WorldWideScience

Sample records for californium 248

  1. Accurate determination of Curium and Californium isotopic ratios by inductively coupled plasma quadrupole mass spectrometry (ICP-QMS) in 248Cm samples for transmutation studies

    International Nuclear Information System (INIS)

    The French Atomic Energy Commission has carried out several experiments including the mini-INCA (INcineration of Actinides) project for the study of minor-actinide transmutation processes in high intensity thermal neutron fluxes, in view of proposing solutions to reduce the radiotoxicity of long-lived nuclear wastes. In this context, a Cm sample enriched in 248Cm (∼97 %) was irradiated in thermal neutron flux at the High Flux Reactor (HFR) of the Laue-Langevin Institute (ILL). This work describes a quadrupole ICP-MS (ICP-QMS) analytical procedure for precise and accurate isotopic composition determination of Cm before sample irradiation and of Cm and Cf after sample irradiation. The factors that affect the accuracy and reproducibility of isotopic ratio measurements by ICP-QMS, such as peak centre correction, detector dead time, mass bias, abundance sensitivity and hydrides formation, instrumental background, and memory blank were carefully evaluated and corrected. Uncertainties of the isotopic ratios, taking into account internal precision of isotope ratio measurements, peak tailing, and hydrides formations ranged from 0.3% to 1.3%. This uncertainties range is quite acceptable for the nuclear data to be used in transmutation studies.

  2. Accurate determination of Curium and Californium isotopic ratios by inductively coupled plasma quadrupole mass spectrometry (ICP-QMS) in Cm-248 samples for transmutation studies

    International Nuclear Information System (INIS)

    The French Atomic Energy Commission has carried out several experiments including the mini-INCA (Incineration of Actinides) project for the study of minor-actinide transmutation processes in high intensity thermal neutron fluxes, in view of proposing solutions to reduce the radiotoxicity of long-lived nuclear wastes. In this context, a Cm sample enriched in 248Cm (similar to 97%) was irradiated in thermal neutron flux at the High Flux Reactor (HFR) of the Laue-Langevin Institute (ILL). This work describes a quadrupole ICP-MS (ICP-QMS) analytical procedure for precise and accurate isotopic composition determination of Cm before sample irradiation and of Cm and Cf after sample irradiation. The factors that affect the accuracy and reproducibility of isotopic ratio measurements by ICP-QMS, such as peak centre correction, detector dead time, mass bias, abundance sensitivity and hydrides formation, instrumental background, and memory blank were carefully evaluated and corrected. Uncertainties of the isotopic ratios, taking into account internal precision of isotope ratio measurements, peak tailing, and hydrides' formations ranged from 0. 3% to 1. 3%. This uncertainties' range is quite acceptable for the nuclear data to be used in transmutation studies. (authors)

  3. Metabolism and toxicity of californium

    International Nuclear Information System (INIS)

    Metabolism of californium can be compared with that of other transplutonium elements. The most important points are as follows: a fast blood clearance and fast bone uptake more important than liver uptake, a relatively high urinary excretion and kidney retention. Blood clearance of californium can be compared with that of americium. Distribution of californium 252 nitrate after intramuscular injection in rats was studied. There are very few experimental data on acute or long term toxicity of californium. (28 references)

  4. Magnetism in californium

    International Nuclear Information System (INIS)

    A SQUID-based magnetic susceptometer has been constructed for studying small radioactive samples at temperatures below 350 K and in magnetic fields up to 50 kilogauss. The device has been used to study californium (element 98) in a number of solid-state forms: the dhcp metal, several oxides (Cf2O3 in both the bcc and monoclinic structures, Cf7O12, CfO2 and BaCfO3), several monopnictides (CfN, CfAs and CfSb) and the trichloride (in both the hexagonal and orthorhombic structures). All of these materials were studied in polycrystalline form, and hexagonal CfCl3 was studied in single-crystal form as well. The susceptometer has the sensitivity to measure samples containing less than 10 micrograms of californium. The magnetic susceptibilities of all of the californium materials at temperatures above about 100 K are described well by the Curie-Weiss relationship. This behavior is consistent with the assumption that the magnetic 5f electrons are localized and that the paramagnetic behavior can be interpreted in terms of the properties of the free ion. The measured values of the effective paramagnetic moment, μ/sub eff/, for all the californium materials that were studied are reasonably consistent with theoretical values based on intermediate coupling models. All of the californium materials showed some indications of cooperative magnetic effects. The dhcp metal was observed to order ferromagnetically at 52 K, and all of the californium compounds studied showed signs of antiferromagnetic ordering, mostly at temperatures below 25 K. 91 refs., 50 figs., 19 tabs

  5. Californium Multiplier (CFX)

    International Nuclear Information System (INIS)

    The availability of 252Cf as an economical high-intensity neutron source has made it possible to construct compact neutron irradiation devices with widespread applications. The simplest such device consists of a single 252Cf source within a moderating and shielding medium. Higher neutron flux levels can be attained either through the use of more 252Cf or through source multiplication by means of a subcritical uranium assembly. Although the use of larger 252Cf sources to achieve higher neutron flux is technically straightforward, an economic penalty is paid as the source strength is increased. Larger californium sources imply larger initial investments to cover the cost of source material and larger operating costs resulting from the decay of the 252Cf source. A Californium Multiplier, the CFX, which produces a flux enhancement of 30 when compared to a conventional moderated 252Cf system has been designed, licensed, built, and tested by IRT Corporation. Such systems are now available on a commercial basis for both neutron radiography and neutron activation analysis. The first commercial CFX system was installed at the Research Laboratories of Eastman Kodak Company in Rochester, NY, in March 1975. This device, using 1 mg of 252Cf, is very stable and the neutron flux generated by the CFX is very reproducible. The performance characteristics of this system are summarized

  6. Californium--palladium metal neutron source material

    Science.gov (United States)

    Dahlen, B.L.; Mosly, W.C. Jr.; Smith, P.K.; Albenesius, E.L.

    1974-01-22

    Californium, as metal or oxide, is uniformly dispersed throughout a noble metal matrix, provided in compact, rod or wire form. A solution of californium values is added to palladium metal powder, dried, blended and pressed into a compact having a uni-form distribution of californium. The californium values are decomposed to californium oxide or metal by heating in an inert or reducing atmosphere. Sintering the compact to a high density closes the matrix around the dispersed californium. The sintered compact is then mechanically shaped into an elongated rod or wire form. (4 claims, no drawings) (Official Gazette)

  7. Californium-252 Neutron Sources for Medical Applications

    International Nuclear Information System (INIS)

    Californium-252 neutron sources are being prepared to investigate the value of this radionuclide in diagnosing and treating diseases. A source resembling a cell-loaded radium needle was developed for neutron therapy. Since therapy needles are normally implanted in the body, very conservative design criteria were established to prevent leakage of radioactive. Methods are being developed to prepare very intense californium sources that could be used eventually for neutron radiography and for diagnosis by neutron activation analysis. This paper discusses these methods

  8. Spontaneous Partitioning of Californium from Curium: Curious Cases from the Crystallization of Curium Coordination Complexes

    Energy Technology Data Exchange (ETDEWEB)

    Cary, Samantha K.; Silver, Mark A.; Liu, Guokui; Wang, Jamie C.; Bogart, Justin A.; Stritzinger, Jared T.; Arico, Alexandra A.; Hanson, Kenneth; Schelter, Eric J.; Albrecht-Schmitt, Thomas E.

    2015-12-07

    The reaction of 248CmCl3 with excess 2,6-pyridinedicarboxylic acid (DPA) under mild solvothermal conditions results in crystallization of the tris-chelate complex Cm(HDPA)3·H2O. Approximately half of the curium remains in solution at the end of this process, and evaporation of the mother liquor results in crystallization of the bis-chelate complex [Cm(HDPA)- (H2DPA)(H2O)2Cl]Cl·2H2O. 248Cm is the daughter of the α decay of 252Cf and is extracted in high purity from this parent. However, trace amounts of 249,250,251Cf are still present in all samples of 248Cm. During the crystallization of Cm(HDPA)3·H2O and [Cm(HDPA)(H2DPA)(H2O)2Cl]Cl·2H2O, californium(III) spontaneously separates itself from the curium complexes and is found doped within crystals of DPA in the form of Cf(HDPA)3. These results add to the growing body of evidence that the chemistry of californium is fundamentally different from that of earlier actinides.

  9. Production of extra pure curium and californium preparations

    International Nuclear Information System (INIS)

    Preparations of curium-244,245,248 and californium-249,252 are used for the production of ionizing radiation sources for different applications and fundamental nuclear-physical investigations, placing high requirements on the radiochemical and chemical purity of the preparations. Extraction chromatography using di-(2-ethylhexyl)phosphoric acid (D2EHPA) as extractant was chosen to prepare extra pure curium and californium preparations. In order to identify the optimal conditions of Cm-Cf separation and to remove impurities from them (reagent and other impurities), investigations were performed into the effect of impurities (Na+, Ca2+, Al3+, Fe2+, Fe3+ taken as example), extractant and eluent concentration and solution flow rate on the efficiency of mutual purification of Cm and Cf. Both theoretical and experimental estimations were made of the maximum concentration at which the impurities do not affect the process. The conditions chosen allow mutual purification of milligram amounts of Cm and Cf from impurity elements at E(pur) =102 - 103 during a single chromatographic cycle (E(pur) =>103) using a column with 5 - 10 cm3 volume. In this case the production yield exceeds 98%. The purification of milligram amounts of curium and californium from fission products (lanthanides in general, cerium in particular) was performed in D2EHPA-decane-PbO2-HNO3 and D2EHPA-decane-DTPA-H3-Cit extraction chromatography systems. In order to establish the optimal conditions, the effect of [D2EHPA] and eluent on the mutual purification of Cm and Cf and on their purification from cerium and impurity elements was studied in the D2EHPA-decane-PbO2-HNO3 system. During a single chromatographic cycle the mutual purification factors of TPE and of their purification from impurity cations achieve 102-103, from cerium - E(pur) > 10. In the D2EHPA-decane-DTPA-H3Cit system, the effect of concentration of extractant and eluent pH on the efficiency of Cm and Cf purification from lanthanides was

  10. Californium Electrodepositions at Oak Ridge National Laboratory

    Energy Technology Data Exchange (ETDEWEB)

    Boll, Rose Ann [ORNL

    2015-01-01

    Electrodepositions of californium isotopes were successfully performed at Oak Ridge National Laboratory (ORNL) during the past year involving two different types of deposition solutions, ammonium acetate (NH4C2H3O2) and isobutanol ((CH3)2CHCH2OH). A californium product that was decay enriched in 251Cf was recovered for use in super-heavy element (SHE) research. This neutron-rich isotope, 251Cf, provides target material for SHE research for the potential discovery of heavier isotopes of Z=118. The californium material was recovered from aged 252Cf neutron sources in storage at ORNL. These sources have decayed for over 30 years, thus providing material with a very high 251Cf-to-252Cf ratio. After the source capsules were opened, the californium was purified and then electrodeposited using the isobutanol method onto thin titanium foils for use in an accelerator at the Joint Institute for Nuclear Research in Dubna, Russia. Another deposition method, ammonium acetate, was used to produce a deposition containing 1.7 0.1 Ci of 252Cf onto a stainless steel substrate. This was the largest single electrodeposition of 252Cf ever prepared. The 252Cf material was initially purified using traditional ion exchange media, such as AG50-AHIB and AG50-HCl, and further purified using a TEVA-NH4SCN system to remove any lanthanides, resulting in the recovery of 3.6 0.1 mg of purified 252Cf. The ammonium acetate deposition was run with a current of 1.0 amp, resulting in a 91.5% deposition yield. Purification and handling of the highly radioactive californium material created additional challenges in the production of these sources.

  11. Historical review of californium-252 discovery and development

    International Nuclear Information System (INIS)

    This paper discusses the discovery and history of californium 252. This isotope may be synthesized by irradiating plutonium 239, plutonium 242, americium 243, or curium 244 with neutrons in a nuclear reactor. Various experiments and inventions involving 252Cf conducted at the Savannah River Plant are discussed. The evolution of radiotherapy using californium 252 is reviewed

  12. Californium-252: a remarkable versatile radioisotope

    Energy Technology Data Exchange (ETDEWEB)

    Osborne-Lee, I.W.; Alexander, C.W.

    1995-10-10

    A product of the nuclear age, Californium-252 ({sup 252}Cf) has found many applications in medicine, scientific research, industry, and nuclear science education. Californium-252 is unique as a neutron source in that it provides a highly concentrated flux and extremely reliable neutron spectrum from a very small assembly. During the past 40 years, {sup 252}Cf has been applied with great success to cancer therapy, neutron radiography of objects ranging from flowers to entire aircraft, startup sources for nuclear reactors, fission activation for quality analysis of all commercial nuclear fuel, and many other beneficial uses, some of which are now ready for further growth. Californium-252 is produced in the High Flux Isotope Reactor (HFIR) and processed in the Radiochemical Engineering Development Center (REDC), both of which are located at the Oak Ridge National Laboratory (ORNL) in Oak Ridge, Tennessee. The REDC/HFIR facility is virtually the sole supplier of {sup 252}Cf in the western world and is the major supplier worldwide. Extensive exploitation of this product was made possible through the {sup 252}Cf Market Evaluation Program, sponsored by the United States Department of Energy (DOE) [then the Atomic Energy Commission (AEC) and later the Energy Research and Development Administration (ERDA)]. This program included training series, demonstration centers, seminars, and a liberal loan policy for fabricated sources. The Market Evaluation Program was instituted, in part, to determine if large-quantity production capability was required at the Savannah River Laboratory (SRL). Because of the nature of the product and the means by which it is produced, {sup 252}Cf can be produced only in government-owned facilities. It is evident at this time that the Oak Ridge research facility can meet present and projected near-term requirements. The production, shipment, and sales history of {sup 252}Cf from ORNL is summarized herein.

