attenuated by grey circumstellar extinction. Substantial mid-infrared excess of the source is consistent with thermal emission from hot dust with a mass of ∼10-6-10-5 M⊙ and a geometric extent which is comparable to the expansion radius of the ejecta from the 2014 event. SED modelling indicates that the dust consists of relatively large grains ( > 0.3 μm), which could be related to the grey circumstellar extinction which we infer for the UV-optical counterpart. Revised analysis of the precursor photometry is also consistent with grey extinction by circumstellar dust, and suggests that the initial mass of the star could be twice as large as previously estimated (nearly ∼ 60 M⊙). Re-analysis of the earlier outburst data shows that the peak luminosity and outflow velocity of the eruption are consistent with a trend exhibited by stellar merger candidates, prompting speculation that SN Hunt 248 may also have stemmed from a massive stellar merger or common-envelope ejection.

  8. Fifth-harmonic production in neon and argon with picosecond 248-nm radiation

    Energy Technology Data Exchange (ETDEWEB)

    Rosman, R.; Gibson, G.; Boyer, K.; Jara, H.; S. T. Luk; McIntyre, I.A.; McPherson, A.; Solem, J.C.; Rhodes, C.K.

    1988-06-01

    The results of a study of fifth-harmonic production in neon and argon irradiated with 248-nm picosecond laser pulses are presented. Focused intensities range from 10/sup 13/ to 10/sup 15/ Wcm/sup 2/. Data for fifth-harmonic intensity as a function of both target density and focused laser intensity are presented and compared with theory. For the laser intensities and medium densities studied, estimates for the linear and nonlinear components of ..delta..k, the wave-vector mismatch between the fundamental and harmonic waves, indicate that the nonlinear component is much greater than the linear component.

  9. Damage thresholds of thin film materials and high reflectors at 248 nm

    Energy Technology Data Exchange (ETDEWEB)

    Rainer, F.; Lowdermilk, W.H.; Milam, D.; Carniglia, C.K.; Hart, T.T.; Lichtenstein, T.L.

    1982-01-01

    Twenty-ns, 248-nm KrF laser pulses were used to measure laser damage thresholds for halfwave-thick layers of 15 oxide and fluoride coating materials, and for high reflectance coatings made with 13 combinations of these materials. The damage thresholds of the reflectors and single-layer films were compared to measurements of several properties of the halfwave-thick films to determine whether measurements of these properties of single-layer films to determine whether measurements of these properties of single-layer films were useful for identifying materials for fabrication of damage resistant coatings.

  10. Actinide Production in the Reaction of Heavy Ions withCurium-248

    Energy Technology Data Exchange (ETDEWEB)

    Moody, Kenton James [Univ. of California, Berkeley, CA (United States)

    1983-07-01

    Chemical experiments were performed to examine the usefulness of heavy ion transfer reactions in producing new, neutron-rich actinide nuclides. A general quasi-elastic to deep-inelastic mechanism is proposed, and the utility of this method as opposed to other methods (e.g. complete fusion) is discussed. The relative merits of various techniques of actinide target synthesis are discussed. A description is given of a target system designed to remove the large amounts of heat generated by the passage of a heavy ion beam through matter, thereby maximizing the beam intensity which can be safely used in an experiment. Also described is a general separation scheme for the actinide elements from protactinium (Z = 91) to mendelevium (Z = 101), and fast specific procedures for plutonium, americium and berkelium. The cross sections for the production of several nuclides from the bombardment of 248Cm with 18O, 86Kr and 136Xe projectiles at several energies near and below the Coulomb barrier were determined. The results are compared with yields from 48Ca and 238U bombardments of 248Cm. Simple extrapolation of the product yields into unknown regions of charge and mass indicates that the use of heavy ion transfer reactions to produce new, neutron-rich above-target species is limited. The substantial production of neutron-rich below-target species, however, indicates that with very heavy ions like 136Xe and 238U the new species 248Am, 249Am and 247Pu should be produced with large cross sections from a 248Cm target. A preliminary, unsuccessful attempt to isolate 247Pu is outlined. The failure is probably due to the half life of the decay, which is calculated to be less than 3 minutes. The absolute gamma ray intensities from 251Bk decay, necessary for calculating the 251Bk cross section, are also determined.

  11. Photodissociation dynamics of 2-nitropropane and 2-methyl-2-nitropropane at 248 and 193 nm.

    Science.gov (United States)

    Sengupta, Sumana; Indulkar, Yogesh; Kumar, Awadhesh; Dhanya, Suresh; Naik, Prakash Dattatray; Bajaj, Parma Nand

    2008-12-11

    Dynamics of formation of electronically excited NO2 and formation of OH fragment, during photo dissociation of 2-nitropropane (NP) and 2-methyl-2-nitropropane (MNP), were investigated at 193 and 248 nm. The radiative lifetime of the electronically excited NO2 fragment, observed at 193 nm, was measured to be 1.2 ( 0.1 micros and the rate coefficient of quenching of its emission by MNP was measured as (2.7 ( 0.1) x 10(-10) molecule(-1) cm3 s(-1). Formation of the ground electronic state of OH was confirmed in both molecules. State selective laser induced fluorescence technique was used to detect the nascent OH (X 2Pi, v'', J'') fragments in different ro-vibrational states, and to obtain information on energy partitioning. Though MNP and NP differ in the types of the available H atoms, the dynamics of OH formation is found to be the same in both. The relative population in different rotational states does not follow Boltzmann equilibrium distribution in both the molecules at 193 and 248 nm. The translational energies of the OH fragments, calculated from the Doppler width, are 21.2 ( 7.2 and 25.0 ( 2.5 kcal mol-1 for NP at 248 and 193 nm, respectively. The translational energies of the OH fragments, in the case of MNP, are found to be lower, 17.5 ( 4.1 and 22.0 ( 3.2 kcal mol-1,respectively, at 248 nm 193 nm. These results are compared with the earlier reports on photodissociation of nitromethane (NM), nitroethane (NE), and other nitroalkanes. All possible dissociation pathways of these molecules--NM, NE, NP, and MNPs leading to the formation of the OH fragment were investigated computationally, with geometry optimization at the B3LYP/6-311+G(d,p) level and energy calculation at the MP4(SDQ)/6-311+G (d,p) level. The results suggest that in NM, OH is formed after isomerization to CH2N(OH)O, whereas in all other cases OH is formed from HONO, a primary product of molecular elimination of nitroalkanes, formed with sufficient internal energy.

  12. The Photodissociation of CH_3OCl to CH_3O + Cl at 248 nm

    Science.gov (United States)

    Krisch, M. J.; McCunn, L. R.; Takematsu, K.; Butler, L. J.; Blase, F. R.; Shu, J.

    2004-03-01

    We investigate the 248 nm photodissociation of methyl hypochlorite (CH_3OCl), an atmospheric chlorine reservoir species. Photofragment translational spectroscopy with a crossed laser-molecular beam apparatus, coupled with tunable VUV photoionization detection, identifies the primary photodissociation channel as cleavage of the O-Cl bond to produce Cl atoms and CH_3O radicals. This result is consistent with the direct dissociation mechanism suggested by other computational and experimental studies of alkyl hypohalites. The measured recoil kinetic energy distribution of the products shows that the CH_3O product is formed with a very narrow range of internal energies. A simple model predicts from conservation of angular momentum that nearly all of the internal energy is in rotational excitation. CH_3OCl thus serves as a photolytic precursor of CH_3O radicals with high and well-defined rotational and translational energies.

  13. Tailoring of a photoactive compound for non-chemically amplified 248-nm resist formulations

    Science.gov (United States)

    Leeson, Michael J.; Pawloski, Adam R.; Levering, Vrad; Yueh, Wang; Willson, C. Grant

    1997-07-01

    Several approaches toward the design of non-chemically amplified deep UV resists have been reported using different photoactive compounds and resins. Diazo-dione chromophores are particularly attractive for this application, but the keto- ketenes derived from their photolysis are more reactive than those derived from the analogous diazonaphthoquinones. Specifically, the 30-diazo-4-ketocoumarin chromophore has been identified as a promising candidate around which to design a non-chemically amplified 248 nm resist. In order to optimize the design of this system, the influence of both electronic and steric influences on the rate of reaction of the ketene with novolac resin has been studied. These experiments were carried out using a low temperature matrix isolation FT-IR technique similar to that previously reported. The reaction of the ketene with the resin hydroxyl group follows pseudo first order kinetics and the rate constant is dependent on the substituents and the substitution pattern on the coumarin.

  14. Cross section limits for the Cm248(Mg25,4n-5n)Hs268,269 reactions

    Science.gov (United States)

    Dvorak, J.; Brüchle, W.; Düllmann, Ch. E.; Dvorakova, Z.; Eberhardt, K.; Eichler, R.; Jäger, E.; Nagame, Y.; Qin, Z.; Schädel, M.; Schausten, B.; Schimpf, E.; Schuber, R.; Semchenkov, A.; Thörle, P.; Türler, A.; Wegrzecki, M.; Yakushev, A.

    2009-03-01

    We report on an attempt to produce and detect Hs268 and Hs269 in the nuclear fusion reaction Mg25+Cm248 using the gas phase chemistry apparatus COMPACT. No decay chains attributable to the decay of hassium isotopes were observed during the course of this experiment. From the nonobservation of Hs269 we derive a cross section limit of 0.4 pb (63% confidence limit) for the reaction Cm248(Mg25,4n)Hs269 at a center-of-target beam energy of 140 MeV. The evaluated cross section limit for the Cm248(Mg25,5n)Hs268 reaction depends on the assumed half-life of unknown Hs268. Current systematics of the half-lives for even-even Hs isotopes suggests a value of 0.5 s, resulting in a cross section limit of 1.3 pb.

  15. Development, inheritance and breeding potential of a recessive genic male sterile line D248A in Sesame (Sesamum indicum L.).

    Science.gov (United States)

    Liu, Hongyan; Yang, Minmin; Wu, Kun; Zhou, Xinan; Zhao, Yingzhong

    2013-01-01

    Genic male sterility (GMS) has great potential for heterosis exploitation in sesame (Sesamum indicum L.). Two spontaneous male-sterile plants were discovered in a Chinese sesame cultivar (Zhuzhi 4) in 2006. By consecutive sib mating with fertile plants from Zhuzhi 4, a new sterile line, D248A, was developed. Anatomy studies showed that D248A has thin, small and greenish anthers on which there are no or little pollen grains. The pollens are irregularly shaped and completely aborted, resulting in no germination and no formation of pollen tubes as revealed by acetocarmine stain or semi-solid suspension culture. Furthermore, D248A has a better performance in growth vigor, bloom duration and yield per plant than the other GMS lines (i.e. 95 ms-2A and 95 ms-5A). To investigate the inheritance mode of fertility, D248A was crossed and backcrossed with six varieties, and a segregating ratio of 3:1 and 1:1 for fertile and sterile plants was observed in F2 and BC1 populations, respectively. These results suggested that D248A is controlled by a recessive GMS gene. The average yield of four D248A-derived F1 hybrids is as high as 1695 kg·ha(-1), which is almost twice of that of 95 ms-5A-derived F1 hybrids. These results indicated that this newly developed recessive GMS line has great potential in sesame hybrid breeding.

  16. Fast and stable gratings inscription in POFs made of different materials with pulsed 248 nm KrF laser

    DEFF Research Database (Denmark)

    Marques, C. A.F.; Min, R.; Leal, A.

    2018-01-01

    This paper presents fiber Bragg grating (FBG) inscription with a pulsed 248 nm UV KrF laser in polymer optical fibers (POFs) made of different polymers, namely polymethyl methacrylate (PMMA), cyclic-olefin polymer and co-polymer, and Polycarbonate. The inscribed gratings and the corresponding...... is more than 130 times. In addition, a reflectivity and a bandwidth close to or higher than the ones with the 325 nm laser were obtained. The polymer optical fiber Bragg gratings (POFBGs) inscribed with the 248 nm laser setup present high stability with small variations in their central wavelength...

  17. 24 CFR 203.438 - Mortgages on Indian land insured pursuant to section 248 of the National Housing Act.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Mortgages on Indian land insured pursuant to section 248 of the National Housing Act. 203.438 Section 203.438 Housing and Urban Development Regulations Relating to Housing and Urban Development (Continued) OFFICE OF ASSISTANT SECRETARY FOR HOUSING...

  18. Comparison of 3D surfaces produced by 248-nm and 193-nm excimer laser radiation

    Science.gov (United States)

    Toenshoff, Hans K.; Graumann, Christoph; Rinke, Marcus; Hesener, Hanno; Kulik, Christian

    1998-10-01

    Currently there is a strong demand for refractive optical elements made from glass in 21/2D and 3D-structures. Due to the characteristics of brittle materials like glass, only a limited number of manufacturing methods can be used to machine these materials with sub-micron resolution. Thus, current microstructures made out of glass are mainly manufactured by photolithography and etching process. Lithography techniques are only for economic purposes for a series production, but is not suitable for manufacturing prototypes or a small series. Micromachining done with Excimer Lasers in combination with high precision CNC- controlled handling systems offers flexible design possibilities for optical components. Due to the limitations of conventional machining techniques for brittle materials, a new laser machining system for material processing at a wavelength of 193 nm has been designed and built. The better absorption of 193 nm compared to 248 nm or larger wavelengths leads to damage free microstructuring of most glasses. Data generation for the volume to be ablated starts with the mathematical description of the surface shape of the optical component. The contour can be derived from a mathematical function or individual xyz-data point information from any CAD-program. A pre-processor calculates the CNC-data for laser triggering, xyz-table and the CNC- mask control. Each laser pulse leads to a material removal, defined by the illuminated surface on the workpiece as well as the energy density. Superposition or overlapping of pulses allows the creation of the desired surface. The surface roughness is determined by the wavelength as well as the chosen ablation strategy. To achieve best results, the process has to be carefully adjusted for a specific material. This technique is a sufficient method for structuring grooves in ceramics or glass as well as producing aspherical transparent optical surfaces or micro lens arrays. This paper shall describe the potential of 193 nm

  19. Californium-252 Program Equipment Evaluation

    Energy Technology Data Exchange (ETDEWEB)

    Chattin, Fred Rhea [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Wilson, Kenton [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Ezold, Julie G. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States)

    2017-12-01

    To successfully continue the 252Cf production and meet the needs of the customers, a comprehensive evaluation of the Building 7920 processing equipment was requested to identify equipment critical to the operational continuity of the program.

  20. 24 CFR 203.43h - Eligibility of mortgages on Indian land insured pursuant to section 248 of the National Housing Act.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Eligibility of mortgages on Indian land insured pursuant to section 248 of the National Housing Act. 203.43h Section 203.43h Housing and... mortgages on Indian land insured pursuant to section 248 of the National Housing Act. A mortgage covering a...

  1. Multiwavelength behaviour of the blazar OJ 248 from radio to γ-rays

    Science.gov (United States)

    Carnerero, M. I.; Raiteri, C. M.; Villata, M.; Acosta-Pulido, J. A.; D'Ammando, F.; Smith, P. S.; Larionov, V. M.; Agudo, I.; Arévalo, M. J.; Arkharov, A. A.; Bach, U.; Bachev, R.; Benítez, E.; Blinov, D. A.; Bozhilov, V.; Buemi, C. S.; Bueno Bueno, A.; Carosati, D.; Casadio, C.; Chen, W. P.; Damljanovic, G.; di Paola, A.; Efimova, N. V.; Ehgamberdiev, Sh. A.; Giroletti, M.; Gómez, J. L.; González-Morales, P. A.; Grinon-Marin, A. B.; Grishina, T. S.; Gurwell, M. A.; Hiriart, D.; Hsiao, H. Y.; Ibryamov, S.; Jorstad, S. G.; Joshi, M.; Kopatskaya, E. N.; Kurtanidze, O. M.; Kurtanidze, S. O.; Lähteenmäki, A.; Larionova, E. G.; Larionova, L. V.; Lázaro, C.; Leto, P.; Lin, C. S.; Lin, H. C.; Manilla-Robles, A. I.; Marscher, A. P.; McHardy, I. M.; Metodieva, Y.; Mirzaqulov, D. O.; Mokrushina, A. A.; Molina, S. N.; Morozova, D. A.; Nikolashvili, M. G.; Orienti, M.; Ovcharov, E.; Panwar, N.; Pastor Yabar, A.; Puerto Giménez, I.; Ramakrishnan, V.; Richter, G. M.; Rossini, M.; Sigua, L. A.; Strigachev, A.; Taylor, B.; Tornikoski, M.; Trigilio, C.; Troitskaya, Yu. V.; Troitsky, I. S.; Umana, G.; Valcheva, A.; Velasco, S.; Vince, O.; Wehrle, A. E.; Wiesemeyer, H.

    2015-07-01

    We present an analysis of the multiwavelength behaviour of the blazar OJ 248 at z = 0.939 in the period 2006-2013. We use low-energy data (optical, near-infrared, and radio) obtained by 21 observatories participating in the Gamma-Ray Large Area Space Telescope (GLAST)-AGILE Support Program of the Whole Earth Blazar Telescope, as well as data from the Swift (optical-UV and X-rays) and Fermi (γ-rays) satellites, to study flux and spectral variability and correlations among emissions in different bands. We take into account the effect of absorption by the Damped Lyman α intervening system at z = 0.525. Two major outbursts were observed in 2006-2007 and in 2012-2013 at optical and near-IR wavelengths, while in the high-frequency radio light curves prominent radio outbursts are visible peaking at the end of 2010 and beginning of 2013, revealing a complex radio-optical correlation. Cross-correlation analysis suggests a delay of the optical variations after the γ-ray ones of about a month, which is a peculiar behaviour in blazars. We also analyse optical polarimetric and spectroscopic data. The average polarization percentage P is less than 3 per cent, but it reaches ˜19 per cent during the early stage of the 2012-2013 outburst. A vague correlation of P with brightness is observed. There is no preferred electric vector polarization angle and during the outburst the linear polarization vector shows wide rotations in both directions, suggesting a complex behaviour/structure of the jet and possible turbulence. The analysis of 140 optical spectra acquired at the Steward Observatory reveals a strong Mg II broad emission line with an essentially stable flux of 6.2 × 10- 15 erg cm- 2 s- 1 and a full width at half-maximum of 2053 km s- 1.

  2. X-RAY EMISSION FROM STELLAR JETS BY COLLISION AGAINST HIGH-DENSITY MOLECULAR CLOUDS: AN APPLICATION TO HH 248

    Energy Technology Data Exchange (ETDEWEB)

    López-Santiago, J.; Ustamujic, S.; Castro, A. I. Gómez de [S. D. Astronomía y Geodesia, Facultad de Ciencias Matemáticas, Universidad Complutense de Madrid, E-28040 Madrid (Spain); Bonito, R.; Orlando, S. [Dipartimento di Fisica e Chimica, Università di Palermo, Piazza del Parlamento 1, I-90134 Palermo (Italy); Orellana, M. [Sede Andina de la Universidad Nacional de Río Negro (Argentina); Miceli, M. [INAF-Osservatorio Astronomico di Palermo, Piazza del Parlamento 1, I-90134 Palermo (Italy); Albacete-Colombo, J. F. [Sede Atlántica de la Universidad Nacional de Río Negro, Don Bosco y Leloir s/n, 8500 Viedma RN (Argentina); Castro, E. de [Dpto. de Astrofísica y CC. de la Atmósfera, Facultad de Física, Universidad Complutense de Madrid, E-28040 Madrid (Spain)

    2015-06-10

    We investigate the plausibility of detecting X-ray emission from a stellar jet that impacts a dense molecular cloud, a scenario that may be typical for classical T Tauri stars with jets in dense star-forming complexes. We first model the impact of a jet against a dense cloud using two-dimensional axisymmetric hydrodynamic simulations, exploring different configurations of the ambient environment. Then, we compare our results with XMM-Newton observations of the Herbig–Haro object HH 248, where extended X-ray emission aligned with the optical knots is detected at the edge of the nearby IC 434 cloud. Our simulations show that a jet can produce plasma with temperatures up to 10{sup 7} K, consistent with production of X-ray emission, after impacting a dense cloud. We find that jets denser than the ambient medium but less dense than the cloud produce detectable X-ray emission only at impact with the cloud. From an exploration of the model parameter space, we constrain the physical conditions (jet density and velocity and cloud density) that reproduce the intrinsic luminosity and emission measure of the X-ray source possibly associated with HH 248 well. Thus, we suggest that the extended X-ray source close to HH 248 corresponds to a jet impacting a dense cloud.

  3. Hot Spot Mutation in TP53 (R248Q Causes Oncogenic Gain-of-Function Phenotypes in a Breast Cancer Cell Line Derived from an African American patient

    Directory of Open Access Journals (Sweden)

    Nataly Shtraizent

    2015-12-01

    Full Text Available African American (AA breast cancer patients often have triple negative breast cancer (TNBC that contains mutations in the TP53 gene. The point mutations at amino acid residues R273 and R248 both result in oncogenic gain-of-function (GOF phenotypes. Expression of mutant p53 (mtp53 R273H associates with increased cell elasticity, survival under serum deprivation conditions, and increased Poly (ADP ribose polymerase 1 (PARP1 on the chromatin in the AA-derived TNBC breast cancer cell line MDA-MB-468. We hypothesized that GOF mtp53 R248Q expression could stimulate a similar phenotype in the AA-derived TNBC cell line HCC70. To test this hypothesis we depleted the R248Q protein in the HCC70 cell line using shRNA-mediated knockdown. Using impedance-based real-time analysis we correlated the expression of mtp53 R248Q with increased cell deformability. We also documented that depletion of mtp53 R248Q increased PARP1 in the cytoplasm and decreased PARP1 on the chromatin. We conclude that in the AA-derived TNBC HCC70 cells mtp53 R248Q expression results in a causative tumor associated phenotype. This study supports using the biological markers of high expression of mtp53 R273H or R248Q as additional diagnostics for TNBC resistant subtypes often found in the AA community. Each mtp53 protein must be considered separately and this work adds R248Q to the increasing list of p53 mutations that can be used for diagnostics and drug targeting. Here we report that when R248Q mtp53 proteins are expressed in TNBC, then targeting the gain-of-function pathways may improve treatment efficacy.

  4. Acetone photolysis at 248 nm revisited: pressure dependence of the CO and CO2 quantum yields.

    Science.gov (United States)

    Somnitz, H; Ufer, T; Zellner, R

    2009-10-14

    Pressure dependent CO and CO2 quantum yields in the laser pulse photolysis of acetone at 248 nm and T = 298 K have been measured directly using quantitative infrared diode laser absorption. The experiments cover the pressure range from 50 to 900 mbar. It is found that the quantum yields show a significant dependence on total pressure, with Phi(CO) decreasing from around 0.5 at 20 mbar to approximately 0.3 at 900 mbar. The corresponding CO2 yields as observed when O2 exists in the reaction mixture, exhibit exactly the opposite behaviour. For the sum of both a value of 1.05(-0.05)(+0.02) independent of pressure is obtained, showing that the sum of (Phi(CO) + Phi(CO2)) is a measure for the primary quantum yield in the photolysis of acetone. In addition, CO quantum yields and corresponding pressure dependences were measured in experiments using different bath gases including He, Ar, Kr, SF6, and O2 as third body colliders. The theoretical framework in which we discuss these data is based on our previous findings that the pressure dependence of the CO yield is a consequence of a stepwise fragmentation mechanism during which acetone decomposes initially into methyl and a vibrationally 'hot' acetyl radical, with the latter being able to decompose promptly into methyl plus CO. The pressure dependence of the CO yield then originates from the second step and is modelled quantitatively via statistical dynamical calculations using a combination of RRKM theory with a time-dependent master equation (ME) approach. From a comparison of experiment with theory the amount of excess energy in the vibrationally hot acetyl radicals (E* approximately 65 kJ mol(-1)) as well as the characteristic collision parameters for interaction of acetyl with the different bath gases were derived. Values of 90, 280, 310, 545, 550 and 1800 cm(-1) for the average energy transferred per downward collision for the bath gases He, Ar, Kr, O2, N2, and SF6, respectively, are obtained. The calculations also

  5. A Compact Group of Galaxies at z = 2.48 Hosting an AGN-driven Outflow

    Science.gov (United States)

    Shih, Hsin-Yi; Stockton, Alan

    2015-12-01

    We present observations of a remarkable compact group of galaxies at z = 2.48. Four galaxies, all within 40 kpc of each other, surround a powerful high-redshift radio source. This group comprises two compact red passive galaxies and a pair of merging galaxies. One of the red galaxies, with an apparent stellar mass of 3.6 × 1011M⊙ and an effective radius of 470 pc, is one of the most extreme examples of a massive quiescent compact galaxy found so far. One of the pair of merging galaxies hosts the active galactic nucleus (AGN) producing the large powerful radio structure. The merger is massive and enriched, consistent with the mass-metallicity relation expected at this redshift. Close to the merging nuclei, the emission lines exhibit broad and asymmetric profiles that suggest outflows powered either by a very young expanding radio jet or by AGN radiation. At ≳50 kpc from the system, we found a fainter extended-emission region that may be a part of a radio-jet-driven outflow. Some of the data presented herein were obtained at the W. M. Keck Observatory, which is operated as a scientific partnership among the California Institute of Technology, the University of California, and the National Aeronautics and Space Administration. The Observatory was made possible by the generous financial support of the W. M. Keck Foundation. The work is also based, in part, on data collected at the Subaru Telescope, which is operated by the National Astronomical Observatory of Japan, and on observations obtained at the Gemini Observatory, which is operated by the Association of Universities for Research in Astronomy, Inc., under a cooperative agreement with the NSF on behalf of the Gemini partnership: the National Science Foundation (United States), the National Research Council (Canada), CONICYT (Chile), the Australian Research Council (Australia), Ministério da Ciência, Tecnologia e Inovação (Brazil), and Ministerio de Ciencia, Tecnología e Innovación Productiva (Argentina).

  6. Manganese determination om minerals by activation analysis, using the californium-252 as a neutron source; Determinacao de manganes em minerios, por analise por ativacao, usando californio-252 como fonte de neutrons

    Energy Technology Data Exchange (ETDEWEB)

    Cardoso, Antonio

    1976-07-01

    Neutron Activation Analysis, using a Californium-252 neutron source, has been applied for the determination of manganese in ores such as pyrolusite, rodonite (manganese silicate)' and blending used in dry-batteries The favorable nuclear properties of manganese, such as high thermal neutron cross-section for the reaction {sup 55}Mn (n.gamma){sup 56} Mn, high concentration of manganese in the matrix and short half - life of {sup 56}Mn, are an ideal combination for non-destructive analysis of manganese in ores. Samples and standards of manganese dioxide were irradiated for about 20 minutes, followed by a 4 to 15 minutes decay and counted in a single channel pulse-height discrimination using a NaI(Tl) scintillation detector. Counting time was equal to 10 minutes. The interference of nuclear reactions {sup 56}Fe(n,p){sup 56}Mn and {sup 59} Co (n, {alpha}){sup 56} were studied, as well as problems in connection with neutron shadowing during irradiation, gamma-rays attenuation during counting and influence of granulometry of samples. One sample,was also analysed by wet-chemical method (sodium bismuthate) in order to compare results. As a whole, i t was shown that the analytical method of neutron activation for manganese in ores and blending, is a method simple, rapid and with good precision and accuracy. (author)

  7. Design of a homogeneous subcritical nuclear reactor based on thorium with a source of californium 252; Diseno de un reactor nuclear subcritico homogeneo a base de Torio con una fuente de Californio 252

    Energy Technology Data Exchange (ETDEWEB)

    Delgado H, C. E.; Vega C, H. R. [Universidad Autonoma de Zacatecas, Unidad Academica de Estudios Nucleares, Cipres No. 10, Fracc. La Penuela, 98068 Zacatecas, Zac. (Mexico); Sajo B, L., E-mail: ce_delgado89@hotmail.com [Universidad Simon Bolivar, Laboratorio de Fisica Nuclear, Apdo. 89000, 1080A Caracas (Venezuela, Bolivarian Republic of)

    2015-10-15

    Full text: One of the energy alternatives to fossil fuels which do not produce greenhouse gases is the nuclear energy. One of the drawbacks of this alternative is the generation of radioactive wastes of long half-life and its relation to the generation of nuclear materials to produce weapons of mass destruction. An option to these drawbacks of nuclear energy is to use Thorium as part of the nuclear fuel which it becomes in U{sup 233} when capturing neutrons, that is a fissile material. In this paper Monte Carlo methods were used to design a homogeneous subcritical reactor based on thorium. As neutron reflector graphite was used. The reactor core is homogeneous and is formed of 70% light water as moderator, 12% of enriched uranium UO{sub 2}(NO{sub 3}){sub 4} and 18% of thorium Th(NO{sub 3}){sub 4} as fuel. To start the nuclear fission chain reaction an isotopic source of californium 252 was used with an intensity of 4.6 x 10{sup 7} s{sup -1}. In the design the value of the effective multiplication factor, whose value turned out k{sub eff} <1 was calculated. Also, the neutron spectra at different distances from the source and the total fluence were calculated, as well as the values of the ambient dose equivalent in the periphery of the reactor. (Author)

  8. 248-NM Laser Photolysis of CHBr3/O-Atom Mixtures: Kinetic Evidence for UV CO(A)-Chemiluminescence in the Reaction of Methylidyne Radicals With Atomic Oxygen

    National Research Council Canada - National Science Library

    Vaghjiani, Ghanshyam L

    2005-01-01

    4TH Positive and Cameron band emissions from electronically excited CO have been observed for the first time in 248-nm pulsed laser photolysis of a trace amount of CHBr3 vapor in an excess of O-atoms...

  9. Phosphorylation of serine 248 of C/EBPα is dispensable for myelopoiesis but its disruption leads to a low penetrant myeloid disorder with long latency.

    Directory of Open Access Journals (Sweden)

    Marie S Hasemann

    Full Text Available BACKGROUND: Transcription factors play a key role in lineage commitment and differentiation of stem cells into distinct mature cells. In hematopoiesis, they regulate lineage-specific gene expression in a stage-specific manner through various physical and functional interactions with regulatory proteins that are simultanously recruited and activated to ensure timely gene expression. The transcription factor CCAAT/enhancer binding protein α (C/EBPα is such a factor and is essential for the development of granulocytic/monocytic cells. The activity of C/EBPα is regulated on several levels including gene expression, alternative translation, protein interactions and posttranslational modifications, such as phosphorylation. In particular, the phosphorylation of serine 248 of the transactivation domain has been shown to be of crucial importance for granulocytic differentiation of 32Dcl3 cells in vitro. METHODOLOGY/PRINCIPAL FINDINGS: Here, we use mouse genetics to investigate the significance of C/EBPα serine 248 in vivo through the construction and analysis of Cebpa(S248A/S248A knock-in mice. Surprisingly, 8-week old Cebpa(S248A/S248A mice display normal steady-state hematopoiesis including unaltered development of mature myeloid cells. However, over time some of the animals develop a hematopoietic disorder with accumulation of multipotent, megakaryocytic and erythroid progenitor cells and a mild impairment of differentiation along the granulocytic-monocytic lineage. Furthermore, BM cells from Cebpa(S248A/S248A animals display a competitive advantage compared to wild type cells in a transplantation assay. CONCLUSIONS/SIGNIFICANCE: Taken together, our data shows that the substitution of C/EBPα serine 248 to alanine favors the selection of the megakaryocytic/erythroid lineage over the monocytic/granulocytic compartment in old mice and suggests that S248 phosphorylation may be required to maintain proper hematopoietic homeostasis in response to

  10. The African Swine Fever Virus Virion Membrane Protein pE248R Is Required for Virus Infectivity and an Early Postentry Event ▿

    Science.gov (United States)

    Rodríguez, Irene; Nogal, María L.; Redrejo-Rodríguez, Modesto; Bustos, María J.; Salas, María L.

    2009-01-01

    The African swine fever virus (ASFV) protein pE248R, encoded by the gene E248R, is a late structural component of the virus particle. The protein contains intramolecular disulfide bonds and has been previously identified as a substrate of the ASFV-encoded redox system. Its amino acid sequence contains a putative myristoylation site and a hydrophobic transmembrane region near its carboxy terminus. We show here that the protein pE248R is myristoylated during infection and associates with the membrane fraction in infected cells, behaving as an integral membrane protein. Furthermore, the protein localizes at the inner envelope of the virus particles in the cytoplasmic factories. The function of the protein pE248R in ASFV replication was investigated by using a recombinant virus that inducibly expresses the gene E248R. Under repressive conditions, the ASFV polyproteins pp220 and pp62 are normally processed and virus particles with morphology indistinguishable from that of those produced in a wild-type infection or under permissive conditions are generated. Moreover, the mutant virus particles can exit the cell as does the parental virus. However, the infectivity of the pE248R-deficient virions was reduced at least 100-fold. An investigation of the defect of the mutant virus indicated that neither virus binding nor internalization was affected by the absence of the protein pE248R, but a cytopathic effect was not induced and early and late gene expression was impaired, indicating that the protein is required for some early postentry event. PMID:19793823

  11. The African swine fever virus virion membrane protein pE248R is required for virus infectivity and an early postentry event.

    Science.gov (United States)

    Rodríguez, Irene; Nogal, María L; Redrejo-Rodríguez, Modesto; Bustos, María J; Salas, María L

    2009-12-01

    The African swine fever virus (ASFV) protein pE248R, encoded by the gene E248R, is a late structural component of the virus particle. The protein contains intramolecular disulfide bonds and has been previously identified as a substrate of the ASFV-encoded redox system. Its amino acid sequence contains a putative myristoylation site and a hydrophobic transmembrane region near its carboxy terminus. We show here that the protein pE248R is myristoylated during infection and associates with the membrane fraction in infected cells, behaving as an integral membrane protein. Furthermore, the protein localizes at the inner envelope of the virus particles in the cytoplasmic factories. The function of the protein pE248R in ASFV replication was investigated by using a recombinant virus that inducibly expresses the gene E248R. Under repressive conditions, the ASFV polyproteins pp220 and pp62 are normally processed and virus particles with morphology indistinguishable from that of those produced in a wild-type infection or under permissive conditions are generated. Moreover, the mutant virus particles can exit the cell as does the parental virus. However, the infectivity of the pE248R-deficient virions was reduced at least 100-fold. An investigation of the defect of the mutant virus indicated that neither virus binding nor internalization was affected by the absence of the protein pE248R, but a cytopathic effect was not induced and early and late gene expression was impaired, indicating that the protein is required for some early postentry event.

  12. A Peptide Derived from the HIV-1 gp120 Coreceptor-Binding Region Promotes Formation of PAP248-286 Amyloid Fibrils to Enhance HIV-1 Infection.

    Directory of Open Access Journals (Sweden)

    Jinquan Chen

    Full Text Available Semen is a major vehicle for HIV transmission. Prostatic acid phosphatase (PAP fragments, such as PAP248-286, in human semen can form amyloid fibrils to enhance HIV infection. Other endogenous or exogenous factors present during sexual intercourse have also been reported to promote the formation of seminal amyloid fibrils.Here, we demonstrated that a synthetic 15-residue peptide derived from the HIV-1 gp120 coreceptor-binding region, designated enhancing peptide 2 (EP2, can rapidly self-assemble into nanofibers. These EP2-derivated nanofibers promptly accelerated the formation of semen amyloid fibrils by PAP248-286, as shown by Thioflavin T (ThT and Congo red assays. The amyloid fibrils presented similar morphology, assessed via transmission electron microscopy (TEM, in the presence or absence of EP2. Circular dichroism (CD spectroscopy revealed that EP2 accelerates PAP248-286 amyloid fibril formation by promoting the structural transition of PAP248-286 from a random coil into a cross-β-sheet. Newly formed semen amyloid fibrils effectively enhanced HIV-1 infection in TZM-bl cells and U87 cells by promoting the binding of HIV-1 virions to target cells.Nanofibers composed of EP2 promote the formation of PAP248-286 amyloid fibrils and enhance HIV-1 infection.

  13. Probing the MSP Prenatal Stage: The Optical Identification of the X-Ray Burster EXO 1745-248 in Terzan 5

    NARCIS (Netherlands)

    Ferraro, F. R.; Pallanca, C.; Lanzoni, B.; Cadelano, M.; Massari, D.; Dalessandro, E.; Mucciarelli, A.

    We report on the optical identification of the neutron star burster EXO 1745-248 in Terzan 5. The identification was performed by exploiting Hubble Space Telescope/Advanced Camera for Surveys images acquired in Director's Discretionary Time shortly after (approximately one month) the Swift detection

  14. High throughput virtual screening and in silico ADMET analysis for rapid and efficient identification of potential PAP248-286 aggregation inhibitors as anti-HIV agents

    Science.gov (United States)

    Malik, Ruchi; Bunkar, Devendra; Choudhary, Bhanwar Singh; Srivastava, Shubham; Mehta, Pakhuri; Sharma, Manish

    2016-10-01

    Human semen is principal vehicle for transmission of HIV-1 and other enveloped viruses. Several endogenous peptides present in semen, including a 39-amino acid fragments of prostatic acid phosphatase (PAP248-286) assemble into amyloid fibrils named as semen-derived enhancer of viral infection (SEVI) that promote virion attachment to target cells which dramatically enhance HIV virus infection by up to 105-fold. Epigallocatechin-3-gallate (EGCG), a polyphenolic compound, is the major catechin found in green tea which disaggregates existing SEVI fibers, and inhibits the formation of SEVI fibers. The aim of this study was to screen a number of relevant polyphenols to develop a rational approach for designing PAP248-286 aggregation inhibitors as potential anti-HIV agents. The molecular docking based virtual screening results showed that polyphenolic compounds 2-6 possessed good docking score and interacted well with the active site residues of PAP248-286. Amino acid residues of binding site namely; Lys255, Ser256, Leu258 and Asn265 are involved in binding of these compounds. In silico ADMET prediction studies on these hits were also found to be promising. Polyphenolic compounds 2-6 identified as hits may act as novel leads for inhibiting aggregation of PAP248-286 into SEVI.

  15. Incidence of fibroblast growth factor receptor 3 gene (FGFR3) A248C, S249C, G372C, and T375C mutations in bladder cancer.

    Science.gov (United States)

    Dodurga, Y; Tataroglu, C; Kesen, Z; Satiroglu-Tufan, N L

    2011-01-18

    Bladder cancer is the most frequent cancer of the urinary system. Fibroblast growth factor receptors (FGFR) belong to the tyrosine kinase family and have important roles in cell differentiation and proliferation and embryogenesis. FGFR3 is located on chromosome 4p16.3, and missense mutations of FGFR3 are associated with autosomal dominant human skeletal disorders and have some oncogenic effects. We examined the incidence of FGFR3 thanatophoric dysplasia mutations located in exon 7, A248C and S249C, and in exon 10, G372C and T375C, and their correlation with clinical-pathological parameters in bladder carcinoma patients. Fifty-six paraffin-embedded specimens of transitional cell carcinoma of the urinary bladder were included in this study. Analysis of FGFR3 thanatophoric dysplasia mutations located in exon 7, A248C and S249C, and in exon 10, G372C and T375C, was performed by PCR-restriction fragment length polymorphism (RFLP) analysis and DNA sequencing. FGFR3 thanatophoric dysplasia mutations located in exon 7, A248C and S249C, and in exon 10, G372C and T375C, were detected in 33 of the 56 patients (heterozygous mutant). Among the 56 transitional cell carcinomas, missense point mutations were detected in seven of them at codon A248C, 28 of them at codon S249C, and three of them at codon T375C, similar to data from previous reports. When the results of the FGFR3 thanatophoric dysplasia mutations located in exon 7, A248C and S249C and in exon 10, G372C and T375C, were analyzed one by one or as a group, despite the findings of previous research reports, our data suggest that these mutations are detected homogenously regardless of the tumor classification and tumor grade.

  16. Bacterial curli protein promotes the conversion of PAP248-286 into the amyloid SEVI: cross-seeding of dissimilar amyloid sequences

    Directory of Open Access Journals (Sweden)

    Kevin Hartman

    2013-02-01

    Full Text Available Fragments of prostatic acid phosphatase (PAP248-286 in human semen dramatically increase HIV infection efficiency by increasing virus adhesion to target cells. PAP248-286 only enhances HIV infection in the form of amyloid aggregates termed SEVI (Semen Enhancer of Viral Infection, however monomeric PAP248-286 aggregates very slowly in isolation. It has therefore been suggested that SEVI fiber formation in vivo may be promoted by exogenous factors. We show here that a bacterially-produced extracellular amyloid (curli or Csg acts as a catalytic agent for SEVI formation from PAP248-286 at low concentrations in vitro, producing fibers that retain the ability to enhance HIV (Human Immunodeficiency Virus infection. Kinetic analysis of the cross-seeding effect shows an unusual pattern. Cross-seeding PAP248-286 with curli only moderately affects the nucleation rate while significantly enhancing the growth of fibers from existing nuclei. This pattern is in contrast to most previous observations of cross-seeding, which show cross-seeding partially bypasses the nucleation step but has little effect on fiber elongation. Seeding other amyloidogenic proteins (IAPP (islet amyloid polypeptide and Aβ1−40 with curli showed varied results. Curli cross-seeding decreased the lag-time of IAPP amyloid formation but strongly inhibited IAPP elongation. Curli cross-seeding exerted a complicated concentration dependent effect on Aβ1−40 fibrillogenesis kinetics. Combined, these results suggest that the interaction of amyloidogenic proteins with preformed fibers of a different type can take a variety of forms and is not limited to epitaxial nucleation between proteins of similar sequence. The ability of curli fibers to interact with proteins of dissimilar sequences suggests cross-seeding may be a more general phenomenon than previously supposed.