  13. Californium-252: a remarkable versatile radioisotope

    International Nuclear Information System (INIS)

    A product of the nuclear age, Californium-252 (252Cf) has found many applications in medicine, scientific research, industry, and nuclear science education. Californium-252 is unique as a neutron source in that it provides a highly concentrated flux and extremely reliable neutron spectrum from a very small assembly. During the past 40 years, 252Cf has been applied with great success to cancer therapy, neutron radiography of objects ranging from flowers to entire aircraft, startup sources for nuclear reactors, fission activation for quality analysis of all commercial nuclear fuel, and many other beneficial uses, some of which are now ready for further growth. Californium-252 is produced in the High Flux Isotope Reactor (HFIR) and processed in the Radiochemical Engineering Development Center (REDC), both of which are located at the Oak Ridge National Laboratory (ORNL) in Oak Ridge, Tennessee. The REDC/HFIR facility is virtually the sole supplier of 252Cf in the western world and is the major supplier worldwide. Extensive exploitation of this product was made possible through the 252Cf Market Evaluation Program, sponsored by the United States Department of Energy (DOE) [then the Atomic Energy Commission (AEC) and later the Energy Research and Development Administration (ERDA)]. This program included training series, demonstration centers, seminars, and a liberal loan policy for fabricated sources. The Market Evaluation Program was instituted, in part, to determine if large-quantity production capability was required at the Savannah River Laboratory (SRL). Because of the nature of the product and the means by which it is produced, 252Cf can be produced only in government-owned facilities. It is evident at this time that the Oak Ridge research facility can meet present and projected near-term requirements. The production, shipment, and sales history of 252Cf from ORNL is summarized herein

  14. Californium-252 Neutron Therapy in China

    International Nuclear Information System (INIS)

    Californium-252 brachytherapy, believed to be the most successful source for neutron therapy, gives most of the cures as well as long-term and complication-free survivals. Chinese radiation oncologists were interested in californium neutron therapy (Cf-NT) in the early 1980s, but 252Cf sources for medical use were not available in China until 1992 when a californium joint venture was established by the China Institute of Atomic Energy (Beijing) and the Research Institute for Nuclear Reactors (Dimitrovgrad) of Russia. In 1995, 25 seeds of 252Cf with a strength of 3 μg each were sent to China for preclinical investigation. Three years later, a high dose rate (HDR) 252Cf source was imported and transferred into a home-made remote after-loader for intracavitary treatment in Chongqing, and a clinical trail was started in February 1999. This is the first time that Cf-NT was performed for cancer patients in China. Since then, Cf-NT in China has developed rapidly. It is estimated that one-tenth of those radiation oncology centers with brachytherapy practice will be equipped with californium units in 5 yr. That means more than 30 units will be in use in hospitals. That is significant compared with other countries, but it is just one, on average, for each province or one per 40 million people in China. Progress also has been achieved in the 252Cf treatment delivery equipment. Preliminary clinical trails showed complete response observed in all cases treated, with a rapid clearance of tumors and mild reactions in normal tissues. The short-term results are quite encouraging. To deal with problems due to the demand for Cf-NT in China, attention should be paid to the following particulars: (1) A high-strength miniature source is needed for HDR/MDR interstitial therapy to extend the Cf-NT coverage. (2) Basic work on radiophysics and radiobiology needs to be done, including source calibration, clinical dosimetry, clinical RBE determination, and Cf-NT quality assurance

  15. Californium-252 sales and loans at Oak Ridge National Laboratory

    International Nuclear Information System (INIS)

    The production and distribution in the United States of 252Cf has recently been consolidated at the Oak Ridge National Laboratory (ORNL). The 252Cf Industrial Sales/Loan Program and the 252Cf University Load Program, which were formerly located at the Savannah River Plant (SRP), have been combined with the californium production and distribution activities of the Transuranium Element Production Program at ORNL. Californium-252 is sold to commercial users in the form of bulk californium oxide, palladium-californium alloy pellets, or alloy wires. Neutron source capsules, which are fabricated for loans to DOE or other US government agencies, are still available in all forms previously available. The consolidation of all 252Cf distribution activities at the production site is expected to result in better service to users. In particular, customers for neutrons sources will be ale to select from a wider range of neutron source forms, including custom designs, through a single contact point

  16. Californium-252 encapsulation at the Savannah River Laboratory

    International Nuclear Information System (INIS)

    More than 1 g of the neutron-emitting isotope californium-252 has been encapsulated at SRL for worldwide medical, industrial, and research uses. Bulk sales packages have been prepared for the USDOE sales program since 1971. Doubly-encapsulated sources have been prepared for USDOE's market evaluation program since 1968. Californium-252 sources for loan and sales packages satisfy the criteria for Special Form Radioactive Material. Encapsulation is performed in special neutron-shielded containment facilities at SRL. Development of improved source and shipping package designs and processes is continuing. 17 figures

  17. Separation of 248Cm (III) from 252Cf (III) and its use in time resolved fluorescence spectroscopic (TRFS) studies

    International Nuclear Information System (INIS)

    The present report gives a description of the methodology for the separation of 248Cm(III) from decayed 252Cf (III) waste solution. The waste solution was first assayed for 252Cf content by neutron counting using a neutron well coincidence counter. The sample was subjected to the chemical separation of 248Cm (III) from 252Cf (III) following anion and cation exchange chromatography. The alpha spectrum of the separated curium fraction showed peaks due to 246Cm and 248Cm while the corresponding alpha spectrum of californium fraction showed 249,250,251,252Cf. The gamma ray abundances of 249Cf were determined with respect to its gamma rays of 387 keV and the data agreed well with that in literature. Separated Cm(III) was further characterized by recording its time resolved fluorescence spectrum (TRFS) in aqueous medium. (author)

  18. Production, distribution and applications of californium-252 neutron sources

    International Nuclear Information System (INIS)

    The radioisotope 252Cf is routinely encapsulated into compact, portable, intense neutron sources with a 2.6-yr half-life. A source the size of a person's little finger can emit up to 1011 neutrons s-1. Californium-252 is used commercially as a reliable, cost-effective neutron source for prompt gamma neutron activation analysis (PGNAA) of coal, cement and minerals, as well as for detection and identification of explosives, land mines and unexploded military ordnance. Other uses are neutron radiography, nuclear waste assays, reactor start-up sources, calibration standards and cancer therapy. The inherent safety of source encapsulations is demonstrated by 30 yr of experience and by US Bureau of Mines tests of source survivability during explosions. The production and distribution center for the US Department of Energy (DOE) Californium Program is the Radiochemical Engineering Development Center (REDC) at Oak Ridge National Laboratory (ORNL). DOE sells 252Cf to commercial reencapsulators domestically and internationally. Sealed 252Cf sources are also available for loan to agencies and subcontractors of the US government and to universities for educational, research and medical applications. The REDC has established the Californium User Facility (CUF) for Neutron Science to make its large inventory of 252Cf sources available to researchers for irradiations inside uncontaminated hot cells. Experiments at the CUF include a land mine detection system, neutron damage testing of solid-state detectors, irradiation of human cancer cells for boron neutron capture therapy experiments and irradiation of rice to induce genetic mutations

  19. Production, distribution and applications of californium-252 neutron sources.

    Science.gov (United States)

    Martin, R C; Knauer, J B; Balo, P A

    2000-01-01

    The radioisotope 252Cf is routinely encapsulated into compact, portable, intense neutron sources with a 2.6-yr half-life. A source the size of a person's little finger can emit up to 10(11) neutrons s(-1). Californium-252 is used commercially as a reliable, cost-effective neutron source for prompt gamma neutron activation analysis (PGNAA) of coal, cement and minerals, as well as for detection and identification of explosives, land mines and unexploded military ordinance. Other uses are neutron radiography, nuclear waste assays, reactor start-up sources, calibration standards and cancer therapy. The inherent safety of source encapsulations is demonstrated by 30 yr of experience and by US Bureau of Mines tests of source survivability during explosions. The production and distribution center for the US Department of Energy (DOE) Californium Program is the Radiochemical Engineering Development Center (REDC) at Oak Ridge National Laboratory (ORNL). DOE sells 252Cf to commercial reencapsulators domestically and internationally. Sealed 252Cf sources are also available for loan to agencies and subcontractors of the US government and to universities for educational, research and medical applications. The REDC has established the Californium User Facility (CUF) for Neutron Science to make its large inventory of 252Cf sources available to researchers for irradiations inside uncontaminated hot cells. Experiments at the CUF include a land mine detection system, neutron damage testing of solid-state detectors, irradiation of human cancer cells for boron neutron capture therapy experiments and irradiation of rice to induce genetic mutations. PMID:11003521

  20. Production, Distribution, and Applications of Californium-252 Neutron Sources

    Energy Technology Data Exchange (ETDEWEB)

    Balo, P.A.; Knauer, J.B.; Martin, R.C.

    1999-10-03

    The radioisotope {sup 252}Cf is routinely encapsulated into compact, portable, intense neutron sources with a 2.6-year half-life. A source the size of a person's little finger can emit up to 10{sup 11} neutrons/s. Californium-252 is used commercially as a reliable, cost-effective neutron source for prompt gamma neutron activation analysis (PGNAA) of coal, cement, and minerals, as well as for detection and identification of explosives, laud mines, and unexploded military ordnance. Other uses are neutron radiography, nuclear waste assays, reactor start-up sources, calibration standards, and cancer therapy. The inherent safety of source encapsulations is demonstrated by 30 years of experience and by U.S. Bureau of Mines tests of source survivability during explosions. The production and distribution center for the U. S Department of Energy (DOE) Californium Program is the Radiochemical Engineering Development Center (REDC) at Oak Ridge National Laboratory (ORNL). DOE sells The radioisotope {sup 252}Cf is routinely encapsulated into compact, portable, intense neutron sources with a 2.6- year half-life. A source the size of a person's little finger can emit up to 10 neutrons/s. Californium-252 is used commercially as a reliable, cost-effective neutron source for prompt gamma neutron activation analysis (PGNAA) of coal, cement, and minerals, as well as for detection and identification of explosives, laud mines, and unexploded military ordnance. Other uses are neutron radiography, nuclear waste assays, reactor start-up sources, calibration standards, and cancer therapy. The inherent safety of source encapsulations is demonstrated by 30 years of experience and by U.S. Bureau of Mines tests of source survivability during explosions. The production and distribution center for the U. S Department of Energy (DOE) Californium Program is the Radiochemical Engineering Development Center (REDC) at Oak Ridge National Laboratory(ORNL). DOE sells {sup 252}Cf to commercial

  1. Prompt neutron spectrum of the spontaneous fission of californium-252

    International Nuclear Information System (INIS)

    The californium-252 spontaneous fission neutron spectrum was measured in the energy range of 0.01 to 10 MeV by the time-of-flight technique using various neutron detectors. The measurements of 252Cf neutron spectrum at energies of 0.01 to 5 MeV were performed as a function of fission fragment kinetic energy. The mean neutron spectrum energy in the range of 0.7 to 10 MeV was found from the results of measurements. The irregularity in the 252Cf neutron spectrum in the neutron energy range of less than 0.7 MeV compared to theoretical values is discussed. The mechanism of 252Cf neutron emission is also discussed on the basis of neutron yield angle measurements. 12 references

  2. 25 CFR 248.6 - Structures.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Structures. 248.6 Section 248.6 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR FISH AND WILDLIFE USE OF COLUMBIA RIVER INDIAN IN-LIEU FISHING SITES § 248.6 Structures. Dwellings, camping facilities, and other structures such as fish drying...

  3. Separation of californium from actinides and lanthanides in aqueous solution by electrochemical formation of amalgams

    International Nuclear Information System (INIS)

    The electrochemical reduction of transneptunium elements (Pu to Cf) and rare earths (Eu, Tm) from aqueous complexing solutions to amalgams was studied over a wide range of cathodic potentials in order to achieve optimal separation of californium. The reduction in acetate media (pH 4.5-4.6) at potentials around -1.7 to -1.9 V1 leads to a quantitative extraction of californium into the mercury phase, while more negative potentials are required for the reduction of the lighter transuranium elements and of the lanthanides. Hence, the optimal conditions for the separation of californium from the investigated actinides and lanthanides were determined. Separation factors α between 25 and 90 were found except in the case of Cf/Eu, where poor values (α varying from 7 to 12) were observed. More negative cathodic potentials decrease the selectivity of the reduction process. A similar study with lithium citrate solutions (pH ∝6) shows that satisfactory separation of californium from lighter and heavier actinides is achievable. A separation factor of 88 is obtained for Cf/Am at -1.98 V. The anodic stripping of mixed amalgams (Pu, Am, Cm, Bk, Tm and Cf) Hg in nitric and acetic acid soultions at potentials ranging from +0.1 to -0.7 V proceeds slowly and proved to be ineffective for the separation of californium from light actinides under conditions described. (orig.)

  4. On-line slurry analyses by californium-252

    International Nuclear Information System (INIS)

    In chemical processing technology on-line activation methods gain an increasing importance for process monitoring and control. A method is described according to which the different fluorspar contents at various strategic points of a flotation plant are determined through neutron activation by 100 μg californium-252. A continuous analytical system for onstream process control of slurries was designed and constructed. A compact facility, called SUSAC, allows continuous application of the method on an industrial scale. The main components of the SUSAC facility are the irradiation and measurement cells. The cells are equipped with multistage countercurrent stirrers ensuring a proper radial and vertical distribution of the sample. The hollow shaft of the stirrer of the irradiation cell houses the Cf-source. The NaI-detector has been installed in a recess in the bottom of the measuring cell. The volumes are 9 dm3 for the irradiation cell, 7.5 dm3 for the measuring cell, 1/2 dm3 for the vonnection line and 4 dm3 for feed and drainage lines including the pump. Investigations on the following topics are discussed: selection of stirrers, residence time, flow rate, pulp density, calibration measurements. (T.G.)

  5. Biomedical neutron research at the Californium User Facility for neutron science

    International Nuclear Information System (INIS)

    The Californium User Facility for Neutron Science has been established at Oak Ridge National Laboratory (ORNL). The Californium User Facility (CUF) is a part of the larger Californium Facility, which fabricates and stores compact 252Cf neutron sources for worldwide distribution. The CUF can provide a cost-effective option for research with 252Cf sources. Three projects at the CUF that demonstrate the versatility of 252Cf for biological and biomedical neutron-based research are described: future establishment of a 252Cf-based neutron activation analysis system, ongoing work to produce miniature high-intensity, remotely afterloaded 252Cf sources for tumor therapy, and a recent experiment that irradiated living human lung cancer cells impregnated with experimental boron compounds to test their effectiveness for boron neutron capture therapy

  6. Biomedical neutron research at the Californium User Facility for neutron science

    Energy Technology Data Exchange (ETDEWEB)

    Martin, R.C. [Oak Ridge National Lab., TN (United States); Byrne, T.E. [Roane State Community College, Harriman, TN (United States); Miller, L.F. [Univ. of Tennessee, Knoxville, TN (United States)

    1997-04-01

    The Californium User Facility for Neutron Science has been established at Oak Ridge National Laboratory (ORNL). The Californium User Facility (CUF) is a part of the larger Californium Facility, which fabricates and stores compact {sup 252}Cf neutron sources for worldwide distribution. The CUF can provide a cost-effective option for research with {sup 252}Cf sources. Three projects at the CUF that demonstrate the versatility of {sup 252}Cf for biological and biomedical neutron-based research are described: future establishment of a {sup 252}Cf-based neutron activation analysis system, ongoing work to produce miniature high-intensity, remotely afterloaded {sup 252}Cf sources for tumor therapy, and a recent experiment that irradiated living human lung cancer cells impregnated with experimental boron compounds to test their effectiveness for boron neutron capture therapy.

  7. Proposed Californium-252 User Facility for Neutron Science at Oak Ridge National Laboratory

    International Nuclear Information System (INIS)

    The Radiochemical Engineering Development Center (REDC) at ORNL has petitioned to establish a Californium-252 User Facility for Neutron Science for academic, industrial, and governmental researchers. The REDC Californium Facility (CF) stores the national inventory of sealed 252Cf neutron source for university and research loans. Within the CF, the 252Cf storage pool and two uncontaminated hot cells currently in service for the Californium Program will form the physical basis for the User Facility. Relevant applications include dosimetry and experiments for neutron tumor therapy; fast and thermal neutron activation analysis of materials; experimental configurations for prompt gamma neutron activation analysis; neutron shielding and material damage studies; and hardness testing of radiation detectors, cameras, and electronics. A formal User Facility simplifies working arrangements and agreements between US DOE facilities, academia, and commercial interests

  8. Emergence of californium as the second transitional element in the actinide series.

    Science.gov (United States)

    Cary, Samantha K; Vasiliu, Monica; Baumbach, Ryan E; Stritzinger, Jared T; Green, Thomas D; Diefenbach, Kariem; Cross, Justin N; Knappenberger, Kenneth L; Liu, Guokui; Silver, Mark A; DePrince, A Eugene; Polinski, Matthew J; Van Cleve, Shelley M; House, Jane H; Kikugawa, Naoki; Gallagher, Andrew; Arico, Alexandra A; Dixon, David A; Albrecht-Schmitt, Thomas E

    2015-01-01

    A break in periodicity occurs in the actinide series between plutonium and americium as the result of the localization of 5f electrons. The subsequent chemistry of later actinides is thought to closely parallel lanthanides in that bonding is expected to be ionic and complexation should not substantially alter the electronic structure of the metal ions. Here we demonstrate that ligation of californium(III) by a pyridine derivative results in significant deviations in the properties of the resultant complex with respect to that predicted for the free ion. We expand on this by characterizing the americium and curium analogues for comparison, and show that these pronounced effects result from a second transition in periodicity in the actinide series that occurs, in part, because of the stabilization of the divalent oxidation state. The metastability of californium(II) is responsible for many of the unusual properties of californium including the green photoluminescence. PMID:25880116

  9. 7 CFR 248.19 - Investigations.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Investigations. 248.19 Section 248.19 Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE..., where appropriate, a review of pertinent practices and policies of any State and local agency,...

  10. 7 CFR 248.9 - Nutrition education.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Nutrition education. 248.9 Section 248.9 Agriculture... Nutrition education. (a) Goals. Nutrition education shall emphasize the relationship of proper nutrition to.... (b) Requirement. The State agency shall integrate nutrition education into FMNP operations and...

  11. Dicty_cDB: SSA248 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSA248 (Link to dictyBase) - - - Contig-U13424-1 - (Link to Original site) - - SSA...248Z 500 - - - - Show SSA248 Library SS (Link to library) Clone ID SSA248 (Link to dicty...iol.tsukuba.ac.jp/CSM/SS/SSA2-B/SSA248Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >SSA248 (SSA248Q) /CSM/SS/SSA2-B/SSA248Q.Seq.d/ XXXXXXXXXXTTTAGAT...nk*kkikxnkl*iy*k*kk Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value SSA248 (SSA

  12. Fissile analysis of Hanford waste using Californium Multiplier/Delayed Neutron Counter system

    International Nuclear Information System (INIS)

    Measurement of low-level (10 ng/g or lower) fissile material (mainly plutonium) in Hanford waste and process samples is becoming increasingly important. A system has been designed consisting of a Californium Multiplier (CFX) and a Delayed Neutron Counter (DNC) to characterize these samples. This report describes hardware and analytical capability of the CFX/DNC system

  13. Study of the shielding for spontaneous fission sources of Californium-252

    International Nuclear Information System (INIS)

    A shielding study is made to attenuate, until maximum permissible levels, the neutrons radiation and photons emitted by spontaneous fission coming from a source of Californium-252. The compound package by a database (Library DLC-23) and the ANISNW code is used, in it version for personal computer. (Author)

  14. Californium (252Cf) and its use as neutron source in science medicine and technology

    International Nuclear Information System (INIS)

    The application of radionuclides in science and nuclear techniques basically is related to unstable isotopes, which are produced from stable elements in nuclear reactor. Their specifications are various from view point of application . Using of physical and chemical properties of radionuclides in chemistry, for with marking the organic compounds we can exactly explain the mechanism of chemical reactions in medical, biology and bio-chemistry. In these cases the behaviour of radionuclides is very important and the selection of the suitable radionuclides is determined between the elements for investigation aims. The special specification of radio-nuclides analysis such as, half-life, kind of ray and energy should be considered with an special accuracy as well as the laws security regulations from view point of ray-protection should be completely observed mean time working these radio-nuclides. It should be considered that application of radio-isotopes is very important from their special specifications point of view. Applying the radionuclides from technology point of view in sciences and nuclear techniques aren't only limited to three analyses of α, β, and γ, but we can use the share of neutron which are produced from spli ting of heavy nucleus such as Californium252 as a neutron source in the depths of the sea and also determining the concentration of low quantity elements on moon and other spheres. The radioisotope of Californium252 is a neutron useful radiator for investigation in nuclear medical and technology because of automatically rapid split to 3.2% Californium252 radiates 1.34 * 109N/m in each mil/GH which suitable replacement for neutron sources based on (a, n) reaction, for example, Radium-Brellium or Amersium-Brellium. The energy distribution of radiated neutrons from analyzing of Californium252 like the spectrum of neutron which is produced from splitting of U235, Pu239 nucleus has the maximum energy in quantity, En=1 MeV in the range of 1.5 MeV. The

  15. Contribution to clinical dosimetry of californium 252 sources used at Gustave Roussy institute

    International Nuclear Information System (INIS)

    The main characteristics of californium 252 sources are presented in the first part of the report. Dose measurements around Californium sources were performed with a pair of ionization multiplication chambers: the first one has an Aluminium wall and is filled with Argon, the second one a plastic tissue-equivalent gas. A set of experiments was performed in order to investigate the relative influence of beta rays on the response of both chambers. Besides the experimental work a computer program was written to calculate the dose distribution around the actual sources made of a series of small active sources placed in catheters. Theoretical data around small sources can be found in the litterature. The comparison between experimental results and theoretical ones has shown a good agreement. The computer program will be included as a sub-routine in the more general computer program used for patients treated with interstitial therapy

  16. Safety Analysis Report for Packaging (SARP) of the Oak Ridge National Laboratory TRU Californium Shipping Container

    International Nuclear Information System (INIS)

    An analytical evaluation of the Oak Ridge National Laboratory TRU Californium Shipping Container was made in order to demonstrate its compliance with the regulations governing off-site shipment of packages that contain radioactive material. The evaluation encompassed five primary categories: structural integrity, thermal resistance, radiation shielding, nuclear criticality safety, and quality assurance. The results of this evaluation demonstrate that the container complies with the applicable regulations

  17. Emergence of californium as the second transitional element in the actinide series

    OpenAIRE

    Cary, Samantha K.; Vasiliu, Monica; Baumbach, Ryan E.; Stritzinger, Jared T.; GREEN, THOMAS D.; Diefenbach, Kariem; Cross, Justin N.; Knappenberger, Kenneth L.; Liu, Guokui; Silver, Mark A.; DePrince, A. Eugene; Polinski, Matthew J.; Van Cleve, Shelley M.; House, Jane H.; Kikugawa, Naoki

    2015-01-01

    A break in periodicity occurs in the actinide series between plutonium and americium as the result of the localization of 5f electrons. The subsequent chemistry of later actinides is thought to closely parallel lanthanides in that bonding is expected to be ionic and complexation should not substantially alter the electronic structure of the metal ions. Here we demonstrate that ligation of californium(III) by a pyridine derivative results in significant deviations in the properties of the resu...

  18. 40 CFR 1065.248 - Gas divider.

    Science.gov (United States)

    2010-07-01

    ... testing. You may use critical-flow gas dividers, capillary-tube gas dividers, or thermal-mass-meter gas... Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR POLLUTION CONTROLS ENGINE-TESTING PROCEDURES Measurement Instruments Flow-Related Measurements § 1065.248 Gas divider. (a) Application. You...

  19. 7 CFR 248.7 - Nondiscrimination.

    Science.gov (United States)

    2010-01-01

    ... Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS WIC FARMERS' MARKET NUTRITION PROGRAM (FMNP) Recipient Eligibility § 248.7... the Civil Rights Act of 1964, title IX of the Education Amendments of 1972, section 504 of...

  20. 7 CFR 248.12 - FMNP costs.

    Science.gov (United States)

    2010-01-01

    ... associated with the provision of nutrition education which meets the requirements of § 248.9 of this part. (2... Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS WIC FARMERS' MARKET NUTRITION PROGRAM (FMNP) State Agency Provisions §...

  1. 7 CFR 248.3 - Administration.

    Science.gov (United States)

    2010-01-01

    ... nutrition education in coordination with the WIC Program, coupon and market management, fiscal reporting... Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS WIC FARMERS' MARKET NUTRITION PROGRAM (FMNP) General § 248.3 Administration....

  2. 7 CFR 248.4 - State Plan.

    Science.gov (United States)

    2010-01-01

    ... farmers' markets. (5) Outline of administrative staff and job descriptions. (6) Detailed description of... with the State Plan. (c) Retention of copy. A copy of the approved State Plan shall be kept on file at... education, and documentation of coordinated efforts as required in § 248.3(e), as well as copies...

  3. 7 CFR 58.248 - Nonfat dry milk.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Nonfat dry milk. 58.248 Section 58.248 Agriculture... Products Bearing Usda Official Identification § 58.248 Nonfat dry milk. (a) Nonfat dry milk in commercial....S. Standard Grade. (b) Regular nonfat dry milk in consumer size packages which bears an...

  4. 47 CFR 90.248 - Wildlife and ocean buoy tracking.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 5 2010-10-01 2010-10-01 false Wildlife and ocean buoy tracking. 90.248 Section 90.248 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) SAFETY AND SPECIAL RADIO SERVICES PRIVATE LAND MOBILE RADIO SERVICES Non-Voice and Other Specialized Operations § 90.248 Wildlife and ocean buoy tracking. (a) The...

  5. 24 CFR 248.177 - Delegated responsibility to State agencies.

    Science.gov (United States)

    2010-04-01

    ... CFR part 91 that the proposed activities are consistent with the approved consolidated plan of the... agencies. 248.177 Section 248.177 Housing and Urban Development Regulations Relating to Housing and Urban... Housing Preservation and Resident Homeownership Act of 1990 § 248.177 Delegated responsibility to...

  6. 7 CFR 248.11 - Financial management system.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Financial management system. 248.11 Section 248.11... § 248.11 Financial management system. (a) Disclosure of expenditures. The State agency shall maintain a financial management system which provides accurate, current and complete disclosure of the financial...

  7. Measurements of integral cross sections in the californium-252 fission neutron spectrum

    International Nuclear Information System (INIS)

    In a low-scattering arrangement cross sections averaged over the californium-252 spontaneous fission neutron spectrum were measured. The reactions 27Al(n,α)46Ti, 47Ti, 48Ti(n,p), 54Fe,56Fe(n,p), 58Ni(n,p), 64Zn(n,p), 115In(n,n') were studied in order to obtain a consistent set of threshold detectors used in fast neutron flux density measurements. Overall uncertainties between 2 and 2.5% could be achieved; corrections due to neutron scattering in source and samples are discussed

  8. Measurement of californium-252 gamma photons depth dose distribution in tissue equivalent material. Vol. 4

    International Nuclear Information System (INIS)

    Phantom of tissue equivalent material with and without bone was used measuring depth dose distribution of gamma-rays from californium-252 source. The source was positioned at center of perspex walled phantom. Depth dose measurements were recorded for X, Y and Z planes at different distances from source. TLD 700 was used for measuring the dose distribution. Results indicate that implantation of bone in tissue equivalent medium cause changes in the gamma depth dose distribution which varies according to variation in bone geometry. 9 figs

  9. 248nm silicon photoablation: Microstructuring basics

    Energy Technology Data Exchange (ETDEWEB)

    Poopalan, P.; Najamudin, S. H.; Wahab, Y.; Mazalan, M. [Advanced Multidisciplinary MEMS-Based Integrated Electronic NCER Centre of Excellent (AMBIENCE), School of Microelectronic Engineering, Universiti Malaysia Perlis, 02600 Arau, Perlis (Malaysia)

    2015-05-15

    248nm pulses from a KrF excimer laser was used to ablate a Si wafer in order to ascertain the laser pulse and energy effects for use as a microstructuring tool for MEMS fabrication. The laser pulses were varied between two different energy levels of 8mJ and 4mJ while the number of pulses for ablation was varied. The corresponding ablated depths were found to range between 11 µm and 49 µm, depending on the demagnified beam fluence.

  10. CD248 facilitates tumor growth via its cytoplasmic domain

    International Nuclear Information System (INIS)

    Stromal fibroblasts participate in the development of a permissive environment for tumor growth, yet molecular pathways to therapeutically target fibroblasts are poorly defined. CD248, also known as endosialin or tumor endothelial marker 1 (TEM1), is a transmembrane glycoprotein expressed on activated fibroblasts. We recently showed that the cytoplasmic domain of CD248 is important in facilitating an inflammatory response in a mouse model of arthritis. Others have reported that CD248 gene inactivation in mice results in dampened tumor growth. We hypothesized that the conserved cytoplasmic domain of CD248 is important in regulating tumor growth. Mice lacking the cytoplasmic domain of CD248 (CD248CyD/CyD) were generated and evaluated in tumor models, comparing the findings with wild-type mice (CD248WT/WT). As compared to the response in CD248WT/WT mice, growth of T241 fibrosarcomas and Lewis lung carcinomas was significantly reduced in CD248CyD/CyD mice. Tumor size was similar to that seen with CD248-deficient mice. Conditioned media from CD248CyD/CyD fibroblasts were less effective at supporting T241 fibrosarcoma cell survival. In addition to our previous observation of reduced release of activated matrix metalloproteinase (MMP)-9, CD248CyD/CyD fibroblasts also had impaired PDGF-BB-induced migration and expressed higher transcripts of tumor suppressor factors, transgelin (SM22α), Hes and Hey1. The multiple pathways regulated by the cytoplasmic domain of CD248 highlight its potential as a therapeutic target to treat cancer

  11. CD248 facilitates tumor growth via its cytoplasmic domain

    Directory of Open Access Journals (Sweden)

    Janssens Tom

    2011-05-01

    Full Text Available Abstract Background Stromal fibroblasts participate in the development of a permissive environment for tumor growth, yet molecular pathways to therapeutically target fibroblasts are poorly defined. CD248, also known as endosialin or tumor endothelial marker 1 (TEM1, is a transmembrane glycoprotein expressed on activated fibroblasts. We recently showed that the cytoplasmic domain of CD248 is important in facilitating an inflammatory response in a mouse model of arthritis. Others have reported that CD248 gene inactivation in mice results in dampened tumor growth. We hypothesized that the conserved cytoplasmic domain of CD248 is important in regulating tumor growth. Methods Mice lacking the cytoplasmic domain of CD248 (CD248CyD/CyD were generated and evaluated in tumor models, comparing the findings with wild-type mice (CD248WT/WT. Results As compared to the response in CD248WT/WT mice, growth of T241 fibrosarcomas and Lewis lung carcinomas was significantly reduced in CD248CyD/CyD mice. Tumor size was similar to that seen with CD248-deficient mice. Conditioned media from CD248CyD/CyD fibroblasts were less effective at supporting T241 fibrosarcoma cell survival. In addition to our previous observation of reduced release of activated matrix metalloproteinase (MMP-9, CD248CyD/CyD fibroblasts also had impaired PDGF-BB-induced migration and expressed higher transcripts of tumor suppressor factors, transgelin (SM22α, Hes and Hey1. Conclusions The multiple pathways regulated by the cytoplasmic domain of CD248 highlight its potential as a therapeutic target to treat cancer.