  17. Cervical foraminal steroid injections under CT guidance: retrospective study of in situ contrast aspects in a serial of 248 cases

    Energy Technology Data Exchange (ETDEWEB)

    Pottecher, Pierre; Krause, Denis; Di Marco, Lucy; Loffroy, Romaric; Estivalet, Louis [CHU Dijon Bocage Central, Departement de Radiologie et Imagerie Diagnostique et Interventionnelle, Dijon (France); Duhal, Romain; Demondion, Xavier [CHRU de Lille, Service de Radiologie Musculosquelettique, CCIAL, Laboratoire d' Anatomie, Faculte de Medecine de Lille, Hopital Roger Salengro, Lille (France)

    2015-01-15

    To describe all the CT findings after in situ contrast injection just before steroid injection and to recognize the abnormal aspects associated with intravascular contamination. We retrospectively evaluated 248 cervical transforaminal steroid injections done at the university hospital in Dijon, France, in 2008-2012, to treat cervicobrachial neuralgia inadequately improved by optimal medical treatment for at least 3 weeks. Features describing the opacification patterns were recorded. Five main nonvascular opacification patterns were identified: clumps of contrast agent outside the foramen (16 %), a crab claw pattern surrounding the ganglion (13 %), a ''French'' circumflex accent pattern (15 %), reflux along the needle (7 %), and facet joint capsule opacification (22 %). Concerning the situations requiring a change in needle position, intravenous injection occurred in 26 % of the patients, with a crab claw pattern in half the cases and a clump pattern in half the cases. Intraarteriolar injection was noted in two patients. CT after in situ contrast injection ensures proper needle positioning outside the blood vessels before steroid injection. Penetration of the needle tip into a vein is very common, whereas arteriolar puncture is extremely rare. (orig.)

  18. Set-up of an XAFS beamline for measurements between 2.4-8 keV at DORIS III

    Science.gov (United States)

    Welter, Edmund

    2010-06-01

    In this paper results from the commissioning phase and from first user experiments of a new EXAFS beamline at the DORIS III storage ring are presented. The bending magnet EXAFS beamline A1 underwent a complete rebuild and now covers the energy range 2.4-8 keV. A Ni-coated toroidal mirror, placed in a 2:1 focusing position and a plane mirror with one Ni coated stripe and one uncoated (SiO2) stripe are used for effective higher harmonics suppression and focusing. The UHV-compatible fixed-exit Double Crystal Monochromator (DCM) is equipped with two Si(111) crystal pairs. The second crystal of one of the two crystal pairs is tilted by 90° around the surface normal to shift the position of glitches. It allows Bragg angles between 5° and 55.5° and continuous scans in quick-EXAFS mode. Test measurements during the commissioning phase proved the excellent performance of the monochromator and a high quality of the XAFS spectra over the entire working range.

  19. Pages 242 - 248.pmd

    African Journals Online (AJOL)

    Administrator

    seizure disorders in Gbawein and Wroughbarh clan region of Grand Bassa County, Liberia. Neuroepidemiology 1983; 2:35-44. 6. Winkler AS, Friedrich K, Konig R, Meindl M,. Helbok R, I U, et al. The head nodding. Syndrome: clinical manifestations and possible causes. Epilepsia 2008;49(12):2008. 7. Nyungura JL, Akim T, ...

  20. Cl2O photochemistry: ultraviolet/vis absorption spectrum temperature dependence and O(3P) quantum yield at 193 and 248 nm.

    Science.gov (United States)

    Papanastasiou, Dimitrios K; Feierabend, Karl J; Burkholder, James B

    2011-05-28

    The photochemistry of Cl(2)O (dichlorine monoxide) was studied using measurements of its UV/vis absorption spectrum temperature dependence and the O((3)P) atom quantum yield, Φ(Cl(2)O)(O)(λ), in its photolysis at 193 and 248 nm. The Cl(2)O UV/vis absorption spectrum was measured over the temperature range 201-296 K between 200 and 500 nm using diode array spectroscopy. Cl(2)O absorption cross sections, σ(Cl(2)O)(λ,T), at temperatures <296 K were determined relative to its well established room temperature values. A wavelength and temperature dependent parameterization of the Cl(2)O spectrum using the sum of six Gaussian functions, which empirically represent transitions from the ground (1)A(1) electronic state to excited states, is presented. The Gaussian functions are found to correlate well with published theoretically calculated vertical excitation energies. O((3)P) quantum yields in the photolysis of Cl(2)O at 193 and 248 nm were measured using pulsed laser photolysis combined with atomic resonance fluorescence detection of O((3)P) atoms. O((3)P) quantum yields were measured to be 0.85 ± 0.15 for 193 nm photolysis at 296 K and 0.20 ± 0.03 at 248 nm, which was also found to be independent of temperature (220-352 K) and pressure (17 and 28 Torr, N(2)). The quoted uncertainties are at the 2σ (95% confidence) level and include estimated systematic errors. ClO radical temporal profiles obtained following the photolysis of Cl(2)O at 248 nm, as reported previously in Feierabend et al. [J. Phys. Chem. A 114, 12052, (2010)], were interpreted to establish a <5% upper-limit for the O + Cl(2) photodissociation channel, which indicates that O((3)P) is primarily formed in the three-body, O + 2Cl, photodissociation channel at 248 nm. The analysis also indirectly provided a Cl atom quantum yield of 1.2 ± 0.1 at 248 nm. The results from this work are compared with previous studies where possible. © 2011 American Institute of Physics

  1. Endoscopic Sleeve Gastroplasty for Obesity: a Multicenter Study of 248 Patients with 24 Months Follow-Up.

    Science.gov (United States)

    Lopez-Nava, Gontrand; Sharaiha, Reem Z; Vargas, Eric J; Bazerbachi, Fateh; Manoel, Galvao Neto; Bautista-Castaño, Inmaculada; Acosta, Andres; Topazian, Mark D; Mundi, Manpreet S; Kumta, Nikhil; Kahaleh, Michel; Herr, Andrea Marie; Shukla, Alpana; Aronne, Louis; Gostout, Christopher J; Abu Dayyeh, Barham K

    2017-10-01

    Endoscopic sleeve gastroplasty (ESG) is a technique for managing mild to moderately obese patients. We aimed to evaluate the long-term outcomes, reproducibility, and predictors of weight response in a large multicenter cohort. Patients who underwent ESG between January 2013 and December 2015 in three centers were retrospectively analyzed. All procedures were performed using the Apollo OverStitch device (Apollo Endosurgery, Austin, TX). We performed per protocol (PP) and intention-to-treat (ITT) analyses, where patients lost to follow-up were considered failures. Multivariable linear and logistic regression analyses were performed. We included 248 patients (mean age 44.5 ± 10 years, 73% female). Baseline BMI was 37.8 ± 5.6 kg/m 2 . At 6 and 24 months, 33 and 35 patients were lost to follow-up, respectively. At 6 and 24 months, %TBWL was 15.2 [95%CI 14.2-16.3] and 18.6 [15.7-21.5], respectively. Weight loss was similar between centers at both follow-up intervals. At 24 months, % of patients achieving ≥10% TBWL was 84.2 and 53% with PP and ITT analyses, respectively. On multivariable linear regression analysis, only %TBWL at 6 months strongly predicted %TBWL at 24 months (adjusted for age, gender, and baseline BMI, β = 1.21, p ESG effectively induces weight loss up to 24 months in moderately obese patients. Failure to achieve adequate weight loss can be predicted early, and patients should be offered adjunctive therapies to augment it.

  2. R248G cystic fibrosis transmembrane conductance regulator mutation in three siblings presenting with recurrent acute pancreatitis and reproductive issues: a case series.

    Science.gov (United States)

    Villalona, Seiichi; Glover-López, Guillermo; Ortega-García, Juan Antonio; Moya-Quiles, Rosa; Mondejar-López, Pedro; Martínez-Romero, Maria C; Rigabert-Montiel, Mariano; Pastor-Vivero, María D; Sánchez-Solís, Manuel

    2017-02-15

    Mutational combinations of the cystic fibrosis transmembrane conductance regulator, CFTR, gene have different phenotypic manifestations at the molecular level with varying clinical consequences for individuals possessing such mutations. Reporting cystic fibrosis transmembrane conductance regulator mutations is important in understanding the genotype-phenotype correlations and associated clinical presentations in patients with cystic fibrosis. Understanding the effects of mutations is critical in developing appropriate treatments for individuals affected with cystic fibrosis, non-classic cystic fibrosis, or cystic fibrosis transmembrane conductance regulator-related disorders. This is the first report of related individuals possessing the R248G missense cystic fibrosis transmembrane conductance regulator mutation and we present their associated clinical histories. All three patients are of Spanish descent. Deoxyribonucleic acid analysis revealed that all three siblings possessed a novel c.742A>G mutation, resulting in a p.Arg248Gly (R248G) amino acid change in exon 6 in trans with the known N1303K mutant allele. Case 1 patient is a 39-year-old infertile man presenting with congenital unilateral absence of the vas deferens and recurrent episodes of epigastric pain. Case 2 patient is a 32-year-old woman presenting with periods of infertility, two previous spontaneous abortions, recurrent epigastric pain, and recurrent pancreatitis. Case 3 patient is a 29-year-old woman presenting with recurrent pancreatitis and epigastric pain. We report the genotype-phenotype correlations and clinical manifestations of a novel R248G cystic fibrosis transmembrane conductance regulator mutation: congenital unilateral absence of the vas deferens in males, reduced female fertility, and recurrent acute pancreatitis. In addition, we discuss the possible functional consequences of the mutations at the molecular level.

  3. Heavy actinide production in the reactions of /sup 238/U+/sup 238/U and /sup 238/U+/sup 248/Cm

    CERN Document Server

    Gaggeler, H; Ferguson, R L; Hahn, R L; Herrmann, G; Hulet, E K; Kratz, J V; Lougheed, R W; Nitschke, J M; Peuser, P; Schädel, M; Stakemann, R; Sümmerer, K; Tittel, G; Trautmann, N; Wirth, G

    1981-01-01

    Experiments on the production of heavy actinides up to mendelevium from the reactions between /sup 238/U on /sup 238/U and /sup 238/U on /sup 248/Cm are summarized. The authors find that independent of the system and the bombarding energy an average of about 4 neutrons is emitted from the primary fragments implying average excitation energies of 30 to 40 MeV in the heavy fragments. An intercomparison of their data with results obtained with lighter particles like /sup 48 /Ca, /sup 84/Kr and /sup 136/Xe on /sup 238/U and /sup 248/Cm targets, respectively, shows increased formation cross sections for heavy actinides with /sup 238/U as projectile. In addition, for the /sup 238 /U+/sup 238/U reaction cross sections for americium shape isomers are determined. Deduced isomer-to-ground-state ratios are found to be lower as compared to light particle induced reactions. With a simple model estimates of production rates for very heavy elements up to z =104 have been performed for the reactions of /sup 238/U on /sup 248...

  4. Residues 248-252 and 300-304 of the cardiac Na+/Ca2+ exchanger are involved in its regulation by phospholemman.

    Science.gov (United States)

    Zhang, Xue-Qian; Wang, JuFang; Song, Jianliang; Ji, Angi M; Chan, Tung O; Cheung, Joseph Y

    2011-10-01

    Using split cardiac Na(+)/Ca(2+) exchangers (NCX1), we previously demonstrated that phospholemman (PLM) regulates NCX1 by interacting with the proximal linker domain (residues 218-358) of the intracellular loop of NCX1. With the use of overlapping loop deletion mutants, interaction sites are localized to two regions spanning residues 238-270 and residues 300-328 of NCX1. In this study, we used alanine (Ala) linker scanning to pinpoint the residues in the proximal linker domain involved in regulation of NCX1 by PLM. Transfection of human embryonic kidney (HEK)293 cells with wild-type (WT) NCX1 or its Ala mutants but not empty vector resulted in NCX1 current (I(NaCa)). Coexpression of PLM with WT NCX1 inhibited I(NaCa). Mutating residues 248-252 (PASKT) or 300-304 (QKHPD) in WT NCX1 to Ala resulted in loss of inhibition of I(NaCa) by PLM. By contrast, inhibition of I(NaCa) by PLM was preserved when residues 238-242, 243-247, 253-257, 258-262, 263-267, 305-309, 310-314, 315-319, 320-324, or 325-329 were mutated to Ala. While mutating residue 301 to alanine completely abolished PLM inhibition, mutation of any single residue 250-252, 300, or 302-304 resulted in partial reduction in inhibition. Mutating residues 248-252 to Ala resulted in significantly weaker association with PLM. The NCX1-G503P mutant that lacks Ca(2+)-dependent activation retained its sensitivity to PLM. We conclude that residues 248-252 and 300-304 in the proximal linker domain of NCX1 were involved in its inhibition by PLM.

  5. Residues 248–252 and 300–304 of the cardiac Na+/Ca2+ exchanger are involved in its regulation by phospholemman

    Science.gov (United States)

    Zhang, Xue-Qian; Wang, JuFang; Song, Jianliang; Ji, Angi M.; Chan, Tung O.

    2011-01-01

    Using split cardiac Na+/Ca2+ exchangers (NCX1), we previously demonstrated that phospholemman (PLM) regulates NCX1 by interacting with the proximal linker domain (residues 218–358) of the intracellular loop of NCX1. With the use of overlapping loop deletion mutants, interaction sites are localized to two regions spanning residues 238–270 and residues 300–328 of NCX1. In this study, we used alanine (Ala) linker scanning to pinpoint the residues in the proximal linker domain involved in regulation of NCX1 by PLM. Transfection of human embryonic kidney (HEK)293 cells with wild-type (WT) NCX1 or its Ala mutants but not empty vector resulted in NCX1 current (INaCa). Coexpression of PLM with WT NCX1 inhibited INaCa. Mutating residues 248–252 (PASKT) or 300–304 (QKHPD) in WT NCX1 to Ala resulted in loss of inhibition of INaCa by PLM. By contrast, inhibition of INaCa by PLM was preserved when residues 238–242, 243–247, 253–257, 258–262, 263–267, 305–309, 310–314, 315–319, 320–324, or 325–329 were mutated to Ala. While mutating residue 301 to alanine completely abolished PLM inhibition, mutation of any single residue 250–252, 300, or 302–304 resulted in partial reduction in inhibition. Mutating residues 248–252 to Ala resulted in significantly weaker association with PLM. The NCX1-G503P mutant that lacks Ca2+-dependent activation retained its sensitivity to PLM. We conclude that residues 248–252 and 300–304 in the proximal linker domain of NCX1 were involved in its inhibition by PLM. PMID:21734189

  6. Dispersion-compensation-free femtosecond Tm-doped all-fiber laser with a 248  MHz repetition rate.

    Science.gov (United States)

    Sun, Biao; Luo, Jiaqi; Ng, Boon Ping; Yu, Xia

    2016-09-01

    In this Letter, we report a dispersion-compensation-free ultrafast thulium-doped all-fiber laser based on nonlinear polarization evolution (NPE) mode locking, delivering 330 fs soliton pulses at 1950 nm. A multifunctional hybrid fiberized device was applied in the oscillator to minimize the physical cavity length to ∼80  cm with a total dispersion of -0.045  ps2, enabling a state-of-the-art fundamental mode-locking repetition rate of 248 MHz in an NPE-based oscillator at ∼2  μm.

  7. Coinheritance of High Oxygen Affinity Hb Helsinki [HBB: c.248A>T; β82(EF6)Lys→Met] with Hb H Disease.

    Science.gov (United States)

    Lee, Shir-Ying; Goh, Jia-Hui; Tan, Karen M L; Liu, Te-Chih

    2017-05-01

    Hb Helsinki [HBB: c.248A>T; β82(EF6)Lys→Met] is a high oxygen affinity hemoglobin (Hb) causing polycythemia, whereas Hb H (β4) disease causes mild to severe chronic hemolytic anemia. The clinical characteristics, gel electrophoresis, capillary electrophoresis (CE) and molecular genotyping of a case of Hb Helsinki coinherited with Hb H disease in an ethnic Malay is described, illustrating the interaction between the β-globin variant and coinheritance of three α gene deletions. The proband was asymptomatic, exhibited microcytosis and a normal with Hb value.

  8. Insolation data manual: long-term monthly averages of solar radiation, temperature, degree-days and global anti K/sub T/ for 248 national weather service stations

    Energy Technology Data Exchange (ETDEWEB)

    Knapp, C L; Stoffel, T L; Whitaker, S D

    1980-10-01

    Monthly averaged data is presented which describes the availability of solar radiation at 248 National Weather Service stations. Monthly and annual average daily insolation and temperature values have been computed from a base of 24 to 25 years of data. Average daily maximum, minimum, and monthly temperatures are provided for most locations in both Celsius and Fahrenheit. Heating and cooling degree-days were computed relative to a base of 18.3/sup 0/C (65/sup 0/F). For each station, global anti K/sub T/ (cloudiness index) were calculated on a monthly and annual basis. (MHR)

  9. Boundary-Layer-Transition Measurements on Hemispheres of Various Surface Roughness in a Wind Tunnel at Mach Numbers from 2.48 to 3.55

    Science.gov (United States)

    Bandettini, Angelo; Isler, Walter E.

    1959-01-01

    Wind-tunnel tests have been made to determine the location of the boundary-layer transition on three hemispheres having surface roughness (absolute) values of 50, 580, and 2760 microinches. After the initial test run of the smoothest (50 microinch) hemisphere, holes ranging in depth from 1500 to 2500 microinches were noticed in the meridian where transition was observed. The holes were believed to be caused by particles in the air stream. Shadowgraph pictures were obtained of all hemispheres and surface temperature measurements were made on one hemisphere (580 microinches). Tests at high Reynolds numbers (6.4 to 7.5 x 10(exp 6) and a Mach number of 2.48 did not indicate any transition on the 50-microinch surface hemisphere before the holes appeared. However, after the holes were noticed, transition locations as low as 50 deg(measured from the stagnation point) were observed at similar Reynolds numbers and Mach numbers. It is felt the transition resulted from the holes. Similar transition locations of approximately 500 were also observed in the tests of hemispheres with surface roughness values of 580 and 2760 microinches at high Reynolds numbers (6.4 x 10(exp 6) to 7.5 x 10(exp 6)) and at a Mach number of 2.48. The results at a Mach number of 2.48 indicate that an absolute surface roughness value of 50 microinches was not critical in causing boundary-layer tran sition at Reynolds numbers of 6.4 to 7.5 x 10(exp 6) whereas roughness values of 580 and 2760 microinches were greater than critical. Transition Reynolds numbers based on momentum thickness, R(sub phi T) varied over a range of approximately 480 to 300 for transition locations, alpha, on the hemisphere from 880 to 410 (measured from the stagnation point). A maximum value of R(phi) of 660 (based on alpha = 90 deg) was obtained with the 50-microinch surface hemisphere at a Mach number of 2.48.

  10. Lack of association between Bax promoter (-248G>A single nucleotide polymorphism and susceptibility towards cancer: evidence from a meta-analysis.

    Directory of Open Access Journals (Sweden)

    Sushil Kumar Sahu

    Full Text Available BACKGROUND: The Bcl-2-associated X protein (Bax is a proapoptotic member of the Bcl-2 family known to be activated and upregulated during apoptosis. Single nucleotide polymorphisms (SNPs in Bax promoter may participate in the process of carcinogenesis by altering its own expression and the cancer related genes. Bax-248G>A polymorphism has been implicated to alter the risk of cancer, but the listed results are inconsistent and inconclusive. In the present study, we performed a meta-analysis to systematically summarize the possible association of this polymorphism with the risk of cancer. METHODOLOGY: We conducted a search of case-control studies on the associations of Bax-248G>A polymorphism with susceptibility to cancer in Pub Med, Science Direct, Wiley Online Library and hand search. Data from all eligible studies based on some key search terms, inclusion and exclusion criteria were extracted for this meta-analysis. Hardy-Weinberg equilibrium (HWE in controls, power calculation, heterogeneity analysis, Begg's funnel plot, Egger's linear regression test, forest plot and sensitivity analysis were performed in the present study. RESULTS: Cancer risk associated with Bax-248G>A polymorphism was estimated by pooled odds ratios (ORs and 95% confidence intervals (95% CIs. The pooled ORs were calculated in allele contrast, homozygous comparison, heterozygous comparison, dominant and recessive model. Statistical significance was checked through Z and p-value in forest plot. A total of seven independent studies including 1772 cases and 1708 controls were included in our meta-analysis. Our results showed that neither allele frequency nor genotype distributions of this polymorphism were associated with risk for cancer in any of the genetic model. Furthermore, Egger's test did not show any substantial evidence of publication bias. CONCLUSIONS/SIGNIFICANCE: This meta-analysis suggests that the Bax-248G>A polymorphism is not an important cancer risk factor

  11. High silicon content silylating reagents for dry-developed positive-tone resists for extreme ultraviolet (13.5 nm) and deep ultraviolet (248 nm) microlithography

    Energy Technology Data Exchange (ETDEWEB)

    Wheeler, D.; Scharrer, E.; Kubiak, G. [and others

    1994-12-31

    Recent results in the use of disilanes as silylating reagents for near-surface imaging with deep-UV (248 nm) and EUV (13.5 nm) lithography are reported. A relatively thin imaging layer of a photo-cross-linking resist is spun over a thicker layer of hard-baked resist that functions as a planarizing layer and antireflective coating. Photoinduced acid generation and subsequent heating crosslinks and renders exposed areas impermeable to an aminodisilane that reacts with the unexposed regions. Subsequent silylation and reactive ion etching afford a positive-tone image. The use of disilanes introduces a higher concentration of silicon into the polymer than is possible with silicon reagents that incorporate only one silicon atom per reactive site. The higher silicon content in the silylated polymer increases etching selectivity between exposed and unexposed regions and thereby increases the contrast. Additional improvements that help to minimize flow during silylation are also discussed, including the addition of bifunctional disilanes. We have resolved high aspect ratio, very high quality 0.20 {mu}m line and space patterns at 248 nm with a stepper having a numerical aperture (NA)= 0.53, and have resolved {<=} 0.15 {mu}m line and spaces at 13.5 nm.

  12. Influence of BCL2-938C>A and BAX-248G>A promoter polymorphisms in the development of AML: case-control study from South India.

    Science.gov (United States)

    Cingeetham, Anuradha; Vuree, Sugunakar; Dunna, Nageswara Rao; Gorre, Manjula; Nanchari, Santhoshi Rani; Edathara, Prajitha Mohandas; Meka, Phannibhushann; Annamaneni, Sandhya; Digumarthi, Raghunadharao; Sinha, Sudha; Satti, Vishnupriya

    2015-09-01

    B-cell lymphoma 2 (BCL2) and BCL2-associated X protein (BAX) proteins are anti-apoptotic and pro-apoptotic determinants of mitochondrial-mediated apoptosis, and their relative expression determines the cell fate. The promoter polymorphisms in these genes were shown to alter the protein function or expression and exert an impact on apoptosis regulation. Deregulation in the expression of any of these genes leads to disruption of cellular homeostasis and malignant transformation. The present study was aimed to determine the association of BCL2-938C>A and BAX-248G>A promoter polymorphisms with origin and progression of acute myeloid leukemia (AML). We also have performed combined genotype analysis to evaluate the cumulative effect of risk genotypes in the AML development. These polymorphisms were genotyped by polymerase chain reaction- restriction fragment length polymorphism (PCR-RFLP) in 221 AML patients and 305 age- and sex-matched healthy controls. Our study revealed that BCL2-938CA (p = 0.018) and BAX-248GG (0.043) genotypes were significantly associated with increased risk for AML occurrence. BAX-248A allele had shown decreased risk for AML. The combined analysis had shown that BCL2-938CA+AA-BAX-248GG group had a 1.63-fold (95 % CI: 1.08-2.45, p = 0.02) increased risk for AML. None of the clinical variables had shown any significant association with both polymorphisms. With respect to complete remission (CR) rate, BAX-248GG genotype (p = 0.002) and G allele (p = 0.009) had conferred significant risk for complete remission failure. Although the log rank test was not significant, survival analysis had shown a trend where BCL2-938CA genotype, and BAX-248GG had reduced median disease-free survival (DFS) of 9 and 10 months, respectively. In conclusion, BCL2-938C>A and BAX-248G>A gene polymorphisms might contribute to the origin of AML. Moreover, influence of BAX-248GG genotype on CR and DFS rate suggests that the BAX-248G>A polymorphism can serve as

  13. In Situ X-ray Diffraction Studies on the De/rehydrogenation Processes of the K$_{2}$[Zn(NH$_{2}$)$_{4}$]-8LiH System

    OpenAIRE

    Cao, Hujun; Pistidda, Claudio; Niewa, Rainer; Ping, Chen; Klassen, Thomas; Dornheim, Martin; Richter, Theresia M. M.; Santoru, Antonio; Milanese, Chiara; Garroni, Sebastiano; Bednarcik, Jozef; Chaudhary, Anna-Lisa; Gizer, Gökhan; Liermann, Hanns-Peter

    2017-01-01

    In this work, the hydrogen absorption and desorption properties of the system K$_2$[Zn(NH$_2$)$_4$]-8LiH are investigated in detail via in situ synchrotron radiation powder X-ray diffraction (SR-PXD), Fourier transform infrared spectroscopy (FT-IR), and volumetric methods. Upon milling, K$_2$[Zn(NH$_2$)$_4$] and 8LiH react to form 4LiNH$_2$-4LiH-K$_2$ZnH$_4$, and then 4LiNH$_2$-4LiH-K$_2$ZnH$_2$ releases H$_2$ in multiple steps. The final products of the desorption reaction are KH, LiZn$_{13}...

  14. Effects of Temperature on the p53-DNA Binding Interactions and Their Dynamical Behavior: Comparing the Wild Type to the R248Q Mutant

    Science.gov (United States)

    Barakat, Khaled; Issack, Bilkiss B.; Stepanova, Maria; Tuszynski, Jack

    2011-01-01

    Background The protein p53 plays an active role in the regulation of cell cycle. In about half of human cancers, the protein is inactivated by mutations located primarily in its DNA-binding domain. Interestingly, a number of these mutations possess temperature-induced DNA-binding characteristics. A striking example is the mutation of Arg248 into glutamine or tryptophan. These mutants are defective for binding to DNA at 310 K although they have been shown to bind specifically to several p53 response elements at sub-physiological temperatures (298–306 K). Methodology/Principal Findings This important experimental finding motivated us to examine the effects of temperature on the structure and configuration of R248Q mutant and compare it to the wild type protein. Our aim is to determine how and where structural changes of mutant variants take place due to temperature changes. To answer these questions, we compared the mutant to the wild-type proteins from two different aspects. First, we investigated the systems at the atomistic level through their DNA-binding affinity, hydrogen bond networks and spatial distribution of water molecules. Next, we assessed changes in their long-lived conformational motions at the coarse-grained level through the collective dynamics of their side-chain and backbone atoms separately. Conclusions The experimentally observed effect of temperature on the DNA-binding properties of p53 is reproduced. Analysis of atomistic and coarse-grained data reveal that changes in binding are determined by a few key residues and provide a rationale for the mutant-loss of binding at physiological temperatures. The findings can potentially enable a rescue strategy for the mutant structure. PMID:22110706

  15. Effects of temperature on the p53-DNA binding interactions and their dynamical behavior: comparing the wild type to the R248Q mutant.

    Directory of Open Access Journals (Sweden)

    Khaled Barakat

    Full Text Available BACKGROUND: The protein p53 plays an active role in the regulation of cell cycle. In about half of human cancers, the protein is inactivated by mutations located primarily in its DNA-binding domain. Interestingly, a number of these mutations possess temperature-induced DNA-binding characteristics. A striking example is the mutation of Arg248 into glutamine or tryptophan. These mutants are defective for binding to DNA at 310 K although they have been shown to bind specifically to several p53 response elements at sub-physiological temperatures (298-306 K. METHODOLOGY/PRINCIPAL FINDINGS: This important experimental finding motivated us to examine the effects of temperature on the structure and configuration of R248Q mutant and compare it to the wild type protein. Our aim is to determine how and where structural changes of mutant variants take place due to temperature changes. To answer these questions, we compared the mutant to the wild-type proteins from two different aspects. First, we investigated the systems at the atomistic level through their DNA-binding affinity, hydrogen bond networks and spatial distribution of water molecules. Next, we assessed changes in their long-lived conformational motions at the coarse-grained level through the collective dynamics of their side-chain and backbone atoms separately. CONCLUSIONS: The experimentally observed effect of temperature on the DNA-binding properties of p53 is reproduced. Analysis of atomistic and coarse-grained data reveal that changes in binding are determined by a few key residues and provide a rationale for the mutant-loss of binding at physiological temperatures. The findings can potentially enable a rescue strategy for the mutant structure.

  16. [Review of:] Dirk Lewandowski, Web Information Retrieval: Technologien zur Informationssuche im Internet. Frankfurt am Main: DGI, 2005. 248 S. (DGI-Schrift; Informationswissenschaft 7), ISBN 3-925474-55-2

    OpenAIRE

    Oberhauser, Otto

    2005-01-01

    Book review of Dirk Lewandowski, Web Information Retrieval: Technologien zur Informationssuche im Internet. Frankfurt am Main: DGI, 2005. 248 p. (DGI-Schrift; Informationswissenschaft 7), ISBN 3-925474-55-2. A well-investigated and easy to read state-of-the-art report on web search engines.

  17. Serrano Cañadas, Enrique: Islas de hielo. Naturaleza, presencia humana y paisaje en las Islas Shetland del Sur, Antártida. Valladolid, Universidad de Valladolid, Secretariado de Publicaciones e Intercambio Editorial, 2008, 248 págs.

    Directory of Open Access Journals (Sweden)

    Jesús Ruiz-Fernández

    2017-06-01

    Full Text Available Reseña de: Serrano Cañadas, Enrique: Islas de hielo. Naturaleza, presencia humana y paisaje en las Islas Shetland del Sur, Antártida. Valladolid, Universidad de Valladolid, Secretariado de Publicaciones e Intercambio Editorial, 2008, 248 págs.

  18. PROBING THE MSP PRENATAL STAGE: THE OPTICAL IDENTIFICATION OF THE X-RAY BURSTER EXO 1745-248 IN TERZAN 5

    Energy Technology Data Exchange (ETDEWEB)

    Ferraro, F. R.; Pallanca, C.; Lanzoni, B.; Cadelano, M.; Dalessandro, E.; Mucciarelli, A. [Dipartimento di Fisica e Astronomia, Università degli Studi di Bologna, v.le Berti Pichat 6/2, I-40127 Bologna (Italy); Massari, D. [INAF-Osservatorio Astronomico di Bologna, via Ranzani 1, I-40127 Bologna (Italy)

    2015-07-01

    We report on the optical identification of the neutron star burster EXO 1745-248 in Terzan 5. The identification was performed by exploiting Hubble Space Telescope/Advanced Camera for Surveys images acquired in Director's Discretionary Time shortly after (approximately one month) the Swift detection of the X-ray burst. The comparison between these images and previous archival data revealed the presence of a star that is currently brightened by ∼3 mag, consistent with expectations during an X-ray outburst. The centroid of this object well agrees with the position, in the archival images, of a star located in the turn-off/sub-giant-branch region of Terzan 5. This supports the scenario that the companion should have recently filled its Roche Lobe. Such a system represents the prenatal stage of a millisecond pulsar, an evolutionary phase during which heavy mass accretion on the compact object occurs, thus producing X-ray outbursts and re-accelerating the neutron star.

  19. Odd oxygen formation in the laser irradiation of O2 at 248 nm - Evidence for reactions of O2 in the Herzberg states with ground state O2

    Science.gov (United States)

    Shi, Jichun; Barker, John R.

    1992-01-01

    Two O3 formation processes (initiation and autocatalytic) are studied in pure O2 and in O2+N2 and O2+Ar mixtures at pressures between 200 and 1600 torr and at temperatures between 298 and 370 K. Evidence is presented that the initiation process produces O3 through chemical reactions between ground state O2 and excited O2 in the Herzberg states, which are produced by the photoabsorption of O2 at 248 nm. For the autocatalytic process, the results are consistent with the proposal that the O3 formation is accelerated by photodissociating vibrationally excited O2(nu), produced in the photolysis of O3 following its initial formation. It is argued that the O2 Herzberg states and O2(nu) may play important roles in the odd oxygen chemistry in the middle atmosphere. It is estimated that the O2(A3Sigma-u(+))+O2 reaction may yield up to about 6 percent of the total odd oxygen production rate near 50 km.

  20. X-ray emission analysis of a plasma source using an yttrium and a mylar target for the generation of 2.48 nm wavelength microbeam

    Energy Technology Data Exchange (ETDEWEB)

    Palladino, Libero; Lorenzo, Ramon Gimenez De; Emilio, Maurizio Di Paolo [Dipartimento di Fisica, Universita’ de L’Aquila (Italy); INFN, Laboratorio Nazionale del Gran Sasso, Assergi (AQ) (Italy); Limongi, Tania, E-mail: tania.limongi@gmail.com [Istituto Italiano di Tecnologia (IIT), Via Morego 30, 16163 Genova (Italy)

    2013-05-01

    In this work, the characteristics of X-ray beam generated from a plasma produced by focusing a Nd-Yag/glass laser beam on mylar or yttrium target were presented. For each target material, the conversion efficiencies of the soft X-ray emission in two different energy ranges, (i) 300–510 eV (almost coincident with the Water Window), (ii) 450–850 eV were measured. The experimental results of the conversion efficiencies will be utilized at the PLASMA-X laboratory of L’Aquila University for the realization of an intense monochromatic X-ray microbeam to be used in radiobiological and in transmission X-ray microscopy applications. In the presented experimental set-up, at the wavelength of 2.48 nm, a monochromatic soft X-rays beam was collected by multilayer spherical mirrors reflecting at an incidence angle close to the normal of the surface. The optical system geometry, the monochromatic beam intensity and the measures of efficiency of conversion of X-ray were described in this paper [5].

  1. Transient conductivity OF 1,3-dimethyluracil, uridine and 3-methyluridine in aqueous solution following 20-ns laser excitation at 248 nm

    Science.gov (United States)

    Görner, Helmut; Currell, Leslie J.

    1996-09-01

    Uridine, 3-methyluridine and 1,3-dimethyluracil in aqueous solution were studied by timeresolved conductimetry after excitation at 248 nm by 20-ns laser pulses. The conductivity signal increases to the maximum value at the pulse end (Δκ m) and decreases then with time, depending on the saturating gas (Ar, N 2O, O 2 or McCI) and pH. The Δκ m signal is suggested to originate from hydrated electrons (e aq-) and protons, the latter resulting from radical cations after rapid reaction with water. Biphotonic photoionization occurs in the whole pH range 3-11 with a quantum yield of 0.016 or smaller for laser intensities of ⩽ 8 MW/cm 2. The reaction of eaq with uncharged bases in Ar-saturated solution at pH 5-8 generates radical anions which are subsequently protonated. The neutralization reaction kinetics of the uracil derivatives depend essentially on the transient proton concentration and lead to the disappearance of most of the conductivity (>90%) within a few microseconds or less in neutral or acidic solution, respectively. For 3-methyluridine and uridine after neutralization, the presence of a long-lived species with acidic properties was observed (in small yield) upon biphotonic (but not monophotonic) excitation. The time-resolved conductivity pattern in the alkaline pH range is different for each of the three pyrimidines, depending essentially on the generation or consumption of OH - in the radical termination reactions.

  2. Radiochemical study of the kinematics of multi-nucleon transfer reactions in 48Ca + 248Cm collisions 10% above the Coulomb barrier

    Science.gov (United States)

    Götz, M.; Götz, S.; Kratz, J. V.; Düllmann, Ch. E.; Mokry, Ch.; Runke, J.; Thörle-Pospiech, P.; Wiehl, N.; Schädel, M.; Ballof, J.; Dorrer, H.; Grund, J.; Huber, D.; Jäger, E.; Keller, O.; Krier, J.; Khuyagbaatar, J.; Lens, L.; Lommel, B.; Mendel, M.; Moody, K. J.; Scharrer, P.; Schausten, B.; Shaughnessy, D.; Schmitt, M.; Steiner, J.; Trautmann, N.; Yakushev, A.; Yakusheva, V.

    2017-05-01

    The kinematics of multi-nucleon transfer reactions in 48Ca + 248Cm collisions at 262 MeV (center of target) was investigated by using a stacked-foil technique and radiochemical separations of trans-curium elements. Trans-curium isotopes were identified by α-particle spectroscopy. For Fm isotopes, by comparing the centroids of the measured post-neutron emission isotope distributions with the most probable primary mass number predicted by Volkov's generalized Qgg systematics, the missing mass (number of evaporated neutrons) is estimated. The latter is compared with that deduced from the measured centroid of the laboratory angular distribution peaked closely to the grazing angle and the centroid of the range distribution, being used to determine the average total kinetic energy loss (TKEL) and the average excitation energy. The latter agrees within the uncertainties with the missing mass so that a consistent picture of the reaction mechanism emerges. For products closer to the target Z, e.g., Cf and Bk, the distributions of kinetic energies are much broader than for Fm, reflecting the fact that in the former, values of TKEL reach from quasi-elastic scattering all the way to deep inelastic scattering. The measured laboratory angular distribution and the average laboratory kinetic energy of the Fm isotopes, being the prototypes for multi-nucleon transfer products, are benchmark values for the design of electromagnetic separators to be constructed for the separation and detection of unknown neutron-rich transactinides produced in this nuclear reaction type.

  3. The reaction {sup 48}Ca+{sup 248}Cm{yields}{sup 296}116{sup *} studied at the GSI-SHIP

    Energy Technology Data Exchange (ETDEWEB)

    Hofmann, S. [GSI Helmholtzzentrum fuer Schwerionenforschung, Darmstadt (Germany); Goethe-Universitaet Frankfurt, Institut fuer Physik, Frankfurt (Germany); Heinz, S.; Mann, R.; Khuyagbaatar, J.; Ackermann, D.; Barth, W.; Block, M.; Burkhard, H.G.; Comas, V.F.; Dahl, L.; Heredia, J.A.; Kindler, B.; Kojouharov, I.; Lang, R.; Lommel, B.; Muenzenberg, G.; Tinschert, K. [GSI Helmholtzzentrum fuer Schwerionenforschung, Darmstadt (Germany); Maurer, J.; Hessberger, F.P. [GSI Helmholtzzentrum fuer Schwerionenforschung, Darmstadt (Germany); Johannes Gutenberg-Universitaet, Helmholtz-Institut Mainz, Mainz (Germany); Antalic, S.; Saro, S. [Comenius University, Department of Nuclear Physics and Biophysics, Bratislava (Slovakia); Eberhardt, K.; Kratz, J.V.; Runke, J.; Thoerle-Pospiech, P.; Trautmann, N. [Johannes Gutenberg-Universitaet Mainz, Mainz (Germany); Gostic, J.; Henderson, R.A.; Kenneally, J.M.; Moody, K.J.; Nelson, S.L.; Shaughnessy, D.A.; Stoyer, M.A.; Wilk, P.A. [Lawrence Livermore National Laboratory, Livermore, CA (United States); Leino, M.; Uusitalo, J. [University of Jyvaeskylae, Department of Physics, Jyvaeskylae (Finland); Nishio, K. [Japan Atomic Energy Agency, Tokai, Ibaraki (Japan); Popeko, A.G.; Yeremin, A.V. [Joint Institute for Nuclear Research, Dubna (Russian Federation)

    2012-05-15

    The synthesis of element 116 in fusion-evaporation reactions of a {sup 48}Ca beam with radioactive {sup 248}Cm targets was studied at the velocity filter SHIP of GSI in Darmstadt. At excitation energies of the compound nuclei of 40.9MeV, four decay chains were measured, which were assigned to the isotope {sup 292}116, and one chain, which was assigned to {sup 293}116. Measured cross-sections of (3.4{sub -1.6}{sup +2.7})pb and (0.9{sub -0.7}{sup +2.1}), respectively, and decay data of the chains agree with data measured previously at the Flerov Laboratory of Nuclear Reactions in Dubna. As a new result, one {alpha}-decay chain was measured, which terminates after four {alpha} decays by spontaneous fission. The {alpha} energies of the second-to-fourth decay are considerably higher than those measured for the {alpha} decays of {sup 289}114, {sup 285}Cn, and {sup 281}Ds and the spontaneous fission half-life is significantly longer than that of {sup 277}Hs measured in previous experiments. A possible assignment is discussed in the frame of excited quasiparticle states of nuclei populated in the decay chain from {sup 293}116. Also other possible assignments were considered and are discussed. At an excitation energy of 45.0MeV no events were observed resulting in a one-event cross-section limit of 1.6 pb. The technical aspects related with the use of radioactive target material at SHIP are described in detail. The experience gained in this experiment will serve as a basis for future experiments aiming to study still heavier elements at the velocity filter SHIP. (orig.)

  4. Characterization of the in vitro expressed autoimmune rippling muscle disease immunogenic domain of human titin encoded by TTN exons 248-249

    Energy Technology Data Exchange (ETDEWEB)

    Zelinka, L. [Biomedical Sciences Program, Kent State University, Kent, OH (United States); McCann, S.; Budde, J.; Sethi, S.; Guidos, M.; Giles, R. [Center for Applied Chemical Biology, Department of Biological Sciences, Youngstown State University, One University Plaza, Youngstown, OH 44555 (United States); Walker, G.R., E-mail: grwalker@ysu.edu [Center for Applied Chemical Biology, Department of Biological Sciences, Youngstown State University, One University Plaza, Youngstown, OH 44555 (United States); Biomedical Sciences Program, Kent State University, Kent, OH (United States)

    2011-08-05

    Highlights: {yields} Affinity purification of the autoimmune rippling muscle disease immunogenic domain of titin. {yields} Partial sequence analysis confirms that the peptides is in the I band region of titin. {yields} This region of the human titin shows high degree of homology to mouse titin N2-A. -- Abstract: Autoimmune rippling muscle disease (ARMD) is an autoimmune neuromuscular disease associated with myasthenia gravis (MG). Past studies in our laboratory recognized a very high molecular weight skeletal muscle protein antigen identified by ARMD patient antisera as the titin isoform. These past studies used antisera from ARMD and MG patients as probes to screen a human skeletal muscle cDNA library and several pBluescript clones revealed supporting expression of immunoreactive peptides. This study characterizes the products of subcloning the titin immunoreactive domain into pGEX-3X and the subsequent fusion protein. Sequence analysis of the fusion gene indicates the cloned titin domain (GenBank ID: (EU428784)) is in frame and is derived from a sequence of N2-A spanning the exons 248-250 an area that encodes the fibronectin III domain. PCR and EcoR1 restriction mapping studies have demonstrated that the inserted cDNA is of a size that is predicted by bioinformatics analysis of the subclone. Expression of the fusion protein result in the isolation of a polypeptide of 52 kDa consistent with the predicted inferred amino acid sequence. Immunoblot experiments of the fusion protein, using rippling muscle/myasthenia gravis antisera, demonstrate that only the titin domain is immunoreactive.

  5. Challenges to accrual predictions to phase III cancer clinical trials: a survey of study chairs and lead statisticians of 248 NCI-sponsored trials.

    Science.gov (United States)

    Schroen, Anneke T; Petroni, Gina R; Wang, Hongkun; Thielen, Monika J; Sargent, Daniel; Benedetti, Jacqueline K; Cronin, Walter M; Wickerham, Donald L; Wang, Xiaofei F; Gray, Robert; Cohn, Wendy F; Slingluff, Craig L; Djulbegovic, Benjamin

    2011-10-01

    Research on barriers to accrual has typically emphasized factors influencing participation after trial activation. We sought to identify factors influencing trial design and accrual predictions prior to trial activation associated with sufficient accrual. A 30-question web-based survey was sent to the study chair and lead statistician for all 248 phase III trials open in 1993-2002 by five Clinical Trials Cooperative Groups. Questions addressed prior trial experience, trial design elements, accrual predictions, and perceived accrual influences. Accrual sufficiency categorization was derived from Clinical Trials Cooperative Group records: sufficient accrual included trials closed with complete accrual or at interim analysis, insufficient accrual included trials closed with inadequate accrual. Responses were analyzed by respondent role (study chair/lead statistician) and accrual sufficiency. Three hundred and nine eligible responses were included (response rate, 63%; lead statisticians, 81%; and study chairs, 45%), representing trials with sufficient (63%) and insufficient accruals (37%). Study chair seniority or lead statistician experience was not linked to accrual sufficiency. Literature review, study chair's personal experience, and expert opinion within Clinical Trials Cooperative Group most commonly influenced control arm selection. Clinical Trials Cooperative Group experience most influenced accrual predictions. These influences were not associated with accrual sufficiency. Among respondents citing accrual difficulties (41%), factors negatively influencing accrual were not consistently identified. Respondents credited three factors with positively influencing accrual: clinical relevance of study, lack of competing trials, and protocol paralleling normal practice. Perceptions of lead statisticians and study chairs may not accurately reflect accrual barriers encountered by participating physicians or patients. Survey responses may be subject to recall bias

  6. Reexamining the heavy-ion reactions 238U+238U and 238U+248Cm and actinide production close to the barrier

    Science.gov (United States)

    Kratz, J. V.; Schädel, M.; Gäggeler, H. W.

    2013-11-01

    that identical isotope distributions are populated independent of the bombarding energy indicating that the same bins of excitation energy are responsible for the production of these fissile isotopes. A comparison of the survival probabilities of the residues of equal charge and neutron transfers in the reactions of 238U projectiles with either 238U or 248Cm targets is consistent with such a cutoff as evaporation calculations assign the surviving heavy actinides to the 3n and/or 4n evaporation channels.

  7. Incidence and clinical characteristics of unexpected uterine sarcoma after hysterectomy and myomectomy for uterine fibroids: a retrospective study of 10,248 cases

    Directory of Open Access Journals (Sweden)

    Zhao WC

    2015-10-01

    Full Text Available Wan-Cheng Zhao,1 Fang-Fang Bi,1 Da Li,2 Qing Yang11Department of Obstetrics and Gynecology, 2Center of Reproductive Medicine, Shengjing Hospital of China Medical University, Shenyang, People’s Republic of ChinaBackground: Uterine fibroids often require a hysterectomy or myomectomy via laparotomy or laparoscopy. Morcellation is often necessary to perform a laparoscopic surgery. The objective of this study is to determine the incidence of unexpected uterine sarcomas (UUSs after hysterectomy and myomectomy for uterine fibroids and to reduce the occurrence and avoid the morcellation of UUSs by analyzing their characteristics.Methods: Women who had a hysterectomy or myomectomy for uterine fibroids in Shengjing Hospital of China Medical University between November 2008 and November 2014 were selected for the study, and their clinical characteristics were analyzed.Results: During the period, 48 UUSs were found in 10,248 cases, and the overall incidence was 0.47%. There was no statistical difference (P=0.449 regarding the incidence (0.50% vs 0.33% between 42 UUSs in 8,456 cases undergoing laparotomy and six UUSs in 1,792 cases undergoing laparoscopy. Most of the UUSs were stage I (89.58%, which occurred more commonly (56.25% in women aged 40–49. Abnormal uterine bleeding (39.58% was the main clinical manifestation. Rapidly growing pelvic masses (12.5%, rich blood flow signals (18.75%, and degeneration of uterine fibroids (18.75% prompted by ultrasonography may suggest the possibility of UUSs. The margins of most UUSs (93.75% were regular, which may cause UUSs to be misdiagnosed as uterine fibroids. Fifteen cases underwent magnetic resonance imaging examinations. Approximately 73.33% showed heterogeneous and hypointense signal intensity on T1-weighted images, and 80% showed intermediate-to-high signal intensity on T2-weighted images, with necrosis and hemorrhage in 40% of cases. After contrast administration, 80% presented early heterogeneous

  8. Production of {sup 256}Lr in the {sup 249,250,251}Cf + {sup 11}B, {sup 243}Am + {sup 18}O, and {sup 248}Cm + {sup 14}N reactions

    Energy Technology Data Exchange (ETDEWEB)

    Sato, N.; Sato, T.K.; Asai, M. [Japan Atomic Energy Agency, Ibaraki (Japan). Advanced Science Research Center; and others

    2014-04-01

    Production cross-sections of the isotope {sup 256}Lr in the {sup 249,250,251}Cf + {sup 11}B, {sup 243}Am + {sup 18}O, and {sup 248}Cm + {sup 14}N reactions were measured using a He/KCl gas-jet transport system and a rotating wheel a-particle detection apparatus. The α-particle energy of {sup 256}Lr was distributed from 8.3 to 8.7 MeV and its half-life, T{sub 1/2}, was measured to be 28 ± 1 s. The maximum cross sections in the {sup 249}Cf({sup 11}B, 4n){sup 256}Lr and {sup 243}Am({sup 18}O, 5n){sup 256}Lr reactions were determined to be 122 ± 36 nb at the beam energy of 63 MeV and 26 ± 7 nb at 96 MeV, respectively. In the {sup 248}Cm({sup 14}N, 6n){sup 256}Lr reaction, the cross section was measured to be 27 ± 10 nb at 91 MeV. (orig.)

  9. Comparación de variables físicas, culinarias y amilográficas del cultivar de arroz (Oryza sativa L. MD248 con dos cultivares comerciales de arroz en Venezuela

    Directory of Open Access Journals (Sweden)

    Manuel Ávila

    2014-12-01

    Full Text Available El objetivo del estudio fue evaluar las variables físicas culinarias y amilográficas del cultivar MD248 y su potencial como arroz de mesa en Venezuela. Para ello, MD248 se sembró bajo un diseño completamente aleatorizado, en Calabozo (Estado Guárico, Venezuela, junto con 2 cultivares empleados como testigos de buena (D-Sativa y baja (D-Primera calidad culinaria. De cada cultivar se cosecharon 2.500 g de arroz paddy y se procesaron hasta obtener una fracción de arroz entero pulido la cual fue evaluada para: largo, ancho, espesor, relación largo/ancho (L/A, peso de 100 granos, contenido de amilosa aparente, tiempo de cocción, relación de expansión volumétrica (REV, relación de absorción de agua (RAA, viscosidades pico, media, final, ‘breakdown’, ‘setback’, consistencia y temperatura de empaste del perfil amilográfico. Además, atributos sensoriales descriptivos (brillo, percepción visual de la adhesividad, adhesividad manual, adhesividad entre los granos y preferenciales (apariencia, adhesividad, calidad global del arroz cocido. Los resultados indicaron diferencias estadísticas altamente significativas (p ≤ 0,01 entre los cultivares para largo, relación L/A, peso de 100 granos, contenido de amilosa aparente, tiempo de cocción, REV, RAA y todas las variables amilográficas, excepto para viscosidad media y temperatura de empaste (p > 0,05. En los perfiles descriptivo y preferencial hubo diferencias altamente significativas (p ≤ 0,01 para todos los atributos evaluados. MD248 estuvo asociado con los mayores valores de largo de grano (7,07 mm, relación L/A (3,43, peso de 100 granos (2,20 g y amilosa aparente (19,14 %, y con los menores valores de tiempo de cocción (22,90 min, REV (3,07, RAA (1,55, viscosidad pico (159,61 RVU, media (130,10 RVU, p > 0,05 y ‘breakdown’ (29,51 RVU. MD248 presentó un perfil descriptivo comparable al cultivar de buena calidad culinaria y se diferenció ampliamente del cultivar de baja

  10. Automated absolute activation analysis with californium-252 sources

    Energy Technology Data Exchange (ETDEWEB)

    MacMurdo, K.W.; Bowman, W.W.

    1978-09-01

    A 100-mg /sup 252/Cf neutron activation analysis facility is used routinely at the Savannah River Laboratory for multielement analysis of many solid and liquid samples. An absolute analysis technique converts counting data directly to elemental concentration without the use of classical comparative standards and flux monitors. With the totally automated pneumatic sample transfer system, cyclic irradiation-decay-count regimes can be pre-selected for up to 40 samples, and samples can be analyzed with the facility unattended. An automatic data control system starts and stops a high-resolution gamma-ray spectrometer and/or a delayed-neutron detector; the system also stores data and controls output modes. Gamma ray data are reduced by three main programs in the IBM 360/195 computer: the 4096-channel spectrum and pertinent experimental timing, counting, and sample data are stored on magnetic tape; the spectrum is then reduced to a list of significant photopeak energies, integrated areas, and their associated statistical errors; and the third program assigns gamma ray photopeaks to the appropriate neutron activation product(s) by comparing photopeak energies to tabulated gamma ray energies. Photopeak areas are then converted to elemental concentration by using experimental timing and sample data, calculated elemental neutron capture rates, absolute detector efficiencies, and absolute spectroscopic decay data. Calculational procedures have been developed so that fissile material can be analyzed by cyclic neutron activation and delayed-neutron counting procedures. These calculations are based on a 6 half-life group model of delayed neutron emission; calculations include corrections for delayed neutron interference from /sup 17/O. Detection sensitivities of < or = 400 ppB for natural uranium and 8 ppB (< or = 0.5 (nCi/g)) for /sup 239/Pu were demonstrated with 15-g samples at a throughput of up to 140 per day. Over 40 elements can be detected at the sub-ppM level.

  11. Metastable charge-transfer state of californium(iii) compounds.

    Science.gov (United States)

    Liu, Guokui; Cary, Samantha K; Albrecht-Schmitt, Thomas E

    2015-06-28

    Among a series of anomalous physical and chemical properties of Cf(iii) compounds revealed by recent investigations, the present work addresses the characteristics of the optical spectra of An(HDPA)3·H2O (An = Am, Cm, and Cf), especially the broadband photoluminescence from Cf(HDPA)3·H2O induced by ligand-to-metal charge transfer (CT). As a result of strong ion-ligand interactions and the relative ease of reducing Cf(iii) to Cf(ii), a CT transition occurs at low energy (transfer state undergoes radiative and non-radiative relaxations. Broadening of the CT transition arises from strong vibronic coupling and hole-charge interactions in the valence band. The non-radiative relaxation of the metastable CT state results from a competition between phonon-relaxation and thermal tunneling that populates the excited states of Cf(iii).

  12. Photolysis of CH{sub 3}CHO at 248 nm: Evidence of triple fragmentation from primary quantum yield of CH{sub 3} and HCO radicals and H atoms

    Energy Technology Data Exchange (ETDEWEB)

    Morajkar, Pranay; Schoemaecker, Coralie; Fittschen, Christa, E-mail: christa.fittschen@univ-lille1.fr [Université Lille Nord de France, PhysicoChimie des Processus de Combustion et de l’Atmosphère – PC2A, UMR 8522, F-59650 Villeneuve d’Ascq (France); Bossolasco, Adriana [Université Lille Nord de France, PhysicoChimie des Processus de Combustion et de l’Atmosphère – PC2A, UMR 8522, F-59650 Villeneuve d’Ascq (France); INFIQC (CONICET), Departamento de Fisicoquímica, Facultad de Ciencias Químicas, Universidad Nacional de Córdoba, Córdoba (Argentina)

    2014-06-07

    Radical quantum yields have been measured following the 248 nm photolysis of acetaldehyde, CH{sub 3}CHO. HCO radical and H atom yields have been quantified by time resolved continuous wave Cavity Ring Down Spectroscopy in the near infrared following their conversion to HO{sub 2} radicals by reaction with O{sub 2}. The CH{sub 3} radical yield has been determined using the same technique following their conversion into CH{sub 3}O{sub 2}. Absolute yields have been deduced for HCO radicals and H atoms through fitting of time resolved HO{sub 2} profiles, obtained under various O{sub 2} concentrations, to a complex model, while the CH{sub 3} yield has been determined relative to the CH{sub 3} yield from 248 nm photolysis of CH{sub 3}I. Time resolved HO{sub 2} profiles under very low O{sub 2} concentrations suggest that another unknown HO{sub 2} forming reaction path exists in this reaction system besides the conversion of HCO radicals and H atoms by reaction with O{sub 2}. HO{sub 2} profiles can be well reproduced under a large range of experimental conditions with the following quantum yields: CH{sub 3}CHO + hν{sub 248nm} → CH{sub 3}CHO{sup *}, CH{sub 3}CHO{sup *} → CH{sub 3} + HCO ϕ{sub 1a} = 0.125 ± 0.03, CH{sub 3}CHO{sup *} → CH{sub 3} + H + CO ϕ{sub 1e} = 0.205 ± 0.04, CH{sub 3}CHO{sup *}→{sup o{sub 2}}CH{sub 3}CO + HO{sub 2} ϕ{sub 1f} = 0.07 ± 0.01. The CH{sub 3}O{sub 2} quantum yield has been determined in separate experiments as ϕ{sub CH{sub 3}} = 0.33 ± 0.03 and is in excellent agreement with the CH{sub 3} yields derived from the HO{sub 2} measurements considering that the triple fragmentation (R1e) is an important reaction path in the 248 nm photolysis of CH{sub 3}CHO. From arithmetic considerations taking into account the HO{sub 2} and CH{sub 3} measurements we deduce a remaining quantum yield for the molecular pathway: CH{sub 3}CHO{sup *} → CH{sub 4} + CO ϕ{sub 1b} = 0.6. All experiments can be

  13. Experimental Cross Sections for Reactions of Heavy Ions and 208Pb, 209Bi, 238U, and 248Cm Targets

    Energy Technology Data Exchange (ETDEWEB)

    Patin, Joshua Barnes [Univ. of California, Berkeley, CA (United States)

    2002-01-01

    The study of the reactions between heavy ions and 208Pb, 209Bi, 238U, and 248Cm Cm targets was performed to look at the differences between the cross sections of hot and cold fusion reactions. Experimental cross sections were compared with predictions from statistical computer codes to evaluate the effectiveness of the computer code in predicting production cross sections. Hot fusion reactions were studied with the MG system, catcher foil techniques and the Berkeley Gas-filled Separator (BGS). 3n- and 4n-exit channel production cross sections were obtained for the 238U(18O,xn)256-xFm, 238U(22Ne,xn)260-xNo, and 248Cm(15N,xn)263-xLr reactions and are similar to previous experimental results. The experimental cross sections were accurately modeled by the predictions of the HIVAP code using the Reisdorf and Schaedel parameters and are consistent with the existing systematics of 4n exit channel reaction products. Cold fusion reactions were examined using the BGS. The 48Pb(238Ca,xn)256-xNo, 208Pb(50Ti,xn)258-xRf, 208Pb(51V,xn)259-xDb, 50Bi(238Ti,xn)259-xDb, and 209Bi(51V,xn)260-xSg reactions were studied. The experimental production cross sections are in agreement with the results observed in previous experiments. It was necessary to slightly alter the Reisdorf and Schaedel parameters for use in the HIVAP code in order to more accurately model the experimental data. The cold fusion experimental results are in agreement with current 1n- and 2n-exit channel systematics.

  14. Reference: 248 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available lopment in maintaining the integrity of organs via cell-cell adhesion, thereby providing mechanical streng...th and facilitating the movement of metabolites throughout the plant. Cell adhesion

  15. Publications | Page 248 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    IDRC on climate change adaptation. New knowledge for an uncertain future Long before the term “global warming” appeared in headlines, Canada's International Development Research Centre (IDRC) was supporting research on climate change. We recognized, early on, that a warming climate threatens not just the.

  16. 24 CFR 248.101 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... of this part, as long as the sale is made on an arm's length basis and the partners who sell their... sales contract; (5) The seller has no input in the continued operation of the project as a result of the... action, expressed as a percentage of the project's extension preservation equity. Bona Fide Offer. A...

  17. QTL Information Table: 248 [Q-TARO

    Lifescience Database Archive (English)

    Full Text Available ntitative characters in rice using RFLP markers. Euphytica V89, 349-354. http://dx.doi.org/10.1007/BF00022292 ... ...ant RFLP C)Interval F2 Palawan IR42 A RG143 RG214 pha Wu, P., Zhang, G., and Huang, N. (1996). Identification of QTLs controlling qua

  18. 24 CFR 248.1 - Purpose.

    Science.gov (United States)

    2010-04-01

    ... to the maximum extent practicable as housing affordable to low income families or persons those privately owned dwelling units that were produced for such purpose with Federal assistance, without unduly... families; and (d) Facilitate the sale of housing to residents under a resident homeownership program. ...

  19. 17 CFR 248.120 - Definitions.

    Science.gov (United States)

    2010-04-01

    .... (iii) If a consumer makes a telephone call to a broker-dealer in response to an advertisement offering... indicate that the broker-dealer's products or services will be marketed to consumers who call in response... call attention to the nature and significance of the information presented. (d) Commission means the...

  20. 17 CFR 248.3 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... for personal, family, or household purposes. (2) Examples—(i) Continuing relationship. A consumer has... connects directly to the notice and is labeled appropriately to convey the importance, nature, and..., family, or household purposes, or that individual's legal representative. (2) Examples. (i) An individual...

  1. Publications | Page 248 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    IDRC works with developing-country researchers and institutions to build local capacity through funding, knowledge sharing, and training. Through books, articles, research publications, and studies, we aim to widen the impact of our investment and advance development research. We share the results of our funded ...

  2. 7 CFR 248.25 - FMNP information.

    Science.gov (United States)

    2010-01-01

    ... Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE..., Vermont: U.S. Department of Agriculture, FNS, Northeast Region, 10 Causeway Street, Room 501, Boston..., Southeast Region, 61 Forsyth Street, SW., Room 8T36, Atlanta, Georgia 30303. (d) Illinois, Indiana, Michigan...

  3. Association of maternal diabetes mellitus in pregnancy with offspring adiposity into early adulthood: sibling study in a prospective cohort of 280,866 men from 248,293 families.

    Science.gov (United States)

    Lawlor, Debbie A; Lichtenstein, Paul; Långström, Niklas

    2011-01-25

    Maternal diabetes mellitus in pregnancy results in greater offspring adiposity at birth. It is unclear whether it is associated with greater adiposity into adulthood, and if so, whether this is via intrauterine mechanisms or shared familial characteristics. A record-linkage prospective cohort study of 280,866 singleton-born Swedish men from 248,293 families was used to explore the intrauterine effect of maternal diabetes mellitus on offspring body mass index (BMI) in early adulthood. Maternal diabetes mellitus during pregnancy was associated with greater mean BMI at age 18 in their sons. The difference in BMI was similar within brothers and between nonsiblings. BMI of men whose mothers had diabetes mellitus during their pregnancy was on average 0.94 kg/m² greater (95% confidence interval [CI], 0.35 to 1.52) than in their brothers born before their mother was diagnosed with diabetes, after adjustment for birth year, maternal age, parity and education, birth weight, gestational age, and age at assessment of BMI. Early-pregnancy BMI was positively associated with son's BMI between nonsiblings, but there was no association within brothers. Adjustment of the maternal diabetes-offspring BMI association for maternal BMI did not alter the association either within brothers or between nonsiblings. Results were also robust to sensitivity analyses restricting the within-sibling analyses to siblings born within 3 years of each other. Maternal diabetes mellitus has long-term consequences for greater BMI in offspring; this association is likely to be via intrauterine mechanisms, and is independent of maternal BMI in early pregnancy.

  4. Neutron Protection Factor Determination and Validation for a Vehicle Surrogate Using a Californium Fission Source

    Science.gov (United States)

    2017-06-01

    a 4 mm x 4 mm (0.157" x 0.157") LiI(Eu) crystal with 96% enrichment of lithium -6. The crystal is connected to a photomultiplier tube (PMT) which...32 Figure 17. Lithium -6 Iodide, Europium Doped Scintillation Detector. Source: [27...Alamos National Laboratory LiI(Eu) Lithium Iodide Europium Doped LLD Low Level Discriminator LLNL Lawrence Livermore National Laboratory MASH Monte

  5. ¿Serían la Guardia, Tutela y Curatela Bienes Jurídicos Penales? Un Análisis Crítico de los Arts. 248 y 249 del CP a la Luz de la Exclusiva Protección de Bienes Jurídicos

    Directory of Open Access Journals (Sweden)

    Gerson Faustino Rosa

    2015-12-01

    Full Text Available El presente trabajo tiene por objeto el análisis crítico y la explotación de un importante problema político-criminal de la actualidad: la criminalización de conductas que afrontan la guarda, la tutela y la curatela en el Código Penal, en sus artículos 248 y 249, lo que ya no tiene sentido ante la actual función del sistema penal, criticándose la actividad desenfrenada del Poder Legislativo, que produce ley espenales que no protegen bien jurídico alguno,oque salvaguardan bienes pasibles de protección por otras esferas del Derecho, valiéndose de la fuerza simbólico-comunicativa del Derecho Penal de forma desnecesaria, ampliando demasiadamente el alcance de la pena criminal, hasta el punto de vulgarizar todo el sistema jurídico penalenrazón de su uso indiscriminado. Paraello, enprimer plano,este estudio trata de la política criminal relativa a la libre planificación familiar, criticando la intervención estatal en cuestiones familiares, como ocurre en el Código Penal de 1940, destacando la necesidad de respetarse los principios de intervención mínima y de proporcionalidad antes de que el legislador se valga de la injerencia penal para la protección de cualquier bien jurídico. Más adelante, se presenta la importancia del bien jurídico-penal, con énfasis en la familia como bien jurídico categorial, especialmente la guardia, tutela y curatela, supuestamente lesionadas por los delitos de los artículos 248 y 249 del Código Penal. Así, se analizan brevemente los tipos penales citados, criticándose dicha criminalización, teniéndose en cuenta que tales tipos son subsidiarios, perfectamente prescindibles en el ordenamiento jurídico-penal y pasibles de salvaguardia por el Derecho Civil, que en la solución de los conflictos familiares se muestra mucho más eficaz que la intervención penal.

  6. Dicty_cDB: AFB248 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available RNA sequence. 38 0.14 2 BI433279 |BI433279.1 EST536040 P. infestans-challenged leaf Solanum tuberosum cDNA c...lone PPCBC62 5' sequence, mRNA sequence. 48 0.14 1 BQ046631 |BQ046631.1 EST595749 P. infestans-challenged...RNA sequence. 48 0.14 1 BI435717 |BI435717.1 EST538478 P. infestans-challenged leaf Solanum tuberosum cDNA c...lone PPCCI86 5' sequence, mRNA sequence. 48 0.14 1 BI435853 |BI435853.1 EST538614 P. infestans-challenged...91390 |BG591390.1 EST499232 P. infestans-challenged leaf Solanum tuberosum cDNA clone BPLI8D17 5' sequence,

  7. Dicty_cDB: AFF248 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FQIKKK--- ---TTAKPXNNNNNNNDDEDEDEDGDIPDLDDFQDDNIIEEEDPAVLSKNNKTTTTTTAN NNNNNXSENKVEDNDNILRTRTYDISITY...FQIKKK--- ---TTAKPXNNNNNNNDDEDEDEDGDIPDLDDFQDDNIIEEEDPAVLSKNNKTTTTTTAN NNNNNXSENKVEDNDNILRTRTYDISITY

  8. 7 CFR 248.20 - Claims and penalties.

    Science.gov (United States)

    2010-01-01

    ... Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS WIC FARMERS' MARKET NUTRITION PROGRAM (FMNP) Miscellaneous Provisions... current Letter of Credit within 30 days from the date of the first demand letter from FNS, FNS will assess...

  9. 7 CFR 248.14 - Distribution of funds.

    Science.gov (United States)

    2010-01-01

    ... Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS WIC FARMERS' MARKET NUTRITION PROGRAM (FMNP) State Agency Provisions... reallocated in accordance with paragraph (k) of this section. (e) Expansion for current State agencies. In...

  10. Dicty_cDB: SHG248 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available KSVDIHPTEPWILASLYDGNVYIWNY ETQNMVKSFEVSPNNPVRTARFIAKKQWIVTGSDDTYIRVYNYNTMEKIKSFXAHADYIR CIIVHPTLPYIL...KSVDIHPTEPWILASLYDGNVYIWNY ETQNMVKSFEVSPNNPVRTARFIAKKQWIVTGSDDTYIRVYNYNTMEKIKSFXAHADYIR CIIVHPTLPYIL

  11. 1935 15' Quad #248 Aerial Photo Mosaic Index

    Data.gov (United States)

    Earth Data Analysis Center, University of New Mexico — Aerial Photo Reference Mosaics contain aerial photographs that are retrievable on a frame by frame basis. The inventory contains imagery from various sources that...

  12. 7 CFR 248.10 - Coupon and market management.

    Science.gov (United States)

    2010-01-01

    ... with the requirements of Title VI of the Civil Rights Act of 1964, title IX of the Education Amendments... employees with FMNP responsibilities on such procedures; (vii) Agree to be monitored for compliance with... not: (i) Collect sales tax on FMNP coupon purchases; (ii) Seek restitution from FMNP recipients for...

  13. Dicty_cDB: VSE248 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ubiqu... 155 6e-37 EF070483_1( EF070483 |pid:none) Maconellicoccus hirsutus clone WHM... 155 6e-37 AB032025_1(...ubiqu... 155 6e-37 EF070591_1( EF070591 |pid:none) Maconellicoccus hirsutus clone WHM... 154 7e-37 protein

  14. Dicty_cDB: SFJ248 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 76 6e-24 4 BU835350 |BU835350.1 T072G09 Populus apical shoot cDNA library Populus tremula x Populus tremuloides...52 4e-14 4 BU824990 |BU824990.1 UK102C04 Populus apical shoot cDNA library Populus tremula x Populus tremuloides

  15. 17 CFR 248.126 - Delivery of opt out notices.

    Science.gov (United States)

    2010-04-01

    ... be provided in compliance with either the electronic disclosure provisions in this subpart or the provisions in section 101 of the Electronic Signatures in Global and National Commerce Act, 15 U.S.C. 7001... electronic disclosures by e-mail from the affiliate providing the notice; or (4) Posts the notice on the...

  16. 49 CFR 195.248 - Cover over buried pipeline.

    Science.gov (United States)

    2010-10-01

    ... railroads 36 (914) 36 (914) Deepwater port safety zones 48 (1219) 24 (610) Gulf of Mexico and its inlets in... removal by equivalent means. (b) Except for the Gulf of Mexico and its inlets in waters less than 15 feet...

  17. 17 CFR 248.1 - Purpose and scope.

    Science.gov (United States)

    2010-04-01

    ... about individuals who obtain financial products or services primarily for personal, family, or household... about individuals who obtain financial products or services primarily for business, commercial, or...) REGULATIONS S-P AND S-AM Regulation S-P: Privacy of Consumer Financial Information and Safeguarding Personal...

  18. All projects related to | Page 248 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Total Funding: CA$ 1,874,950.00. Enhancing Participation of Indigenous People to Address Discrimination and Promote Equity in Health Systems. Project. New research will help indigenous peoples in Latin America tackle the inequity, racial discrimination, and other barriers they face in accessing their right to health care.

  19. Dicty_cDB: SHC248 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available update 2002. 9.10 Translated Amino Acid sequence ---QLKMIVEKENQIQQXQSQLNDQSHHQSNQLSEKDQQLNQLIEKNESDQKXQQLKQQS...instkfksik**ksrksktif*krxkapix fx Frame B: ---QLKMIVEKENQIQQXQSQLNDQSHHQSNQLSEKDQQLNQLIEKNESDQKXQQLKQQS...n*nnnq lkmi*lkkrikfnnynyn*mnkdnynlkyqlimikf*n*knn*nnvnriy*n*mmknnnk innykinkldlinyn*llinlkmikihnsfny...kmiknnnynqsnki*in*nkkikkkknn slkrmknynqfnlrikkkknnslkrmksynqfnki*in*mmkikkk*nnflkkxkspnxi x Homology

  20. 24 CFR 248.105 - Notice of intent.

    Science.gov (United States)

    2010-04-01

    ... the owner intends to extend the affordability restrictions on the project by retaining ownership of... shall be furnished by the Commissioner. Upon the request of any non-English speaking tenants residing in... OF LOW INCOME HOUSING MORTGAGES Prepayments and Plans of Action Under the Low Income Housing...

  1. 48 CFR 52.248-3 - Value Engineering-Construction.

    Science.gov (United States)

    2010-10-01

    .... Collateral costs, as used in this clause, means agency costs of operation, maintenance, logistic support, or... increases in the cost of testing, operations, maintenance, and logistic support. The term does not include... affected by contractually required configuration management or similar procedures, the instructions in...

  2. Dicty_cDB: SFF248 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available PPDQQRLIFA G--- ---KRTPSPFSLKIKRXYANFC*tsxw*txplgsgr*l*h*kxqsqnpxqxrxsprsttf hfrw*tikkwpyxx*lqhpkxipxpfsxxikrwxanxcknlxw*xxpxgsxrf...xxx*kcq sqnsxqxrfsprstxixfxwxtikxwxdxxxlqxskgipxpfsxxxkrxxanxc*nxxr* nxpxgsrrx Transla...*fsl v--- ---KRTPSPFSLKIKRXYANFC*tsxw*txplgsgr*l*h*kxqsqnpxqxrxsprsttf hfrw*tikkwpyxx*lqhpkxipxpfsxxikrwxanxcknlxw*xxpxgsxrf...xxx*kcq sqnsxqxrfsprstxixfxwxtikxwxdxxxlqxskgipxpfsxxxkrxxanxc*nx

  3. 248 A CRITICAL REVIEW OF ALEXIS KAGAME'S FOUR ...

    African Journals Online (AJOL)

    Ike Odimegwu

    philosophy open and their endeavour a charade. However, this lousy situation can only be address through proper reflective activities of. African scholars towards originality of ideas that corresponds and represents the African world and that will make the African world intelligible to Africans. Introduction. The interplay ...

  4. Dicty_cDB: AFK248 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available clone:GKCBBB10, 5'end, expressed in human hepatocellular carcinoma. 36 0.50 2 AV695982 |AV695982.1 Homo sapiens cDNA...clone:GKCBBB08, 5'end, expressed in human hepatocellular carcinoma. 36 0.50 2 BX000526 |BX000526.8 Zebrafish DNA

  5. 17 CFR 248.124 - Reasonable opportunity to opt out.

    Science.gov (United States)

    2010-04-01

    ... consumer is required to decide, as a necessary part of proceeding with the transaction, whether to opt out... transaction. The consumer is required to decide, as a necessary part of proceeding with the transaction... means. (3) At the time of an electronic transaction. The opt out notice is provided to the consumer at...

  6. Twenty Things to Do With a Computer. Artificial Intelligence Memo Number 248.

    Science.gov (United States)

    Papert, Seymour; Solomon, Cynthia

    Ideas about computers in education are usually limited to transactions of a conversational form between students and machines. Computers, however, can do many other things and it is only inertia and prejudice, not lack of ideas, which stand in the way of broadening the range of computer applications in schools. Several examples, over half of which…

  7. 7 CFR 248.16 - Administrative appeal of State agency decisions.

    Science.gov (United States)

    2010-01-01

    ... NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS WIC FARMERS' MARKET NUTRITION PROGRAM... receive FMNP benefits until the hearing official reaches a decision or the expiration of the current FMNP...

  8. 27 CFR 24.248 - Processes authorized for the treatment of wine, juice, and distilling material.

    Science.gov (United States)

    2010-04-01

    ... water for use in wine production. Thin-film evaporation under reduced pressure 1 To separate wine into a... grapes; to remove pink color from blanc de noir wine; to separate red wine into low color and high color...

  9. Morphology of Copper Tin Sulfide Films Grown by Pulsed Laser Deposition at 248 and 355 nm

    DEFF Research Database (Denmark)

    Ettlinger, Rebecca Bolt; Cazzaniga, Andrea Carlo; Crovetto, Andrea

    Thin films solar cells based on Cu2ZnSnS4 (CZTS) as absorber layer have seen a rapid development leading to a world record of 8.8% [1]. However, other p-type semiconductors with fewer elements and reduced complexity compared to CZTS are also available, such as ternary Cu–Sn–S systems, i.e. Cu2SnS3...

  10. : tous les projets | Page 248 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Projet. La recherche sur les changements climatiques et leurs effets sur les populations vulnérables est assez avancée en Afrique australe. Date de début : 31 mars 2011. End Date: 29 septembre 2014. Sujet: BIOAVAILABILITY, AGRICULTURAL METEOROLOGY, ADAPTATION TO CHANGE, VULNERABLE GROUPS.

  11. 24 CFR 248.127 - Limitations on action pursuant to Federal cost limit.

    Science.gov (United States)

    2010-04-01

    ... cost limit. (b) Transfer of the project. With respect to owners who seek to transfer the project— (1) If the transfer preservation rent does not exceed the Federal cost limit, or if the transfer preservation rent exceeds the Federal cost limit and the owner is willing to transfer the project at a price...

  12. Page 1 248 Suresh Kumari and Babu Ram Theorem 3. Let Kaº) be a ...

    Indian Academy of Sciences (India)

    3) converges in the metric space L if and only if (5) and. Proof of Theorem 2. Let 0 < x < t and let. S S S S S S S S CC S S S AAAA S S S CCC S S S S S S S S S S S S S S S S S S S S S CCCC S S S CCCC S S S S S S S CCSCCSCCC SS S S  ...

  13. 17 CFR 248.6 - Information to be included in privacy notices.

    Science.gov (United States)

    2010-04-01

    ... exercise that right at that time; (7) Any disclosures that you make under section 603(d)(2)(A)(iii) of the... everyday business purposes such as to process transactions, maintain account(s), respond to court orders...

  14. 17 CFR 248.121 - Affiliate marketing opt out and exceptions.

    Science.gov (United States)

    2010-04-01

    ... response to this communication. (iii) A registered investment adviser makes a marketing call to the... services offered by the investment adviser. If the consumer calls the toll-free number to inquire about the... result of the election of the consumer to opt out under this subpart; (4) In response to a communication...

  15. SU-E-J-248: Contributions of Tumor and Stroma Phenotyping in Computer-Aided Diagnosis

    Energy Technology Data Exchange (ETDEWEB)

    Li, H; Lan, L; Sennett, C; Giger, M [Univ Chicago, Chicago, IL (United States)

    2015-06-15

    Purpose: To gain insight into the role of parenchyma stroma in the characterization of breast tumors by incorporating computerized mammographic parenchyma assessment into breast CADx in the task of distinguishing between malignant and benign lesions. Methods: This study was performed on 182 biopsy-proven breast mass lesions, including 76 benign and 106 malignant lesions. For each full-field digital mammogram (FFDM) case, our quantitative imaging analysis was performed on both the tumor and a region-of-interest (ROI) from the normal contralateral breast. The lesion characterization includes automatic lesion segmentation and feature extraction. Radiographic texture analysis (RTA) was applied on the normal ROIs to assess the mammographic parenchymal patterns of these contralateral normal breasts. Classification performance of both individual computer extracted features and the output from a Bayesian artificial neural network (BANN) were evaluated with a leave-one-lesion-out method using receiver operating characteristic (ROC) analysis with area under the curve (AUC) as the figure of merit. Results: Lesion characterization included computer-extracted phenotypes of spiculation, size, shape, and margin. For parenchymal pattern characterization, five texture features were selected, including power law beta, contrast, and edge gradient. Merging of these computer-selected features using BANN classifiers yielded AUC values of 0.79 (SE=0.03) and 0.67 (SE=0.04) in the task of distinguishing between malignant and benign lesions using only tumor phenotypes and texture features from the contralateral breasts, respectively. Incorporation of tumor phenotypes with parenchyma texture features into the BANN yielded improved classification performance with an AUC value of 0.83 (SE=0.03) in the task of differentiating malignant from benign lesions. Conclusion: Combining computerized tumor and parenchyma phenotyping was found to significantly improve breast cancer diagnostic accuracy highlighting the need to consider both tumor and stroma in decision making. Funding: University of Chicago Dean Bridge Fund, NCI U24-CA143848-05, P50-CA58223 Breast SPORE program, and Breast Cancer Research Foundation. COI: MLG is a stockholder in R2 technology/Hologic and receives royalties from Hologic, GE Medical Systems, MEDIAN Technologies, Riverain Medical, Mitsubishi, and Toshiba. MLG is a cofounder and stockholder in Quantitative Insights.