  12. 31 CFR 248.4 - Undertaking of indemnity.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Undertaking of indemnity. 248.4 Section 248.4 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) FISCAL... in the circumstances set forth below, a corporate surety authorized by the Secretary of the...

  13. 24 CFR 248.223 - Alternative State strategy.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Alternative State strategy. 248.223... Preservation Act of 1987 § 248.223 Alternative State strategy. (a) The Commissioner may approve a State strategy providing for State approval of plans of action that involve termination of low...

  14. Fast and efficient charge breeding of the Californium rare isotope breeder upgrade electron beam ion source

    Energy Technology Data Exchange (ETDEWEB)

    Ostroumov, P. N., E-mail: ostroumov@anl.gov; Barcikowski, A.; Dickerson, C. A.; Perry, A.; Sharamentov, S. I.; Vondrasek, R. C.; Zinkann, G. P. [Argonne National Laboratory, Argonne, Illinois 60439 (United States); Pikin, A. I. [Brookhaven National Laboratory, Upton, New York 11973 (United States)

    2015-08-15

    The Electron Beam Ion Source (EBIS), developed to breed Californium Rare Isotope Breeder Upgrade (CARIBU) radioactive beams at Argonne Tandem Linac Accelerator System (ATLAS), is being tested off-line. A unique property of the EBIS is a combination of short breeding times, high repetition rates, and a large acceptance. Overall, we have implemented many innovative features during the design and construction of the CARIBU EBIS as compared to the existing EBIS breeders. The off-line charge breeding tests are being performed using a surface ionization source that produces singly charged cesium ions. The main goal of the off-line commissioning is to demonstrate stable operation of the EBIS at a 10 Hz repetition rate and a breeding efficiency into single charge state higher than 15%. These goals have been successfully achieved and exceeded. We have measured (20% ± 0.7%) breeding efficiency into the single charge state of 28+ cesium ions with the breeding time of 28 ms. In general, the current CARIBU EBIS operational parameters can provide charge breeding of any ions in the full mass range of periodic table with high efficiency, short breeding times, and sufficiently low charge-to-mass ratio, 1/6.3 for the heaviest masses, for further acceleration in ATLAS. In this paper, we discuss the parameters of the EBIS and the charge breeding results in a pulsed injection mode with repetition rates up to 10 Hz.

  15. Fast and efficient charge breeding of the Californium rare isotope breeder upgrade electron beam ion source

    International Nuclear Information System (INIS)

    The Electron Beam Ion Source (EBIS), developed to breed Californium Rare Isotope Breeder Upgrade (CARIBU) radioactive beams at Argonne Tandem Linac Accelerator System (ATLAS), is being tested off-line. A unique property of the EBIS is a combination of short breeding times, high repetition rates, and a large acceptance. Overall, we have implemented many innovative features during the design and construction of the CARIBU EBIS as compared to the existing EBIS breeders. The off-line charge breeding tests are being performed using a surface ionization source that produces singly charged cesium ions. The main goal of the off-line commissioning is to demonstrate stable operation of the EBIS at a 10 Hz repetition rate and a breeding efficiency into single charge state higher than 15%. These goals have been successfully achieved and exceeded. We have measured (20% ± 0.7%) breeding efficiency into the single charge state of 28+ cesium ions with the breeding time of 28 ms. In general, the current CARIBU EBIS operational parameters can provide charge breeding of any ions in the full mass range of periodic table with high efficiency, short breeding times, and sufficiently low charge-to-mass ratio, 1/6.3 for the heaviest masses, for further acceleration in ATLAS. In this paper, we discuss the parameters of the EBIS and the charge breeding results in a pulsed injection mode with repetition rates up to 10 Hz

  16. Design of a homogeneous subcritical nuclear reactor based on thorium with a source of californium 252

    International Nuclear Information System (INIS)

    Full text: One of the energy alternatives to fossil fuels which do not produce greenhouse gases is the nuclear energy. One of the drawbacks of this alternative is the generation of radioactive wastes of long half-life and its relation to the generation of nuclear materials to produce weapons of mass destruction. An option to these drawbacks of nuclear energy is to use Thorium as part of the nuclear fuel which it becomes in U233 when capturing neutrons, that is a fissile material. In this paper Monte Carlo methods were used to design a homogeneous subcritical reactor based on thorium. As neutron reflector graphite was used. The reactor core is homogeneous and is formed of 70% light water as moderator, 12% of enriched uranium UO2(NO3)4 and 18% of thorium Th(NO3)4 as fuel. To start the nuclear fission chain reaction an isotopic source of californium 252 was used with an intensity of 4.6 x 107 s-1. In the design the value of the effective multiplication factor, whose value turned out keff <1 was calculated. Also, the neutron spectra at different distances from the source and the total fluence were calculated, as well as the values of the ambient dose equivalent in the periphery of the reactor. (Author)

  17. Fast and efficient charge breeding of the Californium rare isotope breeder upgrade electron beam ion source.

    Science.gov (United States)

    Ostroumov, P N; Barcikowski, A; Dickerson, C A; Perry, A; Pikin, A I; Sharamentov, S I; Vondrasek, R C; Zinkann, G P

    2015-08-01

    The Electron Beam Ion Source (EBIS), developed to breed Californium Rare Isotope Breeder Upgrade (CARIBU) radioactive beams at Argonne Tandem Linac Accelerator System (ATLAS), is being tested off-line. A unique property of the EBIS is a combination of short breeding times, high repetition rates, and a large acceptance. Overall, we have implemented many innovative features during the design and construction of the CARIBU EBIS as compared to the existing EBIS breeders. The off-line charge breeding tests are being performed using a surface ionization source that produces singly charged cesium ions. The main goal of the off-line commissioning is to demonstrate stable operation of the EBIS at a 10 Hz repetition rate and a breeding efficiency into single charge state higher than 15%. These goals have been successfully achieved and exceeded. We have measured (20% ± 0.7%) breeding efficiency into the single charge state of 28+ cesium ions with the breeding time of 28 ms. In general, the current CARIBU EBIS operational parameters can provide charge breeding of any ions in the full mass range of periodic table with high efficiency, short breeding times, and sufficiently low charge-to-mass ratio, 1/6.3 for the heaviest masses, for further acceleration in ATLAS. In this paper, we discuss the parameters of the EBIS and the charge breeding results in a pulsed injection mode with repetition rates up to 10 Hz. PMID:26329185

  18. Neutron activation analysis at the Californium User Facility for Neutron Science

    International Nuclear Information System (INIS)

    The Californium User Facility (CUF) for Neutron Science has been established to provide 252Cf-based neutron irradiation services and research capabilities including neutron activation analysis (NAA). A major advantage of the CUF is its accessibility and controlled experimental conditions compared with those of a reactor environment The CUF maintains the world's largest inventory of compact 252Cf neutron sources. Neutron source intensities of ≤ 1011 neutrons/s are available for irradiations within a contamination-free hot cell, capable of providing thermal and fast neutron fluxes exceeding 108 cm-2 s-1 at the sample. Total flux of ≥109 cm-2 s-1 is feasible for large-volume irradiation rabbits within the 252Cf storage pool. Neutron and gamma transport calculations have been performed using the Monte Carlo transport code MCNP to estimate irradiation fluxes available for sample activation within the hot cell and storage pool and to design and optimize a prompt gamma NAA (PGNAA) configuration for large sample volumes. Confirmatory NAA irradiations have been performed within the pool. Gamma spectroscopy capabilities including PGNAA are being established within the CUF for sample analysis

  19. Long-term effects of an intracavitary treatment with californium-252 on normal tissue

    International Nuclear Information System (INIS)

    About one hundred fifty swine were exposed to either radium-226 or californium-252 sources in the uterine cervix to determine an RBE for both acute and long-term effects. That value for early changes in the tissues at risk in the treatment of cervical cancer was between 6.2 and 6.8. The incidence of complications increased with time after exposure, especially among animals treated with 252Cf. Analysis of rectal injury showed that ulceration occurred frequently within a year postexposure at doses between 1600 and 2400 rad calculated at 2 cm lateral to the source midline. Fat necrosis and smooth muscle atrophy, resulting in a local rectal stricture, were delayed changes observed in some animals. The lower ureter was the site for a greater frequency of complications than the GI tract. Ureteral stricture often occurred at doses of 1200 rad from 252Cf and 7000 rad from 226Ra. Observation of delayed effects in the uterine-cervix in animals held up to 4 years postexposure indicate that the RBE for 252Cf may be increased to a value as high as 18, while repair may have even decreased it to about 5.6 in the rectum. Fifty swine are still being observed for long-term effects after doses above 800 rad from 252Cf and 5000 rad from 226Ra

  20. Manganese determination om minerals by activation analysis, using the californium-252 as a neutron source

    International Nuclear Information System (INIS)

    Neutron Activation Analysis, using a Californium-252 neutron source, has been applied for the determination of manganese in ores such as pyrolusite, rodonite (manganese silicate)' and blending used in dry-batteries The favorable nuclear properties of manganese, such as high thermal neutron cross-section for the reaction 55Mn (n.gamma)56 Mn, high concentration of manganese in the matrix and short half - life of 56Mn, are an ideal combination for non-destructive analysis of manganese in ores. Samples and standards of manganese dioxide were irradiated for about 20 minutes, followed by a 4 to 15 minutes decay and counted in a single channel pulse-height discrimination using a NaI(Tl) scintillation detector. Counting time was equal to 10 minutes. The interference of nuclear reactions 56Fe(n,p)56Mn and 59 Co (n, α)56 were studied, as well as problems in connection with neutron shadowing during irradiation, gamma-rays attenuation during counting and influence of granulometry of samples. One sample,was also analysed by wet-chemical method (sodium bismuthate) in order to compare results. As a whole, i t was shown that the analytical method of neutron activation for manganese in ores and blending, is a method simple, rapid and with good precision and accuracy. (author)

  1. Five-year cure of cervical cancer treated using californium-252 neutron brachytherapy

    International Nuclear Information System (INIS)

    Female pelvic carcinoma is one of the common malignancies seen at the University of Kentucky Medical Center and often presents in an advanced stage. In 1976, the authors began to test californium-252 neutron brachytherapy (NT) for its efficacy for control of primary and recurrent advanced uterine, cervix, and vaginal cancers. The first protocol used was 5000-5500 rad of whole pelvis irradiation followed by 1-2 Cf-252 insertions using a single tandem placed in the utero-cervico-vaginal region. Of 27 patients with primary carcinomas treated, 10 are alive and well 5 year later (37%). Two of two recurrent tumors were locally controlled but failed later. These patients had advanced cervical, vaginal, or endometrial carcinomas. In 1977, a transitional year, treatment of only unfavorable stages and presentations with NT was initiated. Similar results were obtained with NT as compared to conventional photon therapy (PT). Further improvement in treatment results can be anticipated as NT brachytherapy is used for advanced cancer therapy by more effective treatment schedules and radiation doses. Cf-252 can be used as a radium substitute and achieved similar rates of tumor control and 5-year survivals. 21 references, 2 tables

  2. Uptake and distribution of californium-252 chloride administered intraperitoneally, intravenously or intratracheally and the effect of in vivo DTPA chelation on intratracheal instillation in the rat

    International Nuclear Information System (INIS)

    The first phase of this investigation, comprising of three groups of animals, was designed to study the fate of californium-252 chloride administered intraperitoneally, intravenously or intratracheally. The second phase, which consisted of two groups of animals, was designed to examine the effectiveness of DTPA chelation therapy in accelerating the excretion and preventing the deposition of californium-252 chloride instilled into the lungs of rats. Immediately following the dose administration of 2 uCi of californium-252 chloride which was dissolved in 0.2 ml of 0.9% NaCl at pH 3.5, each rat was placed in a metabolism cage. Each rat in the first group of phase II was given intraperitoneal injection of CaNa3 DTPA (50 mg/kg) and each rat in the second group was given intraperitoneal injections of 0.9% NaCl. Injections of the DTPA or the NaCl sham were initiated immediately after the intratracheal administration of californium-252 chloride and were continued every three days until sacrifice. Following intraperitoneal, intravenous or intratracheal administration, the whole body retention of californium as a function of time was described by a three component exponential equation. For each mode of administration the short term component exhibited a biological half-life of between 5 and 10 hours; the intermediate component between 4 and 6 days; and the long term component between 200 and 300 days. The organ data obtained following intraperitoneal and intravenous administration were indistinguishable. On day one, the liver retained about 9% of the administered dose and the kidneys retained 2.4%. Retention for these organs decreased to about 1% by day 32. The femurs maintained an almost constant level of 4.5% of the injected dose over the 32 days. The lungs, spleen, heart, and testes showed significant retention of californium

  3. ENEA results in the international comparison organized by BIPM for the measurament of neutron fluxes of a Californium source

    International Nuclear Information System (INIS)

    During the period between May 1978 and August 1984 under the auspices of Section III of CCEMRI of CIPM it has been carried out the international intercomparison of Californium neutron source emission rate. The previous intercomparison was based on Ra-Be (α -n) source measuraments, which took place between 1959 and 1965, and the results showed a total spread of +- 3%. Owing to the better accuracy achived over the following decade the Ra-Be intercomparison was no longer representative of the state of the art, therefore it was decided to arrange the intercomparison based on Californium which in the meantime reached a wide use in the world. Contributions to the intercomparison were received from fourteen laboratories representative of twelve Nations plus the BIPM. The results put into evidence a considerable advance on accuracy in the neutron source emission rate measuraments. The standard deviation of the residuals obtained from least square fit of normalized data resulted +- 0,57%. In the present report it is widely described the Manganese bath method used at ENEA, CRE Casaccia in Roma, and the experimental procedure followed for its absolute calibration. All measuraments are reported and analysed, including those effectuated for corrective factors determination. The final results obtained at ENEA for the circulated Californium source is (3,457 +- 0,013) 10*H7 neutron/s. The analysis of data from all partecipantes has been effectuated and concluded by J. Axton in March 1986 and the conclusions which have been showed in the present report put in evidence the satisfactory results achived by the ENEA

  4. Feasibility and market potential of protein determination of wheat using californium-252

    International Nuclear Information System (INIS)

    To evaluate the feasibility of protein determination by capture gamma-ray analysis using californium-252 neutrons, an in-situ protein analysis system for use by grain handlers has been examined. Three 227 kilogram (approximately) lots of wheat were used to determine the amount of nitrogen present. Protein analyses by the Kjeldahl method were obtained from samples taken before and after the capture gamma-ray analyses. The 5.267-MeV gamma-ray was selected for use in this study as a compromise between efficiency and interference from other elements. The associated counting equipment was a multichannel analyzer with pulse shaping electronic and analysis computing equipment. A linear regression program was used to compare the regions of interest to the Kjeldahl protein averages. The counts composing each peak were summed and normalized using the total count of the hydrogen peak. The normalized nitrogen percentages indicate a significant correlation between the spectral regions and the Kjeldahl analyses. To a first approximation, the value of wheat is the wheat protein. At the present time, protein testing of wheat is destructive, cumbersome, and time-consuming as compared to the potential for capture gamma-ray analysis testing. Assuming that such a protein analysis unit can analyze 42 tonne of wheat per hour, over 120 units would be needed to monitor one-half the U.S. annual wheat production. A 0.5% improvement in processor realizations and grain throughput value of $167.00 per tonne will result in a projected savings of $150,000 per year per unit