  16. Analysis of the endogenous peptide profile of milk: identification of 248 mainly casein-derived peptides.

    Science.gov (United States)

    Baum, Florian; Fedorova, Maria; Ebner, Jennifer; Hoffmann, Ralf; Pischetsrieder, Monika

    2013-12-06

    Milk is an excellent source of bioactive peptides. However, the composition of the native milk peptidome has only been partially elucidated. The present study applied matrix-assisted laser desorption/ionization time-of-flight mass spectrometry (MALDI-TOF-MS) directly or after prefractionation of the milk peptides by reverse-phase high-performance liquid chromatography (RP-HPLC) or OFFGEL fractionation for the comprehensive analysis of the peptide profile of raw milk. The peptide sequences were determined by MALDI-TOF/TOF or nano-ultra-performance liquid chromatography-nanoelectrospray ionization-LTQ-Orbitrap-MS. Direct MALDI-TOF-MS analysis led to the assignment of 57 peptides. Prefractionation by both complementary methods led to the assignment of another 191 peptides. Most peptides originate from α(S1)-casein, followed by β-casein, and α(S2)-casein. κ-Casein and whey proteins seem to play only a minor role as peptide precursors. The formation of many, but not all, peptides could be explained by the activity of the endogenous peptidases, plasmin or cathepsin D, B, and G. Database searches revealed the presence of 22 peptides with established physiological function, including those with angiotensin-converting-enzyme (ACE) inhibitory, immunomodulating, or antimicrobial activity.

  17. 19 CFR 10.248 - Additional requirements for preferential treatment of brassieres.

    Science.gov (United States)

    2010-04-01

    ... articles in question must be entered within the same year; (B) Articles that are exported to countries..., Canada and Mexico. Notwithstanding the fact that some of the articles ultimately ended up in Canada or Mexico, a declaration of compliance prepared by the entity controlling production must cover all of the...

  18. 24 CFR 248.405 - Grants for building resident capacity and funding predevelopment costs.

    Science.gov (United States)

    2010-04-01

    ... HUD will use in making the assistance available. (b) Allocation. Thirty percent of the assistance made..., environmental, architectural and engineering, application fees, and sponsor's staff and overhead costs. (2...

  19. SU-E-T-248: Determining Output Factor of Irregular Electron Cutouts at Extended SSD

    Energy Technology Data Exchange (ETDEWEB)

    Alkhatib, H [Richland Memorial Hospital, Columbia, SC (United States); Gebreamlak, W [South Carolina Oncology Associates, Columbia, SC (United States); Tedeschi, D [University of South Carolina, Columbia, SC (United States); Mihailidis, D [CAMC Cancer Center, Charleston, WV (United States)

    2015-06-15

    Purpose: To calculate the output factor (OPF) of any irregularly shaped electron beam at extended SSD Methods: Using Cerrobend block, circular cutouts with diameter ranging from 2.0cm to the maximum possible size for 15×15 applicator of Varian 2100C and 14×14 applicator of ELEKTA Synergy LINACs were prepared. In addition, two irregular cutouts were made. For each cutout, percentage depth dose (PDD) at standard SSD and point doses at different SSD were measured in water using Scanditronix diodes and PTW 0.125 cm{sup 3} ion-chambers, respectively. In addition, the distance at which electron fluence along the central axis becomes independent of cutout size was determined using EDR2 films. On each LINAC, electron beam energies of 6, 9, 12, and 15/20 MeV were used. Results: Using the open applicator as the reference field, the lateral buildup ratio (LBR) for each circular cutout as a function of depth was calculated. From the LBR value and radius of the cutout, the corresponding lateral spread parameter (σR(z)) was determined. Taking the cutout side dependence of σR(z)) into account, PDD of the irregular cutouts at the standard SSD were calculated. From the point dose measurement at different SSDs, the effective SSD of each cutout was calculated. Taking the calculated PDD of the irregular cutout and effective SSD (SSDeff) of the circular cutout into account, OPFs of the irregular cutout at extended SSD values were calculated. Finally, the calculated output factors were compared with the measured values. Conclusion: In this research, the improved LBR method has been generalized to calculate output factor of irregular cutouts at extended SSD. In a clinically useful region, the percentage difference between the measured and the calculated output factors of the irregular cutouts was within 2%. Similar results were obtained for all available electron energies of both Varian 2100C and ELEKTA Synergy machines.

  20. Massimo De Giuseppe, La rivoluzione messicana, Bologna, Il Mulino, Universale Paperbacks, 2013, 248 p.

    OpenAIRE

    Traffano, Daniela

    2014-01-01

    Las conmemoraciones del bicentenario del proceso de Independencia y del centenario de la Revolución, que en México motivaron a lo largo del 2010 la difusión de discursos e imágenes, eventos políticos, culturales y deportivos así como la creación de espectáculos, videos y proyectos académicos, trascendieron el Atlántico y encontraron una voz y un espacio muy particulares en Italia, gracias a la última publicación del historiador Massimo De Giuseppe. Se trata de “La rivoluzione messicana”, un v...

  1. 7 CFR 2.48 - Administrator, Rural Business-Cooperative Service.

    Science.gov (United States)

    2010-01-01

    ... authorities of section 1619(b)(3)(A) of the Food, Conservation, and Energy Act of 2008 (7 U.S.C. 8791(b)(3)(A...) of the Food, Agriculture, Conservation, and Trade Act of 1990 (7 U.S.C. 2279-1(e)). (b) Reservation... for business technical assistance and planning; (ii) (iii) Sections 309 (7 U.S.C. 1929) and 309A (7 U...

  2. Phase-shifted Bragg grating inscription in PMMA microstructured POF using 248 nm UV radiation

    DEFF Research Database (Denmark)

    Pereira, L.; Pospori, A.; Antunes, Paulo

    2017-01-01

    for photosensitivity improvement was used. A uniform phase mask customized for 850 nm grating inscription was used to inscribe these Bragg structures. The phase shift defect was created directly during the grating inscription process by placing a narrow blocking aperture in the center of the UV beam. The produced high...... a significant increase in measurement resolution compared to direct interrogation of a single grating. The reflection and transmission spectra when multiple phase shifts are introduced in the FBG structure are also shown. The PS-POFBG's strain, temperature, pressure, and humidity characteristics have been...

  3. 17 CFR 248.9 - Delivering privacy and opt out notices.

    Science.gov (United States)

    2010-04-01

    ..., electronically. (2) Examples of retention or accessibility. You provide a privacy notice to the customer so that... reasonably expect that a customer will receive actual notice of your annual privacy notice if: (i) The customer uses your web site to access financial products and services electronically and agrees to receive...

  4. A retrospective study of californium-252 neutron brachytherapy combined with EBRT versus 3D-CRT in the treatment of esophageal squamous cell cancer.

    Science.gov (United States)

    Wang, Qifeng; Li, Tao; Lang, Jinyi; Wang, Jie; Wang, Jian; Liu, Huiming; Jia, Xitang; Liu, Bo; Wang, C-K Chris

    2015-10-24

    We conducted a retrospective analysis on 884 patients who were diagnosed with esophageal squamous cell carcinoma (ESCC) and treated with either the neutron brachytherapy in combination with external beam radiotherapy (NBT + EBRT) or 3-dimensional conformal radiation therapy (3D-CRT) to determine the differences in efficacy and morbidity between the two treatment groups. The 884 ESCC patients treated with either NBT + EBRT or 3D-CRT between 2002 and 2012 were retrospectively reviewed and analyzed. Multivariable Cox regression was used to compare oncologic outcomes of the two groups of patients in the context of other clinically relevant variables. The acute and chronic toxicities associated with the two groups were compared using Fisher exact and log-rank tests, respectively. Among the 884 patients, 545 received NBT + EBRT and 339 received 3D-CRT (i.e. EBRT-only). The age range is 39-95 years (median 66). The follow-up time range is 3-145 months (median 32). The analysis shows that the NBT + EBRT group has higher overall survival rate and local control rate than that of the 3D-CRT group. The acute toxicity effects were acceptable for both groups of patients with the NBT + EBRT group showing higher rates of leukopenia and thrombocytopenia and the 3D-CRT group showing higher rates on fistula and massive bleeding. The patients treated with NBT + EBRT showed better oncologic outcomes than those treated with 3D-CRT. The toxicity effects were acceptable for both groups with the NBT + EBRT group showing higher rates on the acute effects and the 3D-CRT group showing higher rates on the late effects.

  5. Radiological Characterization Technical Report on Californium-252 Sealed Source Transuranic Debris Waste for the Off-Site Source Recovery Project at Los Alamos National Laboratory

    Energy Technology Data Exchange (ETDEWEB)

    Feldman, Alexander [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2014-04-24

    This document describes the development and approach for the radiological characterization of Cf-252 sealed sources for shipment to the Waste Isolation Pilot Plant. The report combines information on the nuclear material content of each individual source (mass or activity and date of manufacture) with information and data on the radionuclide distributions within the originating nuclear material. This approach allows for complete and accurate characterization of the waste container without the need to take additional measurements. The radionuclide uncertainties, developed from acceptable knowledge (AK) information regarding the source material, are applied to the summed activities in the drum. The AK information used in the characterization of Cf-252 sealed sources has been qualified by the peer review process, which has been reviewed and accepted by the Environmental Protection Agency.

  6. SU-E-T-248: Near Real-Time Analysis of Radiation Delivery and Imaging, Accuracy to Ensure Patient Safety

    Energy Technology Data Exchange (ETDEWEB)

    Wijesooriya, K; Seitter, K; Desai, V; Read, P; Larner, J [University of Virginia Health Systems, Charlottesville, VA (United States)

    2014-06-01

    Purpose: To develop and optimize an effective software method for comparing planned to delivered control point machine parameters for all VARIAN TrueBeam treatments so as to permit (1) assessment of a large patient pool throughout their treatment course to quantify treatment technique specific systematic and random uncertainty of observables, (2) quantify the site specific daily imaging shifts required for target alignment, and (3) define tolerance levels for mechanical parameters and imaging parameters based on statistical analysis data gathered, and the dosimetric impact of variations. Methods: Treatment and imaging log files were directly compared to plan parameters for Eclipse and Pinnacle planned treatments via 3D, IMRT, control point, RapidArc, and electrons. Each control point from all beams/arcs (7984) for all fractions (1940) of all patients treated over six months were analyzed. At each control point gantry angle, collimator angle, couch angle, jaw positions, MLC positions, MU were compared. Additionally per-treatment isocenter shifts were calculated. Results were analyzed as a whole in treatment type subsets: IMRT, 3D, RapidArc; and in treatment site subsets: brain, chest/mediastinum, esophagus, H and N, lung, pelvis, prostate. Results: Daily imaging isocenter shifts from initial external tattoo alignment were dependent on the treatment site with < 0.5 cm translational shifts for H and N, Brain, and lung SBRT, while pelvis, esophagus shifts were ∼1 cm. Mechanical delivery parameters were within tolerance levels for all sub-beams. The largest variations were for RapidArc plans: gantry angle 0.11±0.12,collimator angle 0.00±0.00, jaw positions 0.48±0.26, MLC leaf positions 0.66±0.08, MU 0.14±0.34. Conclusion: Per-control point validation reveals deviations between planned and delivered parameters. If used in a near real-time error checking system, patient safety can be improved by equipping the treatment delivery system with additional forcing functions which by-pass human error avenues.

  7. SU-F-T-248: FMEA Risk Analysis Implementation (AAPM TG-100) in Total Skin Electron Irradiation Technique

    Energy Technology Data Exchange (ETDEWEB)

    Ibanez-Rosello, B; Bautista-Ballesteros, J; Bonaque, J [Hospital La Fe, Valencia, Valencia (Spain); Perez-Calatayud, J [Hospital La Fe, Valencia, Valencia (Spain); Clinica Benidorm, Benidorm, Alicante (Spain); Gonzalez-Sanchis, A; Lopez-Torrecilla, J; Brualla-Gonzalez, L; Garcia-Hernandez, T; Vicedo-Gonzalez, A; Granero, D; Serrano, A; Borderia, B; Solera, C [Hospital General ERESA, Valencia, Valencia (Spain); Rosello, J [Hospital General ERESA, Valencia, Valencia (Spain); Universidad de Valencia, Valencia, Valencia (Spain)

    2016-06-15

    Purpose: Total Skin Electron Irradiation (TSEI) is a radiotherapy treatment which involves irradiating the entire body surface as homogeneously as possible. It is composed of an extensive multi-step technique in which quality management requires high consumption of resources and a fluid communication between the involved staff, necessary to improve the safety of treatment. The TG-100 proposes a new perspective of quality management in radiotherapy, presenting a systematic method of risk analysis throughout the global flow of the stages through the patient. The purpose of this work has been to apply TG-100 approach to the TSEI procedure in our institution. Methods: A multidisciplinary team specifically targeting TSEI procedure was formed, that met regularly and jointly developed the process map (PM), following TG-100 guidelines of the AAPM. This PM is a visual representation of the temporal flow of steps through the patient since start until the end of his stay in the radiotherapy service. Results: This is the first stage of the full risk analysis, which is being carried out in the center. The PM provides an overview of the process and facilitates the understanding of the team members who will participate in the subsequent analysis. Currently, the team is implementing the analysis of failure modes and effects (FMEA). The failure modes of each of the steps have been identified and assessors are assigning a value of severity (S), frequency of occurrence (O) and lack of detection (D) individually. To our knowledge, this is the first PM made for the TSEI. The developed PM can be useful for those centers that intend to implement the TSEI technique. Conclusion: The PM of TSEI technique has been established, as the first stage of full risk analysis, performed in a reference center in this treatment.

  8. 17 CFR Appendix A to Subpart A of... - Appendix A to Subpart A of Part 248 Forms

    Science.gov (United States)

    2010-04-01

    ... personal information to market to me.” (4) Nonaffiliate opt-out. If the financial institution shares... not share my personal information with other financial institutions to jointly market to me.” (h... Privacy Form is Used (a) The model form may be used, at the option of a financial institution, including a...

  9. 77 FR 12365 - Agency Information Collection; Activity Under OMB Review: Submission of Audit Reports-Part 248

    Science.gov (United States)

    2012-02-29

    ... Research and Innovative Technology Administration Agency Information Collection; Activity Under OMB Review... techniques or other forms of information technology. DATES: Written comments should be submitted by April 30... Information, RTS-42, Bureau of Transportation Statistics, 1200 New Jersey Avenue SE., Washington, DC 20590...

  10. 30 CFR 250.248 - What solid and liquid wastes and discharges information and cooling water intake information must...

    Science.gov (United States)

    2010-07-01

    ... Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR OFFSHORE OIL AND GAS AND SULPHUR OPERATIONS IN THE OUTER CONTINENTAL SHELF Plans and Information Contents of Development and Production Plans... quantity, and composition of solid and liquid wastes (such as spent drilling fluids, drill cuttings, trash...

  11. 17 CFR 248.30 - Procedures to safeguard customer records and information; disposal of consumer report information.

    Science.gov (United States)

    2010-04-01

    ... Regulation S-P: Privacy of Consumer Financial Information and Safeguarding Personal Information Relation to... security or integrity of customer records and information; and (3) Protect against unauthorized access to... any customer. (b) Disposal of consumer report information and records—(1) Definitions (i) Consumer...

  12. Resenha: GOTTSCHALL, Jonathan. The story telling animal: how stories make us human. Boston,New York: Houghton Mifflin Harcourt, 2012. p. 248.

    Directory of Open Access Journals (Sweden)

    Marcus Assis Lima

    2014-04-01

    Full Text Available O autor é professor de Literatura Americana na Washington & Jefferson College, na Pensilvânia. Esse seu mais recente trabalho procura responder uma pergunta básica: Contar uma estória é apenas uma diversão e um passatempo ou tem alguma função biológica e, portanto, alguma função para espécie humana? Ele parte do princípio que "somos, como espécie, viciados em narrativas. Mesmo quando o corpo vai dormir, a mente continua alerta durante todo o sono, contando estórias a ela mesma" (p.xiv. Gottschall afirma que a mente humana não apenas foi "moldada para a ficção, mas que ela foi moldada pela ficção" (p.56. A "mente narrativa" é viciada em significados. Se ela não consegue encontrar um padrão de significados no mundo, ela irá tentar impor um padrão, ela é como uma fábrica que descarta muitas narrativas verdadeiras quando pode, mas que "também pode fabricar mentiras quando não encontra verdades" (p.103. Ele defende que uma estória de vida seria uma "mitologia pessoal" sobre quem somos - de onde viemos, como chegamos onde chegamos; são quem somos e formam nossa identidade. Em sua linha evolucionista de argumentos, Gottschall acredita que as narrativas, como os organismos biológicos, também evoluem, adaptando-se de acordo com demandas do ambiente. De modo que os seres humanos teriam evoluído para desejarem fortemente as narrativas e esse desejo tem sido um enorme benefício para todos nós: "As narrativas nos dão prazer e instruções. Elas simulam mundos de modo que possamos viver melhor no mundo reeal. Elas nos ajudam a criar laços comunais e a definir nossa cultura. As narrativas foram uma dádiva para nossa espécie" (p.197.

  13. Historic Archaeology of the Johnson (41DN248) and Jones (41DN250) Farmsteads in the Ray Roberts Lake Area: 1850-1950

    Science.gov (United States)

    1996-08-15

    garden. Garden crops included onions, cabbage, tomatoes, potatoes, squash, lettuce, cabbage, and okra . Families also had orchards, collected wild fruits...with the exception of Feature 12, also exhibited fewer burned t-lements. The diagnostic bottle glass in Feature 11 was mostly medicinal/ extract , followed...sherds). Data on vessel type for the bottle glass indicates that the majority of the identified bottle sherds were from medicine and/or extract 0 115

  14. Alexandru Bănică and Ionel Muntele – Resilience and Territory, 248 pp., Terra Nostra, Iaşi, 2015, ISBN 978-606-623-056-8

    Directory of Open Access Journals (Sweden)

    Alexandru-Ionuţ Petrişor

    2017-03-01

    Full Text Available The article is a review of the book “Resilience and territory. Conceptual operating and methodological perspectives”, by Alexandru Bănică and Ionel Muntele, placed within the framework of placing resilience at the core of research.

  15. Conflitos Sociais na Europa: uma paz impossível? 10.5102/uri.v4i1.248

    Directory of Open Access Journals (Sweden)

    Leila Bijos

    2007-08-01

    Full Text Available Análise dos movimentos sociais na França e na América Latina, num contexto de ausência de programas políticos de inserção de imigrantes. Por meio da violência, os jovens manifestantes expressam seu inconformismo com o desemprego, o fracasso escolar e outros sintomas da discriminação de que se julgam vítimas, inclusive por parte da polícia. A passagem do estado de natureza até o estado social produz no homem uma mudança bem acentuada, substituindo, em sua conduta, o instinto pelo sentimento de justiça, e outorgando a suas ações relações morais que antes estavam ausentes. À medida que a repressão se intensifique, fica ainda mais difícil a percepção da realidade. A França, como sociedade pode converter-se em uma ameaça a si própria ao não combinar integração e diferenças socioeconômicas, superando a oposição entre um modelo republicano e um comunitarismo carregado de agressividade. A América Latina vivenciou uma longa era de repressão militar, de violência, oprimida por um Estado distante dos indivíduos; incapaz de suprí-los com políticas públicas e sociais. Na sociedade civil é onde surgem e se desenvolvem os conflitos econômicos, sociais, ideológicos, religiosos, que as instituições públicas têm o dever de equacionar.

  16. The Behaviour of the Military Battery Type BB248/U Used to Start the Engine of the A.P.C.

    Science.gov (United States)

    1979-12-01

    comprises entre —18 et —26 C. La moteur , de type diesel, démarre ~ is t~~pérature minlmale de—20 C sans assistance d’accumulateurs auxilisir es d...démarrage van e entre8.7 at 21.3 Au tandia qua la charge qui traverse lea acci uiateura durant ismarche du moteur oscille entre 6.5 et 9.5 Ah seulement...pour une durée de30 A 45 sin. Enfin , is viacositC de l’huile A moteur eat susceptible d’influenc,rl’aptitude au démarrage. C’est ainsi que deux

  17. A pacemaker with P = 2.48 h modulated the generator of flares in the X-ray light curve of Sgr A* in the year 2012

    Science.gov (United States)

    Leibowitz, Elia

    2017-01-01

    In an intensive observational campaign in the nine month duration of Chandra X-ray Visionary Project that was conducted in the year 2012, 39 large X-ray flares of Sgr A* were recorded. An analysis of the times of the observed flares reveals that the 39 flares are separated in time by intervals that are grouped around integer numbers times 0.10333 days. This time interval is thus the period of a uniform grid of equally spaced points on the time axis. The grouping of the flares around tic marks of this grid is derived from the data with at least a 3.2 σ level of statistical significance. No signal of any period can be found among 22 flares recorded by Chandra in the years 2013-2014. If the 0.10333 day period is that of a nearly circular Keplerian orbit around the blackhole at the center of the Galaxy, its radius is at 7.6 Schwarzschild radii. Large flares were more likely to be triggered when the agent responsible for their outbursts was near the peri-center phase of its slightly eccentric orbit.

  18. Phosphorylation of Serine 248 of C/EBPa Is Dispensable for Myelopoiesis but Its Disruption Leads to a Low Penetrant Myeloid Disorder with Long Latency

    DEFF Research Database (Denmark)

    Hasemann, Marie S; Schuster, Mikkel B; Frank, Anne-Katrine

    2012-01-01

    Transcription factors play a key role in lineage commitment and differentiation of stem cells into distinct mature cells. In hematopoiesis, they regulate lineage-specific gene expression in a stage-specific manner through various physical and functional interactions with regulatory proteins that ...

  19. Influence of cold work in the elastic modulus of the Ti-16.2Hf-24.8Nb-1Zr alloy characterized by instrumented nanoindentation

    OpenAIRE

    González Colominas, Marta; Peña Andrés, Francisco Javier; Manero Planella, José María; Gil Mur, Francisco Javier

    2010-01-01

    Nowadays, β type Ti-based alloys have been developed for load transfer clinical applications due to their superelasticity, shape memory effect, low elastic modulus and high damping capacity [1]. These properties promote bone regeneration and make them promising candidates for being used in load transfer implantology. The objective of the present work is to achieve a material with shape memory properties and/or low elastic modulus. The influence of cold work on the thermoelastic...

  20. The contingency fees ("patto di quota lite") between Italian and American Law: a few remarks on pro-competitive capabilities and limits of the reform introduced by the law 248/06

    OpenAIRE

    Cangiano Raffaele

    2007-01-01

    La recente riforma introdotta dal c.d. decreto Bersani per promuovere la concorrenza nel settore dei servizi professionali ha rimosso dal nostro ordinamento la risalente disposizione che vietava il patto di quota lite. La riforma, intesa a favorire lo sviluppo di una competizione più vivace in un mercato piuttosto ingessato, ha provocato l'indignata reazione degli avvocati che, al contrario, dovrebbero trovare nuovi stimoli nella possibilità di ancorare apertamente il compenso al risultato co...

  1. Thermosalinograph data of the Hawaii Ocean Time-series (HOT) program in the North Pacific 100 miles north of Oahu, Hawaii for cruises HOT239-248 during 2012 (NODC Accession 0120323)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The HOT program makes repeated observations of the physics, biology and chemistry at a site approximately 100 km north of Oahu, Hawaii. Two stations are visited...

  2. A Review of the Literature on Social and Emotional Learning for Students Ages 3-8: Outcomes for Different Student Populations and Settings (Part 4 of 4). REL 2017-248

    Science.gov (United States)

    O'Conner, Rosemarie; De Feyter, Jessica; Carr, Alyssa; Luo, Jia Lisa; Romm, Helen

    2017-01-01

    Social and emotional learning (SEL) is the process by which children and adults learn to understand and manage emotions, maintain positive relationships, and make responsible decisions. This is the fourth in a series of four related reports about what is known about SEL programs for students ages 3-8. The report series addresses four issues raised…

  3. Design and characterization of a low-viscous muscle tissue mimicking media at the ISM-band (2.4–2.48 GHz) for easy antenna displacement in in vitro measurements

    DEFF Research Database (Denmark)

    Jónasson, Sævar Þór; Zhurbenko, Vitaliy; Johansen, Tom Keinicke

    2012-01-01

    Phantoms mimicking electromagnetic properties of biological tissues are widely used in evaluation of electromagnetic field distribution in human body. In this paper, low-viscous, optically transparent liquids that mimic muscle tissue, are designed and characterized. Various mixing ratios of de...

  4. Pap Test Reporting Rates for Conventional Smear and Liquid-Based Cervical Cytology from the Largest Academic Women's Hospital in China: Analysis of 1,248,785 Pap Test Reports.

    Science.gov (United States)

    Tao, Xiang; Austin, R Marshall; Zhang, Hao; Zhang, Lihong; Xiao, Jianan; Wang, Li; Zhou, Xianrong; Zhao, Chengquan

    2015-01-01

    The Obstetrics and Gynecology Hospital of Fudan University (OGHFU) in Shanghai is the largest academic women's hospital in China. Between 2009 and 2014, the use of liquid-based cytology (LBC) significantly increased while gradually adopting the Bethesda System (TBS), and in 2012 local regulations mandated that pathologists replace technicians to sign out Pap tests. A retrospective OGHFU database search documented all Pap test reports between 2009 and 2014 by specimen type, either LBC or conventional Pap smears (CPS), and final reporting category. A total of 1,224,785 Pap reports were analyzed to document variations in Pap test reporting during a period of major change in cervical screening in China. LBC gradually replaced CPS, which declined from over 65% of Pap tests in 2010 to 6.4% in 2014. Of 514,811 Pap reports using the traditional class system, class I (negative) reports accounted for 98.3% of results. With the introduction of TBS reporting, pathologist reviews and substantial replacement of CPS by LBC, the laboratory abnormal Pap test rate increased significantly to almost 5%. Changes in cervical cytology reporting between 2009 and 2014 in China's largest academic women's hospital reflected both increased use of LBC and the introduction of pathologist TBS reporting. Abnormality rates increased significantly and fell within CAP benchmark ranges. © 2016 S. Karger AG, Basel.

  5. Funkcjonalna interpretacja tekstów historycznych. Dwa typy prolepsy w języku greckim na przykładzie Medei Eurypidesa (248–249) i Ewangelii wg św. Jana (12, 12–13)

    OpenAIRE

    Sobotka, Piotr

    2013-01-01

    The two parts of the article analyse the possibilities of a functional interpretation, in terms of the theme-rheme devision, of ancient texts. The author discusses examples from Classical Greek and Latin as well as New Testament Greek, especially their word order, grammatical and lexical features. On this basis he proposes an analytical approach to the description of the linguistic values connected on some degree with the communicative structure of these examples. The contextual p...

  6. CTD data of the Hawaii Ocean Time-series (HOT) program in the North Pacific 100 miles north of Oahu, Hawaii for cruises HOT239-248 during 2012 (NODC Accession 0119895)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The HOT program makes repeated observations of the physics, biology and chemistry at a site approximately 100 km north of Oahu, Hawaii. Two stations are visited...

  7. Niskin bottle data of the Hawaii Ocean Time-series (HOT) program in the North Pacific 100 miles north of Oahu, Hawaii for cruises HOT239-248 during 2012 (NCEI Accession 0119430)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The HOT program makes repeated observations of the physics, biology and chemistry at a site approximately 100 km north of Oahu, Hawaii. Two stations are visited...

  8. Amandine Orsini, 2010, La biodiversité sous influence ? Les lobbies industriels face aux politiques internationales d’environnement, Éditions de l’Université de Bruxelles, Bruxelles, 248 p.

    Directory of Open Access Journals (Sweden)

    Fanny Florémont

    2011-05-01

    Full Text Available Le sommet de Nagoya en octobre 2010 a remis à l’avant-scène les négociations internationales sur la biodiversité. Parmi les mesures phares prises lors de cette dixième conférence des parties à la Convention sur la diversité biologique (CDB, l’adoption du protocole relatif à l’accès et au partage des avantages (APA tirés de l’exploitation des ressources naturelles a conclu huit années de négociations internationales au sujet de la biopiraterie. Comment les firmes agissent-elles lors de l’éla...

  9. Oubrou Tareq, Privot Michaël et Baylocq Cédric, Profession imâm : entretiens avec Michaël Privot et Cédric Baylocq, Paris, Albin Michel, 2009, 248 p.

    Directory of Open Access Journals (Sweden)

    Marie-Laure Boursin

    2011-11-01

    Full Text Available Ce recueil d’entretiens avec Tareq Oubrou s’ouvre sur un avant-propos des co-auteurs, Michaël Privot et Cédric Baylocq. Le premier, docteur en langues et lettres, spécialisé en philosophie islamique classique, s’est converti, adolescent, à l’islam ; le second, doctorant en anthropologie, se présente comme agnostique, « animé de profondes convictions laïques républicaines » (p. 15. A partir d’entretiens effectués entre 2006 et 2008, autour de divers thèmes, les auteurs tentent d’appréhender c...

  10. Discovery of isotopes of the transuranium elements with 93≤Z≤98

    Energy Technology Data Exchange (ETDEWEB)

    Fry, C.; Thoennessen, M., E-mail: thoennessen@nscl.msu.edu

    2013-01-15

    One hundred and five isotopes of the transuranium elements neptunium, plutonium, americium, curium, berkelium, and californium have been observed so far; the discovery of these isotopes is described. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  11. Separation of Transplutonium Elements from Neutron Irradiated Americium-241

    National Research Council Canada - National Science Library

    UENO, Kaoru; WATANABE, Kenju; SAGAWA, Chiaki; ISHIMORI, Tomitaro

    1974-01-01

    .... The ratios of the amounts present of these isotopes were determined by mass spectrometry. It was not possible to identify 249Bk in the berkelium fraction owing to the interference from other β-ray emitting nuclides. In the californium fraction, both spontaneous fission and a-activities due to 250, 252 were observed.

  12. Neutron-Activated Gamma-Emission: Technology Review

    Science.gov (United States)

    2012-01-01

    flux sources developed for boron neutron capture therapy ( BNCT ), found to be an experimental success in cancer treatment (26). 30 Improved flux on...achievable Am americium API associated particle imaging B boron Be beryllium BNCT boron neutron capture therapy C carbon Cf californium Cl

  13. ORF Alignment: NC_003552 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available th = 248 ... Query: 2 ... LKAENLRYVYTSGLIKTTKKTAVRSVDLEILPGEAVAIVGESGCGKSTLAKLLVQQLSP...A 61 ... LKAENLRYVYTSGLIKTTKKTAVRSVDLEILPGEAVAIVGESGCGKSTLAKLLVQQLSPA Sbjct: 1 ... LKAENLRYVYTSGLIKTTKK

  14. ORF Alignment: NC_004605 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available LYMSLLKQAPRAKFSFL 60 ... Query: 189 FLLFKTPGWNDYRYPLLERLKNIGFNASPKVEIEHPAMIHKIILQTDHFGITMSDHVPQG 248 ... ... FLLFKTPGWNDYRYPLLERLKNIGFNASPKVEIEHPAMIHKIILQTDHFGITMSDHVPQG Sbjct: 121 FLLFKTPGWNDYRYPLLERLKNIGFNASPKVEIEHPAMIHKIILQTDHFGITMSDHVPQG 180 ...

  15. 248. Reemplazo de raíz de aorta según técnica de david y de arco aórtico con injerto trifurcado, en un paciente diagnosticado de síndrome de loeys-dietz

    OpenAIRE

    Forteza Gil, A.; Bellot, R.; Diego, J; García, D.; Prieto, G.; Villar, S.; Sánchez, V.; Sanz, P.; J.M.a Cortina

    2010-01-01

    Se describe la técnica quirúrgica de un paciente de 24 años de edad con síndrome de Loeys-Dietz. Se trata de una enfermedad hereditaria del tejido conectivo producida por la mutación del gen del receptor del factor de crecimiento transformante (TGF)-β;. Su característica principal y condicionante del pronóstico es la dilatación del sistema vascular, principalmente la aorta. Método: El paciente presentaba dilatación aneurismática de la raíz y del arco aórtico, con un diámetro máximo de 50 m...

  16. 248. Reemplazo de raíz de aorta según técnica de david y de arco aórtico con injerto trifurcado, en un paciente diagnosticado de síndrome de loeys-dietz

    Directory of Open Access Journals (Sweden)

    A. Forteza Gil

    2010-01-01

    Resultado y conclusiones: No hubo complicaciones postoperatorias. El tratamiento quirúrgico precoz en los pacientes afectos de síndrome de Loeys-Dietz es imprescindible. La experiencia acumulada hasta el momento revela la agresividad de esta enfermedad. Por ello, es necesario un abordaje completo cuando existe afectación a distintos niveles. El empleo de técnicas de preservación valvular permite además disminuir la morbimortalidad asociada a las prótesis valvulares.

  17. Study of Search Engine Transaction Logs Shows Little Change in How Users use Search Engines. A review of: Jansen, Bernard J., and Amanda Spink. “How Are We Searching the World Wide Web? A Comparison of Nine Search Engine Transaction Logs.” Information Processing & Management 42.1 (2006: 248‐263.

    Directory of Open Access Journals (Sweden)

    David Hook

    2006-09-01

    Full Text Available Objective – To examine the interactions between users and search engines, and how they have changed over time. Design – Comparative analysis of search engine transaction logs. Setting – Nine major analyses of search engine transaction logs. Subjects – Nine web search engine studies (4 European, 5 American over a seven‐year period, covering the search engines Excite, Fireball, AltaVista, BWIE and AllTheWeb. Methods – The results from individual studies are compared by year of study for percentages of single query sessions, one term queries, operator (and, or, not, etc. usage and single result page viewing. As well, the authors group the search queries into eleven different topical categories and compare how the breakdown has changed over time. Main Results – Based on the percentage of single query sessions, it does not appear that the complexity of interactions has changed significantly for either the U.S.‐based or the European‐based search engines. As well, there was little change observed in the percentage of one‐term queries over the years of study for either the U.S.‐based or the European‐based search engines. Few users (generally less than 20% use Boolean or other operators in their queries, and these percentages have remained relatively stable. One area of noticeable change is in the percentage of users viewing only one results page, which has increased over the years of study. Based on the studies of the U.S.‐based search engines, the topical categories of ‘People, Place or Things’ and ‘Commerce, Travel, Employment or Economy’ are becoming more popular, while the categories of ‘Sex and Pornography’ and ‘Entertainment or Recreation’ are declining. Conclusions – The percentage of users viewing only one results page increased during the years of the study, while the percentages of single query sessions, oneterm sessions and operator usage remained stable. The increase in single result page viewing implies that users are tending to view fewer results per web query. There was also a significant difference in the percentage of queries using Boolean operators between the US‐based and the European‐based search engines. One of the study’s findings was that results from a study of a particular search engine cannot necessarily be applied to all search engines. Finally, web search topics show a trend towards information or commerce searching rather than entertainment.

  18. Solid-State Neutron Multiplicity Counting System Using Commercial Off-the-Shelf Semiconductor Detectors

    Energy Technology Data Exchange (ETDEWEB)

    Rozhdestvenskyy, S. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

    2017-08-09

    This work iterates on the first demonstration of a solid-state neutron multiplicity counting system developed at Lawrence Livermore National Laboratory by using commercial off-the-shelf detectors. The system was demonstrated to determine the mass of a californium-252 neutron source within 20% error requiring only one-hour measurement time with 20 cm2 of active detector area.

  19. Directed evolution of the periodic table: probing the electronic structure of late actinides.

    Science.gov (United States)

    Marsh, M L; Albrecht-Schmitt, T E

    2017-07-25

    Recent investigations of the coordination chemistry and physical properties of berkelium (Z = 97) and californium (Z = 98) have revealed fundamental differences between post-curium elements and lighter members of the actinide series. This review highlights these developments and chronicles key findings and concepts from the last half-century that have helped usher in a new understanding of the evolution of electronic structure in the periodic table.

  20. Open Source: Potential in Latin America for Radiological Weapons

    Science.gov (United States)

    2010-03-01

    terrorist group would need to acquire a radioactive isotope with a relatively short half-life. 36,37 As an aside, the IAEA verified that depleted...cns.miis.edu/npr/pdfs/123salama.pdf (accessed March 3, 2010), Useful RDD isotopes include cobalt-60, strontium-90, yttrium-90, iridium-192, cesium-137...plutonium-238, radium -226, americium-241, and californium-252. 37 Hansell and Salama, “Does intent equal capability?,” 640-641. 38 Internation Atomic

  1. Gclust Server: 68268 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available 68268 CEL_F09E10.3_25147288 Cluster Sequences Related Sequences(625) 248 dhs-25: DeHydrogenases... Related Sequences(625) Sequence length 248 Representative annotation dhs-25: DeHydrogenases

  2. 76 FR 7245 - Endangered and Threatened Wildlife and Plants; Revised Critical Habitat for the Arroyo Toad

    Science.gov (United States)

    2011-02-09

    ... Designated as Subunit 11b: 844 Subunit 11b: 844 (341). (341). 12. Lower Santa Margarita River San Diego...: 615 (248). (248). 13. Upper Santa Margarita River Riverside, San Entire Unit Included as Unit...

  3. THE EFFECT OF TURKISH CILDREN'S STREET GAMES UPON THE "RESPECT VALUE" OF SECONDARY EDUCATION STUDENTS

    OpenAIRE

    Yener Özen

    2016-01-01

    This research was carried out in order to analyze whether there was a significant difference at respect value levels of secondary education students participated and not participated into the Turkish children’s street games. The research group included totally 496 secondary education students (248 females, 248 males) as 248 sportive secondary education students (124 females, 124 males) and 248 non-sportive secondary education students (124 females, 124 males) participated into Turkish childre...

  4. Journal of Biosciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Biosciences; Volume 28; Issue 3. Issue front cover thumbnail. Volume 28, Issue 3. April 2003, pages 248-358. Viral Evasion of Host Responses. pp 248-248. Preface · Shahid Jameel · More Details Fulltext PDF. pp 249-264 Articles. Viral mimicry of the complement system · John Bernet Jayati ...

  5. PROCEEDINGS OF THE SYMPOSIUM COMMEMORATING THE 25th ANNIVERSARY OF ELEMENTS 97 and 98 HELD ON JAN. 20, 1975

    Energy Technology Data Exchange (ETDEWEB)

    Seaborg, Glenn T.; Street Jr., Kenneth; Thompson, Stanley G.; Ghiorso, Albert

    1976-07-01

    This volume includes the talks given on January 20, 1975, at a symposium in Berkeley on the occasion of the celebration of the 25th anniversary of the discovery of berkelium and californium. Talks were given at this symposium by the four people involved in the discovery of these elements and by a number of people who have made significant contributions in the intervening years to the investigation of their nuclear and chemical properties. The papers are being published here, without editing, in the form in which they were submitted by the authors in the months following the anniversary symposium, and they reflect rather faithfully the remarks made on that occasion.

  6. Composition containing transuranic elements for use in the homeopathic treatment of aids

    Energy Technology Data Exchange (ETDEWEB)

    Lustig, D.

    1996-04-18

    A homeopathic remedy consisting of a composition containing one or more transuranic elements, particularly plutonium, for preventing and treating acquired immunodeficiency syndrome (AIDS) in humans, as well as seropositivity for human immunodeficiency virus (HIV). Said composition is characterized in that it uses any chemical or isotopic form of one or more transuranic elements (neptunium, plutonium, americium, curium, berkelium, californium or einsteinium), particularly plutonium, said form being diluted and dynamized according to conventional homeopathic methods, particularly the so-called Hahnemann and Korsakov methods, and provided preferably but not exclusively in the form of lactose and/or saccharose globules or granules impregnated with the active principle of said composition. (author).

  7. Advanced development of the spectrum sciences Model 5005-TF, single-event test fixture

    Energy Technology Data Exchange (ETDEWEB)

    Ackermann, M.R.; Browning, J.S. (Sandia National Labs., Albuquerque, NM (USA)); Hughlock, B.W. (Boeing Aerospace and Electronics Co., Seattle, WA (USA)); Lum, G.K. (Lockheed Missiles and Space Co., Sunnyvale, CA (USA)); Tsacoyeanes, W.C. (Draper (Charles Stark) Lab., Inc., Cambridge, MA (USA)); Weeks, M.D. (Spectrum Sciences, Inc., Santa Clara, CA (USA))

    1990-09-01

    This report summarizes the advanced development of the Spectrum Sciences Model 5005-TF, Single-Event Test Fixture. The Model 5005-TF uses a Californium-252 (Cf-252) fission-fragment source to test integrated circuits and other devices for the effects of single-event phenomena. Particle identification methods commonly used in high-energy physics research and nuclear engineering have been incorporated into the Model 5005-TF for estimating the particle charge, mass, and energy parameters. All single-event phenomena observed in a device under test (DUT) are correlated with an identified fission fragment, and its linear energy transfer (LET) and range in the semiconductor material of the DUT.

  8. TOWARD AN IMPROVED UNDERSTANDING OF STRUCTURE AND MAGNETISM IN NEPTUNIUM AND PLUTONIUM PHOSPHONATES AND SULFONATES

    Energy Technology Data Exchange (ETDEWEB)

    Albrecht-Schmitt, Thomas

    2012-03-01

    This grant supported the exploratory synthesis of new actinide materials with all of the actinides from thorium to californium with the exceptions of protactinium and berkelium. We developed detailed structure-property relationships that allowed for the identification of novel materials with selective ion-exchange, selective oxidation, and long-range magnetic ordering. We found novel bonding motifs and identified periodic trends across the actinide series. We identified structural building units that would lead to desired structural features and novel topologies. We also characterized many different spectroscopic trends across the actinide series. The grant support the preparation of approximately 1200 new compounds all of which were structurally characterized.