  5. Oxygen enhancement ratio (OER) and therapeutic gain factor (GF) for californium-252 at low dose rate

    International Nuclear Information System (INIS)

    The potential benefit of the introduction of californium-252 in interstitial and intracavitary therapy is related to the greater efficiency of its neutron emission against anoxic cancer cells. In that respect, the oxygen enhancement ratio (OER) of the 252Cf emission has been determined for a continuous low dose rate irradiation. The biological system is growth inhibition in Vicia faba bean roots. A new Vicia faba ''BelB'' strain has been used, which better tolerates long periods (up to about 10 hours) of anoxia. In a first series of experiments, for a 252Cf (Dsub(n+γ)) dose rate of 0.11 Gy.h-1, an OER of 1.4+-0.1 was observed (the γ contribution Dγ to the total absorbed dose Dsub(n+γ) was 0.35 at the position of the root tips). In a second series of experiments, in somewhat different geometrical conditions with a 252Cf (Dsub(n+γ)) dose rate of 0.13 Gy.h-1, an OER of 1.5+-0.1 was observed (Dγ/Dsub(n+γ)=0.42). The OER values observed for similar irradiation times, with iridium-192 γ-rays, were 2.3+-0.2 and 2.6+-0.1 respectively, which leads to therapeutic gain factors (GF) of 1.6 and 1.7 respectively. These GF values are slightly lower than those previously obtained (GF=1.8) on the same system, with d(50)-Be p(75)-Be and 15 MeV neutron beams

  6. Application of TSH bioindicator for studying the biological efficiency of neutrons from californium-252 source

    International Nuclear Information System (INIS)

    The effectiveness of neutrons from a Californium-252 source in the induction of various abnormalities in the Tradescantia clone 4430 stamen hair cells (TSH-assay) was studied. The special attention was paid to check whether any enhancement in effects caused by process of boron neutron capture is visible in the cells enriched with boron ions. Two chemicals (borax and BSH) were applied to introduce boron-10 ions into cells. Inflorescence, normal or pretreated with chemicals containing boron, were irradiated in the air with neutrons from a Cf-252 source at KAERI, Taejon, Korea. To estimate the relative biological effectiveness (RBE) in the induction of gene mutations of the neutron beam under the study, Tradescantia inflorescences, without any chemical pretreatment, were irradiated with various doses of X-rays. The ranges of radiation doses used were 0-0.1 Gy in neutrons and 0-0.5 Gy in X-rays. After the time needed to complete the postirradiation repair Tradescantia cuttings were transferred to Cracow, where screening of gene and lethal; mutations, cell cycle alterations in somatic cells have been done, and dose response relationships were figured. The maximal RBE values were estimated in the range of 4.6-6.8. Alterations of RBE value were observed; from 6.8 to 7.8 in the case of plants pretreated with 240 ppm of B-10 from borax, and 4.6 to 6.1 in the case of 400 ppm of B-10 from BSH. Results showed a slight, although statistically insignificant increase in biological efficacy of radiation from the Cf-252 source in samples pretreated with boron containing chemicals. (author)

  7. Divalent and trivalent gas-phase coordination complexes of californium: evaluating the stability of Cf(ii).

    Science.gov (United States)

    Dau, Phuong D; Shuh, David K; Sturzbecher-Hoehne, Manuel; Abergel, Rebecca J; Gibson, John K

    2016-08-01

    The divalent oxidation state is increasingly stable relative to the trivalent state for the later actinide elements, with californium the first actinide to exhibit divalent chemistry under moderate conditions. Although there is evidence for divalent Cf in solution and solid compounds, there are no reports of discrete complexes in which Cf(II) is coordinated by anionic ligands. Described here is the divalent Cf methanesulfinate coordination complex, Cf(II)(CH3SO2)3(-), prepared in the gas phase by reductive elimination of CH3SO2 from Cf(III)(CH3SO2)4(-). Comparison with synthesis of the corresponding Sm and Cm complexes reveals reduction of Cf(III) and Sm(III), and no evidence for reduction of Cm(III). This reflects the comparative 3+/2+ reduction potentials: Cf(3+) (-1.60 V) ≈ Sm(3+) (-1.55 V) ≫ Cm(3+) (-3.7 V). Association of O2 to the divalent complexes is attributed to formation of superoxides, with recovery of the trivalent oxidation state. The new gas-phase chemistry of californium, now the heaviest element to have been studied in this manner, provides evidence for Cf(II) coordination complexes and similar chemistry of Cf and Sm. PMID:27424652

  8. Hypoxic versus normoxic external-beam irradiation of cervical carcinoma combined with californium-252 neutron brachytherapy. Comparative treatment results of a 5-year randomized study

    Czech Academy of Sciences Publication Activity Database

    Tačev, T.; Vacek, Antonín; Ptáčková, B.; Strnad, V.

    2005-01-01

    Roč. 181, č. 5 (2005), s. 273-284. ISSN 0179-7158 Institutional research plan: CEZ:AV0Z50040507 Keywords : cervical carcinoma * hypoxyradiotherapy * californium-252 Subject RIV: BO - Biophysics Impact factor: 3.490, year: 2005

  9. Solving the Hydration Structure of the Heaviest Actinide Aqua Ion Known: The Californium(III) Case

    Energy Technology Data Exchange (ETDEWEB)

    Den Auwer, Ch.; Guillaumont, D. [CEA Marcoule, Nucl Energy Div, Radiochem Proc Dept, SCPS LILA, 30 (France); Galbis, E.; Pappalardo, Rafael R.; Marcos Sanchez, E. [Univ Seville, Dept Quim Fis, E-41012 Seville (Spain); Hernandez-Cobos, J. [Inst Ciencias Fis, Cuernavaca 62251, Morelos (Mexico); Le Naour, C.; Simoni, E. [Univ Paris Sud, Inst Phys Nucl Orsay, Paris (France)

    2010-07-01

    In summary, the first MC simulation of the trivalent cation of californium, based on an exchangeable hydrated ion-water intermolecular potential, has been shown to extend and improve the hydrated ion model. Likewise, the CfL{sub III}-edge EXAFS spectrum of an acidic 1 mm Cf(ClO{sub 4}){sub 3} aqueous solution recorded under optimized experimental conditions has greatly improved the signal/noise ratio of the only previously recorded spectrum. The comparison of the experimental EXAFS spectrum with the two computed ones, obtained from two different intermolecular potentials that predict eight (BP86) or nine (MP2) water molecules in the first coordination shell, leads to the conclusion that the lowest hydration number is preferred. Then, as Cf{sup III} is the heaviest actinide aqua ion for which there is experimental information, the actinide contraction is supported by the present study. (For U{sup III}, R{sub U-O}=2.56 Angstroms, and CN=9{+-}1; for Pu{sup III}, R{sub Pu-O}=2.51 Angstroms and CN=9{+-}1; for Cm{sup III}, R{sub Cm-O}=2.47 Angstroms and CN=9{+-}1). The role of the second hydration shell is important in defining the structure and dynamics of the Cf{sup III} aqua ion, but the contribution of second-shell water molecules to the EXAFS signal as back-scatters is marginal. Finally, this work gives an illustrative example of the benefits which can be achieved from the combination of experimental X-ray absorption spectroscopy and computer simulations. The usefulness of the simultaneous analysis of the results as well as the importance of the structural statistical average has been clearly demonstrated herein. Each technique independently was not adequate. We believe that this study traces out a still poorly explored combined methodology which may be extremely useful for many other complexes and chemical problems. A systematic theoretical and experimental examination of the other known actinide cations on the same basis should be undertaken to confirm the

  10. 10 CFR 72.248 - Safety analysis report updating.

    Science.gov (United States)

    2010-01-01

    ... Approval of Spent Fuel Storage Casks § 72.248 Safety analysis report updating. (a) Each certificate holder for a spent fuel storage cask design shall update periodically, as provided in paragraph (b) of this... Commission, in accordance with § 72.4, within 90 days after the spent fuel storage cask design has...

  11. 49 CFR 195.248 - Cover over buried pipeline.

    Science.gov (United States)

    2010-10-01

    ... MATERIALS SAFETY ADMINISTRATION, DEPARTMENT OF TRANSPORTATION (CONTINUED) PIPELINE SAFETY TRANSPORTATION OF HAZARDOUS LIQUIDS BY PIPELINE Construction § 195.248 Cover over buried pipeline. (a) Unless specifically... the pipe and the ground level, road bed, river bottom, or underwater natural bottom (as determined...

  12. 17 CFR 248.127 - Renewal of opt out elections.

    Science.gov (United States)

    2010-04-01

    ... (CONTINUED) REGULATIONS S-P AND S-AM Regulation S-AM: Limitations on Affiliate Marketing § 248.127 Renewal of... marketing solicitations to the consumer; (5) That the consumer's election has expired or is about to expire... expires, you may not make marketing solicitations to a consumer who previously opted out, unless: (i)...

  13. 14 CFR 248.2 - Filing of audit reports.

    Science.gov (United States)

    2010-01-01

    ... Information, in duplicate, a special report consisting of a true and complete copy of the audit report... included in, attached to, or submitted with or separately as a part of, the audit report. (b) Each air... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Filing of audit reports. 248.2 Section...

  14. Design, construction, and characterization of a facility for neutron capture gamma ray analysis of sulfur in coal using californium-252

    International Nuclear Information System (INIS)

    A study of neutron capture gamma ray analysis of sulfur in coal using californium-252 as a neutron source is reported. Both internal and external target geometries are investigated. The facility designed for and used in this study is described. The external target geometry is found to be inappropriate because of the low thermal neutron flux at the sample location, which must be outside the biological shielding. The internal target geometry is found to have a sufficient thermal neutron flux, but an excessive gamma ray background. A water filled plastic facility, rather than the paraffin filled steel one used in this study, is suggested as a means of increasing flexibility and decreasing the beackground in the internal target geometry

  15. 248 nm imaging photolithography assisted by surface plasmon polariton interference

    Science.gov (United States)

    Tian, Man-man; Mi, Jia-jia; Shi, Jian-ping; Wei, Nan-nan; Zhan, Ling-li; Huang, Wan-xia; Zuo, Ze-wen; Wang, Chang-tao; Luo, Xian-gang

    2014-01-01

    A new photolithography technique for 248 nm based on the interference of surface plasmon waves is proposed and demonstrated by using computer simulations. The basic structure consists of surface plasmon polariton (SPP) interference mask and multi-layer film superlens. Using the amplification effect of superlens on evanescent wave, the near field SPP interference pattern is imaged to the far field, and then is exposed on photo resist (PR). The simulation results based on finite difference time domain (FDTD) method show that the full width at half maximum (FWHM) of the interference pattern is about 19 nm when the p-polarization light from 248 nm source is vertically incident to the structure. Meanwhile, the focal depth is 150 nm for negative PR and 60 nm for positive PR, which is much greater than that in usual SPP photolithography.

  16. 31 CFR 248.5 - Exception to requirement of undertaking of indemnity Form 2244.

    Science.gov (United States)

    2010-07-01

    ... undertaking of indemnity Form 2244. 248.5 Section 248.5 Money and Finance: Treasury Regulations Relating to... POSSESSIONS Action to Be Taken by Claimants § 248.5 Exception to requirement of undertaking of indemnity Form... officer or employee responsible for handling the claim, in his discretion, may accept an undertaking...

  17. 24 CFR 248.405 - Grants for building resident capacity and funding predevelopment costs.

    Science.gov (United States)

    2010-04-01

    ... capacity and funding predevelopment costs. 248.405 Section 248.405 Housing and Urban Development... Technical Assistance and Capacity Building § 248.405 Grants for building resident capacity and funding..., including third party costs for training, development consulting, legal, appraisal,...

  18. 24 CFR 248.111 - Appraisal and preservation value of eligible low income housing.

    Science.gov (United States)

    2010-04-01

    ... of actual project operating expenses at the time of the appraisal, based on the average of the actual... receive incentives under §§ 248.153, 248.157 or 248.161 only based upon an appraisal conducted in... regarding the performance of an appraisal pursuant to this section. (c) Appraisers. The Commissioner and...

  19. Dicty_cDB: CFI248 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFI248 (Link to dictyBase) - - - Contig-U14964-1 - (Link to Original site) ... -18 CP001196_2670( CP001196 |pid:none) Oligotropha car boxidovorans OM5... 93 7e-18 AF168363_3( AF168363 | ... pid:none) Lactococcus lactis pyrrolidone car ... 93 7e-18 CP000517_1515( CP000517 |pid:none) Lac ...

  20. Actinide production from xenon bombardments of curium-248

    International Nuclear Information System (INIS)

    Production cross sections for many actinide nuclides formed in the reaction of 129Xe and 132Xe with 248Cm at bombarding energies slightly above the coulomb barrier were determined using radiochemical techniques to isolate these products. These results are compared with cross sections from a 136Xe + 248Cm reaction at a similar energy. When compared to the reaction with 136Xe, the maxima in the production cross section distributions from the more neutron deficient projectiles are shifted to smaller mass numbers, and the total cross section increases for the production of elements with atomic numbers greater than that of the target, and decreases for lighter elements. These results can be explained by use of a potential energy surface (PES) which illustrates the effect of the available energy on the transfer of nucleons and describes the evolution of the di-nuclear complex, an essential feature of deep-inelastic reactions (DIR), during the interaction. The other principal reaction mechanism is the quasi-elastic transfer (QE). Analysis of data from a similar set of reactions, 129Xe, 132Xe, and 136Xe with 197Au, aids in explaining the features of the Xe + Cm product distributions, which are additionally affected by the depletion of actinide product yields due to deexcitation by fission. The PES is shown to be a useful tool to predict the general features of product distributions from heavy ion reactions

  1. Operational experience with the Argonne National Laboratory Californium Rare Ion Breeder Upgrade facility and electron cyclotron resonance charge breeder

    Science.gov (United States)

    Vondrasek, R.; Clark, J.; Levand, A.; Palchan, T.; Pardo, R.; Savard, G.; Scott, R.

    2014-02-01

    The Californium Rare Ion Breeder Upgrade (CARIBU) of the Argonne National Laboratory Argonne Tandem Linac Accelerator System (ATLAS) facility provides low-energy and accelerated neutron-rich radioactive beams to address key nuclear physics and astrophysics questions. A 350 mCi 252Cf source produces fission fragments which are thermalized and collected by a helium gas catcher into a low-energy particle beam with a charge of 1+ or 2+. An electron cyclotron resonance (ECR) ion source functions as a charge breeder in order to raise the ion charge sufficiently for acceleration in the ATLAS linac. The ECR charge breeder has achieved stable beam charge breeding efficiencies of 10.1% for 23Na7+, 17.9% for 39K10+, 15.6% for 84Kr17+, and 12.4% for 133Cs27+. For the radioactive beams, a charge breeding efficiency of 11.7% has been achieved for 143Cs27+ and 14.7% for 143Ba27+. The typical breeding times are 10 ms/charge state, but the source can be tuned such that this value increases to 100 ms/charge state with the best breeding efficiency corresponding to the longest breeding times—the variation of efficiencies with breeding time will be discussed. Efforts have been made to characterize and reduce the background contaminants present in the ion beam through judicious choice of q/m combinations. Methods of background reduction are being investigated based upon plasma chamber cleaning and vacuum practices.