  9. Detection of rare earth elements in Powder River Basin sub-bituminous coal ash using laser-induced breakdown spectroscopy (LIBS)

    Energy Technology Data Exchange (ETDEWEB)

    Tran, Phuoc [National Energy Technology Lab. (NETL), Pittsburgh, PA, (United State; Mcintyre, Dustin [National Energy Technology Lab. (NETL), Pittsburgh, PA, (United State

    2015-10-01

    We reported our preliminary results on the use of laser-induced breakdown spectroscopy to analyze the rare earth elements contained in ash samples from Powder River Basin sub-bituminous coal (PRB-coal). We have identified many elements in the lanthanide series (cerium, europium, holmium, lanthanum, lutetium, praseodymium, promethium, samarium, terbium, ytterbium) and some elements in the actinide series (actinium, thorium, uranium, plutonium, berkelium, californium) in the ash samples. In addition, various metals were also seen to present in the ash samples

  10. Effects Of Parenting Styles On Psychosocial Well-Being Of ...

    African Journals Online (AJOL)

    Results obtained from this study showed that there are significant effects of parenting styles on emotional well-being of adolescents (F = 47.05, df = 1:248, P < .05), Interpersonal-interaction of adolescents (F = 48.92, df = 1:248, P < .05), and stress influence of adolescents (F=82.72, df = 1:248, P < .05). Based on these ...

  11. ORF Alignment: NC_006677 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available SAVQPL 60 ... Query: 128 YLKELCPLAEDLGVSLSLEPLNPTSVNTESAIWTIEQAMDIIEDVGHPAMGLCLDYWNIW 187 ... YLKELCPLAE...DLGVSLSLEPLNPTSVNTESAIWTIEQAMDIIEDVGHPAMGLCLDYWNIW Sbjct: 121 YLKELCPLAEDLGVSLSLE...PLNPTSVNTESAIWTIEQAMDIIEDVGHPAMGLCLDYWNIW 180 ... Query: 248 VEIFSSDVPDSLYDRDLSDVIRFCRE 273 ... VEIFSSDVPDSLYDRDLSDVIRFCRE Sbjct: 241 VEIFSSDVPDSLYDRDLSDVIRFCRE 266

  12. Dicty_cDB: Contig-U15700-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available NNTIDAGILP-----LPAALGDFVFEDTNGNGIQDAGEPGIAGVKVNLLDKDGKPVNGSD 248 Query: 690 SYPINSYTTGPDGYYKFDDFSFGKYIITFSG...G+P+ T G Y N+ PG Y+ +F P FT Sbjct: 232 VKVNLLDKDGKPVNGSD-----GQPLTTTTYANGMYAFTNLLPGDYVVQFIGPEGQAFTT 286

  13. The Relationship Between Marital Adjustment and Psychological Symptoms in Women: The Mediator Roles of Coping Strategies and Gender Role Attitudes

    National Research Council Canada - National Science Library

    Yüksel, Özge; Dağ, İhsan

    2015-01-01

    .... 248 married women participated in the study. Participants completed Marital Adjustment Scale, Ways of Coping Questionnaire, Brief Symptom Inventory, Gender Role Attitudes Scale and Demographic Information Form...

  14. ORF Alignment: EHA1 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available .t00010 [Entamoeba histolytica HM-1:IMSS] ... Length = 50 ... Query: 199 AKEEHECVICRDVLTEAAHLRCGHDFHVSCL...KGWLARASDCPICRNPINL 248 ... AKEEHECVICRDVLTEAAHLRCGHDFHVSCLKGWLARASDCPICRNPINL Sbjct: 1 ... AKEEHECVICRDVLTEAAHLRCGHDFHVSCLKGWLARASDCPICRNPINL 50

  15. Dicty_cDB: VHC472 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Achlya ambisexualis heat shock protein... 248 3e-64 U39047_1( U39047 |pid:none) Achlya ambisexualis heat...Achlya ambisexualis isolate JS855 ... 248 3e-64 AF402100_1( AF402100 |pid:none) Achlya ambisexualis isolate

  16. Browse Author Index

    African Journals Online (AJOL)

    Items 201 - 248 of 248 ... T. Taringa, NT · Taru, Josiah · Tarusarira, Joram · Tayob, A · Tayob, Abdulkader · ter Avest, I · Tisani, E · Tobler, J · Tobler, J · Tobler, Judy · Togarasei, Lovemore ...

  17. EST Table: FS922872 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available xidation reduction) 10/09/28 73 %/248 aa gb|AAQ12887.1| Z9-desaturase SFWG5A [Choristoneura parallel...a] gb|AAQ12888.1| Z9-desaturase SFWG5B [Choristoneura parallela] 10/09/13 53 %/248 aa FBp

  18. Browse Title Index

    African Journals Online (AJOL)

    Items 201 - 248 of 248 ... Vol 28 (1999), The importance of opinion leaders in agricultural production among male and female farmers of Kasenge Parish in the Mukono District of Uganda, Abstract. J. Adupa, G.H. ... Vol 28 (1999), The need for changes in veld management technology generation and dissemination, Abstract.

  19. Citral derived amides as potent bacterial NorA efflux pump inhibitors

    DEFF Research Database (Denmark)

    Thota, Niranjan; Koul, Surrinder; Reddy, Mallepally V

    2008-01-01

    Monoterpene citral and citronellal have been used as starting material for the preparation of 5,9-dimethyl-deca-2,4,8-trienoic acid amides and 9-formyl-5-methyl-deca-2,4,8-trienoic acid amides. The amides on bioevaluation as efflux pump inhibitors (EPIs) against Staphylococcus aureus 1199 and Nor...

  20. AcEST: DK960998 [AcEST

    Lifescience Database Archive (English)

    Full Text Available S=Medic... 248 2e-64 tr|B5LWQ7|B5LWQ7_ZIZJJ Ubiquitin extensive-like protein OS=Zizip... 248 2e-64 tr|A9RJI9...RHYCGKCGLTYVYQKA Sbjct: 121 CPNAECGAGTFMANHFDRHYCGKCGLTYVYQKA 153 >tr|B5LWQ7|B5LWQ7_ZIZJJ Ubiquitin extensive

  1. AcEST: DK960484 [AcEST

    Lifescience Database Archive (English)

    Full Text Available rized protein OS=Medic... 248 2e-64 tr|B5LWQ7|B5LWQ7_ZIZJJ Ubiquitin extensive-like protein OS=Zizip... 248 ...N ECGAGTFMANH DRHYCGKCGLTYVYQKA Sbjct: 121 CPNAECGAGTFMANHFDRHYCGKCGLTYVYQKA 153 >tr|B5LWQ7|B5LWQ7_ZIZJJ Ubiquitin extensive

  2. Dicty_cDB: Contig-U10615-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Expect = 2e-66 Identities = 248/248 (100%) Strand = Plus / Plus Query: 11 acaaccanaaaanatttccgnatcatcacatgnatgganatcnccna...anaaaanatttccgnatcatcacatgnatgganatcnccnaatgnattcaattc 70 Query: 71 atcntttgggatccntntganattacnccna...|||| Sbjct: 71 atcntttgggatccntntganattacnccnacntccnctggngnanantcaatcccttta 130 Query: 131 ncaaaaccnnangctgg...212 (95%) Strand = Plus / Plus Query: 12 caaccanaaaanatttccgnatcatcacatgnatgganatcnccnaatgnattcaattca 71 |||...||||||||||||||||||||||| || ||||||||||||||||| |||||||||||| Sbjct: 11 caaccanaaaanatttccgnatcatcncangnatgganatcnccna

  3. Drug: D05945 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available rial; Coccidiostat [for poultry] CAS: 127-77-5 PubChem: 47207603 LigandBox: D05945 NIKKAJI: J5.401A ATOM 17 ...D05945 Drug Sulfabenz (USAN/INN) C12H12N2O2S 248.0619 248.3009 D05945.gif Antibacte

  4. Detecting, mapping and monitoring of land subsidence in Jharia ...

    Indian Academy of Sciences (India)

    Kalidas Road, Dehradun 248 001, India. CSIR – Central Institute of Mining and Fuel Research, Barwa Road, Dhanbad 826 001, India. Geodetic and Research Branch (Survey of India), 17 E.C. Road, Dehradun 248 001, India. Bharat Coking Coal ...

  5. Fission properties and production mechanisms for the heaviest known elements

    Energy Technology Data Exchange (ETDEWEB)

    Hoffman, D.C.

    1981-01-01

    Mass yields of the spontaneous fission of Fm isotopes, Cf isotopes, and /sup 259/Md are discussed. Actinide yields were measured for bombardments of /sup 248/Cm with /sup 16/O, /sup 18/O, /sup 20/Ne, and /sup 22/Ne. A superheavy product might be produced by bombarding /sup 248/Cm with /sup 48/Ca ions. 12 figures. (DLC)

  6. Association of a functional Indoleamine 2,3-dioxygenase 2 genotype with specific immune responses

    DEFF Research Database (Denmark)

    Køllgaard, Tania; Klausen, Tobias Wirenfeldt; Idorn, Manja

    2012-01-01

    Two frequent single-nucleotide-polymorphisms (SNPs) are present in the indoleamine 2,3-dioxygenase 2 (IDO2) gene that influence its enzymatic activity. Thus, one SNP (R248W) is associated with a reduction in IDO2 catalytic activity, whereas the other SNP (Y359stop) generates a premature stop codon...... responses against IDO2 in patients homozygous for the 248W giving reduction in IDO2 activity compared with the 248R. Hence, spontaneous immune responses against IDO2 seem to be correlated with reduced enzymatic activity of IDO2. The patient IDO2 genotype may well influence the outcome of IDO2-based anti-cancer...

  7. Monte-Carlo Modeling of the Prompt Radiation Emitted by a Nuclear Device in the National Capital Region, Revision 1

    Science.gov (United States)

    2016-08-10

    R. Mercier. 2003. "Dose Response Relationships for Acute Ionizing-Radiation Lethality." Health Physics 565-575. DHS. 2003. National Prepardness...ENDF/B-VII njoy99.248 Sodium - 11 11023.70c ENDF/B-VII njoy99.248 Aluminum - 13 13027.70c ENDF/B-VII njoy99.248 Silicon - Natural Isotope Mix...Mix 19000.62c ENDF/B-VI.8 njoy99.50 Calcium – Natural Isotope Mix 20000.62c ENDF/B-VI.8 njoy99.50 Iron – Natural Isotope Mix 26000.55c RMCCS njoy

  8. Alternatives to the Judicially Promulgated Feres Doctrine

    Science.gov (United States)

    2007-04-01

    1950) (barring a soldier’s suit against the Government for negligently performed surgery). 24 See Costo v. United States, 248 F.3d 863 (9th Cir...Doctrine A. Ambiguous Standard 198 See Costo v. United States, 248 F.3d 863 (9th Cir. 2001) (barring suit for the wrongful death of a sailor who drowned...courts tend to bar the service member’s claim. See Costo v. United States, 248 F.3d 863 (9th Cir. 2001) (barring suit for the drowning death of a

  9. Dollar Summary of Prime Contract Awards by Contractor, State or Country, and Place, FY83, Part 2 (Gillespie Delorenzo Asla & Assocs-Planning Analysis Corp).

    Science.gov (United States)

    1983-01-01

    BURLINGTON MASS 85 85 85 85 N L AVIATION LTD UN KINGDOM 2,558 273 2,285 2,556 273 2,285 M L ENERGIA INC PRINCETON NEW JERSEY 28 28 28 28 M M L...155 155 PIPE INC PORTSMOUTH VIRGINIA 588 588 743 743 PIPE INSTALLATION CORP ATCO ILw jE6EY 42 42 42 42 PIPELINE RENOVATION SERVICE INC FORT BRAGG NCAR...107 107 PIPELINE RENOVATION SERVICE INC LANGLEY AFB VIRGINIA 205 161 44 PIPELINE RENOVATION SERVICE INC NORFOLK VIRGINIA 248 248 560 268 248 44

  10. Dicty_cDB: SLG476 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available keenae haplotype H172 NA... 249 4e-65 DQ996096_2( DQ996096 |pid:none) Littorina keenae haplotype H51 NAD...DQ996194_2( DQ996194 |pid:none) Littorina keenae haplotype H149 NA... 248 7e-65 DQ159954_10( DQ159954 |pid:none)...keenae haplotype H111 NA... 248 1e-64 DQ996137_2( DQ996137 |pid:none) Littorina keenae haplotype H92 NAD...keenae haplotype H163 NA... 248 1e-64 DQ996160_2( DQ996160 |pid:none) Littorina keenae haplotype H115 NA

  11. Measurements of the neutron capture cross sections and incineration potentials of minor-actinides in high thermal neutron fluxes: Impact on the transmutation of nuclear wastes; Mesures des sections efficaces de capture et potentiels d'incineration des actinides mineurs dans les hauts flux de neutrons: Impact sur la transmutation des dechets

    Energy Technology Data Exchange (ETDEWEB)

    Bringer, O

    2007-10-15

    This thesis comes within the framework of minor-actinide nuclear transmutation studies. First of all, we have evaluated the impact of minor actinide nuclear data uncertainties within the cases of {sup 241}Am and {sup 237}Np incineration in three different reactor spectra: EFR (fast), GT-MHR (epithermal) and HI-HWR (thermal). The nuclear parameters which give the highest uncertainties were thus highlighted. As a result of fact, we have tried to reduce data uncertainties, in the thermal energy region, for one part of them through experimental campaigns in the moderated high intensity neutron fluxes of ILL reactor (Grenoble). These measurements were focused onto the incineration and transmutation of the americium-241, the curium-244 and the californium-249 isotopes. Finally, the values of 12 different cross sections and the {sup 241}Am isomeric branching ratio were precisely measured at thermal energy point. (author)

  12. A gas secondary electron detector

    CERN Document Server

    Drouart, A; Alamanos, N; Auger, F; Besson, P; Bougamont, E; Bourgeois, P; Lobo, G; Pollacco, E C; Riallot, M

    2002-01-01

    A new Secondary Electron gas Detector (SED) is under development to be used in conjunction with an emissive foil to detect low energy heavy ions as an alternative to micro-channel plates. It could measure position and time of flight. Secondary electrons are accelerated to 10 keV so that they can cross through the 0.9 mu m Mylar entrance window. The electrons then are multiplied in the isobutane gas of the detector at 4-10 Torr. A time resolution of 150 ps and a spatial resolution of 3 mm have been obtained by using californium fission fragments on a prototype detector of 7x7 cm sup 2. The advantage of the SED against MCP is that its size is not limited. Our final goal is to build a large size detector (15x40 cm sup 2) that will operate at the focal plane of the VAMOS magnetic spectrometer at GANIL.

  13. Environmental assessment of the thermal neutron activation explosive detection system for concourse use at US airports

    Energy Technology Data Exchange (ETDEWEB)

    Jones, C.G.

    1990-08-01

    This document is an environmental assessment of a system designed to detect the presence of explosives in checked airline baggage or cargo. The system is meant to be installed at the concourse or lobby ticketing areas of US commercial airports and uses a sealed radioactive source of californium-252 to irradiate baggage items. The major impact of the use of this system arises from direct exposure of the public to scattered or leakage radiation from the source and to induced radioactivity in baggage items. Under normal operation and the most likely accident scenarios, the environmental impacts that would be created by the proposed licensing action would not be significant. 44 refs., 19 figs., 18 tabs.

  14. Chelation and stabilization of berkelium in oxidation state +IV

    Science.gov (United States)

    Deblonde, Gauthier J.-P.; Sturzbecher-Hoehne, Manuel; Rupert, Peter B.; An, Dahlia D.; Illy, Marie-Claire; Ralston, Corie Y.; Brabec, Jiri; de Jong, Wibe A.; Strong, Roland K.; Abergel, Rebecca J.

    2017-09-01

    Berkelium (Bk) has been predicted to be the only transplutonium element able to exhibit both +III and +IV oxidation states in solution, but evidence of a stable oxidized Bk chelate has so far remained elusive. Here we describe the stabilization of the heaviest 4+ ion of the periodic table, under mild aqueous conditions, using a siderophore derivative. The resulting Bk(IV) complex exhibits luminescence via sensitization through an intramolecular antenna effect. This neutral Bk(IV) coordination compound is not sequestered by the protein siderocalin—a mammalian metal transporter—in contrast to the negatively charged species obtained with neighbouring trivalent actinides americium, curium and californium (Cf). The corresponding Cf(III)-ligand-protein ternary adduct was characterized by X-ray diffraction analysis. Combined with theoretical predictions, these data add significant insight to the field of transplutonium chemistry, and may lead to innovative Bk separation and purification processes.

  15. The CARIBU EBIS control and synchronization system

    Science.gov (United States)

    Dickerson, Clayton; Peters, Christopher

    2015-01-01

    The Californium Rare Isotope Breeder Upgrade (CARIBU) Electron Beam Ion Source (EBIS) charge breeder has been built and tested. The bases of the CARIBU EBIS electrical system are four voltage platforms on which both DC and pulsed high voltage outputs are controlled. The high voltage output pulses are created with either a combination of a function generator and a high voltage amplifier, or two high voltage DC power supplies and a high voltage solid state switch. Proper synchronization of the pulsed voltages, fundamental to optimizing the charge breeding performance, is achieved with triggering from a digital delay pulse generator. The control system is based on National Instruments realtime controllers and LabVIEW software implementing Functional Global Variables (FGV) to store and access instrument parameters. Fiber optic converters enable network communication and triggering across the platforms.

  16. Off-line commissioning of EBIS and plans for its integration into ATLAS and CARIBU

    Energy Technology Data Exchange (ETDEWEB)

    Ostroumov, P. N., E-mail: ostroumov@anl.gov; Barcikowski, A.; Dickerson, C. A.; Mustapha, B.; Perry, A.; Sharamentov, S. I.; Vondrasek, R. C.; Zinkann, G. [Argonne National Laboratory, Argonne, Illinois 60439 (United States)

    2016-02-15

    An Electron Beam Ion Source Charge Breeder (EBIS-CB) has been developed at Argonne to breed radioactive beams from the CAlifornium Rare Isotope Breeder Upgrade (CARIBU) facility at Argonne Tandem Linac Accelerator System (ATLAS). The EBIS-CB will replace the existing ECR charge breeder to increase the intensity and significantly improve the purity of reaccelerated radioactive ion beams. The CARIBU EBIS-CB has been successfully commissioned offline with an external singly charged cesium ion source. The performance of the EBIS fully meets the specifications to breed rare isotope beams delivered from CARIBU. The EBIS is being relocated and integrated into ATLAS and CARIBU. A long electrostatic beam transport system including two 180° bends in the vertical plane has been designed. The commissioning of the EBIS and the beam transport system in their permanent location will start at the end of this year.

  17. Populations of selected microbial and fungal species growing on the surface of rape seeds following treatment with desiccants or plant growth regulators.

    Science.gov (United States)

    Frac, Magdalena; Jezierska-Tys, Stefania; Tys, Jerzy

    2010-01-01

    The aim of this study was to determine the effects of desiccants and plant growth regulators on selected microbial species affecting rape seeds, with special emphasis on the growth of fungi and identification of the genus and species composition. The experimental material in the study was seeds of winter rape cv. Californium that were collected from the field during combine harvest. The chemical agents applied, both desiccants and growth regulators, generally decreased the populations of bacteria occurring on the surface of rape seeds. The responses of fungi depended upon the type of agent applied and were manifested as either stimulation or inhibition of the growth of the fungal species. The fungi isolated from the surface of rape seeds were characteristic of those found in the field environment (Cladosporium and Penicillium) and typical for those present on the surface of rape seeds (Alternaria).

  18. Reliability of semiconductor and gas-filled diodes for over-voltage protection exposed to ionizing radiation

    Directory of Open Access Journals (Sweden)

    Stanković Koviljka

    2009-01-01

    Full Text Available The wide-spread use of semiconductor and gas-filled diodes for non-linear over-voltage protection results in a variety of possible working conditions. It is therefore essential to have a thorough insight into their reliability in exploitation environments which imply exposure to ionizing radiation. The aim of this paper is to investigate the influence of irradiation on over-voltage diode characteristics by exposing the diodes to californium-252 combined neutron/gamma radiation field. The irradiation of semiconductor over-voltage diodes causes severe degradation of their protection characteristics. On the other hand, gas-filled over-voltage diodes exhibit a temporal improvement of performance. The results are presented with the accompanying theoretical interpretations of the observed changes in over-voltage diode behaviour, based on the interaction of radiation with materials constituting the diodes.

  19. Triton and alpha-particle contribution from LiF converter for neutron dosimeter

    CERN Document Server

    Camacho, M E; Balcazar, M

    1999-01-01

    A personnel neutron dosimeter prototype based on chemical and electrochemical etched CR-39 detector, combined with LiF converter, has been calibrated using an ICRP-like phantom, under a heavy-water moderated Californium source neutron spectra; A conversion factor of 1.052+-126 spots cm sup - sup 2 mSv sup - sup 1 was obtained. The sealing properties of the detector holder showed a ten-fold reduction in radon background when it was tested in a high radon atmosphere. A convenient mechanical shock resistance was achieved in LiF converters by sintering to 11 tons pressure LiF powder at 650 deg. C, during one hour.

  20. Study of reproducibility of measurements with the spectrometer of Bonner multispheres

    Energy Technology Data Exchange (ETDEWEB)

    Azevedo, G.A.; Pereira, W.W.; Patrao, K.C.S.; Fonseca, E.S., E-mail: geisadeazevedo@gmail.com, E-mail: walsan@ird.gov.br, E-mail: karla@ird.gov.br, E-mail: evaldo@ird.gov.br [Instituto de Radionprotecao e Dosimetria (IRD/CNEN-RJ), Rio de Janeiro, RJ (Brazil)

    2013-07-01

    This work aims to study the metrological behavior of the Bonner Multisphere Spectrometer (BMS) of the LN / LNMRI / IRD - Laboratorio Metrologia de Neutrons / Laboratorio Nacional de Metrologia e Radiacao Ionizante / Instituto de Radioprotecao e Dosimetria, for measurements in repeatability and reproducibility conditions. Initially, a simulation was done by applying the Monte Carlo method, using the MCNP code and respecting the ISO 8529-1 (2001), using the sources of Californium ({sup 252} Cf), Americium-Beryllium ({sup 241} AmBe) and californium in heavy water (Cf + D{sub 2}O), all located at a distance of 100 cm from the neutron detector ({sup 6}Li (Eu) - crystal scintillator). In this program, the counting of neutrons that are captured by the detector was made. The source is located in the center of a sphere of radius 300 cm. Analyzes the impact of these neutrons in a point of the sphere wall, which in this case acted as a neutron detector and from there, it is estimated the number of neutrons that collide in the whole sphere. The purpose is to obtain the neutron count for different energy bands in a solid field of neutrons, since they have a spectrum ranging from a low to a high energy that can also vary within a particular environment. Wishes to obtain new fields with different sources and moderators materials to be used as new reference fields. Measurements are being conducted for these fields, with the aim of analyzing the variability conditions of the measurement (repeatability and reproducibility) in LEN - Laboratorio de Espectrometria de Neutrons of the LN/LMNRI/IRD. Thus, the spectrometer will be used to improve both the knowledge of the spectrum as the standard of neutrons of the lab, proving that a spectrometry is essential for correct measurement.

  1. Phylogeography and population genetic structure of double-crested cormorants (Phalacrocorax auritus)

    Science.gov (United States)

    Mercer, Dacey; Haig, Susan M.; Roby, Daniel D.

    2013-01-01

    We examined the genetic structure of doublecrested cormorants (Phalacrocorax auritus) across their range in the United States and Canada. Sequences of the mitochondrial control region were analyzed for 248 cormorants

  2. ORF Alignment: NC_006086 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006086 gi|50914876 >1edt0 6 248 223 459 1e-24 ... emb|CAE84954.1| chitin binding protein [Debaryomyces robe...rtsiae] ... Length = 237 ... Query: 138 WHDKTSDPTEKDKVNSMGELPKEVDLAFIFHDWTKDYSL

  3. Excimer Laser Etching

    Energy Technology Data Exchange (ETDEWEB)

    Boatner, Lynn A [ORNL; Longmire, Hu Foster [ORNL; Rouleau, Christopher M [ORNL; Gray, Allison S [ORNL

    2008-04-01

    Excimer laser radiation at a wavelength of = 248 nm represents a new etching method for the preparation of metallographic specimens. The method is shown to be particularly effective for enhancing the contrast between different phases in a multiphase metallographic specimen.

  4. Multilocus phylogeny of East African gerbils (Rodentia, Gerbilliscus) illuminates the history of the Somali-Masai savanna

    Czech Academy of Sciences Publication Activity Database

    Aghová, T.; Šumbera, R.; Piálek, L.; Mikula, Ondřej; McDonough, M. M.; Lavrenchenko, L. A.; Meheretu, Y.; Mbau, J. S.; Bryja, J.

    2017-01-01

    Roč. 44, č. 10 (2017), s. 2295-2307 ISSN 0305-0270 Institutional support: RVO:67985904 Keywords : biogeography * Gerbillinae * historical DNA * murid rodents * phylogeography Subject RIV: EG - Zoology Impact factor: 4.248, year: 2016

  5. Gclust Server: 92122 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available Related Sequences(248) 213 two-component hybrid sensor and regulator [Nostoc sp. PCC 7120] 1 1.00e-99...Representative annotation two-component hybrid sensor and regulator [Nostoc sp. PCC 7120] Number of Sequences

  6. 30 CFR 947.773 - Requirements for permits and permit processing.

    Science.gov (United States)

    2010-07-01

    ....160 (2) Department of Natural Resources: Burning Permit, RCW 77.04.150 & .170 Dumping Permit, RCW 76..., RCW 75.20.100 (6) Department of Social Health Services: Public Sewage, WAC 248.92 Public Water Supply...

  7. Isabel Allende: "La casa de los espíritos"

    OpenAIRE

    Scheerer, Thomas M. (Prof.)

    1992-01-01

    Isabel Allende: "La casa de los espíritos" / Monika M. u. Thomas M. Scheerer. - In: Der hispanoamerikanische Roman / hrsg. von Volker Roloff ... - Darmstadt : Wiss. Buchges. - Bd. 2. (1992). - S. 238-248

  8. Review: Lorenzo Cotula, The Great African Land Grab?: Agricultural Investments and the Global Food System (2013

    Directory of Open Access Journals (Sweden)

    Kerstin Nolte

    2013-01-01

    Full Text Available Review of the monograph:Lorenzo Cotula, The Great African Land Grab?: Agricultural Investments and the Global Food System, London, New York: Zed Books, 2013, ISBN 9781780324203, 248 pages

  9. First-Year Evaluation of Mexico's Tax on Nonessential Energy-Dense Foods: An Observational Study

    National Research Council Canada - National Science Library

    Batis, Carolina; Rivera, Juan A; Popkin, Barry M; Taillie, Lindsey Smith

    2016-01-01

    ... of the Mexican urban population from The Nielsen Company's Mexico Consumer Panel Services (CPS). We included 6,248 households that participated in the Nielsen CPS in at least 2 mo during 2012-2014...

  10. Arora, Dr Baldev Raj

    Indian Academy of Sciences (India)

    Bombay), FNASc. Date of birth: 10 October 1947. Specialization: Electromagnetic Geophysics, Seismotectonics and Geomagnetism Address: 36, Janakpuri, Engineers Enclave, Phase III, GMS Road, Dehra Dun 248 001, Uttarakhand Contact:

  11. Zoning Districts - Volusia County HUB Zones

    Data.gov (United States)

    NSGIC Local Govt | GIS Inventory — Historically Underutilized Business (HUB) Zones in Volusia County. Go to http://www.sba.gov/hubzone or contact the Department of Economic Development (386) 248-8048...

  12. What influences youth to operate all-terrain vehicles safely?

    National Research Council Canada - National Science Library

    Grummon, A. H; Heaney, C. A; Dellinger, W. A; Wilkins, J. R

    2014-01-01

    .... Youth (n = 248) aged 9–14 from central Ohio and one of their parents completed self-report measures of ATV safety behaviors, youth general propensity for risk taking, protection motivation and parental behaviors to facilitate youth safety...

  13. Tagasi Pariisis / Karl Rumor

    Index Scriptorium Estoniae

    Rumor, Karl, pseud., 1886-1971

    2008-01-01

    Prantsusmaa sisepoliitilisest olustikust. Poliitilistest oludest 1937. aasta Euroopas, sõjameeleoludest Vahemerel, Nyloni konverentsist. Varem ilmunud: Uus Eesti 21. juuni 1937, nr. 166; 8., 13. sept. 1937, nr. 243, 248

  14. Drug: D09741 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available mones 248 Mixed hormone preparations 2482 Estrogens and progestins D09741 Drospiren...[HSA:1557] Therapeutic category of drugs in Japan [BR:br08301] 2 Agents affecting individual organs 24 Hor

  15. Influence of Self-Esteem and Self-Monitoring on Attitudes toward ...

    African Journals Online (AJOL)

    Results show that there is a significant gender difference in attitudes towards internet fraud (F{1.248} =3.785,P.05) and that there is a significant main influence of self- monitoring on attitude towards ...

  16. Divorce, divorce rates, and professional care seeking for mental health problems in Europe: a cross-sectional population-based study

    National Research Council Canada - National Science Library

    Bracke, Piet F; Colman, Elien; Symoens, Sara A A; Van Praag, Lore

    2010-01-01

    ...-level divorce rates--contribute to marital status differences in professional care-seeking behavior. We use data from the Eurobarometer 248 on mental well-being that was collected via telephone interviews...

  17. Gupta, Prof. Santosh Kumar

    Indian Academy of Sciences (India)

    objective Evolutionary Algorithm and Experimental Online Optimal Control Address: Distinguished Professor, Department of Chemical Engineering, University of Petroleum & Energy Studies, Energy Acres, PO Bidholi, Dehra Dun 248 007, ...

  18. Selected Oral Health Indicators in the United States, 2005-2008

    Science.gov (United States)

    ... a dental filling, crown, or other type of restorative dental material applied to the tooth regardless of ... 248). 2007. Burt BA, Eklund SA. Dentistry, Dental Practice, and the Community, 6th ed. St. Louis, MO: ...

  19. Evolutionary history of the thicket rats (genus Grammomys) mirrors the evolution of African forests since late Miocene

    Czech Academy of Sciences Publication Activity Database

    Bryja, J.; Šumbera, R.; Kerbis Peterhans, J. C.; Aghová, T.; Bryjová, A.; Mikula, Ondřej; Nicolas, V.; Denys, C.; Verheyen, E.

    2017-01-01

    Roč. 44, č. 1 (2017), s. 182-194 ISSN 0305-0270 Institutional support: RVO:67985904 Keywords : Arvicanthini * coastal forests * late Miocene Subject RIV: EG - Zoology Impact factor: 4.248, year: 2016

  20. 78 FR 4469 - Biweekly Notice; Applications and Amendments to Facility Operating Licenses and Combined Licenses...

    Science.gov (United States)

    2013-01-22

    ..., Pilgrim Nuclear Power Station (Pilgrim), Plymouth County, Massachusetts Entergy Nuclear Vermont Yankee...--193; IP2--271; IP3--248; Palisades-- ] 249; Pilgrim--239; RBS--178; VY--253; and Waterford--240...

  1. Theoretical study on production cross sections of exotic actinide nuclei in multinucleon transfer reactions

    Science.gov (United States)

    Zhu, Long

    2017-12-01

    Within the dinuclear system (DNS) model, the multinucleon transfer reactions 129,136Xe + 248Cm, 112Sn + 238U, and 144Xe + 248Cm are investigated. The production cross sections of primary fragments are calculated with the DNS model. By using a statistical model, we investigate the influence of charged particle evaporation channels on production cross sections of exotic nuclei. It is found that for excited neutron-deficient nuclei the charged particle evaporation competes with neutron emission and plays an important role in the cooling process. The production cross sections of several exotic actinide nuclei are predicted in the reactions 112Sn + 238U and 136,144Xe + 248Cm. Considering the beam intensities, the collisions of 136,144Xe projectiles with a 248Cm target for producing neutron-rich nuclei with Z=92‑96 are investigated. Supported by National Natural Science Foundation of China (11605296) and Natural Science Foundation of Guangdong Province, China (2016A030310208)

  2. 76 FR 60836 - Applicants

    Science.gov (United States)

    2011-09-30

    ... [email protected]fmc.gov . A & D International Logistics, Corp. (NVO), 248 NW., 62nd Avenue, Miami, FL 33126...: New NVO License. Draco Freight Logistics Corporation (NVO & OFF), 8544 NW. 93rd Street, Medley, FL...

  3. Bagchee, Krishnadas

    Indian Academy of Sciences (India)

    . (London), FNA. Date of birth: 19 January 1898. Date of death: 6 January 1973. Specialization: Cytology, Genetics, Timber Pathology, Forest Pathology, Mycology Last known address: Nandadeep, 63A, Rajpur Road, Dehra Dun 248 001.

  4. NIHSeniorHealth

    Medline Plus

    Full Text Available ... next Play now What Are Advance Directives? - Duration: 2 minutes, 55 seconds. 16,759 views 2 years ... now Preparing for the End of Life - Duration: 2 minutes, 33 seconds. 5,248 views 3 years ...

  5. Evaluation of Statens Serum Institut Enteric Medium for Detection of Enteric Pathogens

    OpenAIRE

    Blom, Marianne; Meyer, Aase; Gerner-Smidt, Peter; Gaarslev, Knud; Espersen, Frank

    1999-01-01

    The efficacy of the Statens Serum Institut (SSI) enteric medium for isolation and direct identification of enteric pathogens was evaluated. Six different biochemical reactions can be read by using the SSI enteric medium, allowing direct identification of a range of enteric pathogens. All 248 gram-negative bacterial species that were tested grew on the SSI enteric medium. Only 10 of 248 bacteria (4%) showed discrepant results in the biochemical reactions, and none of these were enteric pathoge...

  6. The Program Manager’s Support System (PMSS). An Executive Overview and Descriptions of Functional Modules

    Science.gov (United States)

    1989-05-01

    50 Program Office Organization and Staffing Module 50 Expert Systems for Acquisition Strategies 51 Procurement Document Generator Module 51...PC; Z-248 50 trade-off analysis Program Office Organization PROS Develop PMO organization Prototype IBM-PC; Z-248 50 and Staffing charts, on board...prototype moduie. It requires a color graphics card. Program Office Organization and Staffing (PROS) Module The Program Office Organization and Staffing

  7. Chromium allergy

    DEFF Research Database (Denmark)

    Hansen, M B; Johansen, J D; Menné, Torkil

    2003-01-01

    . The MET10% for Cr(III) and Cr(VI) was calculated from the dose-response curves to be 0.18 microg/cm2/48 h (6 p.p.m.) and 0.03 microg/cm2/48 h (1 p.p.m.), respectively. No significant differences in the response to combined Cr(III) and Cr(VI) solutions versus single solutions were found. Cr...

  8. 12 CFR 208.1 - Authority, purpose, and scope.

    Science.gov (United States)

    2010-01-01

    ..., 248(a), 248(c), 481-486, 601 and 611); sections 1814, 1816, 1818, 1831o, 1831p-1, 1831r-1 and 1835a of the Federal Deposit Insurance Act (FDI Act) (12 U.S.C. 1814, 1816, 1818, 1831o, 1831p-1, 1831r-1, and... banks organized under local laws, located in a dependency or insular possession or any part of the...

  9. 77 FR 51503 - Endangered and Threatened Wildlife and Plants; Revisions to the Regulations for Impact Analyses...

    Science.gov (United States)

    2012-08-24

    ... the jeopardy standard. 248 F.3d at 1283. According to the court, these definitions thus led FWS to... impacts pursuant to New Mexico Cattlegrowers Ass'n v. FWS, 248 F.3d 1277 (10th Cir. 2001). The genesis of... called into question, id. at 1283 n.2 (citing Sierra Club v. U.S. Fish & Wildlife Serv., 245 F.3d 434...

  10. Gclust Server: 92222 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available 92222 PoTR_582834 Cluster Sequences Related Sequences(248) 226 eugene3.14400002 1 1....00e-19 14.29 0.0 0.0 0.0 0.0 0.0 Show 92222 Cluster ID 92222 Sequence ID PoTR_582834 Link to cluster sequen...ces Cluster Sequences Link to related sequences Related Sequences(248) Sequence length 226 Representative an

  11. Biased and constitutive signaling in the CC-chemokine receptor CCR5 by manipulating the interface between transmembrane helices 6 and 7

    DEFF Research Database (Denmark)

    Steen, Anne; Thiele, Stefanie; Guo, Dong

    2013-01-01

    The equilibrium state of CCR5 is manipulated here toward either activation or inactivation by introduction of single amino acid substitutions in the transmembrane domains (TMs) 6 and 7. Insertion of a steric hindrance mutation in the center of TM7 (G286F in position VII:09/7.42) resulted in biased....... Furthermore, replacing Trp-248 with a smaller aromatic amino acid (Tyr/Phe) impaired the β-arrestin recruitment, yet with maintained G protein activity (biased signaling); also, here aplaviroc switched to a full agonist. Thus, the altered positioning of Trp-248, induced by G286F, led to a constraint of G......-conserved Trp in TM6 (Trp-248 in position VI:13/6.48, part of the CWXP motif) was influenced by the G286F mutation, causing Trp-248 to change orientation away from TM7. The essential role of Trp-248 in CCR5 activation was supported by complete inactivity of W248A-CCR5 despite maintaining chemokine binding...

  12. Bk and Cf chromatographic separation and ²⁴⁹Bk/²⁴⁸Cm and ²⁴⁹Cf/²⁴⁸Cm elemental ratios determination by inductively coupled plasma quadrupole mass spectrometry.

    Science.gov (United States)

    Gourgiotis, A; Isnard, H; Nonell, A; Aubert, M; Stadelmann, G; Dupont, E; AlMahamid, I; Tiang, G; Rao, L; Lukens, W; Cassette, P; Panebianco, S; Letourneau, A; Chartier, F

    2013-03-15

    The French Atomic Energy Commission has carried out several experiments for the study of minor-actinide transmutation processes in high intensity thermal neutron flux. In this context a Cm sample enriched in (248)Cm (∼97%) was irradiated in a thermal neutron flux at the High Flux Reactor (HFR) of the Laue-Langevin Institute (ILL). The precise and accurate determination of Cf isotope ratios and of (249)Bk/(248)Cm and (249)Cf/(248)Cm elemental ratios in the (248)Cm irradiated sample is crucial for the calculation of actinide neutron capture cross-sections. This work describes an analytical procedure for the separation and the isotope ratio measurement of Bk and Cf in the irradiated sample. The Bk and Cf separation is based on a lanthanides separation protocol previously developed by the laboratory. Well-defined retention times for Bk and Cf were obtained by coupling the Ionic Chromatography (IC) with an ICP-QMS. All conditions of element separation by IC and the different steps of the analytical protocol in order to obtain the isotopic and elemental ratios are presented. Relative uncertainties of Cf isotopic ratios range from 0.3% to 0.5% and the uncertainty of the (249)Bk/(248)Cm and (249)Cf/(248)Cm elemental ratios are respectively 6.1% and 3.2%. This level of uncertainty for both isotopic and elemental ratios is in perfect agreement with the requirement for transmutation studies. Copyright © 2012 Elsevier B.V. All rights reserved.

  13. Recommendations for including surgery on the public health agenda.

    Science.gov (United States)

    Wong, Evan G; Ameh, Emmanuel A; Wren, Sherry M; Mulwafu, Wakisa; Hardy, Mark A; Nwomeh, Benedict C; Kushner, Adam L; Price, Raymond R

    2015-07-01

    Surgical care has made limited inroads on the public health and global health agendas despite increasing data showing the enormous need. The objective of this study was to survey interested members of a global surgery community to identify patterns of thought regarding barriers to political priority. All active members of the nongovernmental organization Surgeons OverSeas were surveyed and asked why surgical care is not receiving recognition and support on the public health and global health agenda. Responses were categorized using the Shiffman framework on determinants of political priority for global initiatives by two independent investigators, and the number of responses for each of the 11 factors was calculated. Seventy-five Surgeons OverSeas members replied (75 of 176; 42.6% response rate). A total of 248 individual reasons were collected. The most common responses were related to external frame, defined as public portrayals of the issue (60 of 248; 24.2%), and lack of effective interventions (48 of 248; 19.4%). Least cited reasons related to global governance structure (4 of 248; 2.4%) and policy window (4 of 248; 1.6%). This survey of a global surgery community identified a number of barriers to the recognition of surgical care on the global health agenda. Recommendations include improving the public portrayal of the problem; developing effective interventions and seeking strong and charismatic leadership. Copyright © 2015 Elsevier Inc. All rights reserved.