  2. Long-term effects of an intracavitary treatment with californium-252 on normal tissue. [Swine, /sup 226/Ra

    Energy Technology Data Exchange (ETDEWEB)

    Sullivan, M.F.; Beamer, J.L.; Mahony, T.D.; Cross, F.T.; Lund, J.E.; Endres, G.W.R.

    1976-01-01

    About one hundred fifty swine were exposed to either radium-226 or californium-252 sources in the uterine cervix to determine an RBE for both acute and long-term effects. That value for early changes in the tissues at risk in the treatment of cervical cancer was between 6.2 and 6.8. The incidence of complications increased with time after exposure, especially among animals treated with /sup 252/Cf. Analysis of rectal injury showed that ulceration occurred frequently within a year postexposure at doses between 1600 and 2400 rad calculated at 2 cm lateral to the source midline. Fat necrosis and smooth muscle atrophy, resulting in a local rectal stricture, were delayed changes observed in some animals. The lower ureter was the site for a greater frequency of complications than the GI tract. Ureteral stricture often occurred at doses of 1200 rad from /sup 252/Cf and 7000 rad from /sup 226/Ra. Observation of delayed effects in the uterine-cervix in animals held up to 4 years postexposure indicate that the RBE for /sup 252/Cf may be increased to a value as high as 18, while repair may have even decreased it to about 5.6 in the rectum. Fifty swine are still being observed for long-term effects after doses above 800 rad from /sup 252/Cf and 5000 rad from /sup 226/Ra.

  3. Femtosecond ultraviolet (248 nm) excimer laser processing of Teflon (PTFE)

    International Nuclear Information System (INIS)

    We have investigated by X-ray photoelectron spectroscopy (XPS) the surface of poly(tetrafluoroethylene) (PTFE) films, which were subjected to processing by femtosecond (fs) UV radiation from an excimer laser (KrF: λ=248 nm, tp∼380 fs) in air. Bulk characterization of processed PTFE films by Fourier transform infrared spectroscopy (FTIR) permit an investigation of the laser induced modifications in the material at energy densities below the ablation threshold. No features in XPS and FTIR spectra indicated the incorporation of hydrogen and/or oxygen, or the formation of a cross-linked network of carbon indicating chemically clean processing in contrast to nanosecond excimer laser processing which chemically degrades the surface. Scanning electron microscopy (SEM) of the micrometer size vertical interconnect (microvia) indicated mechanically and thermally damage free processing of PTFE with good edge quality, in contrast to nanosecond excimer laser processing

  4. Results with the electron cyclotron resonance charge breeder for the 252Cf fission source project (Californium Rare Ion Breeder Upgrade) at Argonne Tandem Linac Accelerator System

    International Nuclear Information System (INIS)

    The construction of the Californium Rare Ion Breeder Upgrade, a new radioactive beam facility for the Argonne Tandem Linac Accelerator System (ATLAS), is nearing completion. The facility will use fission fragments from a 1 Ci 252Cf source; thermalized and collected into a low-energy particle beam by a helium gas catcher. In order to reaccelerate these beams, an existing ATLAS electron cyclotron resonance (ECR) ion source was redesigned to function as an ECR charge breeder. Thus far, the charge breeder has been tested with stable beams of rubidium and cesium achieving charge breeding efficiencies of 9.7% into 85Rb17+ and 2.9% into 133Cs20+.

  5. Bk and Cf chromatographic separation and 249Bk/248Cm and 249Cf/248Cm elemental ratios determination by inductively coupled plasma quadrupole mass spectrometry

    International Nuclear Information System (INIS)

    The French Atomic Energy Commission has carried out several experiments for the study of minor-actinide transmutation processes in high intensity thermal neutron flux. In this context a Cm sample enriched in 248Cm (97%) was irradiated in a thermal neutron flux at the High Flux Reactor (HFR) of the Laue-Langevin Institute (ILL). The precise and accurate determination of Cf isotope ratios and of 249Bk/248Cm and 249Cf/248Cm elemental ratios in the 248Cm irradiated sample is crucial for the calculation of actinide neutron capture cross-sections.This work describes an analytical procedure for the separation and the isotope ratio measurement of Bk and Cf in the irradiated sample.The Bk and Cf separation is based on a lanthanides separation protocol previously developed by the laboratory. Well-defined retention times for Bk and Cf were obtained by coupling the Ionic Chromatography (IC) with an ICP-QMS. All conditions of element separation by IC and the different steps of the analytical protocol in order to obtain the isotopic and elemental ratios are presented. Relative uncertainties of Cf isotopic ratios range from 0.3% to 0.5% and the uncertainty of the 249Bk/248Cm and 249Cf/248Cm elemental ratios are respectively 6.1% and 3.2%.This level of uncertainty for both isotopic and elemental ratios is in perfect agreement with the requirement for transmutation studies. (authors)

  6. 24 CFR 248.175 - Resident homeownership program-limited equity cooperative.

    Science.gov (United States)

    2010-04-01

    ...-limited equity cooperative. 248.175 Section 248.175 Housing and Urban Development Regulations Relating to... Resident homeownership program—limited equity cooperative. (a) Tenants may carry out a resident homeownership program through the purchase of eligible low income housing by a limited equity cooperative...

  7. 24 CFR 248.157 - Voluntary sale of housing not in excess of Federal cost limit.

    Science.gov (United States)

    2010-04-01

    ... excess of Federal cost limit. 248.157 Section 248.157 Housing and Urban Development Regulations Relating... UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES PREPAYMENT OF LOW INCOME HOUSING MORTGAGES Prepayments and Plans of Action Under the Low Income Housing Preservation and Resident Homeownership Act of...

  8. 24 CFR 248.161 - Mandatory sale of housing in excess of the Federal cost limit.

    Science.gov (United States)

    2010-04-01

    ... of the Federal cost limit. 248.161 Section 248.161 Housing and Urban Development Regulations Relating... UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES PREPAYMENT OF LOW INCOME HOUSING MORTGAGES Prepayments and Plans of Action Under the Low Income Housing Preservation and Resident Homeownership Act of...

  9. 24 CFR 248.127 - Limitations on action pursuant to Federal cost limit.

    Science.gov (United States)

    2010-04-01

    ... Federal cost limit. 248.127 Section 248.127 Housing and Urban Development Regulations Relating to Housing... HOUSING ACT AND OTHER AUTHORITIES PREPAYMENT OF LOW INCOME HOUSING MORTGAGES Prepayments and Plans of Action Under the Low Income Housing Preservation and Resident Homeownership Act of 1990 §...

  10. 17 CFR 248.13 - Exception to opt out requirements for service providers and joint marketing.

    Science.gov (United States)

    2010-04-01

    ... requirements for service providers and joint marketing. 248.13 Section 248.13 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION (CONTINUED) REGULATIONS S-P AND S-AM Regulation S-P: Privacy of... out requirements for service providers and joint marketing. (a) General rule. (1) The opt...

  11. 17 CFR 248.12 - Limits on sharing account number information for marketing purposes.

    Science.gov (United States)

    2010-04-01

    ..., direct mail marketing, or other marketing through electronic mail to the consumer. (b) Exceptions... number information for marketing purposes. 248.12 Section 248.12 Commodity and Securities Exchanges... account number information for marketing purposes. (a) General prohibition on disclosure of...

  12. Ab initio full-potential study of mechanical properties and magnetic phase stability of californium monopnictides (CfN and CfP)

    Science.gov (United States)

    Amari, S.; Bouhafs, B.

    2016-09-01

    Based on the first-principles methods, the structural, elastic, electronic, properties and magnetic ordering of californium monopnictides CfX (X = P) have been studied using the full-potential augmented plane wave plus local orbitals (FP-L/APW + lo) method within the framework of density functional theory (DFT). The electronic exchange correlation energy is described by generalized gradient approximation GGA and GGA+U (U is the Hubbard correction). The GGA+U method is applied to the rare-earth 5f states. We have calculated the lattice parameters, bulk modulii and the first pressure derivatives of the bulk modulii. The elastic properties of the studied compounds are only investigated in the most stable calculated phase. In order to gain further information, we have calculated Young's modulus, shear modulus, anisotropy factor and Kleinman parameter by the aid of the calculated elastic constants. The results mainly show that californium monopnictides CfX (X = P) have an antiferromagnetic spin ordering. Density of states (DOS) and charge densities for both compounds are also computed in the NaCl (B1) structure.

  13. Single-pulse laser effects measurements at 248 nm

    International Nuclear Information System (INIS)

    We have measured induced impulse and mass loss from exposures of a number of materials to 50 ns, KrF (0.248 μm) laser pulses as a function of incident laser fluence, ambient atmospheric pressure, and angle of incidence. The energy on target was normally about 100 J but was varied down to about 10 J and the beam diameter on target was varied from about 0.1 to 38 mm providing incident laser fluences of from about 104 J/m2 to about 1010 J/m2. Calculations indicate that for fluences in these experiments below about 107 J/m2, the blowoff hydrodynamics is predominately one dimensional. The ambient atmospheric pressure was varied from about 105 Pa of dry air to a vacuum of less than 10-2 Pa; the angle of incidence was varied from normal incidence to 100 from grazing incidence. In a few cases, the pressure was measured as a function of time, sometimes concurrently with impulse. A number of plasma physics measurements were also performed concurrently

  14. Photofragment Translational Spectroscopy of Propargyl Radicals at 248 nm

    Energy Technology Data Exchange (ETDEWEB)

    Goncher, S.J.; Moore, D.T.; Sveum, N.E.; Neumark, D.M.

    2007-12-21

    The photodissociation of propargyl radical, C{sub 3}H{sub 3}, and its perdeuterated isotopolog was investigated using photofragment translational spectroscopy. Propargyl radicals were produced by 193 nm photolysis of allene entrained in a molecular beam expansion, and then photodissociated at 248 nm. photofragment time-of-flight spectra were measured at a series of laboratory angles using electron impact ionization coupled to a mass spectrometer. Data for ion masses corresponding to C{sub 3}H{sub 2}{sup +}, C{sub 3}H{sup +}, C{sub 3}{sup +}, and the analogous deuterated species show that both H and H{sub 2} loss occur. The translational energy distributions for these processes have average values = 5.7 and 15.9 kcal/mol, respectively, and are consistent with dissociation on the ground state following internal conversion, with no exit barrier for H loss but a tight transition state for H{sub 2} loss. The translational energy distribution for H atom loss is similar to that in previous work on propargyl in which the H atom, rather than the heavy fragment, was detected. The branching ratio for H loss/H{sub 2} loss was determined to be 97.6/2.4 {+-} 1.2, in good agreement with RRKM results.

  15. PHILIPS 248X3LFH 时尚和健康的完美组合

    Institute of Scientific and Technical Information of China (English)

    刘宗宇

    2012-01-01

    飞利浦MODA显示器248C3LSB依靠时尚的造型和优秀的显示效果获得了《微型计算机》编辑部年度推荐产品称号。而现在,飞利浦新推出了一款可以称之为MODA升级版的248x3LFH显示器。

  16. AN INTEGRAL REACTOR PHYSICS EXPERIMENT TO INFER ACTINIDE CAPTURE CROSS-SECTIONS FROM THORIUM TO CALIFORNIUM WITH ACCELERATOR MASS SPECTROMETRY

    International Nuclear Information System (INIS)

    The principle of the proposed experiment is to irradiate very pure actinide samples in the Advanced Test Reactor (ATR) at INL and, after a given time, determine the amount of the different transmutation products. The determination of the nuclide densities before and after neutron irradiation will allow inference of effective neutron capture cross-sections. This approach has been used in the past and the novelty of this experiment is that the atom densities of the different transmutation products will be determined using the Accelerator Mass Spectroscopy (AMS) technique at the ATLAS facility located at ANL. It is currently planned to irradiate the following isotopes: 232Th, 235U, 236U, 238U, 237Np, 238Pu, 239Pu, 240Pu, 241Pu, 242Pu, 241Am, 243Am and 248Cm.

  17. Anatomy of a controversy: Application of the Langevin technique to the analysis of the Californium-252 Source-Driven Noise Analysis method for subcriticality determination

    International Nuclear Information System (INIS)

    The expressions for the power spectral density of the noise equivalent sources have been calculated explicitly for the (a) stochastic transport equation, (b) the one-speed transport equaton, (c) the one-speed P1 equations, (d) the one-speed diffusion equation and (e) the point kinetic equation. The stochastic nature of Fick's law in (d) has been emphasized. The Langevin technique has been applied at various levels of approximation to the interpretation of the Californium-252 Source-Driven Noise Analysis (CSDNA) experiment for determining the reactivity in subcritical media. The origin of the controversy surrounding this method has been explained. The foundations of the CSDNA method as a viable experimental technique to infer subcriticality from a measured ratio of power spectral densities of the outputs of two neutron detectors and a third external source detector has been examined by solving the one-speed stochastic diffusion equation for a point external Californium-252 source and two detectors in an infinite medium. The expression relating reactivity to the measured ratio of PSDs was found to depend implicitly on k itself. Through a numerical analysis fo this expression, the authors have demonstrated that for a colinear detector-source-detector configuration for neutron detectors far from the source, the expression for the subcritical multiplication factor becomes essentially insensitive to k, hence, demonstrating some possibility for the viability of this technique. However, under more realistic experimental conditions, i.e., for finite systems in which diffusion theroy is not applicable, the measurement of the subcritical multiplication factor from a single measured ratio of PSDs, without extensive transport calculations, remains doubtful

  18. Application of SCGE assay, classical cytogenetics and FISH for studying in vitro californium-252 neutrons irradiations and BSH pretreatment on human lymphocytes

    International Nuclear Information System (INIS)

    Recently, there has been observed a tendency to apply various energy neutrons for tumor therapy and particularly low energy neutrons from various sources, including californium-252 source, for cancer radiotherapy based on the neutron capture. In this study peripheral blood lymphocytes were used as a model for human cells and three methods were applied to assess the effectiveness of californium-252 neutrons irradiations in vitro in normal cells or pre-treated with compound enriched in B-10 ion. Human blood samples or isolated lymphocytes were irradiated with neutrons from isotopic 252Cf source at the Faculty of Nuclear Physics and Technics at University of Mining and Metallurgy (both neutron source and samples were placed in polyethylene block). Chemical pretreatment with BSH (Na210B12H11SH) was done to introduce boron-10 ion into cells in order to check any enhancement effect due to the process of boron neutron capture. Comet assay was done to investigate the DNA damage. Classical cytogenetics was applied to assess the frequencies of unstable aberrations (dicentrics and rings). Fluorescence in situ hybridization (FISH) with probes for chromosomes 1, 4 (14.3% of whole genome) and pancentromeric probe was performed to evaluate the frequencies of stable aberrations. Linear (or close to linear) increase of DNA damage and aberration frequency was observed with dose of radiation both for lymphocytes untreated or pre-treated with BSH. Very little differences (statistically insignificant) due to radiation dose and BSH pretreatment were observed in the frequencies of SCEs detected in the second mitosis. There is no significant difference between boron pre-treated and not treated cells, and even slightly higher effects were observed in case of the highest dose without BSH pretreatment. The level of translocations observed is comparable with the frequencies of dicentrics and rings. (author)

  19. Californium-252 neutron sources

    International Nuclear Information System (INIS)

    Major production programs for the Savannah River reactors and the High Flux Isotopes Reactor at Oak Ridge have made 252Cf one of the most available and, at the USAEC's sales price of $10/μg, one of the least-expensive isotopic neutron sources. Reactor production has totaled approximately 2 g, and, based on expected demand, an additional 10 g will be produced in the next decade. The approximately 800 mg chemically separated to date has been used to prepare over 600 neutron sources. Most, about 500, have been medical sources containing 1 to 5 μg of 252Cf plated in needles for experimental cancer therapy studies. The remainder have generally been point sources containing 10 μg to 12 mg of oxide for activation, well logging, or radiography uses. Bulk sources have also been supplied to the commercial encapsulators. The latest development has been the production of 252Cf cermet wire which can be cut into almost contamination-free lengths of the desired 252Cf content. Casks are available for transport of sources up to 50 mg. Subcritical assemblies have been developed to multiply the source neutrons by a factor of 10 to 40, and collimators and thermalizers have also been extensively developed to shape the neutron flux and energy distributions for special applications. (U.S.)

  20. Calculations of Nuclear Astrophysics and Californium Fission Neutron Spectrum Averaged Cross Section Uncertainties Using ENDF/B-VII.1, JEFF-3.1.2, JENDL-4.0 and Low-fidelity Covariances

    International Nuclear Information System (INIS)

    Nuclear astrophysics and californium fission neutron spectrum averaged cross sections and their uncertainties for ENDF materials have been calculated. Absolute values were deduced with Maxwellian and Mannhart spectra, while uncertainties are based on ENDF/B-VII.1, JEFF-3.1.2, JENDL-4.0 and Low-Fidelity covariances. These quantities are compared with available data, independent benchmarks, EXFOR library, and analyzed for a wide range of cases. Recommendations for neutron cross section covariances are given and implications are discussed

  1. Liquid phase silylation process for 248-nm lithography using EL IR photoresist

    Science.gov (United States)

    Zhang, Guojing; Smith, Bruce W.; Fuller, Lynn F.

    1994-05-01

    The goal of this investigation was to develop a 0.3 micron silylation process for 248 nm exposure, using a commercial photoresist material. Presented are results from investigation into liquid silylation of 248 nm exposure of Dynachem EL IRTM, a non-melamine image reversal novalac material designed for i-line application. A GCA BOLD 0.42 NA, 248 nm excimer laser projection system was used for exposure. A process has been developed utilizing a silylation solution of hexamethyl- cyclotrisilazane (HMCTS), propylene-glycol-methyl-ether-acetate (PGMEA), and xylene mixtures. Using a 15 run Box-Behnken statistically designed experiment, dry development in 02 RIE has been optimized with chamber pressure, flow rate, and 02 flow as process factors. Process responses optimized were selectivity, etch rate, and anisotropy. Results show capabilities and sensitivities of the process. Response surfaces are presented, along with resist image results of 0.3 microns at 5:1 aspect ratio.

  2. P53 codon 11, 72, and 248 gene polymorphisms in endometriosis

    OpenAIRE

    Hsieh, Yao-Yuan; Lin, Chich-Sheng

    2006-01-01

    Objective: Mutated p53 gene is related to the instability of cell growth and cell cycle progression. We aimed to evaluate the association between endometriosis and p53 codon 11, 72 and 248 gene polymorphisms. Patients and methods: Women were divided into two groups: (1) moderate/severe endometriosis (n=148), and (2) non-endometriosis groups (n=150). P53 gene polymorphisms include codon11 Glu/Gln or Lys (GAG->CAG or AAG), codon 72 Arg/Pro (CGC->CCC), and codon 248 Arg/Thr (CGG->TCG). These gen...

  3. Chalcogenide compounds made by pulsed laser deposition at 355 and 248 nm

    DEFF Research Database (Denmark)

    Ettlinger, Rebecca Bolt; Cazzaniga, Andrea Carlo; Crovetto, Andrea; Ravnkilde, Lasse; Youngman, Tomas Hugh; Pryds, Nini; Schou, Jørgen

    Thin films made by pulsed laser deposition may differ depending on the laser wavelength. We compared ZnS, Cu2SnS3 and a target enriched with SnS relative to Cu2SnS3 using 355 nm and 248 nm lasers......Thin films made by pulsed laser deposition may differ depending on the laser wavelength. We compared ZnS, Cu2SnS3 and a target enriched with SnS relative to Cu2SnS3 using 355 nm and 248 nm lasers...

  4. 17 CFR 248.122 - Scope and duration of opt out.

    Science.gov (United States)

    2010-04-01

    ... (CONTINUED) REGULATIONS S-P AND S-AM Regulation S-AM: Limitations on Affiliate Marketing § 248.122 Scope and... before the company's affiliates may make marketing solicitations to the consumer using eligibility... consumer's election to opt out prohibits any affiliate covered by the opt out notice from using...

  5. 17 CFR 248.125 - Reasonable and simple methods of opting out.

    Science.gov (United States)

    2010-04-01

    ... COMMISSION (CONTINUED) REGULATIONS S-P AND S-AM Regulation S-AM: Limitations on Affiliate Marketing § 248.125... consumer that you receive from an affiliate to make a marketing solicitation to the consumer about your... electronically mailed or processed at an Internet Web site, if the consumer agrees to the electronic delivery...

  6. 17 CFR 248.123 - Contents of opt out notice; consolidated and equivalent notices.

    Science.gov (United States)

    2010-04-01

    ... Marketing § 248.123 Contents of opt out notice; consolidated and equivalent notices. (a) Contents of opt out...”; (iii) A general description of the types of eligibility information that may be used to make marketing... make marketing solicitations to the consumer; (v) That the consumer's election will apply for...

  7. 19 CFR 10.248 - Additional requirements for preferential treatment of brassieres.

    Science.gov (United States)

    2010-04-01

    ... documents, work orders and other production records, and inventory control records; and (v) Accounting books..., column 34), or its electronic equivalent, the distinct and unique identifier assigned by CBP to the... States was at least 75 percent (or 85 percent, if applicable under 19 CFR 10.248(b)(1)(ii)) of...

  8. PCR-RFLP to Detect Codon 248 Mutation in Exon 7 of "p53" Tumor Suppressor Gene

    Science.gov (United States)

    Ouyang, Liming; Ge, Chongtao; Wu, Haizhen; Li, Suxia; Zhang, Huizhan

    2009-01-01

    Individual genome DNA was extracted fast from oral swab and followed up with PCR specific for codon 248 of "p53" tumor suppressor gene. "Msp"I restriction mapping showed the G-C mutation in codon 248, which closely relates to cancer susceptibility. Students learn the concepts, detection techniques, and research significance of point mutations or…

  9. P53 codon 11, 72, and 248 gene polymorphisms in endometriosis

    Directory of Open Access Journals (Sweden)

    Yao-Yuan Hsieh , Chich-Sheng Lin

    2006-01-01

    Full Text Available Objective: Mutated p53 gene is related to the instability of cell growth and cell cycle progression. We aimed to evaluate the association between endometriosis and p53 codon 11, 72 and 248 gene polymorphisms. Patients and methods: Women were divided into two groups: (1 moderate/severe endometriosis (n=148, and (2 non-endometriosis groups (n=150. P53 gene polymorphisms include codon11 Glu/Gln or Lys (GAG->CAG or AAG, codon 72 Arg/Pro (CGC->CCC, and codon 248 Arg/Thr (CGG->TCG. These gene polymorphisms were amplified by polymerase chain reaction and detected by electrophoresis after restriction enzyme (Taq I, BstU I, Hap II digestions. Associations between the endometriosis and p53 polymorphisms were evaluated. Results: The distributions of p53 codon 72 polymorphisms in both groups were significantly different. The proportions of Arg homozygotes/heterozygotes/Pro homozygotes in both groups were 9.5/66.2/24.3% and 30.7/50/19.3%. The proportions of Arg/Pro alleles were 42.6/57.4% and 56/44%. The distributions of p53 codon 11 and 248 polymorphisms in both groups were non-significantly different. All individuals appeared the wild genotypes (Glu11 and Arg248 homozygotes. Conclusion: Association between endometriosis and p53 codon 72 polymorphism exists. P53 codon 72*Pro-related genotype and allele are related with higher susceptibility of endometriosis. P53 codon 11 and 248 polymorphisms are not related with endometriosis susceptibility.

  10. Californium interrogation prompt neutron (CIPN) instrument for non-destructive assay of spent nuclear fuel-Design concept and experimental demonstration

    Science.gov (United States)

    Henzlova, D.; Menlove, H. O.; Rael, C. D.; Trellue, H. R.; Tobin, S. J.; Park, Se-Hwan; Oh, Jong-Myeong; Lee, Seung-Kyu; Ahn, Seong-Kyu; Kwon, In-Chan; Kim, Ho-Dong

    2016-01-01

    This paper presents results of the first experimental demonstration of the Californium Interrogation Prompt Neutron (CIPN) instrument developed within a multi-year effort launched by the Next Generation Safeguards Initiative Spent Fuel Project of the United States Department of Energy. The goals of this project focused on developing viable non-destructive assay techniques with capabilities to improve an independent verification of spent fuel assembly characteristics. For this purpose, the CIPN instrument combines active and passive neutron interrogation, along with passive gamma-ray measurements, to provide three independent observables. This paper describes the initial feasibility demonstration of the CIPN instrument, which involved measurements of four pressurized-water-reactor spent fuel assemblies with different levels of burnup and two initial enrichments. The measurements were performed at the Post-Irradiation Examination Facility at the Korea Atomic Energy Institute in the Republic of Korea. The key aim of the demonstration was to evaluate CIPN instrument performance under realistic deployment conditions, with the focus on a detailed assessment of systematic uncertainties that are best evaluated experimentally. The measurements revealed good positioning reproducibility, as well as a high degree of insensitivity of the CIPN instrument's response to irregularities in a radial burnup profile. Systematic uncertainty of individual CIPN instrument signals due to assembly rotation was found to be orientation in the instrument.

  11. Stability of 248-254^Cf isotopes against alpha and cluster radioactivity

    OpenAIRE

    Santhosh, K. P.; Biju, R. K.

    2013-01-01

    Stability of 248-254^Cf nuclei against alpha and cluster emission is studied within our Coulomb and proximity potential model (CPPM). It is found that these nuclei are stable against light clusters (except alpha particle) and instable against heavy cluster emissions. For heavy cluster emissions the daughter nuclei lead to doubly magic 208^Pb or neighbouring one. The effect of quadrapole and hexadecapole deformations of parent nuclei, daughter nuclei and emitted cluster on half lives are also ...

  12. Actinide production in the reaction of heavy ions with curium-248

    International Nuclear Information System (INIS)

    Chemical experiments were performed to examine the usefulness of heavy ion transfer reactions in producing new, neutron-rich actinide nuclides. A general quasi-elastic to deep-inelastic mechanism is proposed, and the utility of this method as opposed to other methods (e.g. complete fusion) is discussed. The relative merits of various techniques of actinide target synthesis are discussed. A description is given of a target system designed to remove the large amounts of heat generated by the passage of a heavy ion beam through matter, thereby maximizing the beam intensity which can be safely used in an experiment. Also described is a general separation scheme for the actinide elements from protactinium (Z=91) to mendelevium (Z=101), and fast specific procedures for plutonium, americium and berkelium. The cross sections for the production of several nuclides from the bombardment of 248Cm with 18O, 86Kr and 136Xe projectiles at several energies near and below the Coulomb barrier were determined. The results are compared with yields from 48Ca and 238U bombardments of 248Cm. Simple extrapolation of the product yields into unknown regions of charge and mass indicates that the use of heavy ion transfer reactions to produce new, neutron-rich above-target species is limited. The substantial production of neutron-rich below-target species, however, indicates that with very heavy ions like 136Xe and 238U the new species 248Am, 249Am and 247Pu should be produced with large cross sections from a 248Cm target. A preliminary, unsuccessful attempt to isolate 247Pu is outlined. The failure is probably due to the half life of the decay, which is calculated to be less than 3 minutes. The absolute gamma ray intensities from 251Bk decay, necessary for calculating the 251Bk cross section, are also determined

  13. Biological Efficiency of Californium-252 Source Evaluated by Comet Assay, Classical Cytogenetics and FISH in Human Lymphocytes Irradiated without and with BSH Pretreatment

    International Nuclear Information System (INIS)

    Biological effectiveness of californium-252 source was evaluated after irradiations in vitro of normal or pre-treated with compound enriched in B-10 ion cells. Peripheral blood lymphocytes were used as a model for human cells. DNA and chromosomal damage were studied to compare biological effectiveness of irradiation. Human blood samples or isolated lymphocytes were irradiated with the isotopic source of 252Cf, at the Faculty of Physics and Nuclear Techniques at the University of Mining and Metallurgy (both neutron source and samples were placed in ''infinite'' polyethylene block). Chemical pretreatment with Na210B12H11SH (BSH) was performed to introduce boron-10 ion into cells in order to check any enhancement effect due to the process of boron neutron capture. Single cell gel electrophoresis also known as the Comet assay was done to investigate the DNA damage. Classical cytogenetic analysis was applied to assess the frequencies of unstable aberrations (dicentrics, rings and a centric fragments). To evaluate the frequencies of stable aberrations the fluorescence in situ hybridisation (FISH) with probes for chromosomes 1, 4 (14.3% of the whole genome) was performed. Linear (or close to linear) increase with radiation dose were observed for the DNA damage and aberration frequencies in lymphocytes both untreated or pre-treated with BSH. Levels of translocations evaluated for the whole genome were comparable with the frequencies of dicentrics and rings. No significant differences were detected due to radiation dose in the frequencies of sister chromatid exchanges (SCE) detected in the second mitosis. No statistically significant differences were observed in various biological end-points between normal or boron pre-treated cells. (author)

  14. Spatial structure of oligopeptide PAP(248-261), the N-terminal fragment of the HIV enhancer prostatic acid phosphatase peptide PAP(248-286), in aqueous and SDS micelle solutions

    Science.gov (United States)

    Blokhin, Dmitriy S.; Filippov, Andrei V.; Antzutkin, Oleg N.; Karataeva, Farida Kh.; Klochkov, Vladimir V.

    2014-07-01

    Prostatic acid phosphatase (PAP) is an enzyme that facilitates infection of cells by HIV. Its peptide fragment PAP(248-286) forms amyloid fibrils known as SEVI, which enhance attachment of the virus by viral adhesion to the host cell prior to receptor-specific binding via reducing the electrostatic repulsion between the membranes of the virus and the target cell. The secondary structure of PAP(248-286) in aqueous and SDS solutions can be divided into an N-terminal disordered region, an α-helical central part and an α/310-helical C-terminal region (Nanga et al., 2009). In this work, we used NMR spectroscopy to study the spatial structure of the isolated N-terminal fragment of PAP(248-286), PAP(248-261) (GIHKQKEKSRLQGG), in aqueous and SDS micelle solutions. Formation of a PAP(248-261)-SDS complex was confirmed by chemical shift alterations in the 1H NMR spectra of the peptide, as well as by the signs and values of Nuclear Overhauser Effect (NOE). In addition, the PAP(248-261) peptide does not form any specified secondary structure in either aqueous or SDS solutions.