  14. Influence of laser wavelength on two-dimensional carbon nanosheet formation from laser-induced exfoliation of naphthalene

    Science.gov (United States)

    Qian, Min; Niu, Yue Ping; Gong, Shang Qing

    2018-01-01

    Pulsed Nd:YAG (532 nm) and Excimer (248 nm) lasers were employed to produce freestanding, two-dimensional (2D), carbon nanosheets (CNSs) from naphthalene, through laser-induced exfoliation. The polymer-to-carbon transition was investigated in terms of laser wavelengths, fluences, as well as target preparations. Continuous and porous CNSs of several nanometers in thickness and micrometers in size were obtained from 532 and 248 nm pulsed laser exfoliation of spin-coated naphthalene films, respectively. The porous morphology is ascribed to the photon-induced dissociation of chemical bonds dominated in 248 nm laser interaction with ablated naphthalene. With the increase of laser fluences from 1 to 5 J cm-2, amorphous carbon and ultrathin CNS structures were obtained in sequence. This work revealed a general mechanism of producing 2D structured carbon materials from pulsed laser exfoliation.

  15. Settlement induction of Acropora palmata planulae by a GLW-amide neuropeptide

    Science.gov (United States)

    Erwin, P. M.; Szmant, A. M.

    2010-12-01

    Complex environmental cues dictate the settlement of coral planulae in situ; however, simple artificial cues may be all that is required to induce settlement of ex situ larval cultures for reef re-seeding and restoration projects. Neuropeptides that transmit settlement signals and initiate the metamorphic cascade have been isolated from hydrozoan taxa and shown to induce metamorphosis of reef-building Acropora spp. in the Indo-Pacific, providing a reliable and efficient settlement cue. Here, the metamorphic activity of six GLW-amide cnidarian neuropeptides was tested on larvae of the Caribbean corals Acropora palmata, Montastraea faveolata and Favia fragum. A. palmata planulae were induced to settle by the exogenous application of the neuropeptide Hym-248 (concentrations ≥1 × 10-6 M), achieving 40-80% attachment and 100% metamorphosis of competent planulae (≥6 days post-fertilization) during two spawning seasons; the remaining neuropeptides exhibited no activity. Hym-248 exposure rapidly altered larval swimming behavior (96% metamorphosis after 6 h. In contrast , M. faveolata and F. fragum planulae did not respond to any GLW-amides tested, suggesting a high specificity of neuropeptide activators on lower taxonomic scales in corals. Subsequent experiments for A. palmata revealed that (1) the presence of a biofilm did not enhance attachment efficiency when coupled with Hym-248 treatment, (2) neuropeptide-induced settlement had no negative effects on early life-history developmental processes: zooxanthellae acquisition and skeletal secretion occurred within 12 days, colonial growth occurred within 36 days, and (3) Hym-248 solutions maintained metamorphic activity following storage at room temperature (10 days), indicating its utility in remote field settings. These results corroborate previous studies on Indo-Pacific Acropora spp. and extend the known metamorphic activity of Hym-248 to Caribbean acroporids. Hym-248 allows for directed and reliable settlement of

  16. Erythrobacter pelagi sp. nov., a member of the family Erythrobacteraceae isolated from the Red Sea

    KAUST Repository

    Wu, H.-x.

    2011-08-05

    A novel Gram-negative, aerobic, catalase- and oxidase-positive, non-sporulating, non-motile, rod-shaped bacterium, designated strain UST081027-248(T), was isolated from seawater of the Red Sea. Phylogenetic analysis based on 16S rRNA gene sequences showed that strain UST081027-248(T) fell within the genus Erythrobacter. Levels of 16S rRNA gene sequence similarity between the novel strain and the type strains of Erythrobacter species ranged from 95.3% (with Erythrobacter gangjinensis) to 98.2% (with Erythrobacter citreus). However, levels of DNA-DNA relatedness between strain UST081027-248(T) and the type strains of closely related species were below 70%. Optimal growth of the isolate occurred in the presence of 2.0% NaCl, at pH 8.0-9.0 and at 28-36 degrees C. The isolate did not produce bacteriochlorophyll a. The predominant cellular fatty acids were C-17:1 omega 6c, summed feature 8 (C-18:1 omega 6c and/or C-18:1 omega 7c) and C-15:0 2-OH. The genomic DNA G+C content of strain UST081027-248(T) was 60.4 mol%. Phenotypic properties and phylogenetic distinctiveness clearly indicated that strain UST081027-248(T) represents a novel species of the genus Erythrobacter, for which the name Erythrobacter pelagi sp. nov. is proposed. The type strain is UST081027-248(T) (=JCM 17468(T)=NRRL 59511(T)).

  17. Decision Analysis Model for Passenger-Aircraft Fire Safety with Application to Fire-Blocking of Seats

    Science.gov (United States)

    1984-04-01

    Guam 10. 3/27/77 KLM , B747, Jet 248 248 192 Canary Islands 11. 9/29/77 Japan Air, DC8, Jet 79 34 25 Malaysia 12. 12/17/78 Indian Airlines, B737, Jet...Caravelle, Jet 37 33 33 Algeria (In-Flight) 4. 5/6/70 Somali , Viscount, Turboprop 30 5 0-5 Somalia (In-Flight) 5. 3/15/74 Sterling, Caravelle, Jet 96 15 15...even if seat blocking bad been present. 10. 3/27/77 KLM , B747, Canary Islands The estimated split between fire and crash-trauma fatalities is taken from

  18. Retrato. Hombre de cuerpo entero, con barba, bigote y sombrero. Manuel Bartolomé Cossío. Madrid.

    OpenAIRE

    Padro

    2010-01-01

    1 fot.; papel; imagen 17,4 x 24,8 cm. - Retrato. Hombre de cuerpo entero, con barba, bigote y sombrero. Manuel Bartolomé Cossío, pedagogo krausista de la Institición Libre de Enseñanza. Madrid. (Gelatina D. O. P. texturada montada sobre cartulina, medida total 17,4 x 24,8. Negativo totalmente retocado. Leve arruga en ángulo superior izquierdo. Sello impreso del fotógrafo en margen inferior derecho de cartulina: "Padró, Huertas 70 - Madrid" y en reverso: "Padró. Estudio de pintura. Galería fo...

  19. Structure and Recognition of a Novel HIV-1 gp120-gp41 Interface Antibody that Caused MPER Exposure through Viral Escape

    Energy Technology Data Exchange (ETDEWEB)

    Wibmer, Constantinos Kurt; Gorman, Jason; Ozorowski, Gabriel; Bhiman, Jinal N.; Sheward, Daniel J.; Elliott, Debra H.; Rouelle, Julie; Smira, Ashley; Joyce, M. Gordon; Ndabambi, Nonkululeko; Druz, Aliaksandr; Asokan, Mangai; Burton, Dennis R.; Connors, Mark; Abdool Karim, Salim S.; Mascola, John R.; Robinson, James E.; Ward, Andrew B.; Williamson, Carolyn; Kwong, Peter D.; Morris, Lynn; Moore, Penny L.; Desrosiers, Ronald C.

    2017-01-11

    A comprehensive understanding of the regions on HIV-1 envelope trimers targeted by broadly neutralizing antibodies may contribute to rational design of an HIV-1 vaccine. We previously identified a participant in the CAPRISA cohort, CAP248, who developed trimer-specific antibodies capable of neutralizing 60% of heterologous viruses at three years post-infection. Here, we report the isolation by B cell culture of monoclonal antibody CAP248-2B, which targets a novel membrane proximal epitope including elements of gp120 and gp41. Despite low maximum inhibition plateaus, often below 50% inhibitory concentrations, the breadth of CAP248-2B significantly correlated with donor plasma. Site-directed mutagenesis, X-ray crystallography, and negative-stain electron microscopy 3D reconstructions revealed how CAP248-2B recognizes a cleavage-dependent epitope that includes the gp120 C terminus. While this epitope is distinct, it overlapped in parts of gp41 with the epitopes of broadly neutralizing antibodies PGT151, VRC34, 35O22, 3BC315, and 10E8. CAP248-2B has a conformationally variable paratope with an unusually long 19 amino acid light chain third complementarity determining region. Two phenylalanines at the loop apex were predicted by docking and mutagenesis data to interact with the viral membrane. Neutralization by CAP248-2B is not dependent on any single glycan proximal to its epitope, and low neutralization plateaus could not be completely explained by N- or O-linked glycosylation pathway inhibitors, furin co-transfection, or pre-incubation with soluble CD4. Viral escape from CAP248-2B involved a cluster of rare mutations in the gp120-gp41 cleavage sites. Simultaneous introduction of these mutations into heterologous viruses abrogated neutralization by CAP248-2B, but enhanced neutralization sensitivity to 35O22, 4E10, and 10E8 by 10-100-fold. Altogether, this study expands the region of the HIV-1 gp120-gp41 quaternary interface that is a target for broadly neutralizing

  20. UV, visible and IR laser interaction with gelatine

    Energy Technology Data Exchange (ETDEWEB)

    Oujja, M [Institute of Physical Chemistry Rocasolano, CSIC, Serrano 119, 28006 Madrid (Spain); Rebollar, E [Institute of Physical Chemistry Rocasolano, CSIC, Serrano 119, 28006 Madrid (Spain); Abrusci, C [Institute of Polymer Science and Technology, CSIC, Juan de la Cierva 3, 28006 Madrid (Spain); Amo, A Del [Filmoteca Espanola, Magdalena 10, 28012 Madrid (Spain); Catalina, F [Institute of Polymer Science and Technology, CSIC, Juan de la Cierva 3, 28006 Madrid (Spain); Castillejo, M [Institute of Physical Chemistry Rocasolano, CSIC, Serrano 119, 28006 Madrid (Spain)

    2007-04-15

    In this work we investigate the effects on gelatine films of nanosecond pulsed laser irradiation at different laser wavelengths from the UV to the IR at 248, 266, 355, 532 and 1064 nm. We compared gelatines differing in gel strength values (Bloom 75 and 225) and in crosslinking degree. Formation of bubbles at the wavelengths in the UV (248 and 266 nm), melting and resolidification at 355 nm, and formation of craters by ablation in the VIS and IR (532 and 1064 nm) are the observed morphological changes. On the other hand, changes of the fluorescence behaviour of the films upon UV irradiation reveal chemical modifications of photolabile chromophores.

  1. Compensated bismuth-loaded plastic scintillators for neutron detection using low-energy pseudo-spectroscopy

    Energy Technology Data Exchange (ETDEWEB)

    Dumazert, Jonathan, E-mail: jonathan.dumazert@cea.fr [CEA, LIST, Laboratoire Capteurs Architectures Electroniques, 91191 Gif-sur-Yvette (France); Coulon, Romain; Bertrand, Guillaume H.V.; Normand, Stéphane [CEA, LIST, Laboratoire Capteurs Architectures Electroniques, 91191 Gif-sur-Yvette (France); Méchin, Laurence [CNRS, UCBN, Groupe de Recherche en Informatique, Image, Automatique et Instrumentation de Caen, 14050 Caen (France); Hamel, Matthieu [CEA, LIST, Laboratoire Capteurs Architectures Electroniques, 91191 Gif-sur-Yvette (France)

    2016-05-21

    Gadolinium-covered modified plastic scintillators show a high potential for the deployment of cost-effective neutron detectors. Taking advantage of the low-energy photon and electron signature of thermal neutron captures in gadolinium-155 and gadolinium-157 however requires a background correction. In order to display a trustable rate, dual compensation schemes appear as an alternative to Pulse Shape Discrimination. This paper presents the application of such a compensation scheme to a two-bismuth loaded plastic scintillator system. A detection scintillator interacts with incident photon and fast neutron radiations and is covered with a gadolinium converter to become thermal neutron-sensitive as well. In the meantime, an identical compensation scintillator, covered with terbium, solely interacts with the photon and fast neutron part of incident radiations. After the acquisition and the treatment of the counting signals from both sensors, a hypothesis test determines whether the resulting count rate after subtraction falls into statistical fluctuations or provides a robust image of neutron activity. A laboratory prototype is tested under both photon and neutron radiations, allowing us to investigate the performance of the overall compensation system. The study reveals satisfactory results in terms of robustness to a cesium-137 background and in terms of sensitivity in presence of a californium-252 source.

  2. Systematic studies of the fundamental chemistry of pyrochlore oxides. An{sub 2}Zr{sub 2}O{sub 7} [An=Pu, Am, Cm, Bk and Cf

    Energy Technology Data Exchange (ETDEWEB)

    Haire, R.G.; Assefa, Z. [Oak Ridge National Laboratory, Oak Ridge, TN (United States); Raison, P.E. [Commissariat a l' Energie Atomique, CEA-Cadarache DRN/DEC/SPUA/LACA (France)

    2002-11-01

    Our efforts to pursue the fundamental science of actinide pyrochlore oxides, An{sub 2}Zr{sub 2}O{sub 7}, (An=plutonium through californium), are presented. We have addressed their structural and chemical behavior via X-ray diffraction, Raman spectroscopy and by considering the pseudo-oxidation potentials of the actinides. The structure, fundamental chemistry, ionic radii and the electronic configuration of the specific actinide involved in these oxide systems all have a significant impact on their science. We are also exploring a calculational approach based on valence-bond relationships to assess the position of the oxygen atoms located at the general crystallographic position. The oxygen position is important regarding the chemical behavior and thermal stability of these materials. Also considered is the structural stability of the materials regarding self-irradiation, and with some compounds, their resistance towards oxidation. These aspects will be discussed using a systematic evaluation of the five-actinide systems together with comparable lanthanide systems studied. (author)

  3. 1982 US-CEC neutron personnel dosimetry intercomparison study

    Energy Technology Data Exchange (ETDEWEB)

    Swaja, R.E.; Sims, C.S.; Greene, R.T.; Schraube, H.; Burger, G.

    1983-11-01

    A neutron personnel dosimetry intercomparison study was conducted during April 19-23, 1982, as a joint effort between the United States and the Commission of European Communities. Dosimeters from 48 participating agencies were mounted on cylindrical phantoms and exposed to a range of low-level dose equivalents (0.48-13.91 mSv neutron and 0.02-1.32 mSv gamma) in nine different radiation fields. Exposure conditions considered in this study included four mixed-field spectra produced using the Health Physics Research Reactor, four monoenergetic neutron fields generated by accelerators, and one 15-cm D/sub 2/O-moderated californium source spectrum. In general, neutron results reported by the participating agencies were consistent with expected dosimeter performance based on energy response characteristics of the detection systems. Albedo dosimeters, which were the most popular neutron monitoring systems used in this study, provided the best overall accuracy for all exposure conditions. Film, Cr-39 recoil track, and Th-232 fission track systems generally underestimated dose equivalents relative to reference values. Associated gamma measurements showed that TLD monitors produced more accurate results than film dosimeters although both systems overestimated gamma dose equivalents in mixed radiation fields. 24 references, 10 figures, 19 tables.

  4. Application of the backward extrapolation method to pulsed neutron sources

    Energy Technology Data Exchange (ETDEWEB)

    Talamo, Alberto; Gohar, Yousry

    2018-01-01

    Particle detectors operated in pulse mode are subjected to the dead-time effect. When the average of the detector counts is constant over time, correcting for the dead-time effect is simple and can be accomplished by analytical formulas. However, when the average of the detector counts changes over time it is more difficult to take into account the dead-time effect. When a subcritical nuclear assembly is driven by a pulsed neutron source, simple analytical formulas cannot be applied to the measured detector counts to correct for the dead-time effect because of the sharp change of the detector counts over time. This work addresses this issue by using the backward extrapolation method. The latter can be applied not only to a continuous (e.g. californium) external neutron source but also to a pulsed external neutron source (e.g. by a particle accelerator) driving a subcritical nuclear assembly. The backward extrapolation method allows to obtain from the measured detector counts both the dead-time value and the real detector counts.

  5. The cross sections of fusion-evaporation reactions: the most promising route to superheavy elements beyond Z=118

    Science.gov (United States)

    Jadambaa, Khuyagbaatar

    2017-11-01

    The synthesis of superheavy elements beyond oganesson (Og), which has atomic number Z = 118, is currently one of the main topics in nuclear physics. An absence of sufficient amounts of target material with atomic numbers heavier than californium (Z = 98) forces the use of projectiles heavier than 48Ca (Z = 20), which has been successfully used for the discoveries of elements with Z = 114 - 118 in complete fusion reactions. Experimental cross sections of 48Ca with actinide targets behave very differently to "cold" and "hot" fusion-evaporation reactions, where doubly-magic lead and deformed actinides are used as targets, respectively. The known cross sections of these reactions have been analysed compared to calculated fission barriers. It has been suggested that observed discrepancies between the cross sections of 48Ca-induced and other fusionevaporation reactions originate from the shell structure of the compound nucleus, which lies in the island of the stability. Besides scarcely known data on other reactions involving heavier projectiles, the most promising projectile for the synthesis of the elements beyond Og seems to be 50Ti. However, detailed studies of 50Ti, 54Cr, 58Fe and 64Ni-induced reactions are necessary to be performed in order to fully understand the complexities of superheavy element formation.

  6. Report to the DOE nuclear data committee. [EV RANGE 10-100; CROSS SECTIONS; PHOTONEUTRONS; NEUTRONS; GAMMA RADIATION; COUPLED CHANNEL THEORY; DIFFERENTIAL CROSS SECTIONS; MEV RANGE 01-10; ; CAPTURE; GAMMA SPECTRA; THERMAL NEUTRONS; COMPUTER CALCULATIONS; DECAY; FISSION PRODUCTS; FISSION YIELD; SHELL MODELS; NUCLEAR DATA COLLECTIONS

    Energy Technology Data Exchange (ETDEWEB)

    Struble, G.L.; Haight, R.C.

    1981-03-01

    Topics covered include: studies of (n, charged particle) reactions with 14 to 15 MeV neutrons; photoneutron cross sections for /sup 15/N; neutron radiative capture; Lane-model analysis of (p,p) and (n,n) scattering on the even tin isotopes; neutron scattering cross sections for /sup 181/Ta, /sup 197/Au, /sup 209/Bi, /sup 232/Th, and /sup 238/U inferred from proton scattering and charge exchange cross sections; neutron-induced fission cross sections of /sup 245/Cm and /sup 242/Am; fission neutron multiplicities for /sup 245/Cm and /sup 242/Am; the transport of 14 MeV neutrons through heavy materials 150 < A < 208; /sup 249/Cm energy levels from measurement of thermal neutron capture gamma rays; /sup 231/Th energy levels from neutron capture gamma ray and conversion electron spectroscopy; new measurements of conversion electron binding energies in berkelium and californium; nuclear level densities; relative importance of statistical vs. valence neutron capture in the mass-90 region; determination of properties of short-lived fission products; fission yield of /sup 87/Br and /sup 137/I from 15 nuclei ranging from /sup 232/Th to /sup 249/Cf; evaluation of charged particle data for the ECPL library; evaluation of secondary charged-particle energy and angular distributions for ENDL; and evaluated nuclear structure libraries derived from the table of isotopes. (GHT)

  7. Activation analysis of ITER blanket first wall

    Energy Technology Data Exchange (ETDEWEB)

    Lopatkin, A.; Muratov, V. [RDIPE (NIKIET), Moscow (Russian Federation)

    1998-09-01

    To analyze the activation of ITER blanket structural components, the authors have prepared the AUCDAS code that calculates changes in nuclide concentrations and radioactivity characteristics during neutron irradiation and during cooling. UCDAS takes into account all neutron reactions and decay types, the prepared library of constants contains nuclear data of nuclides from hydrogen to californium. A comparative analysis of the results as obtained using UCDAS code and the widely known FISPACT code is given. The analysis of decay heat, gas generation and activity of ITER blanket first wall`s structural components was carried out. The beryllium coating, copper alloy and stainless steel were analysed. Calculations were performed for the first plasma burning pulse, 6 months and 1 year of operation in accordance with the ITER scenario. The materials recommended by ITER central team and their Russian analogs were considered: TGR and B1 (beryllium coating), GlidCop AL-25 Ds and Br-MKX (copper alloy), 316LN-IG and 12Cr18Ni10Ti (stainless steel). It has been demonstrated that there is a difference in all of the considered characteristics between the above materials. It is caused by impurities which are present in the materials. The report also considers the accumulation of gases (H, D, T, He{sup 3}, He{sup 4}) in the above materials. Besides, the change in the activity of irradiated materials during the cooling of up to 10{sup 7} years was calculated. (orig.) 7 refs.

  8. Toward achieving flexible and high sensitivity hexagonal boron nitride neutron detectors

    Science.gov (United States)

    Maity, A.; Grenadier, S. J.; Li, J.; Lin, J. Y.; Jiang, H. X.

    2017-07-01

    Hexagonal boron nitride (h-BN) detectors have demonstrated the highest thermal neutron detection efficiency to date among solid-state neutron detectors at about 51%. We report here the realization of h-BN neutron detectors possessing one order of magnitude enhancement in the detection area but maintaining an equal level of detection efficiency of previous achievement. These 3 mm × 3 mm detectors were fabricated from 50 μm thick freestanding and flexible 10B enriched h-BN (h-10BN) films, grown by metal organic chemical vapor deposition followed by mechanical separation from sapphire substrates. Mobility-lifetime results suggested that holes are the majority carriers in unintentionally doped h-BN. The detectors were tested under thermal neutron irradiation from californium-252 (252Cf) moderated by a high density polyethylene moderator. A thermal neutron detection efficiency of ˜53% was achieved at a bias voltage of 200 V. Conforming to traditional solid-state detectors, the realization of h-BN epilayers with enhanced electrical transport properties is the key to enable scaling up the device sizes. More specifically, the present results revealed that achieving an electrical resistivity of greater than 1014 Ωṡcm and a leakage current density of below 3 × 10-10 A/cm2 is needed to fabricate large area h-BN detectors and provided guidance for achieving high sensitivity solid state neutron detectors based on h-BN.

  9. Design of the low energy beam transport line between CARIBU and the EBIS charge breeder

    Energy Technology Data Exchange (ETDEWEB)

    Perry, A., E-mail: aperry4@hawk.iit.edu [Argonne National Laboratory, Argonne, IL 60439, USA and Illinois Institute of Technology, Chicago, IL 60616 (United States); Ostroumov, P. N.; Barcikowski, A.; Dickerson, C.; Kondrashev, S. A.; Mustapha, B.; Savard, G. [Argonne National Laboratory, Argonne, IL 60439 (United States)

    2015-01-09

    An Electron Beam Ion Source Charge Breeder (EBIS-CB) has been developed to breed radioactive beams from the CAlifornium Rare Isotope Breeder Upgrade (CARIBU) facility at ATLAS. The EBIS-CB will replace the existing ECR charge breeder to increase the intensity and improve the purity of reaccelerated radioactive ion beams. The EBIS-CB is in the final stage of off-line commissioning. Currently, we are developing a low energy beam transport (LEBT) system to transfer CARIBU beams to the EBIS-CB. As was originally planned, an RFQ cooler-buncher will precede the EBIS-CB. Recently, it was decided to include a multi-reflection time-of-flight (MR-TOF) mass-spectrometer following the RFQ. MR-TOF is a relatively new technology used to purify beams with a mass-resolving power up to 3×10{sup 5} as was demonstrated in experiments at CERN/ISOLDE. Very high purity singly-charged radioactive ion beams will be injected into the EBIS for charge breeding and due to its inherent properties, the EBIS-CB will maintain the purity of the charge bred beams. Possible contamination of residual gas ions will be greatly suppressed by achieving ultra-high vacuum in the EBIS trap. This paper will present and discuss the design of the LEBT and the overall integration of the EBIS-CB into ATLAS.

  10. Analysis of patents on mining technology

    Energy Technology Data Exchange (ETDEWEB)

    Menyailo, N.I.; Grishchenko, A.N.; Ratner, M.V.; Kobylyanskii, A.Ya.; Tyshlek, E.G.

    1987-09-01

    Analyses the current work being carried out with the aim of developing and perfecting coal mining technology with regard to improving safety and working conditions (equipment is currently responsible for 6.3% of all hazards in coal mines) by examining patents of class ES 21 S produced in the USSR, USA, UK, FRG, Japan and France between 1970-1984. By far the majority of patents is concerned with improving technology and productivity and a disappointing number deals with safety matters (only 7.2% of the patents for new cutter loader designs deal with dust suppression systems and most of these come from the FRG; no patents for powered mining complexes deal with the problem of noise and vibration reduction). The patents with the most direct relevance to health and safety concern remote control devices for mining equipment, in particular, devices based on radioactive isotopes (e.g. cesium-137, americum-241, selenium-75, californium-252) but measures for monitoring them and protecting against them are not found.

  11. MinT: Middleware for Cooperative Interaction of Things

    Directory of Open Access Journals (Sweden)

    Soobin Jeon

    2017-06-01

    Full Text Available This paper proposes an Internet of Things (IoT middleware called Middleware for Cooperative Interaction of Things (MinT. MinT supports a fully distributed IoT environment in which IoT devices directly connect to peripheral devices easily construct a local or global network, and share their data in an energy efficient manner. MinT provides a sensor abstract layer, a system layer and an interaction layer. These enable integrated sensing device operations, efficient resource management, and active interconnection between peripheral IoT devices. In addition, MinT provides a high-level API to develop IoT devices easily for IoT device developers. We aim to enhance the energy efficiency and performance of IoT devices through the performance improvements offered by MinT resource management and request processing. The experimental results show that the average request rate increased by 25% compared to Californium, which is a middleware for efficient interaction in IoT environments with powerful performance, an average response time decrease of 90% when resource management was used, and power consumption decreased by up to 68%. Finally, the proposed platform can reduce the latency and power consumption of IoT devices.

  12. MinT: Middleware for Cooperative Interaction of Things

    Science.gov (United States)

    Jeon, Soobin; Jung, Inbum

    2017-01-01

    This paper proposes an Internet of Things (IoT) middleware called Middleware for Cooperative Interaction of Things (MinT). MinT supports a fully distributed IoT environment in which IoT devices directly connect to peripheral devices easily construct a local or global network, and share their data in an energy efficient manner. MinT provides a sensor abstract layer, a system layer and an interaction layer. These enable integrated sensing device operations, efficient resource management, and active interconnection between peripheral IoT devices. In addition, MinT provides a high-level API to develop IoT devices easily for IoT device developers. We aim to enhance the energy efficiency and performance of IoT devices through the performance improvements offered by MinT resource management and request processing. The experimental results show that the average request rate increased by 25% compared to Californium, which is a middleware for efficient interaction in IoT environments with powerful performance, an average response time decrease of 90% when resource management was used, and power consumption decreased by up to 68%. Finally, the proposed platform can reduce the latency and power consumption of IoT devices. PMID:28632182

  13. An Account of Oak Ridge National Laboratory's Thirteen Research Reactors

    Energy Technology Data Exchange (ETDEWEB)

    Rosenthal, Murray Wilford [ORNL

    2009-08-01

    The Oak Ridge National Laboratory has built and operated 13 nuclear reactors in its 66-year history. The first was the graphite reactor, the world's first operational nuclear reactor, which served as a plutonium production pilot plant during World War II. It was followed by two aqueous-homogeneous reactors and two red-hot molten-salt reactors that were parts of power-reactor development programs and by eight others designed for research and radioisotope production. One of the eight was an all-metal fast burst reactor used for health physics studies. All of the others were light-water cooled and moderated, including the famous swimming-pool reactor that was copied dozens of times around the world. Two of the reactors were hoisted 200 feet into the air to study the shielding needs of proposed nuclear-powered aircraft. The final reactor, and the only one still operating today, is the High Flux Isotope Reactor (HFIR) that was built particularly for the production of californium and other heavy elements. With the world's highest flux and recent upgrades that include the addition of a cold neutron source, the 44-year-old HFIR continues to be a valuable tool for research and isotope production, attracting some 500 scientific visitors and guests to Oak Ridge each year. This report describes all of the reactors and their histories.

  14. Neutron Detector Signal Processing to Calculate the Effective Neutron Multiplication Factor of Subcritical Assemblies

    Energy Technology Data Exchange (ETDEWEB)

    Talamo, Alberto [Argonne National Lab. (ANL), Argonne, IL (United States). Nuclear Engineering Division; Gohar, Yousry [Argonne National Lab. (ANL), Argonne, IL (United States). Nuclear Engineering Division

    2016-06-01

    This report describes different methodologies to calculate the effective neutron multiplication factor of subcritical assemblies by processing the neutron detector signals using MATLAB scripts. The subcritical assembly can be driven either by a spontaneous fission neutron source (e.g. californium) or by a neutron source generated from the interactions of accelerated particles with target materials. In the latter case, when the particle accelerator operates in a pulsed mode, the signals are typically stored into two files. One file contains the time when neutron reactions occur and the other contains the times when the neutron pulses start. In both files, the time is given by an integer representing the number of time bins since the start of the counting. These signal files are used to construct the neutron count distribution from a single neutron pulse. The built-in functions of MATLAB are used to calculate the effective neutron multiplication factor through the application of the prompt decay fitting or the area method to the neutron count distribution. If the subcritical assembly is driven by a spontaneous fission neutron source, then the effective multiplication factor can be evaluated either using the prompt neutron decay constant obtained from Rossi or Feynman distributions or the Modified Source Multiplication (MSM) method.

  15. Fast neutron tomography with real-time pulse-shape discrimination in organic scintillation detectors

    Energy Technology Data Exchange (ETDEWEB)

    Joyce, Malcolm J., E-mail: m.joyce@lancaster.ac.uk [Department of Engineering, Lancaster University, Lancaster, Lancashire LA1 4YW (United Kingdom); Agar, Stewart [Department of Engineering, Lancaster University, Lancaster, Lancashire LA1 4YW (United Kingdom); Aspinall, Michael D. [Hybrid Instruments Ltd., Gordon Manley Building, Lancaster Environment Centre, Lancaster University, Lancaster LA1 4YW (United Kingdom); Beaumont, Jonathan S.; Colley, Edmund; Colling, Miriam; Dykes, Joseph; Kardasopoulos, Phoevos; Mitton, Katie [Department of Engineering, Lancaster University, Lancaster, Lancashire LA1 4YW (United Kingdom)

    2016-10-21

    A fast neutron tomography system based on the use of real-time pulse-shape discrimination in 7 organic liquid scintillation detectors is described. The system has been tested with a californium-252 source of dose rate 163 μSv/h at 1 m and neutron emission rate of 1.5×10{sup 7} per second into 4π and a maximum acquisition time of 2 h, to characterize two 100×100×100 mm{sup 3} concrete samples. The first of these was a solid sample and the second has a vertical, cylindrical void. The experimental data, supported by simulations with both Monte Carlo methods and MATLAB®, indicate that the presence of the internal cylindrical void, corners and inhomogeneities in the samples can be discerned. The potential for fast neutron assay of this type with the capability to probe hydrogenous features in large low-Z samples is discussed. Neutron tomography of bulk porous samples is achieved that combines effective penetration not possible with thermal neutrons in the absence of beam hardening.

  16. Report on the workshop "Decay spectroscopy at CARIBU: advanced fuel cycle applications, nuclear structure and astrophysics". 14-16 April 2011, Argonne National Laboratory, USA.

    Energy Technology Data Exchange (ETDEWEB)

    Kondev, F.; Carpenter, M.P.; Chowdhury, P.; Clark, J.A.; Lister, C.J.; Nichols, A.L.; Swewryniak, D. (Nuclear Engineering Division); (Univ. of Massachusetts); (Univ. of Surrey)

    2011-10-06

    A workshop on 'Decay Spectroscopy at CARIBU: Advanced Fuel Cycle Applications, Nuclear Structure and Astrophysics' will be held at Argonne National Laboratory on April 14-16, 2011. The aim of the workshop is to discuss opportunities for decay studies at the Californium Rare Isotope Breeder Upgrade (CARIBU) of the ATLAS facility with emphasis on advanced fuel cycle (AFC) applications, nuclear structure and astrophysics research. The workshop will consist of review and contributed talks. Presentations by members of the local groups, outlining the status of relevant in-house projects and availabile equipment, will also be organized. time will also be set aside to discuss and develop working collaborations for future decay studies at CARIBU. Topics of interest include: (1) Decay data of relevance to AFC applications with emphasis on reactor decay heat; (2) Discrete high-resolution gamma-ray spectroscopy following radioactive decya and related topics; (3) Calorimetric studies of neutron-rich fission framgents using Total ABsorption Gamma-Ray Spectrometry (TAGS) technique; (4) Beta-delayed neutron emissions and related topics; and (5) Decay data needs for nuclear astrophysics.

  17. The cross sections of fusion-evaporation reactions: the most promising route to superheavy elements beyond Z=118

    Directory of Open Access Journals (Sweden)

    Jadambaa Khuyagbaatar

    2017-01-01

    Full Text Available The synthesis of superheavy elements beyond oganesson (Og, which has atomic number Z = 118, is currently one of the main topics in nuclear physics. An absence of sufficient amounts of target material with atomic numbers heavier than californium (Z = 98 forces the use of projectiles heavier than 48Ca (Z = 20, which has been successfully used for the discoveries of elements with Z = 114 - 118 in complete fusion reactions. Experimental cross sections of 48Ca with actinide targets behave very differently to “cold” and “hot” fusion-evaporation reactions, where doubly-magic lead and deformed actinides are used as targets, respectively. The known cross sections of these reactions have been analysed compared to calculated fission barriers. It has been suggested that observed discrepancies between the cross sections of 48Ca-induced and other fusionevaporation reactions originate from the shell structure of the compound nucleus, which lies in the island of the stability. Besides scarcely known data on other reactions involving heavier projectiles, the most promising projectile for the synthesis of the elements beyond Og seems to be 50Ti. However, detailed studies of 50Ti, 54Cr, 58Fe and 64Ni-induced reactions are necessary to be performed in order to fully understand the complexities of superheavy element formation.

  18. Intracavitary moderator balloon combined with (252)Cf brachytherapy and boron neutron capture therapy, improving dosimetry in brain tumour and infiltrations.

    Science.gov (United States)

    Brandão, S F; Campos, T P R

    2015-07-01

    This article proposes a combination of californium-252 ((252)Cf) brachytherapy, boron neutron capture therapy (BNCT) and an intracavitary moderator balloon catheter applied to brain tumour and infiltrations. Dosimetric evaluations were performed on three protocol set-ups: (252)Cf brachytherapy combined with BNCT (Cf-BNCT); Cf-BNCT with a balloon catheter filled with light water (LWB) and the same set-up with heavy water (HWB). Cf-BNCT-HWB has presented dosimetric advantages to Cf-BNCT-LWB and Cf-BNCT in infiltrations at 2.0-5.0 cm from the balloon surface. However, Cf-BNCT-LWB has shown superior dosimetry up to 2.0 cm from the balloon surface. Cf-BNCT-HWB and Cf-BNCT-LWB protocols provide a selective dose distribution for brain tumour and infiltrations, mainly further from the (252)Cf source, sparing the normal brain tissue. Malignant brain tumours grow rapidly and often spread to adjacent brain tissues, leading to death. Improvements in brain radiation protocols have been continuously achieved; however, brain tumour recurrence is observed in most cases. Cf-BNCT-LWB and Cf-BNCT-HWB represent new modalities for selectively combating brain tumour infiltrations and metastasis.

  19. Intracavitary moderator balloon combined with 252Cf brachytherapy and boron neutron capture therapy, improving dosimetry in brain tumour and infiltrations

    Science.gov (United States)

    Brandão, S F

    2015-01-01

    Objective: This article proposes a combination of californium-252 (252Cf) brachytherapy, boron neutron capture therapy (BNCT) and an intracavitary moderator balloon catheter applied to brain tumour and infiltrations. Methods: Dosimetric evaluations were performed on three protocol set-ups: 252Cf brachytherapy combined with BNCT (Cf-BNCT); Cf-BNCT with a balloon catheter filled with light water (LWB) and the same set-up with heavy water (HWB). Results: Cf-BNCT-HWB has presented dosimetric advantages to Cf-BNCT-LWB and Cf-BNCT in infiltrations at 2.0–5.0 cm from the balloon surface. However, Cf-BNCT-LWB has shown superior dosimetry up to 2.0 cm from the balloon surface. Conclusion: Cf-BNCT-HWB and Cf-BNCT-LWB protocols provide a selective dose distribution for brain tumour and infiltrations, mainly further from the 252Cf source, sparing the normal brain tissue. Advances in knowledge: Malignant brain tumours grow rapidly and often spread to adjacent brain tissues, leading to death. Improvements in brain radiation protocols have been continuously achieved; however, brain tumour recurrence is observed in most cases. Cf-BNCT-LWB and Cf-BNCT-HWB represent new modalities for selectively combating brain tumour infiltrations and metastasis. PMID:25927876

  20. Investigation of Workplace-like Calibration Fields via a Deuterium-Tritium (D-T) Neutron Generator.

    Science.gov (United States)

    Mozhayev, Andrey V; Piper, Roman K; Rathbone, Bruce A; McDonald, Joseph C

    2017-04-01

    Radiation survey meters and personal dosimeters are typically calibrated in reference neutron fields based on conventional radionuclide sources, such as americium-beryllium (Am-Be) or californium-252 (Cf), either unmodified or heavy-water moderated. However, these calibration neutron fields differ significantly from the workplace fields in which most of these survey meters and dosimeters are being used. Although some detectors are designed to yield an approximately dose-equivalent response over a particular neutron energy range, the response of other detectors is highly dependent upon neutron energy. This, in turn, can result in significant over- or underestimation of the intensity of neutron radiation and/or personal dose equivalent determined in the work environment. The use of simulated workplace neutron calibration fields that more closely match those present at the workplace could improve the accuracy of worker, and workplace, neutron dose assessment. This work provides an overview of the neutron fields found around nuclear power reactors and interim spent fuel storage installations based on available data. The feasibility of producing workplace-like calibration fields in an existing calibration facility has been investigated via Monte Carlo simulations. Several moderating assembly configurations, paired with a neutron generator using the deuterium tritium (D-T) fusion reaction, were explored.

  1. Production of medical radioisotopes in the ORNL High Flux Isotope Reactor (HFIR) for cancer treatment and arterial restenosis therapy after PTCA

    Energy Technology Data Exchange (ETDEWEB)

    Knapp, F.F. Jr.; Beets, A.L.; Mirzadeh, S.; Alexander, C.W.; Hobbs, R.L.

    1998-06-01

    The High Flux Isotope Reactor (HFIR) at the Oak Ridge National Laboratory (ORNL) represents an important resource for the production of a wide variety of medical radioisotopes. In addition to serving as a key production site for californium-252 and other transuranic elements, important examples of therapeutic radioisotopes which are currently routinely produced in the HFIR for distribution include dysprosium-166 (parent of holmium-166), rhenium-186, tin-117m and tungsten-188 (parent of rhenium-188). The nine hydraulic tube (HT) positions in the central high flux region permit the insertion and removal of targets at any time during the operating cycle and have traditionally represented a major site for production of medical radioisotopes. To increase the irradiation capabilities of the HFIR, special target holders have recently been designed and fabricated which will be installed in the six Peripheral Target Positions (PTP), which are also located in the high flux region. These positions are only accessible during reactor refueling and will be used for long-term irradiations, such as required for the production of tin-117m and tungsten-188. Each of the PTP tubes will be capable of housing a maximum of eight HT targets, thus increasing the total maximum number of HT targets from the current nine, to a total of 57. In this paper the therapeutic use of reactor-produced radioisotopes for bone pain palliation and vascular brachytherapy and the therapeutic medical radioisotope production capabilities of the ORNL HFIR are briefly discussed.

  2. Students’ anticipated situational engagement : the roles of teacher behaviour, personal engagement, and gender

    NARCIS (Netherlands)

    Thijs, J.T.; Verkuyten, M.J.A.M.

    2009-01-01

    Among 9th-grade students (248 girls, 255 boys) from a large multiethnic school, the authors examined 2 aspects of anticipated situational engagement in relation to 3 types of hypothetical teacher behavior: authoritarian, authoritative, permissive. Furthermore, the authors investigated the moderating

  3. Educators' Self-Reported Training, Use, and Perceived Effectiveness of Evidence-Based Classroom Management Practices

    Science.gov (United States)

    Cooper, Justin T.; Gage, Nicholas A.; Alter, Peter J.; LaPolla, Stefanie; MacSuga-Gage, Ashley S.; Scott, Terrance M.

    2018-01-01

    A survey study of 248 educators in four states was conducted to identify respondents' formal training, use, and perceived effectiveness of 37 evidence-based classroom management practices within four general categories: (a) antecedent-based, (b) instructionally based, (c) consequence-based, and (d) self-management. Results indicated that, on…

  4. Performance Analysis of an Experimental Centrifugal Pump ...

    African Journals Online (AJOL)

    The maximum possible power coefficient is 2.48x10-4 at a corresponding flow coefficient of 3.2x10-3 giving a head coefficient of 0.078 at the best efficient point (BEP). Electronic sensors on the H47 rig provided measurements that ensured noticing of fluctuations across the Venturi meter caused by the onset of cavitation.

  5. High and Mighty: Implicit Associations between Space and Social Status

    Science.gov (United States)

    2011-10-10

    e.g., Piaget , 1927/1969; Tversky et al., 1991). To date, dozens of experiments across a wide range of disciplines, from psychology to anthropol- ogy...The Psychology of Learn- ing and Motivation, ed. B. H. Ross (Burlington: Academic Press), 217–248. Piaget , J. (1927/1969). The Child’s Con- ception of

  6. Yadav, Dr Ram Ratan

    Indian Academy of Sciences (India)

    ... Tree Ring Analysis, Climate Change, Biodiversity Address: CSIR Emeritus Scientist, Wadia Institute of Himalayan Geology, 33, Gen. Mahadev Singh Road, Dehra Dun 248 001, Uttrakhand Contact: Residence: 94526 94759. Mobile: 94503 94957. Email: rryadav2000@gmail.com. YouTube; Twitter; Facebook; Blog ...

  7. An unusual presentation of advanced prostate cancer in a 56-year ...

    African Journals Online (AJOL)

    P.O. Areo

    2016-12-26

    Dec 26, 2016 ... metastatic to the omentum. Scand J Urol Nephrol 2002;36(3):225–7. [5] Ani I, Costaldi M, Abouassaly R. Metastatic prostate cancer with malig- nant ascites: a case report and literature review. Can Urol Assoc J. 2013;7(3–4):E248–50. [6] Petrakis D, Pentheroudakis G, Kamina S, Pappa L, Papadiotis E,.

  8. Does Self-Image Matter? Client's Self-Image, Behaviour and Evaluation of a Career Counselling Session: An Exploratory Study

    Science.gov (United States)

    Schedin, Gunnar; Armelius, Kerstin

    2008-01-01

    This exploratory study addresses differences in self-image as a client characteristic in career counselling by using the Structural Analysis of Social Behaviour (Benjamin, L., "Journal of Consulting and Clinical Psychology," 64(6), 1203-1212, 1996; Benjamin, L., "Journal of Personality Assessment," 66(2), 248-266, 1996) and an adaptation…

  9. Laser Flash Photolysis of Hydrogen Peroxide to Oxidize Protein Solvent-Accessible Residues on the Microsecond Timescale

    National Research Council Canada - National Science Library

    Hambly, David M; Gross, Michael L

    2005-01-01

    ... to unfold, exposing residues that are protected in the native protein. To circumvent this possibility, we developed a method using a 248 nm KrF excimer laser to cleave hydrogen peroxide at low concentrations (15 mM, 0. 04...

  10. AFRICAN JOURNAL OF ECONOMIC REVIEW

    African Journals Online (AJOL)

    Dr Kazungu

    J.N.(1997), Homelessness in female-headed families: Childhood and adult risk and protective factors», American Journal of Public Health, Vol.87, PP. 241-248. Biglan. A., Noell, J., Ochs, L., Smolkowski, K. and Metzler, C. W (1995), «Does sexual coercion play a role in the high-risk sexual behavior of adolescent and young ...

  11. Use of Complementary and Alternative Medicine (CAM) Treatments by Parents of Children with Autism Spectrum Disorders

    Science.gov (United States)

    Christon, Lillian M.; Mackintosh, Virginia H.; Myers, Barbara J.

    2010-01-01

    Parents of children with autism spectrum disorders (ASDs) may elect to use complementary and alternative medicine (CAM) treatments with their children in place of, or in addition to, conventional treatments. CAM treatments are controversial and understudied and, for most, the efficacy has not been established. The current study (n = 248) examined…

  12. 75 FR 41575 - Notice of Intent To Prepare an Environmental Impact Statement for a Long-Term Landscape...

    Science.gov (United States)

    2010-07-16

    ... CFR parts 1500 through 1508, The Valles Caldera Preservation Act, Public Law 106-248, NEPA Procedures...) which includes mechanical treatments, prescribed burning, management of lightning caused wildland fires... acres of forest and grassland ecosystems over a 10-year period. The management of lightning caused fires...

  13. Gender and Developmental Differences in Attitudes toward Science ...

    African Journals Online (AJOL)

    It also attempted to study developmental differences in attitudes toward science between pupils when they were in grade 7 and when they got to grade 9 two years after. A stratified random sample (N=248) was obtained and studied using gender and grade level variables as independent ones and the attitude to science as ...

  14. Pacific Partnership 2007: The First Dedicated United States Ship Humanitarian and Civic Assistance Mission

    Science.gov (United States)

    2010-10-25

    and education for public health officials. Training for HN medical personnel included lifesaving skills, nutrition , and prenatal care. Biomedical...38.27 Lower back pain 998 245 295 248 124 19 67 33.50 Muscle pain 403 61 77 197 38 18 12 13.53 Sprain, strain, tendonitis 78 23 12 25 11 3 4

  15. Trigonometric Characterization of Some Plane Curves

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 20; Issue 3. Trigonometric Characterization of Some Plane Curves. B Barua J Das. General Article Volume 20 ... Author Affiliations. B Barua1 J Das1. Indian Society of Nonlinear Analysts (INSA), 248 B, B B Chatterjee Road, Kolkata 700 042, W B, India ...

  16. Georgia's forests, 2004

    Science.gov (United States)

    Richard A. Harper; Nathan D. McClure; Tony G. Johnson; J. Frank Green; James K. Johnson; David B. Dickinson; James L. Chamerlain; KaDonna C. Randolph; Sonja N. Oswalt

    2009-01-01

    Between 1997 and 2004, the Forest Service, Forest Inventory and Analysis Program conducted the eighth inventory of Georgia forests. Forest land area remained stable at 24.8 million acres, and covered about two-thirds of the land area in Georgia. About 24.2 million acres of forest land was considered timberland and 92 percent of that was privately owned. Family forest...

  17. An Isolator in Image Guide.

    Science.gov (United States)

    1982-05-11

    used to search for 3. Muller’s method is an improvement on Newton’s method. For more detail one should refer to Peter Henrici , "Elements of Numerical...247 ... C IS NOT KNUWN. FOR MORE DETAIL ABOUI MULLER’S METHOD 248 .. C SEE ’ELEMENTS OF NUMERICAL ANALYSIS’ BY PETER HENRICI , 249 .. C JOHN UILEY A

  18. CAA Annual Report, Fiscal Year 1992.

    Science.gov (United States)

    1992-11-01

    original unvectorized sort. The original ATCAL and sort routines consumed the majority of CPU resources in CEM. Burns and Brewer embedded their...IBM RS-6000 Model 560 RISC machines 35 - 80386 processor upgrades for remaining Zenith Z-248 microcomputers 11 - Macintosh SI computers 2 - Apple

  19. Estimates of source parameters of M 4.9 M 4.9 M 4.9 Kharsali ...

    Indian Academy of Sciences (India)

    Wadia Institute of Himalayan Geology, Dehradun 248 001, India. ∗ e-mail: ajaypaul@wihg.res.in. This paper presents .... the boundaries of geological subprovinces having characteristic geology and physiography (Gansser ..... the seismic ray makes an angle io at the focus. The line joining the origin to the recording station.

  20. Dicty_cDB: VHD572 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available tose 6-phosphate 1-phosphofructokinase, exon 1. 82 3e-11 1 DX414156 |DX414156.1 SOYC248TH LargeInsertSoybeanGenLibBuild...4 Glycine max genomic clone H12A17:Build4MTP4H23, genomic survey seque

  1. Dicty_cDB: SHG495 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available hosphofructokinase, exon 1. 88 2e-27 2 DX414156 |DX414156.1 SOYC248TH LargeInsertSoybeanGenLibBuild...4 Glycine max genomic clone H12A17:Build4MTP4H23, genomic survey sequence. 48 0.30 1 CE635

  2. Dicty_cDB: VHE404 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available UENCE, 2 unordered pieces. 50 0.077 1 DX414156 |DX414156.1 SOYC248TH LargeInsertSoybeanGenLibBuild4 Glycine ...max genomic clone H12A17:Build4MTP4H23, genomic survey sequence. 48 0.30 1 EJ712224 |EJ712224.1 109295608356

  3. Dicty_cDB: VHB407 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available argeInsertSoybeanGenLibBuild4 Glycine max genomic clone H12A17:Build4MTP4H23, gen... chromosome 2 map 1685067-2090751 strain AX4, complete sequence. 1350 0.0 1 DX414156 |DX414156.1 SOYC248TH L

  4. Dicty_cDB: VHE205 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 86 5', genomic survey sequence. 48 0.45 1 DX414156 |DX414156.1 SOYC248TH LargeInsertSoybeanGenLibBuild...4 Glycine max genomic clone H12A17:Build4MTP4H23, genomic survey sequence. 48 0.45 1 CE

  5. Dicty_cDB: VHB312 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 751 strain AX4, complete sequence. 1023 0.0 2 DX414156 |DX414156.1 SOYC248TH LargeInsertSoybeanGenLibBuild...4 Glycine max genomic clone H12A17:Build4MTP4H23, genomic survey sequence. 48 0.34

  6. The leisure style of Canadian rural recreation participants: An analysis based on three different rural leisure settings

    Science.gov (United States)

    Paul Heintzman; Don. Dawson

    2012-01-01

    This study was a secondary analysis of data from a previous study of 248 Canadians on four dimensions of leisure style: time use, leisure setting, leisure activity participation, and leisure motivation. Correlation analyses were conducted to determine if frequency of participation in three rural leisure settings were related to other leisure style dimensions.

  7. Low-Noise Operation of All-Fiber Femtosecond Cherenkov Laser

    DEFF Research Database (Denmark)

    Liu, Xiaomin; Villanueva Ibáñez, Guillermo Eduardo; Lægsgaard, Jesper

    2013-01-01

    We investigate the noise properties of a femtosecond all-fiber Cherenkov radiation source with emission wavelength around 600 nm, based on an Yb-fiber laser and a highly-nonlinear photonic crystal fiber. A relative intensity noise as low as - 103 dBc/Hz, corresponding to 2.48 % pulse-to-pulse flu...

  8. The Relation between the Religious Belief and the Tendency of Dogmatism

    OpenAIRE

    高木, 秀明; 安藤, 嘉奈子; 山口, 陽子; 井上, 果子

    1997-01-01

    This study investigates the relation between the religious belief and the tendency of dogmatism among the Japanese adolescents. 248 subjects responded to the questionnaire. According to their responses concerning attitude and interest towards religion, the subjects were divided into 6 groups. Results show that anti religion adolescent group tended to be more dogmatic.

  9. Biosorption of Fe (II) and Cd (II) ions from aqueous solution using a ...

    African Journals Online (AJOL)

    MOP & Cd-AOP attained equilibrium at 45mins. The enthalpy 0f adsorption ranged from 2.48 KJ/mol to 14.418 KJ/mol and the entropy of adsorption ranged from -3.53 KJ/mol to 41.07 KJ/mol for both adsorbents (MOP and AOP). The kinetic ...

  10. Drug: D09188 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available 8301] 2 Agents affecting individual organs 24 Hormones 248 Mixed hormone preparations 2482 Estrogens and pro...Progestogens and estrogens, sequential preparations G03FB05 Norethisterone and estrogen D09188 Estradiol - norethisterone acetate mixt PubChem: 96025868 ...

  11. Parent-Endorsed Sex Differences in Toddlers with and without ASD: Utilizing the M-CHAT

    Science.gov (United States)

    Øien, Roald A.; Hart, Logan; Schjølberg, Synnve; Wall, Carla A.; Kim, Elizabeth S.; Nordahl-Hansen, Anders; Eisemann, Martin R.; Chawarska, Katarzyna; Volkmar, Fred R.; Shic, Frederick

    2017-01-01

    Sex differences in typical development can provide context for understanding ASD. Baron-Cohen ("Trends Cogn Sci" 6(6):248-254, 2002) suggested ASD could be considered an extreme expression of normal male, compared to female, phenotypic profiles. In this paper, sex-specific M-CHAT scores from N = 53,728 18-month-old toddlers, including n…

  12. Vibrational studies and phase transitions in Co(ClO 4) 2·6H 2O and Mn(ClO 4) 2·6H 2O

    Science.gov (United States)

    Patel, M. B.; Patel, Sushama; Khandelwal, D. P.; Bist, H. D.

    1983-10-01

    A vibrational assignment of cobalt and manganese perchlorate hexadrytes is proposed. Three phase transitions in each salt (at 333,240 and 166 K in the CO salt and at 341,248 and 161 K in the Mn salt) have been observed and have been attributed to the ordering of aquo-octahedral complexes occupying two distinguishable sites.

  13. Dicty_cDB: Contig-U12962-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available s musculus BAC clone RP23-248O15 from chromosom... 44 5.1 1 ( EF545376 ) Ascidiota blepharophylla subsp. alaskan...a voucher ... 44 5.1 1 ( EF545375 ) Ascidiota blepharophylla subsp. alaskana voucher ... 44 5.1 1 ( CT01

  14. AcEST: DK957364 [AcEST

    Lifescience Database Archive (English)

    Full Text Available N=CAT2... 249 5e-66 sp|P49317|CATA3_NICPL Catalase isozyme 3 OS=Nicotiana plumbagini... 248 1e-65 sp|O24339|CATA_SOLAP...KFYT 128 >sp|O24339|CATA_SOLAP Catalase OS=Soldanella alpina PE=2 SV=1 Length = 492 Score = 247 bits (631),

  15. From Adolescent "Serious Offender" to Adult Felon: A Predictive Study of Offense Progression.

    Science.gov (United States)

    Benda, Brent B.; Corwyn, Robert Flynn; Toombs, Nancy J.

    2001-01-01

    Studies 248 adolescents who had been in a Serious Offender Program to examine the relative predictiveness of: a common risk assessment tool; a battery of psychological tests; and a combination of demographic and theoretical factors. Regression procedures indicate that the following are significant predictors: prior commitment; male; gang members;…

  16. Military Vision Research Program

    Science.gov (United States)

    2012-10-01

    a result, optic nerve or brain injury can lead to permanent loss of vision or cognitive functions. Unfortunately, there are currently no medical...foveal lesion (macular hole). Vision Res. 39, 2421–2427 (1999). 5. Amsler, M. L’examen qualitatif de la fonction maculaire. Ophthalmologica 114, 248

  17. Science and Technology Teachers' Opinions about Problems Faced While Teaching 8th Grade Science Unit "Force and Motion" and Suggestions for Solutions

    Science.gov (United States)

    Bozdogan, Aykut Emre; Uzoglu, Mustafa

    2015-01-01

    The aim of this study is to explore the problems encountered while teaching force and motion unit in 8th grade science and technology course from teachers' perspectives and offer solutions to eliminate these problems. The study was conducted with 248 science and technology teachers working in 7 regions in Turkey in 2012-2013 academic year.…

  18. Potential Of Fired Clay Bricks Produced From Aponmu Clay Deposits

    African Journals Online (AJOL)

    The potential of fired clay obtained from Aponmu river, Ondo State. Nigeria for brick production have been investigated. Properties of produced bricks investigated was compressive strength, density and water absorption. The results shows that the Compressive strength, density and water absorption values ranged from 2.48 ...

  19. A toadfish (Batrachoidiformes) from the Oligocene of the Eastern Carpathians (Piatra Neamt, Romania)

    Czech Academy of Sciences Publication Activity Database

    Přikryl, Tomáš; Grădianu, I.; Georgescu, V.; Carnevale, G.

    2018-01-01

    Roč. 287, č. 2 (2018), s. 241-248 ISSN 0077-7749 R&D Projects: GA ČR(CZ) GA16-21523S Institutional support: RVO:67985831 Keywords : Batrachoidiformes * toadfish * Bituminous Marls Formation * Eastern Carpathians * Oligocene Subject RIV: DB - Geology ; Mineralogy Impact factor: 0.777, year: 2016

  20. 78 FR 78519 - Appraisals for Higher-Priced Mortgage Loans

    Science.gov (United States)

    2013-12-26

    ... 1026 Appraisals for Higher-Priced Mortgage Loans; Final Rule #0;#0;Federal Register / Vol. 78 , No. 248... Appraisals for Higher-Priced Mortgage Loans AGENCY: Board of Governors of the Federal Reserve System (Board... for ``higher-risk mortgages.'' For certain mortgages with an annual percentage rate that exceeds the...

  1. 78 FR 1536 - Fall 2012 Semiannual Agenda of Regulations

    Science.gov (United States)

    2013-01-08

    ... 2007 edition, the Internet became the basic means for disseminating the Unified Agenda. The complete.... Additional information on these entries is available in the Unified Agenda published on the Internet. In... Leahy- Smith America Invents Act and to Revise Reexamination Fees. 248 Rules of Practice for 0651-AC70...

  2. Studies on the chemistry of element 104 with the centrifuge system SISAK-3

    Energy Technology Data Exchange (ETDEWEB)

    Eberhardt, K.; Kratz, J.V.; Mendel, M.; Naehler, A.; Trautmann, N.; Wiehl, N. [Mainz Univ. (Germany); Alstadt, J.; Omtvedt, J.P. [Oslo Univ. (Norway); Malmbeck, R.; Skarnemark, G.; Wierczinski, B. [Chalmers Univ. of Technology, Goeteborg (Sweden); Eichler, B.; Gaeggeler, H.W.; Jost, D.T.; Tuerler, A. [Paul Scherrer Inst. (PSI), Villigen (Switzerland)

    1997-09-01

    The centrifuge system SISAK-3 combined with a detector for the measurement of {alpha}-particles and spontaneous fission (SF) fragments in a flowing organic liquid has been applied to study the chemical behaviour of element 104 produced in the reaction {sup 248}Cm({sup 18}O,5n){sup 261}104. (author) 2 figs., 2 refs.

  3. InterProScan Result: FS889884 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available ting two-sector ATPase complex (GO:0016469)|Biological Process: ATP metabolic process (GO:0046034) ... ...IPR018118 unintegrated Biological Process: proton transport (GO:0015992)|Cellular Component: proton-transpor...FS889884 FS889884_3_ORF2 248E909520AB51B4 PANTHER PTHR15184 ATP SYNTHASE 1.4e-10 T

  4. Discharge instabilities in high-pressure fluorine based excimer laser gas mixtures

    NARCIS (Netherlands)

    Mathew, D.

    2007-01-01

    Fluorine based excimer lasers such as KrF, ArF and F2 are currently the most powerful sources available in the ultraviolet wavelength range, operating at 248 nm, at 193 nm and at 157 nm, respectively. They are thus of central importance for numerous applications in this range. At these short

  5. Data of evolutionary structure change: 1I7KB-2ONUA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1I7KB-2ONUA 1I7K 2ONU B A PVGKRLQQELMTLMMSGDKGISAFPESDNLFKWVGTIHG.../entryChain> 2ONU A 2ONUA LEU CA 387 2ONU A 2ONU...248 THR CA 202 ALA CA 208 PHE CA 291 2ONU... A 2ONUA

  6. Effect of Some Environmental Variables on the Community Structure ...

    African Journals Online (AJOL)

    Water samples and zooplankton were collected monthly for five months in three sites in Wushishi Dam, Niger State. The study was undertaken to look at effect of some environmental variables on zooplankton community in the dam. Dissolved oxygen (DO) was highest in site 1 with mean value of 2.60±0.248 mg/l. There was ...

  7. Can epigenetic control explain pronounced within plant heterogeneity of meiosis in a translocation trisome of Secale L.?

    NARCIS (Netherlands)

    Sybenga, J.

    2012-01-01

    Meiotic metaphase I configuration frequencies were determined in different tillers of genetically related plants of rye (Secale cereale L.) heterozygous for reciprocal translocation T248W (between chromosome arms 1RS and 6RS) and with an additional (telocentric) arm 1RS. Seventeen different

  8. Go4Life

    Medline Plus

    Full Text Available ... all Try some of these Go4Life exercises to improve your flexibility! 2:48 Play next Play now ... all Try some of these Go4Life exercises to improve your strength! Stronger muscles can make it easier ...

  9. Postsecondary Strengths, Challenges, and Supports Experienced by Foster Care Alumni College Graduates

    Science.gov (United States)

    Salazar, Amy M.; Jones, Kevin R.; Emerson, John C.; Mucha, Lauren

    2016-01-01

    Young people transitioning from foster care to college experience unique identities and circumstances that make being successful in college especially challenging. We used qualitative survey data from 248 college graduates who were formerly in foster care to explore the strengths, challenges, and supports they experienced while in college that…

  10. "Playlinks": A Theatre-for-Young Audiences Artist-in-the-Classroom Project

    Science.gov (United States)

    McLauchlan, Debra

    2017-01-01

    "Playlinks," the project documented in this paper, contributed a theatre-based artist-in-the-classroom study to the Community Arts Zone initiative. "Playlinks" involved 248 elementary school classrooms in pre- and post-production workshops connected to live theatre that visited their schools. Data sources included researcher…

  11. 2015-2016 Travel and Hospitality Expense Reports for Joanne ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Ruxandra Staicu

    Cross-Canada democratic transition lectures with leading researcher and book co-editor. Date(s):. 2016-03-30 to 2016-04-03. Destination(s):. Montreal, Toronto, Vancouver. Airfare: $968.74. Other. Transportation: $248.71. Accommodation: $461.37. Meals and. Incidentals: $302.96. Other: $0.00. Total: $1,981.78.

  12. Evaluating the Role of Protected Natural Areas for Environmental Education in Italy

    Science.gov (United States)

    De Dominicis, Stefano; Bonaiuto, Marino; Carrus, Giuseppe; Passafaro, Paola; Perucchini, Paola; Bonnes, Mirilia

    2017-01-01

    Two quasi-experimental field studies (N = 419; 248) tested the effects of an outdoor environmental education program based in local Protected Natural Areas (PNAs) on 3rd-to-6th-grade students' proenvironmental attitudes and behaviors. Results show the program increases children's place attachment, proenvironmental attitudes, ethics and…

  13. Korean and Foreign Students' Perceptions of the Teacher's Role in a Multicultural Online Learning Environment in Korea

    Science.gov (United States)

    Lee, Dong Yub

    2011-01-01

    This study investigated Korean and foreign students' perception of the teacher's role in multicultural online learning environments in Korea. On the basis of a literature review, a survey questionnaire was developed and piloted with 248 university students in Korea. The questionnaire was subsequently modified on the basis of the results of the…

  14. Properties of carbonisation products obtained from impregnated coal

    Czech Academy of Sciences Publication Activity Database

    Plevová, Eva; Šugárková, Věra; Kaloč, M.; Vaculíková, Lenka

    -, - (2008), s. 52-61. ISBN 978-80-248-1939-6 Grant - others:GA CŘ(CZ) GA105/00/1698 Institutional research plan: CEZ:AV0Z30860518 Keywords : chlorides * impregnation * coal Subject RIV: CC - Organic Chemistry

  15. Pediatric Palliative Care: A Personal Story

    Medline Plus

    Full Text Available ... Little Stars 11,437 views 10:35 Teen Cancer Stories | UCLA Daltrey/Townshend Teen & Young Adult Cancer Program - Duration: 11:08. UCLA Health 248,569 views 11:08 The Ugly Truth of Pediatric Cancer - Duration: 5:21. KidsCancerChannel 61,073 views 5: ...

  16. Pediatric Palliative Care: A Personal Story

    Medline Plus

    Full Text Available ... Little Stars 11,437 views 10:35 Teen Cancer Stories | UCLA Daltrey/Townshend Teen & Young Adult Cancer Program - Duration: 11:08. UCLA Health 248,967 views 11:08 The Ugly Truth of Pediatric Cancer - Duration: 5:21. KidsCancerChannel 61,073 views 5: ...

  17. University Counseling Centers' Perceptions and Experiences Pertaining to Emotional Support Animals

    Science.gov (United States)

    Kogan, Lori R.; Schaefer, Karen; Erdman, Phyllis; Schoenfeld-Tacher, Regina

    2016-01-01

    Increasing numbers of students are requesting accommodations for emotional support animals (ESAs) in higher education settings. Since the legislation pertaining to this type of service animal differs from the laws governing disability service animals, colleges and universities are faced with developing new policies and guidelines. A sample of 248

  18. Gclust Server: 92083 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available Sequences Related Sequences(248) 661 periplasmic sensor hybrid histidine kinase 1 1.00e-25 0.0 0.0 0.0...length 661 Representative annotation periplasmic sensor hybrid histidine kinase Number of Sequences 1 Homologs

  19. Browse Title Index

    African Journals Online (AJOL)

    Items 51 - 100 of 248 ... Vol 44, No 2 (2016), Factors influencing extension service delivery in maize production by using agricultural innovation system in Morogoro and Dodoma regions, Tanzania, Abstract. C.P. Msuya, R.M. Wambura. Vol 44, No 1 (2016), Factors limiting and preventing emerging farmers to progress to ...

  20. Dipotassium dialuminium cyclooctaphosphate

    Directory of Open Access Journals (Sweden)

    Abdelghani Oudahmane

    2010-07-01

    Full Text Available Single crystals of the title compound, K2Al2P8O24, were obtained by solid-state reaction. The monoclinic structure is isotypic with that of the GaIII analogue and is built of eight-membered phosphate ring anions P8O248− (2/m symmetry isolated from each other and further linked by isolated AlO6 octahedra (overline{1} symmetry by sharing corners. Each AlO6 octahedron is linked to four P8O248− rings in such a way that two rings are linked through bidentate diphosphate groups attached in the cis positions on two opposite parallel edges of the octahedron. The two other rings are linked via corner-sharing to the two remaining corners in the trans positions of the AlO6 octahedron. Each P8O248− ring anion is linked to eight AlO6 octahedra. More accurately, each ring anion is linked to four AlO6 octahedra through bidentate diphosphate groups attached in the cis positions to the AlO6 octahedron and to the four remaining octahedra by sharing corners. This three-dimensional linkage delimits channels running parallel to [001] in which the ten-coordinated K+ cations (2 symmetry are distributed over two columns. These columns alternate with empty octagonally-shaped channels expanding through the P8O248− ring anions.

  1. Journal of Astrophysics and Astronomy | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Astrophysics and Astronomy. Nagendra Kumar. Articles written in Journal of Astrophysics and Astronomy. Volume 29 Issue 1-2 March-June 2008 pp 243-248. Damping of Slow Magnetoacoustic Waves in an Inhomogeneous Coronal Plasma · Nagendra Kumar Pradeep Kumar Shiv Singh Anil ...

  2. 76 FR 66332 - Florida Power Corporation; Notice of Withdrawal of Application for Amendment to Facility...

    Science.gov (United States)

    2011-10-26

    ... Traveler, TSTF-248, Revision 0, ``Revise Shutdown Margin Definition for Stuck Rod Exception.'' The proposed amendment would have revised the definition of shutdown margin to include a provision allowing an exception.../reading-rm/adams.html . Persons who do not have access to ADAMS or who encounter problems in accessing the...

  3. Pulsed laser ablation of LaSrCoO

    NARCIS (Netherlands)

    Span, E.A.F.; Roesthuis, Frank J.G.; Blank, David H.A.; Rogalla, Horst

    1999-01-01

    The ablation process of La0.5Sr0.5CoO3 by a spatial uniform 248 nm excimer laser beam has been characterized. Ablation rates, changes in the target surface morphology and composition have been studied as a function of the laser fluence. The dependence of the ablation rate on the laser fluence has

  4. Discovery of SM Higgs Boson in ATLAS Experiment

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 18; Issue 3. Discovery of SM Higgs Boson in ATLAS Experiment. Prafulla Kumar Behera. General Article Volume 18 Issue 3 March 2013 pp 248-263. Fulltext. Click here to view fulltext PDF. Permanent link:

  5. G Growth isolat h respo ted fro dif onse o om Ara fferent of regio ...

    African Journals Online (AJOL)

    SAM

    Azad P (2004). Screening of native Rhizobium strains for sustainable crop production in pulse-rice cropping system. In Biotechnology in. Sustainable and Organic Farming (Eds. Yadav AK, Chaudhary SR,. Talukdar NC), Shree Publishers and Distributors, New Delhi. pp. 244-. 248. Barboza F, Correa NS, Rosas SB (2000).

  6. Endemic Hepatitis E in two Nordic Countries

    DEFF Research Database (Denmark)

    Norder, H.; Sundqvist, L.; Magnusson, L.

    2009-01-01

    Antibodies against hepatitis E virus (anti-HEV) were found in 248 Swedish and Danish patients between 1993 and 2007. Most patients were symptomatic and tested for anti-HEV due to travel abroad. Among patients with known country of infection, most were infected in Asia, mainly on the Indian...

  7. Genetic diversity of Santalum album using random amplified ...

    African Journals Online (AJOL)

    It is of great economic importance because of its fragrant heartwood and oil. In the present study Random Amplified Polymorphic DNA (RAPD) technique was used to accesses the genetic diversity among 30 accessions of S. album collected from different parts of South India. A total of 248 polymorphic amplicons were ...

  8. 76 FR 81295 - Cost Accounting Standards: Cost Accounting Standards 412 and 413-Cost Accounting Standards...

    Science.gov (United States)

    2011-12-27

    ... a third party, this measurement emulates the costs of self- insuring the pension fund against the... Pension Harmonization Rule; Final Rule #0;#0;Federal Register / Vol. 76 , No. 248 / Tuesday, December 27... Standards Pension Harmonization Rule AGENCY: Cost Accounting Standards Board, Office of Federal Procurement...

  9. Egyptian Journal of Medical Human Genetics - Vol 9, No 2 (2008)

    African Journals Online (AJOL)

    Frequency of fragile-x in x‑linked mental retardation · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. ES El Sobky, SA El‑Ella, MA Tawfik, WF Mohamed, 237-248 ...

  10. Congenital malformations prevalent among Egyptian children and ...

    African Journals Online (AJOL)

    Rabah M. Shawky

    0.9. Q90–Q99 Chromosomal abnormalities, not elsewhere classified. Down syndrome. 2523. 74.49. Chromosomal deletions. 143. 4.22. Other trisomies. 78. 2.30. Others autosomal syndromes. 35. 1.03. Fragile X syndrome. 248. 7.32. Turner. 204. 6.02. Klinefelter syndrome. 130. 3.84. Others sex chromosome syndromes. 26.

  11. Spreading to a limit: the time required for a neophyte to reach its maximum range

    Czech Academy of Sciences Publication Activity Database

    Gassó, N.; Pyšek, Petr; Vila, M.; Williamson, M.

    2010-01-01

    Roč. 16, č. 2 (2010), s. 310-311 ISSN 1366-9516 R&D Projects: GA MŠk LC06073 Institutional research plan: CEZ:AV0Z60050516 Keywords : plant invasions * maximum range * residence time Subject RIV: EF - Botanics Impact factor: 4.248, year: 2010

  12. Scientific Investigations of Elementary School Children

    Science.gov (United States)

    Valanides, Nicos; Papageorgiou, Maria; Angeli, Charoula

    2014-01-01

    The study provides evidence concerning elementary school children's ability to conduct a scientific investigation. Two hundred and fifty sixth-grade students and 248 fourth-grade students were administered a test, and based on their performance, they were classified into high-ability and low-ability students. The sample of this study was…

  13. Differential Effects of Women's Child Sexual Abuse and Subsequent Sexual Revictimization.

    Science.gov (United States)

    Wyatt, Gail Elizabeth; And Others

    1992-01-01

    Examined differential effects of sexual revictimization in community sample of 248 African-American and white women, ages 18 to 36. Findings suggest that unintended pregnancies and abortions were significantly associated with sexual revictimization. Women who reported more than one incident in both childhood and adulthood were also likely to have…

  14. Analysis of inheritance mode in chrysanthemum using EST-derived SSR markers

    NARCIS (Netherlands)

    Park, Sang Kun; Arens, Paul; Esselink, Danny; Lim, Jin Hee; Shin, Hak Ki

    2015-01-01

    To study the inheritance mode of hexaploid chrysanthemum (random or preferential chromosome pairing), a segregation analysis was carried out using SSR markers derived from chrysanthemum ESTs in the public domain. A total of 248 EST-SSR primer pairs were screened in chrysanthemum cultivars

  15. 76 FR 70479 - Draft Environmental Assessment and Safe Harbor Agreement for the Houston Toad Within Nine Texas...

    Science.gov (United States)

    2011-11-14

    .... Box 1306, Albuquerque, New Mexico 87103 (505) 248-6651). SUPPLEMENTARY INFORMATION: Under a Safe Harbor Agreement, participating property owners voluntarily undertake management activities to enhance...) a detailed account of conservation activities to be undertaken on the portion of the property to be...

  16. Methods Development for the Isolation and Culture of Primary Corneal Endothelial Cells

    Science.gov (United States)

    2017-02-01

    stage component (C) incorporates a raised convex button for seating an inverted cornea. Panel D depicts the device as assembled for use. A...6. 21. Yue BY, Sugar J, Gilboy JE, Elvart JL. Growth of human corneal endothelial cells in culture. Invest Ophthalmol Vis Sci 1989; 30(2): 248-53

  17. Download this PDF file

    African Journals Online (AJOL)

    user

    This study was performed to evaluate the effect of different doses of sage extract on the growth and .... 1 Ingredients of the experimental diets during different stages of the study and their calculated nutrient content (g/kg of feed). Feeding stages. 0 to 4 wk. 5 to 8 wk. 9 to 13 wk. Ingredients. Maize. 300. 370. 460. Wheat. 248.

  18. Energy balance closure at a variety of ecosystems in Central Europe with contrasting topographies

    Czech Academy of Sciences Publication Activity Database

    McGloin, R.; Šigut, L.; Havránková, K.; Dušek, J.; Pavelka, M.; Sedlák, Pavel

    2018-01-01

    Roč. 248, č. 15 (2018), s. 418-431 ISSN 0168-1923 Institutional support: RVO:68378289 Keywords : energy balance closure * eddy covariance * complex terrain * forest ecosystems * cropland * marshland Subject RIV: EH - Ecology, Behaviour OBOR OECD: Meteorology and atmospheric sciences Impact factor: 3.887, year: 2016

  19. Probability inequalities for decomposition integrals

    Czech Academy of Sciences Publication Activity Database

    Agahi, H.; Mesiar, Radko

    2017-01-01

    Roč. 315, č. 1 (2017), s. 240-248 ISSN 0377-0427 Institutional support: RVO:67985556 Keywords : Decomposition integral * Superdecomposition integral * Probability inequalities Subject RIV: BA - General Mathematics Impact factor: 1.357, year: 2016 http:// library .utia.cas.cz/separaty/2017/E/mesiar-0470959.pdf

  20. AcEST: DK950875 [AcEST

    Lifescience Database Archive (English)

    Full Text Available A Beta-tubulin (Fragment) OS=Paravahlkampfi... 44 0.004 tr|Q9BKC7|Q9BKC7_9EUKA Beta-tubulin (Fragment) OS=Jakob... S++++ TCCL FP ++ +L +N Sbjct: 219 HLVSAVMSGVTCCLRFPGQLNSDLRKLAVN 248 >tr|Q9BKC7|Q9BKC7_9EUKA Beta-tubulin (Fragment) OS=Jakob

  1. Untitled

    African Journals Online (AJOL)

    frontal chest radiographs simulating disease: CT findings in seven patients. Am J Roentgenol. 1993; 160:245-248,. 2. Akan H. Cause of an opaque azygos lobe on frontal chest radiographs. Am J Radiol 1995; 164: 510-51. 3. Mata J, Caceres J, Alegret X, Coscojuela P, De marcos A. Imaging the azygos lobe: normal.

  2. The Effects of Parental Loss on the Formation of Intimate Relationships.

    Science.gov (United States)

    Hepworth, Jeri; And Others

    1984-01-01

    Studied effects of parental loss in a sample of 98 young married couples and 248 college students. Compared to those with no parental loss, young adults with parental death tended to be more hesitant about intimate relationships. Persons with parental divorce generally indicated accelerated courtship patterns. (JAC)

  3. Impact of a Temporary Food Shortage on Children and Their Mothers.

    Science.gov (United States)

    McDonald, Mary Alice; And Others

    1994-01-01

    Evaluated the effects of a drought and temporary food shortage on 248 Kenyan mother-child dyads' energy intake, weight, and behaviors. Found that school-age children were affected more negatively than toddlers, showing significant declines in energy intake, age-corrected weight, activity on the playground, and classroom attention. Behavior…

  4. No evidence for larger leaf trait plasticity in ecological generalists compared to specialists

    Czech Academy of Sciences Publication Activity Database

    Dostál, Petr; Fischer, M.; Chytrý, M.; Prati, D.

    2017-01-01

    Roč. 44, č. 3 (2017), s. 511-521 ISSN 0305-0270 R&D Projects: GA ČR GA15-09119S; GA ČR GB14-36079G Institutional support: RVO:67985939 Keywords : ecological generalists and specialists * phenotypic plasticity * multispecies experiments Subject RIV: EH - Ecology, Behaviour Impact factor: 4.248, year: 2016

  5. Molecular Mechanism of Action for Allosteric Modulators and Agonists in CC-chemokine Receptor 5 (CCR5)

    DEFF Research Database (Denmark)

    Karlshøj, Stefanie; Amarandi, Roxana Maria; Larsen, Olav

    2016-01-01

    , but maintained positive allosteric modulation of CCL3-binding. Despite a similar overall binding mode of all three metal-ion chelator complexes, the pyridine-ring of ZnClTerp blocks the conformational switch of W248 required for receptor activation, explaining its lack of activity. Importantly, ZnClTerp becomes...

  6. The fetal profile line : a proposal for a sonographic reference line to classify forehead and mandible anomalies in the second and third trimester

    NARCIS (Netherlands)

    de Jong-Pleij, Elisabeth A. P.; Ribbert, Lucia S. M.; Pistorius, Lou R.; Tromp, Ellen; Bilardo, Caterina M.

    Objectives To test the fetal profile (FP) line, defined as the line that passes through the anterior border of the mandible and the nasion, as a reference line for forehead and mandible anomalies. Methods Volumes of 248 normal and 24 pathological fetuses (1636 and 1937?weeks gestation, respectively)

  7. Dicty_cDB: VFN749 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CP001186_1337( CP001186 |pid:none) Bacillus cereus G9842, complete... 125 7e-28 CP000903_1350( CP000903 |pid:none) Bacillus weihenste...phanensis KBA... 125 7e-28 BX294154_248( BX294154 |pid:n

  8. The Development of Self-Representations during the Transition to Early Adolescence: The Role of Gender, Puberty, and School Transition

    Science.gov (United States)

    Schaffhuser, Kathrin; Allemand, Mathias; Schwarz, Beate

    2017-01-01

    The present study investigated the development of global and domain-specific self-representations in the transition from late childhood to early adolescence and tested whether gender, puberty, and school transition help explain individual differences in change. The study was based on three measurement occasions over 2 years and included 248

  9. Cloning and expression analysis of a partial LEAFY homologue from ...

    African Journals Online (AJOL)

    A partial homologue of LEAFY, designated as AcLFY (Genebank accession no HQ433335), was isolated from pineapple (Ananas comosus L. cv. Comte de Paris) by PCR. The conserved cDNA fragment of AcLFY is 256 bp in length and contained an open reading frame of 248 bp, which encodes 82 amino acids protein.

  10. Study of the high-j states in {sup 249}Cm.

    Energy Technology Data Exchange (ETDEWEB)

    Ahmad, I.

    1998-07-16

    The authors have performed the reaction {sup 248}Cm({sup 4}He, {sup 3}He) using 98.5-MeV alpha particles from the IUCF cyclotron to populate high-j states in {sup 249}Cm. A tentative assignment of the K{sub 17/2} component of the 1/2{sup +}[880] Nilsson state has been made.

  11. 76 FR 66048 - 36(b)(1) Arms Sales Notification

    Science.gov (United States)

    2011-10-25

    ... services, and other related elements of logistics support. The estimated cost is $1.248 billion. This... elements of logistics support. (iv) Military Department: Army (UJR) Air Force (YEK) (v) Prior Related Cases... engineering through extensive engineering analysis and testing. Access to AVENGER firmware and hardware could...

  12. Cumulative Reports and Publications through December 31, 1992

    Science.gov (United States)

    1993-04-01

    tip body and time hysteresis camping. ICASE Report No. 89-22, April 18, 1989. 24 pages. Matematica Aplicada e Computacional , Vol. 8, No. 2, pp. 101-118...distributed parameter systems. ICASE Report No. 85-58, November 22, 1985, 102 pages. Mathematica Applicada e Computacional , Vol. 5, No. 3, 1987, pp. 203-248

  13. On the collections of Birds, sent by the late A. T. Demery from the Sulymah River (W. Africa)

    NARCIS (Netherlands)

    Büttikofer, J.

    1892-01-01

    The collecting work of our much lamented african naturalist, Mr. A. T. Demery, having been abruptly stopped last year by his unexpected death (N. L. M. 1891, p. 248), it will be of no little importance to publish a list of the species of birds, obtained during his sojourn on the banks of the Sulymah

  14. EST Table: FS904141 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available ar to 2-aminoethanethiol (cysteamine) dioxygenase [Tribolium castaneum] gb|EFA09634.1| hypothetical protein ...10 33 %/248 aa gnl|Amel|GB12350-PA 10/09/10 35 %/238 aa gi|91090992|ref|XP_974899.1| PREDICTED: similar to 2-aminoethanethiol (cystea

  15. Utilization of soya protein as an alternative protein source in ...

    African Journals Online (AJOL)

    STORAGESEVER

    2009-01-05

    Jan 5, 2009 ... Diets. Ingredients (gkg-1). FD. MD. SD. Corn flour. 100. 100. 100. Fish meal. 380. 190. -. Soybean meal. -. 248. 500. Wheat bran. 340. 222. 120. Cottonseed meal. 150. 200. 240. Fish oil. 10. 5 ..... Kaushik SJ, Cravedi JP, Lalles JP, Sumpter J, Fauconneau B, Laroche. M (1995). Partial or total replacement of ...

  16. New Fellows and Honorary Fellow

    Indian Academy of Sciences (India)

    Home; Fellowship. Fellow Profile. Elected: 1948 Section: Chemistry. Lal, Dr Bijan Bihari Ph.D. (Lucknow). Date of birth: 4 August 1913. Date of death: 2 June 2000. Specialization: Archaeological Chemistry, Archaeometry, Conservation and Environmental Archaeology Last known address: 47, Subhas Road, Dehra Dun 248 ...

  17. Epidemiology and population dynamics of Phytophthora infestans in ...

    African Journals Online (AJOL)

    Global estimates of losses attributed to plant diseases are approximated at 24.8 million dollars, of this amount 3.4 million dollars has been recorded for potato. Of the potato diseases, late blight (Phytophthora infestans) is the most significant constraint in tropical Africa. Variation in losses of potato caused by late blight have ...

  18. Pediatric Palliative Care: A Personal Story

    Medline Plus

    Full Text Available ... 27. HammondCare 19,943 views 22:27 Teen Cancer Stories | UCLA Daltrey/Townshend Teen & Young Adult Cancer Program - Duration: 11:08. UCLA Health 248,855 views 11:08 The Ugly Truth of Pediatric Cancer - Duration: 5:21. KidsCancerChannel 61,073 views 5: ...

  19. Attitudes of Medical School Faculty toward Gifts from the Pharmaceutical Industry.

    Science.gov (United States)

    Banks, James W., III; Mainous, Arch G., III

    1992-01-01

    A survey of 248 University of Kentucky medical school faculty investigated attitudes toward American Medical Association policy concerning gifts from the pharmaceutical industry. Faculty generally agreed with the guidelines but felt gifts did not influence prescribing behaviors. PhD faculty favored more prescriptive policy than did MD faculty.…

  20. Borderline personality disorder and emotional intelligence

    NARCIS (Netherlands)

    Peter, M.; Schuurmans, H.; Vingerhoets, A.J.J.M.; Smeets, G.; Verkoeijen, P.; Arntz, A.

    2013-01-01

    The present study investigated emotional intelligence (EI) in borderline personality disorder (BPD). It was hypothesized that patients with BPD (n = 61) compared with patients with other personality disorders (PDs; n = 69) and nonpatients (n = 248) would show higher scores on the ability to perceive

  1. Okonji et al (6).cdr

    African Journals Online (AJOL)

    Timothy Ademakinwa

    Purification of tapioca leaf rhodanese. Phytochemistry15: 1343-1344. Bradford, K. M. 1976. A rapid and sensitive method for the quantitation of micrograme quantities of protein utilizing the principle of protein-dye binding. Analytical Biochemistry 72: 248-254. Broderick, K., Potluri, P., Zhuang, S., Scheffer,. I., Sharma, V., Pilz, ...

  2. Perception of Sexuality Education amongst Secondary School ...

    African Journals Online (AJOL)

    . 2.5. Others. 64. 6.1. Don't know. 44. 4.2. Total. 1050. 100.0. Where it should be given? Home. 608. 57.9. Primary school. 16. 1.5. Secondary school. 260. 24.8 ... Table 3: Relationship between Gender and Source of Sexuality Information. Sex.

  3. The influence of climatic features on distribution and infection of root ...

    African Journals Online (AJOL)

    The effect of climatic features on distribution and infection of root knot nematodes was investigated in 248 cowpea growing areas in 31 states and the Federal Capital Territory of Nigeria. The studies revealed pronounced incidence of Meloidogyne javanica (65.5%) at high altitude of 500-2000 m, high mean annual maximum ...

  4. National Defense Authorization Act for Fiscal Year 2014

    Science.gov (United States)

    2013-06-20

    Chief Information Officer ............... 248 Naval Reactors ................................................................................... 249... Fusion Cen- tre and the joint Planning Operations Centre to cooperate on mis- sile defense. We propose to develop a transparency regime based upon a... conceptual , developmental, and operational prototyping. The committee urges the Rapid Fielding program to spearhead efforts to find innovative

  5. Antibodies to malaria vaccine candidates are associated with chloroquine or sulphadoxine/pyrimethamine treatment efficacy in children in an endemic area of Burkina Faso

    DEFF Research Database (Denmark)

    Diarra, Amidou; Nebie, Issa; Tiono, Alfred

    2012-01-01

    of the value of suboptimal vaccines. The study aim was to investigate relationship between antibodies and anti-malarial drug treatment outcomes. METHODS: Some 248 children aged 0.5 and 15 years were recruited prior to the high malaria transmission season. Venous blood (5 ml) was obtained from each child...

  6. Antiproliferative heparin (glycosaminoglycans) isolated from giant ...

    African Journals Online (AJOL)

    Heparin was isolated from two bivalve mollusks, Tridacna maxima (giant clam) and Perna viridis (green mussel). The isolated heparin was quantified in crude as well as purified samples and they were estimated as 2.72 and 2.2 g/kg (in crude) and 260 and 248 mg/g (in purified samples) in T. maxima and P. viridis, ...

  7. Children and Advertising: A Bibliography. Working Draft.

    Science.gov (United States)

    Council of Better Business Bureaus, Inc., New York, NY.

    Some 248 books, articles, speeches, statements, and testimonies concerning the effects of television advertising on children are listed. Material that relates primarily to the effects of television program content is not included. The listing is alphabetical by author. All items were published between 1945 and 1975, with the majority published in…

  8. International Journal of Biological and Chemical Sciences - Vol 2 ...

    African Journals Online (AJOL)

    Psychopharmacological properties of the saponin fraction of Ficus platyphylla stem bark · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. BA Chindo, JA Anuka, G Lees, AH Yaro, SS Adamu, S Amos, C Wambebe, KS Gamaniel, 239-248.

  9. Domain Modeling: NP_059998.2 [SAHG[Archive

    Lifescience Database Archive (English)

    Full Text Available NP_059998.2 chr7 Crystal structure of putative S-adenosylmethionine dependent methy...ltransferase from Listeria monocytogenes p3g5lb_ chr7/NP_059998.2/NP_059998.2_apo_37-248.pdb psi-blast 0 ...

  10. Domain Modeling: NP_055398.1 [SAHG[Archive

    Lifescience Database Archive (English)

    Full Text Available NP_055398.1 chr3 Crystal structure of integrin-linked kinase ankyrin repeat domain ...in complex with PINCH1 LIM1 domain p3f6qb_ chr3/NP_055398.1/NP_055398.1_holo_233-305.pdb psi-blast 246C,248G

  11. A Model of Reading Comprehension in Chinese Elementary School Children

    Science.gov (United States)

    Yeung, Pui-sze; Ho, Connie Suk-han; Chan, David Wai-ock; Chung, Kevin Kien-hoa; Wong, Yau-kai

    2013-01-01

    The relationships of reading-related skills (rapid naming, morphological awareness, syntactic skills, discourse skills, and verbal working memory) and word reading to reading comprehension were examined among 248 Chinese fourth graders in Hong Kong. Multiple regression analysis results showed that syntactic skills (word order knowledge,…

  12. Medical Surveillance Monthly Report (MSMR). Volume 10, Number 2, April 2004

    Science.gov (United States)

    2004-04-01

    hyperalimentation 10,248 34.2 Early or threatened labor 11,487 13.2 Acquired hypothyroidism 4,127 13.8 Other current conditions complicating pregnancy 10,767...common pathophysiologic or etiologic bases and/or significant international health policymaking importance. Our modifications included breaking out

  13. Roles of a forest corridor between Marojejy, Anjanaharibe- Sud and ...

    African Journals Online (AJOL)

    Madagascar Conservation & Development ... Site-based conservation is widely recognized as a fundamental requirement for the maintenance of biodiversity. We carried out a rapid ... We recorded 248 endemic vertebrate species, including 80 amphibians, 52 reptiles, 79 birds, 27 small mammals and 10 lemurs. Of these ...

  14. Risk of Abnormal Eating Attitudes among Turkish Dietetic Students

    Science.gov (United States)

    Kiziltan, Gul; Karabudak, Efsun

    2008-01-01

    The purpose of this study was to determine the prevalence of abnormal eating attitudes among Turkish dietetic students and the relations between nutrition education and eating attitudes. The study population was 568 female university students (248 dietetic students, 320 non-dietetic students). Two scales were used: Eating Attitudes Test (EAT-26)…

  15. Pollen-inferred millennial changes in landscape patterns at a major biogeographical interface within Europe

    Czech Academy of Sciences Publication Activity Database

    Jamrichová, Eva; Petr, L.; Jiménez-Alfaro, B.; Jankovská, Vlasta; Dudová, Lydie; Pokorný, P.; Kolaczek, P.; Zernitskaya, V.; Čierniková, M.; Břízová, E.; Syrovátka, V.; Hájková, Petra; Hájek, M.

    2017-01-01

    Roč. 44, č. 10 (2017), s. 2386-2397 ISSN 0305-0270 EU Projects: European Commission(XE) 278065 - LONGWOOD Institutional support: RVO:67985939 Keywords : distribution patterns * gradient analysis * historical biogeography * Holocene * pollen Subject RIV: EH - Ecology, Behaviour Impact factor: 4.248, year: 2016

  16. Evolutionary history of the thicket rats (genus Grammomys) mirrors the evolution of African forests since late Miocene

    Czech Academy of Sciences Publication Activity Database

    Bryja, Josef; Šumbera, R.; Kerbis Peterhans, J. C.; Aghová, Tatiana; Bryjová, Anna; Mikula, Ondřej; Nicolas, V.; Denys, C.; Verheyen, E.

    2017-01-01

    Roč. 44, č. 1 (2017), s. 182-194 ISSN 0305-0270 Institutional support: RVO:68081766 Keywords : Arvicanthini * coastal forests * late Miocene * lowland forests * mountain forests * phylogeography * Plio-Pleistocene climate changes * Rodentia * tropical Africa Subject RIV: EG - Zoology Impact factor: 4.248, year: 2016

  17. Parent Report of Stereotyped Behaviors, Social Interaction, and Developmental Disturbances in Individuals with Angelman Syndrome

    Science.gov (United States)

    Walz, Nicolay Chertkoff

    2007-01-01

    Research examining autistic symptoms in Angelman syndrome (AS) is limited. The goal of this study was to further characterize the nature of stereotyped behaviors, social interaction deficits, and developmental disturbances in individuals with AS. Parents of 248 individuals between the ages of 3 and 22 completed a survey of autistic symptomatology…

  18. Inductive Information Retrieval Using Parallel Distributed Computation.

    Science.gov (United States)

    1984-06-01

    ormance, 8, pp. 793-810, 196. ONR -0)1. Jonathan T. Grudin and Serge Larochelle. Digraph Frequency Effects in Skilled Typing. February 1982. ONR-8202...248, 1983. ONR-4083. Gary Perlman. Natural Artificial Lang ges: Low-Level Processes. December 192. Also published in The Internatonal Journal of Man

  19. Pattern, outcome and challenges of neonatal surgical cases in a ...

    African Journals Online (AJOL)

    ... 460 (6.2%) had a surgical condition. Of the 1,657 babies that died within the same period, 196 (11.8%) of them were those with surgical conditions. Congenital abnormalities accounted for 408 (88.7%) of all the surgical cases. Intestinal obstruction 129 (31.6%), neural tube defects 101 (24.8%) and anterior abdominal wall ...

  20. Ulcerative chickenpox in an immunocompetent child

    African Journals Online (AJOL)

    were cellulitis (24.8% of the group with complications), abscess (7.2%), necrotising skin lesions (4.6%), staphylococcal scalded skin syndrome (2.8%) and necrotising fasciitis (0.8%).3. Our patient appears to have the relatively uncommon necrotising form of secondary bacterial skin infection (ecthyma) as a complication of.

  1. Bacterial diversity in snow on North Pole ice floes

    DEFF Research Database (Denmark)

    Hauptmann, Aviaja Zenia Edna Lyberth; Stibal, Marek; Bælum, Jacob

    2014-01-01

    The microbial abundance and diversity in snow on ice floes at three sites near the North Pole was assessed using quantitative PCR and 454 pyrosequencing. Abundance of 16S rRNA genes in the samples ranged between 43 and 248 gene copies per millilitre of melted snow. A total of 291,331 sequences we...

  2. A COMMUNITY STUDY OF TAXI VIOLENCE AND DISTRESS ...

    African Journals Online (AJOL)

    Three hundred and thirty three (66%) reported feeling sad about people who have died, 328 (65%) reported feeling sad but did not know why, 294 (59%) were scared about something they had seen, and 248 (50%) reported not being able to concentrate in class. Of note, 132 (26%) reported that life was not worth living and ...

  3. Risk Of Conjunctival Contamination From Blood Splashes During ...

    African Journals Online (AJOL)

    Prescription eye spectacles were the most common form of eye protection at 41.9 and 20.9% respectively for surgeons and their assistants. The contamination rate for provided protective eye wear was 53.1% with the average number of droplets being 2.48 per procedure for the principal surgeon. The duration of surgery and ...

  4. The Soundtrack of Recklessness: Musical Preferences among Adolescents.

    Science.gov (United States)

    Arnett, Jeffrey

    1992-01-01

    Adolescents (n=248) with various musical preferences were compared. Adolescents who preferred hard rock or heavy metal music reported higher rates of reckless behavior and were associated with higher levels of sensation seeking, negative family relationships, and, among girls, lower self-esteem. The relationship between sensation seeking, reckless…

  5. Enhanced cerebrovascular expression of matrix metalloproteinase-9 and tissue inhibitor of metalloproteinase-1 via the MEK/ERK pathway during cerebral ischemia in the rat

    DEFF Research Database (Denmark)

    Maddahi, Aida; Chen, Qingwen; Edvinsson, Lars

    2009-01-01

    of metalloproteinase-9 (MMP-9) and tissue inhibitor of metalloproteinase-1 (TIMP-1). RESULTS: Here, we found an infarct volume of 24.8 +/- 2% and a reduced neurological function after two hours of middle cerebral artery occlusion (MCAO), followed by 48 hours of recirculation in rat. Immunocytochemistry and confocal...

  6. The biosynthesis of C5-C25 terpenoid compounds.

    Science.gov (United States)

    Dewick, Paul M

    2002-04-01

    This review covers recently-published experimental information on the biosynthesis of terpenoids in the range C5-C25. In addition to sections on the mevalonate and mevalonate-independent (deoxyxylulose phosphate) pathways, the review considers in turn hemiterpenoids, polyprenyl diphosphate synthases, monoterpenoids, sesquiterpenoids, diterpenoids, and sesterterpenoids. The literature from January 1998 to December 2000 is reviewed, with 248 references cited.

  7. Analysis of genetic diversity of Piper spp. in Hainan Island (China ...

    African Journals Online (AJOL)

    use

    2011-10-26

    Oct 26, 2011 ... Inter-simple sequence repeat (ISSR) analysis was used to evaluate the genetic variation of Piper spp. from Hainan, China. 247 polymorphic bands out of a total of 248 (99.60%) were generated from 74 individual plants of Piper spp. The overall level of genetic diversity among Piper spp. in Hainan was.

  8. 78 FR 64943 - Medicare Program; Medicare Part B Monthly Actuarial Rates, Premium Rate, and Annual Deductible...

    Science.gov (United States)

    2013-10-30

    ... of the Tax Equity and Fiscal Responsibility Act of 1982 (TEFRA) (Pub. L. 97-248) suspended this... contingency margin for 2014. Starting in 2011, manufacturers and importers of brand-name prescription drugs... brand-name drug fees is estimated to be $3 billion. The contingency margin has been reduced to account...

  9. 76 FR 67572 - Medicare Program; Medicare Part B Monthly Actuarial Rates, Premium Rate, and Annual Deductible...

    Science.gov (United States)

    2011-11-01

    ... of the Tax Equity and Fiscal Responsibility Act of 1982 (TEFRA) (Pub. L. 97-248) suspended this..., manufacturers and importers of brand-name prescription drugs will pay a fee that is allocated to the Part B account of the SMI trust. For 2012, the total of these brand-name drug fees will be $2.8 billion. The...

  10. 77 FR 69850 - Medicare Program; Medicare Part B Monthly Actuarial Rates, Premium Rate, and Annual Deductible...

    Science.gov (United States)

    2012-11-21

    ... of the Tax Equity and Fiscal Responsibility Act of 1982 (TEFRA) (Pub. L. 97-248) suspended this..., manufacturers and importers of brand-name prescription drugs have paid a fee that is allocated to the Part B account of the SMI trust. For 2013, the total of these brand-name drug fees is estimated to be $2.7...

  11. Five-Factor Personality Traits as Predictor of Career Maturity

    Science.gov (United States)

    Atli, Abdullah

    2017-01-01

    Purpose: This study aims to determine the predictive strength of personality traits based on the five-factor theory on the level of career maturity Research Methods: The sample of the study included a total of 429 high school students, 248 females (57.8%) and 181 males (42.2%). The study utilized the "Career Maturity Scale" to determine…

  12. Cross-Cultural Comparison of Effective Leadership in Schools for Children with Blindness or Low Vision in the United States and Nigeria

    Science.gov (United States)

    Ajuwon, Paul M.; Oyinlade, A. Olu

    2016-01-01

    In this project, the authors used the Essential Behavioral Leadership Qualities (EBLQ) method of measuring leadership effectiveness to assess and compare the effectiveness of principals (leaders) of residential schools for children with blindness or low vision in the United States (U.S.) and Nigeria. A total of 248 teachers (subordinates) in 25…

  13. Investigation of the effects of LIFT printing with a KrF-excimer laser on thermally sensitive electrically conductive adhesives

    NARCIS (Netherlands)

    Perinchery, S.M.; Smits, E.C.P.; Sridhar, A.; Albert, P.; Brand, J. van den; Mandamparambil, R.; Yakimets, I.; Schoo, H.F.M.

    2014-01-01

    Laser induced forward transfer is an emerging material deposition technology. We investigated the feasibility of this technique for printing thermally sensitive, electrically conductive adhesives with and without using an intermediate dynamic release layer. A 248nm KrF-excimer laser was used to

  14. Environmental Assessment for Selected Regions in the Mediterranean Sea

    Science.gov (United States)

    1992-01-01

    the northern strait between Tunisia and Sicily. The best set of current measurements in the southern strait was collected by Osservatorio Geofisico ...the eastern Mediterranean. OceanoL Acta 9(3): 239-248. Arevalo, L. and T. Garcia (1982). Corrientes de la Costa de Malaga, metodos y resultados. Inf

  15. Reconstituting the Social: Transforming Institutions and Emerging Forms of Knowledge-Making in Korea, Late Nineteenth Century to 1945

    Directory of Open Access Journals (Sweden)

    John DiMoia

    2016-09-01

    Full Text Available Kyung Moon Hwang, Rationalizing Korea: The Rise of the Modern State, 1894-1945. University of California Press, 2015. 416 pp. $75 (cloth; $35 (paper/e-book. Theodore Jun Yoo, It's Madness: The Politics of Mental Health in Colonial Korea. University of California Press, 2016. 248 pp. $65 (cloth/e-book.

  16. Effects of laser wavelength and fluence on the growth of ZnO thin films by pulsed laser deposition

    NARCIS (Netherlands)

    Craciun, V.; Amirhaghi, S.; Craciun, D.; Elders, J.; Gardeniers, Johannes G.E.; Boyd, Ian W.

    Transparent, electrically conductive and c-axis oriented ZnO thin films have been grown by the pulsed laser deposition (PLD) technique on silicon and Corning glass substrates employing either a KrF excimer laser (λ = 248 nm) or a frequency-doubled Nd:YAG laser (λ = 532 nm). The crystalline

  17. Palaeoenvironmental reconstruction of Hüsamlar coal seam, SW ...

    Indian Academy of Sciences (India)

    56

    2009 Palaeoenvironment of Seam I in the Marathousa Lignite Mine, Megalopolis Basin. (Southern Greece); International Journal of Coal Geology 78 233-248. Suárez-Ruiz I, Jimenez A, Iglesias J, Laggoun-Defarge F and Pradot J G 1994 Influence of. Resinite on Huminite Properties; Energy &Fuels 8 1417-1424. Sun S and ...

  18. Initial Nitrous Oxide Fluxes from a Maize—legume Cropping System ...

    African Journals Online (AJOL)

    komla

    Amazon. Submitted to Global Biogeochemical. Cycles. Rodhe, H. (1990). A comparison of the contribution of various gases to the greenhouse effect. Science 248: 1217—1219. Sanginga, N., J.A. Okogun, B.Va.nlauwe, J. Diels,. R.J. Carsky, 8! KB. Dashiell (2001). Nitrogen contribution of promiscuous soybeans in maize-.

  19. Weighted-noise threshold based channel estimation for OFDM ...

    Indian Academy of Sciences (India)

    In Kashyap & Mehta. (2014), in the context of driving power control in underlay cognitive radio, impact of various channel estimation errors has been studied. ...... Minn H and Bhargava V 2000 An investigation into time-domain approach for OFDM channel estima- tion. IEEE Trans. Broadcasting 46(4): 240–248, doi: 10.1109/ ...

  20. Browse Title Index

    African Journals Online (AJOL)

    Items 151 - 200 of 248 ... Vol 35 (2006), Poverty reduction through alternative livelihoods in Botswana\\'s desert margins, Abstract. P Malope, KR ... Vol 45, No 1 (2017), Research themes, authors and methodologies in the South African Journal of Agricultural Extension: an analysis of publications 1999–2014, Abstract.

  1. Niche asymmetry of vascular plants increases with elevation

    Czech Academy of Sciences Publication Activity Database

    Dvorský, Miroslav; Macek, Martin; Kopecký, Martin; Wild, Jan; Doležal, Jiří

    2017-01-01

    Roč. 44, č. 6 (2017), s. 1418-1425 ISSN 0305-0270 R&D Projects: GA ČR GA13-13368S Institutional support: RVO:67985939 Keywords : drought stress * Himalaya * HOF models Subject RIV: EH - Ecology, Behaviour Impact factor: 4.248, year: 2016

  2. First proton-proton collisions at the LHC as observed with the ALICE detector: measurement of the charged-particle pseudorapidity density at root s=900 GeV

    Czech Academy of Sciences Publication Activity Database

    Aamodt, K.; Adamová, Dagmar; Bielčík, J.; Bielčíková, Jana; Kapitán, Jan; Král, J.; Krus, M.; Kushpil, Svetlana; Kushpil, Vasilij; Mareš, Jiří A.; Pachr, M.; Petráček, V.; Polák, Karel; Pospíšil, V.; Šmakal, R.; Šumbera, Michal; Tlustý, D.; Wagner, V.; Závada, Petr; Zycháček, V.

    2010-01-01

    Roč. 65, 1-2 (2010), s. 111-125 ISSN 1434-6044 R&D Projects: GA MŠk LA09013 Institutional support: RVO:68378271 ; RVO:61389005 Keywords : ALICE * high energies * hadrons Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders; BF - Elementary Particles and High Energy Physics (FZU-D) Impact factor: 3.248, year: 2010

  3. Saaremaa rannaala võib suureneda 200 meetrilt riigiteeni / Ain Lember

    Index Scriptorium Estoniae

    Lember, Ain

    2003-01-01

    Aasta lõpuks valmiva Saare maakonna rannaalade tsoneeringu ülesandeks on koostada rannaalade andmebaas, hinnata mõju keskkonnale, töötada välja metoodika rannaalade planeerimiseks. Tsoneering hõlmab asustust, kuhu jääb neli alevikku ja 248 küla 10 235 elanikuga

  4. improving the quality of small RCTs

    African Journals Online (AJOL)

    ice and young researchers, who are often required to complete a. 'srnall-scale' research project for their master's (l\\/ll\\/led) thesesfi2. RCTs 'nested' in routine .... of Australia 2002;176:248-9. 5. Ward E, King M, Lloyd M, Bower P, Friedli. K. Conducting randomised trials in gener- al practice: methodological and practical.

  5. What Friends Are for: The Relationships between Body Image, Substance Use, and Peer Influence among Finnish Adolescents

    Science.gov (United States)

    Palmqvist, Riia; Santavirta, Nina

    2006-01-01

    The study investigated the relationships between substance use, body image, and peer influence among Finnish adolescents. The participants (N = 488, 240 boys and 248 girls), were eighth-grade high school students. The data were gathered using a questionnaire. In addition to background information, the study covered risk behaviors frequency, body…

  6. AcEST: DK959921 [AcEST

    Lifescience Database Archive (English)

    Full Text Available DTR Putative uncharacterized protein OS=Medic... 248 2e-64 tr|B5LWQ7|B5LWQ7_ZIZJJ Ubiquitin extensive-like p...B5LWQ7|B5LWQ7_ZIZJJ Ubiquitin extensive-like protein OS=Ziziphus jujuba GN=UBQ PE=2 SV=1 Length = 156 Score

  7. Gclust Server: 201503 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available 201503 TET_1461.m00002 Cluster Sequences - 248 hypothetical protein chr_0_8255671_1...461; no annotation 1 1.00e-99 0.0 11.11 0.0 0.0 0.0 0.0 Show 201503 Cluster ID 201503 Sequence ID TET_1461.m

  8. Download this PDF file

    African Journals Online (AJOL)

    Rivista di Agricultura Sub- tropicale e Tropicale 77:209—248. Rezene Fessehaie and Parker, C. (1992). Problems and control of parasitic weeds in Ethiopia. In: Proceedings, 2nd Ethiopian Weed Science Workshop, Addis. Ababa, 1988, pp. 61—63. EWSC, Addis Ababa, Ethiopia. Saghir, A.R. (1979). Different chemicals and ...

  9. Download this PDF file

    African Journals Online (AJOL)

    To date, very few studies have attempted to measure the code of silence among the South. African Police Service .... police agencies: medium-sized police agencies with 76 to 200 sworn officers (24,8%), large police agencies with 201 to 500 sworn officers. (13,9%), or very large police agencies with over. 500 sworn officers ...

  10. AcEST: BP919367 [AcEST

    Lifescience Database Archive (English)

    Full Text Available |Q0VJ74_9BILA Calreticulin OS=Heligmosomoides polygyrus... 36 1.3 tr|A8WXR3|A8WXR3_CAEBR Putative uncharacte...+ +++A AE KK +R+ Sbjct: 248 QAAIDSLQRKRARRSAALAEQRKKLQQRQ 276 >tr|Q0VJ74|Q0VJ74_9BILA Calreticulin OS=Heligmos

  11. ERRATUM- Paradoxical helminthiasis and giardiasis in Cape Town ...

    African Journals Online (AJOL)

    Eggs and cysts were seen at the following prevalence: Ascaris 24.8%; Trichuris 50.6%; Hymenolepis nana 2.2%; Enterobius 0.6%; Giardia 17.3%; hookworm 0.08%; and Trichostrongylus 0.1%. Approximately 60% of sewage sludge is used in a form that will contain viable eggs and cysts. Conclusions: Prevalence trends in ...

  12. Thinking About America’s Defense. An Analytical Memoir

    Science.gov (United States)

    2008-01-01

    248 And Finally: Do Your Homework ...desist, I think we have heard the last of this matter. They, of all people, should avoid making sweeping statements before they do their homework ...each side’s retaliatory capability; banning land-based mobile missiles would have a similarly deleterious effect. There was a rather shocking finding

  13. Influence of nuclear dissipation on fission dynamics of the excited ...

    Indian Academy of Sciences (India)

    A stochastic approach to fission dynamics based on two-dimensional Langevin equations was applied to calculate the anisotropy of the fission fragments angular distribution and average pre-scission neutron multiplicities for the compound nucleus 248Cf formed in the $${16}$O+$^{232}$Th reactions. Postsaddle nuclear ...

  14. Journal of Chemical Sciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Chemical Sciences. G Mugesh. Articles written in Journal of Chemical Sciences. Volume 112 Issue 3 June 2000 pp 239-248. Aspects of organochalcogen (S, Se, Te) compounds stabilized by intramolecular coordination · G Mugesh Arunashree Panda Harkesh B Singh · More Details Abstract ...

  15. All projects related to | Page 187 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Topic: WEST AFRICA, HIGHER EDUCATION INSTITUTIONS, INFORMATION TECHNOLOGY, EDUCATIONAL REFORM, UNIVERSITIES. Region: Ivory Coast, Canada. Total Funding: CA$ 248,600.00. Modernization of the Education and Research System at Universite´ Nangui Abrogoua Following the Post-Election Crisis ...

  16. Pediatric Palliative Care: A Personal Story

    Medline Plus

    Full Text Available ... 27. HammondCare 19,764 views 22:27 Teen Cancer Stories | UCLA Daltrey/Townshend Teen & Young Adult Cancer Program - Duration: 11:08. UCLA Health 248,569 views 11:08 The Ugly Truth of Pediatric Cancer - Duration: 5:21. KidsCancerChannel 61,073 views 5: ...

  17. Prevalence of Sexual Activity and Outcome among Female ...

    African Journals Online (AJOL)

    Seventeen (12.4%) students had initiated sexual intercourse before 11 years. The frequency of sexual exposure was high, with 34.3% of the students having intercourse more than once in a week. Pregnancy rate among sexually active females was 27.0%, with 24.8% rate of induced abortion. Early sexual health education ...

  18. Predictors of Maternal Sensitivity in At-Risk Families

    Science.gov (United States)

    Neuhauser, Alex

    2018-01-01

    Maternal sensitivity is of central importance to a child's healthy development. This study examines how different types of psychosocial stress originating from the child, the parents, the context, and overall stress relate to maternal sensitivity. Psychosocial stress and its impact on maternal sensitivity are assessed in an at-risk sample of 248

  19. Multiple Facets of Self-Control in Arab Adolescents: Parallel Pathways to Greater Happiness and Less Physical Aggression

    Science.gov (United States)

    Gavriel-Fried, Belle; Ronen, Tammie; Agbaria, Qutaiba; Orkibi, Hod; Hamama, Liat

    2018-01-01

    Adolescence is a period of dramatic change that necessitates using skills and strengths to reduce physical aggression and increase happiness. This study examined the multiple facets of self-control skills in achieving both goals simultaneously, in a sample of 248 Arab adolescents in Israel. We conceptualized and tested a new multi-mediator model…

  20. Clinician’s perceptions of and emotional responses to online infidelity

    NARCIS (Netherlands)

    Dijkstra, Pieternel; de Zeeuw, Heleen; Barelds, Dick P.H.; Buunk, Abraham P.

    2015-01-01

    Aim of the present study was to examine the degree to which mental health workers perceive twelve online partner behaviors as different types of infidelity and to examine the degree to which these behaviors evoke two types of jealousy, that is, fait accompli and anxious jealousy among mental. 248

  1. Bulletin of Materials Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science. A M Umarji. Articles written in Bulletin of Materials Science. Volume 23 Issue 4 August 2000 pp 243-248 Refractory Cements. Ceramic joining through reactive wetting of alumina with calcium aluminate refractory cements · K Geetha A M Umarji T R N Kutty · More Details ...

  2. Diagnosis and treatment of malaria in peripheral health facilities in Uganda

    DEFF Research Database (Denmark)

    Ndyomugyenyi, Richard; Magnussen, Pascal; Clarke, Siân

    2007-01-01

    , vomiting and abdominal pains. However, due to the low prevalence of malaria, the predictive values of these individual signs alone, or in combination, were poor. Only 24.8% of 1627 patients had malaria according to case definition and > 75% of patients were unnecessarily treated for malaria and few slide...

  3. The Language Growth of Spanish-Speaking English Language Learners

    Science.gov (United States)

    Rojas, Raul; Iglesias, Aquiles

    2013-01-01

    Although the research literature regarding language growth trajectories is burgeoning, the shape and direction of English Language Learners' (ELLs) language growth trajectories are largely not known. This study used growth curve modeling to determine the shape of ELLs' language growth trajectories across 12,248 oral narrative language samples…

  4. Optimal labeling dose, labeling time, and magnetic resonance imaging detection limits of ultrasmall superparamagnetic iron-oxide nanoparticle labeled mesenchymal stromal cells

    DEFF Research Database (Denmark)

    Mathiasen, Anders Bruun; Hansen, Louise; Friis, Tina

    2013-01-01

    -oxide (USPIO) labeled mesenchymal stromal cells (MSCs). Materials and Methods. 248 gel-phantoms were constructed and scanned on a 1.5T MRI-scanner. Phantoms contained human MSCs preincubated with USPIO nanoparticles for 2, 6, or 21 hours using 5 or 10  μ g USPIO/10(5) MSCs. In addition, porcine hearts were...

  5. - comparison between 75G and 100G oral glucose tolerance tests

    African Journals Online (AJOL)

    Summary. Study Objective: To compare the diagnostic performances of 75g and 100g oral glucose tolerance tests in detecting. Gestational Diabetes Mellitus in Nigerian pregnant women. Materials and Methods: 248 women in 3rd trimester attend- ing antenatal clinic of the Lagos University Teaching Hospi- tal, Lagos ...

  6. Coordinating a Team of Robots for Urban Reconnaisance

    Science.gov (United States)

    2010-11-01

    skid on the ground in order to allow the robot to turn. Our wheels are driven along a gearway built into the inner rim of the tyre , with the...Wagner, Alan and et al. s.l. : Springer, 2006, Distributed Autonomous Robotic Systems, Vol. 7, pp. 237-248. 13. OrcBoard. OrcBoard. [Online

  7. Enhanced methanol oxidation and oxygen reduction reactions on palladium-decorated FeCo@Fe/C core–shell nanocatalysts in alkaline medium

    CSIR Research Space (South Africa)

    Fashedemi, OO

    2013-12-01

    Full Text Available lie between 0.231 and 0.248 nm which correspond to the (111) plane of the Pd alloy, in close agreement with the d-spacing of 0.225 nm obtained from the XRD data. A well-defined Pd icosahedron has an interplanar distance of about 0.230 nm between its...

  8. Combined effects of prenatal exposures to environmental chemicals on birth weight

    DEFF Research Database (Denmark)

    Govarts, Eva; Remy, Sylvie; Bruckers, Liesbeth

    2016-01-01

    Prenatal chemical exposure has been frequently associated with reduced fetal growth by single pollutant regression models although inconsistent results have been obtained. Our study estimated the effects of exposure to single pollutants and mixtures on birth weight in 248 mother-child pairs. Arse...

  9. Addressing the human resource for health crisis in Tanzania: the lost ...

    African Journals Online (AJOL)

    From 2001 to 2010 a total of 2,248 medical doctors and 198 dental surgeons graduated from five local training institutions and abroad. ... included place of accommodation, allowance (for internship) or salary delay (for first appointment), difficulty working environment, limited carrier opportunities and concern for job security.

  10. 75 FR 15739 - International Business Machines Corporation: Armonk, NY; Notice of Termination of Investigation

    Science.gov (United States)

    2010-03-30

    ... Termination of Investigation Pursuant to Section 223 of the Trade Act of 1974, as amended, an investigation... Business Machines Corporation, Armonk, New York. The petitioning group of workers is covered by a certification, (TA-W-71,248) which expires on July 31, 2011. Consequently, further investigation in this case...

  11. Neutron and proton shell closure in the superheavy region via ...

    Indian Academy of Sciences (India)

    emission from nuclei in the superheavy region with an aim to find the next neutron and proton shell closure in ... et al [5] studied cluster emission from the superheavy nucleus 277Ds and from its alpha decay products ... The isotope of 292116 was identified in the reaction of curium with calcium (248Cm. + 48Ca → 292116 + ...

  12. How Hearing Loss and Age Affect Emotional Responses to Nonspeech Sounds

    Science.gov (United States)

    Picou, Erin M.

    2016-01-01

    Purpose: The purpose of this study was to evaluate the effects of hearing loss and age on subjective ratings of emotional valence and arousal in response to nonspeech sounds. Method: Three groups of adults participated: 20 younger listeners with normal hearing (M = 24.8 years), 20 older listeners with normal hearing (M = 55.8 years), and 20 older…

  13. Functioning of 7-Year-Old Children Born at 32 to 35 Weeks' Gestational Age

    NARCIS (Netherlands)

    Cserjesi, R.; Van Braeckel, K.N.J.A.; Butcher, P.R.; Kerstjens, J.M.; Reijneveld, S.A.; Bouma, A.; Geuze, R.H.; Bos, A.F.

    2012-01-01

    OBJECTIVE: To compare neuropsychological functions in moderately preterm (32-35 weeks' gestation) and full-term children at the age of 7 years and identify gender differences. METHODS: Community-based prospective cohort study of 248 moderately preterm children (138 boys) and 130 full-term children

  14. Parental Time Pressures and Depression among Married Dual-Earner Parents

    Science.gov (United States)

    Roxburgh, Susan

    2012-01-01

    This article examines whether there is an association between depression and parental time pressure among employed parents. Using a sample of 248 full-time employed parents and using the stress process framework, I also examine the extent to which gender, socioeconomic status, social support, and job conditions account for variation in the…

  15. Suicide in serial killers.

    Science.gov (United States)

    Lester, David; White, John

    2010-02-01

    In a sample of 248 killers of two victims in America from 1900 to 2005, obtained from an encyclopedia of serial killers by Newton (2006), those completing suicide did not differ in sex, race, or the motive for the killing from those who were arrested.

  16. Advanced Fabrication Processes for Superconducting Very Large Scale Integrated Circuits

    Science.gov (United States)

    2015-10-13

    oxide was σ = 2%, where σ is standard deviation (normalized to the mean value). Photolithography was done using a Canon FPA-3000 EX4 stepper with 248...Advances in Cryogenic Engineering Materials, vol. 32, ch. 80, R.P Reed and A.F Clark, Eds. Springer, 1986, pp. 671-678. [19] Y.H. Shi, B.R. Zhao

  17. Dicty_cDB: VSJ470 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 5.4 Zebrafish DNA sequence *** SEQUENCING IN PROGRESS *** from clone CH211-248L17. 48 0.21 2 AJ277431 |AJ277431.1 Megaselia scala...ris retrotransposon TROMB-Ms2. 36 0.43 2 AJ277430 |AJ277430.1 Megaselia scala

  18. Pediatric Palliative Care: A Personal Story

    Medline Plus

    Full Text Available ... 27. HammondCare 19,699 views 22:27 Teen Cancer Stories | UCLA Daltrey/Townshend Teen & Young Adult Cancer Program - Duration: 11:08. UCLA Health 248,474 views 11:08 The Ugly Truth of Pediatric Cancer - Duration: 5:21. KidsCancerChannel 61,073 views 5: ...

  19. A comparative study of via drilling and scribing on PEN and PET substrates for flexible electronic applications using excimer and Nd:YAG laser sources

    NARCIS (Netherlands)

    Mandamparambil, R.; Fledderus, H.; Brand, J. van den; Saalmink, M.; Kusters, R.; Podprocky, T.; Steenberge, G. van; Baets, J. de; Dietzel, A.H.

    2009-01-01

    A study on via drilling and channel scribing on PEN and PET substrates for flexible electronic application is discussed in this paper. For the experiments, both KIF excimer laser (248 nm) and frequency tripled Nd:YAG (355 nm) laser are used. Different measurement techniques like optical microscopy,

  20. Drug: D04462 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available of drugs in Japan [BR:br08301] 2 Agents affecting individual organs 24 Hormones 248 Mixed hormone preparation...orethisterone - mestranol mixt G03FB Progestogens and estrogens, sequential preparations G03FB05 Norethisterone and estrogen D04462 Norethisterone - mestranol mixt PubChem: 17398115 ...