  15. Photothermal Ablation of Polystyrene Film by 248 NM Excimer Laser Irradiation: a Mechanistic Study by Time-Resolved Measurements

    OpenAIRE

    Tsuboi, Yasuyuki; Sakashita, Shin-Ichi; Hatanaka, Koji; Fukumura, Hiroshi; Masuhara, Hiroshi

    1996-01-01

    Laser ablation mechanism at 248 nm irradiation of polystyrene film was investigated and discussed. An ablation threshold was determined by etch depth measurement and nanosecond photographic observation. Temperature at the threshold was evaluated to be 370℃ by using an effective absorption coefficient which was confirmed by transmission measurement of the excitation pulse. The temperature was in good agreement with that of thermal degradation of the polymer, showing that 248 nm ablation of pol...

  16. Photodissociation dynamics of 2-nitropropane and 2-methyl-2-nitropropane at 248 and 193 nm.

    Science.gov (United States)

    Sengupta, Sumana; Indulkar, Yogesh; Kumar, Awadhesh; Dhanya, Suresh; Naik, Prakash Dattatray; Bajaj, Parma Nand

    2008-12-11

    Dynamics of formation of electronically excited NO2 and formation of OH fragment, during photo dissociation of 2-nitropropane (NP) and 2-methyl-2-nitropropane (MNP), were investigated at 193 and 248 nm. The radiative lifetime of the electronically excited NO2 fragment, observed at 193 nm, was measured to be 1.2 ( 0.1 micros and the rate coefficient of quenching of its emission by MNP was measured as (2.7 ( 0.1) x 10(-10) molecule(-1) cm3 s(-1). Formation of the ground electronic state of OH was confirmed in both molecules. State selective laser induced fluorescence technique was used to detect the nascent OH (X 2Pi, v'', J'') fragments in different ro-vibrational states, and to obtain information on energy partitioning. Though MNP and NP differ in the types of the available H atoms, the dynamics of OH formation is found to be the same in both. The relative population in different rotational states does not follow Boltzmann equilibrium distribution in both the molecules at 193 and 248 nm. The translational energies of the OH fragments, calculated from the Doppler width, are 21.2 ( 7.2 and 25.0 ( 2.5 kcal mol-1 for NP at 248 and 193 nm, respectively. The translational energies of the OH fragments, in the case of MNP, are found to be lower, 17.5 ( 4.1 and 22.0 ( 3.2 kcal mol-1,respectively, at 248 nm 193 nm. These results are compared with the earlier reports on photodissociation of nitromethane (NM), nitroethane (NE), and other nitroalkanes. All possible dissociation pathways of these molecules--NM, NE, NP, and MNPs leading to the formation of the OH fragment were investigated computationally, with geometry optimization at the B3LYP/6-311+G(d,p) level and energy calculation at the MP4(SDQ)/6-311+G (d,p) level. The results suggest that in NM, OH is formed after isomerization to CH2N(OH)O, whereas in all other cases OH is formed from HONO, a primary product of molecular elimination of nitroalkanes, formed with sufficient internal energy. PMID:19053556

  17. Minimum fluence for laser blow-off of thin gold films at 248 and 532 nm

    International Nuclear Information System (INIS)

    The minimum 248 nm, 25 ns, and 532 nm, 15 ns laser fluences required to blow off thin gold films from optical quartz have been measured as a function of film thickness. The films apparently blow off when the gold-quartz interface reaches the normal boiling point of gold. Even though the initial reflectivities at the two wavelengths are very different, the actual laser fluences required to blow off the films are very similar. While the reflectivities above the melting point appear to be very low, as expected, large decreases in the reflectivity at 532 nm may also occur prior to film melting

  18. Minimum fluence for laser blow-off of thin gold films at 248 and 532 nm

    Energy Technology Data Exchange (ETDEWEB)

    Baseman, R.J.; Froberg, N.M.; Andreshak, J.C.; Schlesinger, Z. (IBM Thomas J. Watson Research Center, Yorktown Heights, New York 10598 (USA))

    1990-04-09

    The minimum 248 nm, 25 ns, and 532 nm, 15 ns laser fluences required to blow off thin gold films from optical quartz have been measured as a function of film thickness. The films apparently blow off when the gold-quartz interface reaches the normal boiling point of gold. Even though the initial reflectivities at the two wavelengths are very different, the actual laser fluences required to blow off the films are very similar. While the reflectivities above the melting point appear to be very low, as expected, large decreases in the reflectivity at 532 nm may also occur prior to film melting.

  19. Decay properties of 266Bh and 262Db produced in the 248Cm+23Na reaction

    International Nuclear Information System (INIS)

    Decay properties of an isotope 266Bh and its daughter nucleus 262Db produced by the 248Cm(23Na,5n) reaction were studied by using a gas-filled recoil separator coupled with a position-sensitive semiconductor detector. 266Bh was clearly identified from the correlation of the known nuclide, 262Db. The obtained decay properties of 266Bh and 262Db are consistent with those observed in the 278113 chain, which provided further confirmation of the discovery of 278113. (author)

  20. TGFβ-mediated suppression of CD248 in non-cancer cells via canonical Smad-dependent signaling pathways is uncoupled in cancer cells

    International Nuclear Information System (INIS)

    CD248 is a cell surface glycoprotein, highly expressed by stromal cells and fibroblasts of tumors and inflammatory lesions, but virtually undetectable in healthy adult tissues. CD248 promotes tumorigenesis, while lack of CD248 in mice confers resistance to tumor growth. Mechanisms by which CD248 is downregulated are poorly understood, hindering the development of anti-cancer therapies. We sought to characterize the molecular mechanisms by which CD248 is downregulated by surveying its expression in different cells in response to cytokines and growth factors. Only transforming growth factor (TGFβ) suppressed CD248 protein and mRNA levels in cultured fibroblasts and vascular smooth muscle cells in a concentration- and time-dependent manner. TGFβ transcriptionally downregulated CD248 by signaling through canonical Smad2/3-dependent pathways, but not via mitogen activated protein kinases p38 or ERK1/2. Notably, cancer associated fibroblasts (CAF) and cancer cells were resistant to TGFβ mediated suppression of CD248. The findings indicate that decoupling of CD248 regulation by TGFβ may contribute to its tumor-promoting properties, and underline the importance of exploring the TGFβ-CD248 signaling pathway as a potential therapeutic target for early prevention of cancer and proliferative disorders

  1. A bright-rimmed cloud sculpted by the H ii region Sh2-48

    CERN Document Server

    Ortega, M E; Giacani, E; Rubio, M; Dubner, G

    2013-01-01

    To characterize a bright-rimmed cloud embedded in the HII region Sh2-48 searching for evidence of triggered star formation. We carried out observations towards a region of 2'x2' centered at RA=18h 22m 11.39s, dec.=-14deg 35m 24.81s (J2000) using the Atacama Submillimeter Telescope Experiment (ASTE; Chile) in the 12CO J=3-2,13CO J=3-2, HCO+ J=4-3, and CS J=7-6 lines with an angular resolution of about 22". We also present radio continuum observations at 5 GHz carried out with the Jansky Very Large Array (JVLA; EEUU) interferometer with a synthetized beam of 7"x5". The analysis of our molecular observations reveals the presence of a relatively dense clump with n(H_2)~3x10^3 cm^-3, located in projection onto the interior of the HII region Sh2-48. The emission distribution of the four observed molecular transitions has, at VLSR~38 kms^-1, morphological anti-correlation with the bright-rimmed cloud as seen in the optical emission. From the new radio continuum observations we identify a thin layer of ionized gas lo...

  2. 清新护眼 飞利浦睿蓝摩登248X3LFH登场

    Institute of Scientific and Technical Information of China (English)

    2012-01-01

    飞利浦将创新的睿蓝光波(LightFrame)与Moda摩登系列产品完美结合,为用户带来最新力作——睿蓝摩登248X3LFH!与其它Moda产品不同的是248X3LFH机身背部采用了黑色镜面烤漆,而机身框架则采用极具金属质感的镀银处理,这样搭配圆润的铝铸基座,

  3. Photodissociation of pernitric acid (HO2NO2) at 248 nm

    Science.gov (United States)

    Macleod, Helene; Smith, Gregory P.; Golden, David M.

    1989-01-01

    The photodissociation of pernitric acid (PNA) was studied at 248 nm. The quantum yield for production of OH radicals is 34 + or - 16 percent. The yield of OH from PNA was measured relative to that of H2O2. The translational and rotational energy content of the OH photofragment from PNA was characterized. A fluorescent emission was also observed and characterized. It is attributed to electronically excited NO2 produced in the PNA photodissociation. A maximum yield of 30 percent for NO2 production was determined. The intensity of this emission, and a mass spectrometric peak at m/e = 33, were found to be useful means of characterizing the purity of the PNA sample.

  4. Study of 242‑248Cm isotopes in the projected shell model framework

    Science.gov (United States)

    Sadiq, Saiqa; Devi, Rani; Khosa, S. K.

    2016-04-01

    The projected shell model framework is employed to study the band spectra in 242‑248Cm isotopes. The present calculations reproduce the available experimental data on the yrast bands. Besides this, B(E2) transition probabilities of even-even Cm isotopes have also been calculated. The low spin states of yrast band are seen to arise purely from zero-quasi-particle (o-qp) intrinsic states whereas the high spin states have multi-quasi-particle structure. For the odd-neutron (odd-N) isotopes, the calculated results qualitatively reproduce the available data on ground and lowest excited state bands for 243,245Cm. However, for 247Cm the negative-parity ground state band is in reasonable agreement with the experimental data.

  5. Laser conditioning of LaF 3 MgF 2 dielectric coatings at 248 nm

    Science.gov (United States)

    Eva, E.; Mann, K.; Kaiser, N.; Anton, B.; Henking, R.; Ristau, D.; Weissbrodt, P.; Mademann, D.; Raupach, L.; Hacker, E.

    1996-10-01

    Highly reflective LaF3/MgF2 systems for a wavelength of 248 nm on MgF2 and crystalline quartz substrates were investigated. The influence of laser conditioning on damage threshold and absorptance was remarkable in those coatings that had a high initial absorptance. Monitoring with a laser calorimeter revealed the conditioning effect to be a function of the irradiation dose rather than of energy density or pulse rate. Furthermore, x-ray photoelectron spectroscopy and transmission electron microscopy investigations showed that conditioning induces stoichiometric and structural changes in the multilayers, especially in near-surface sublayers, whereas scanning electron microscopy and atomic force microscopy investigations indicated that the surface remains unchanged.

  6. MANTRA: An Integral Reactor Physics Experiment to Infer Actinide Capture Cross-sections from Thorium to Californium with Accelerator Mass Spectrometry

    Energy Technology Data Exchange (ETDEWEB)

    G. Youinou; C. McGrath; G. Imel; M. Paul; R. Pardo; F. Kondev; M. Salvatores; G. Palmiotti

    2011-08-01

    The principle of the proposed experiment is to irradiate very pure actinide samples in the Advanced Test Reactor at INL and, after a given time, determine the amount of the different transmutation products. The determination of the nuclide densities before and after neutron irradiation will allow inference of effective neutron capture cross-sections. This approach has been used in the past and the novelty of this experiment is that the atom densities of the different transmutation products will be determined using the Accelerator Mass Spectrometry technique at the ATLAS facility located at ANL. It is currently planned to irradiate the following isotopes: 232Th, 235U, 236U, 238U, 237Np, 238Pu, 239Pu, 240Pu, 241Pu, 242Pu, 241Am, 243Am, 244Cm and 248Cm.

  7. MANTRA: An Integral Reactor Physics Experiment to Infer Actinide Capture Cross-sections from Thorium to Californium with Accelerator Mass Spectrometry

    International Nuclear Information System (INIS)

    The principle of the proposed experiment is to irradiate very pure actinide samples in the Advanced Test Reactor at INL and, after a given time, determine the amount of the different transmutation products. The determination of the nuclide densities before and after neutron irradiation will allow inference of effective neutron capture cross-sections. This approach has been used in the past and the novelty of this experiment is that the atom densities of the different transmutation products will be determined using the Accelerator Mass Spectrometry technique at the ATLAS facility located at ANL. It is currently planned to irradiate the following isotopes: 232Th, 235U, 236U, 238U, 237Np, 238Pu, 239Pu, 240Pu, 241Pu, 242Pu, 241Am, 243Am, 244Cm and 248Cm.

  8. A systematic study of actinide production from the interactions of heavy ions with 248Cm

    International Nuclear Information System (INIS)

    Production cross sections for heavy actinides produced from the interactions of 12C, 31P, 40Ar, and 44Ca ions with 248Cm were measured at energies ranging from 0.98 to 1.35 X Coulomb barrier. The recoiling reaction products were collected in copper or gold catcher foils located near the 248Cm target. Separate fractions of Bk, Cf, Es, Fm, and Md were obtained from a radiochemical separation procedure. For the 12C system, a He/KCl jet was used to transport the recoiling No activities of interest to a rotating wheel system. The isotopic distributions of the actinide products were found to be essentially symmetric about the maximum with full-widths-at-half-maximum of approximately 2.5 mass units. Isotopic distributions of the 12C, 31P, 40Ar, and 44Ca systems were found to be very similar to the 40,48Ca systems studied previously. The maxima of the isotopic distributions generally occurred for those reaction channels which involved the exchange of the fewest number of nucleons between the target and projectile for which the calculated excitation energy was a positive quantity. Additionally, the maxima of the excitation functions occurred at those projectile energies which were consistent with the calculated reaction barriers based upon a binary reaction mechanism. The experimental data from the four systems investigated were compared to several models of heavy ion interactions including a damped reaction mechanism, compound nucleus formation and subsequent particle evaporation, and classical partial wave calculations for binary systems

  9. 17 CFR Appendix A to Subpart A of... - Appendix A to Subpart A of Part 248 Forms

    Science.gov (United States)

    2010-04-01

    .... The opt-out choices made available to the consumer who contacts the institution through these methods...; investment experience; credit-based insurance scores; insurance claim history; medical information; overdraft... under this part, must comply with section 624 of the FCRA and 17 CFR part 248, subpart B, with...

  10. 77 FR 12365 - Agency Information Collection; Activity Under OMB Review: Submission of Audit Reports-Part 248

    Science.gov (United States)

    2012-02-29

    ... published on April 11, 2000 (65 FR 19477-78) or you may visit http://DocketInfo.dot.gov . Docket: For access... the audit report, BTS will accept the annual report submitted to the stockholders. The audited reports...: Submission of Audit Reports--Part 248 AGENCY: Research and Innovative Technology Administration...

  11. 77 FR 26824 - Agency Information Collection; Activity Under OMB Review; Submission of Audit Reports-Part 248

    Science.gov (United States)

    2012-05-07

    ... the following collection of information was published on February 29, 2012 (77 FR 12365). No comments... the audit report, BTS will accept the annual report submitted to the stockholders. The audited reports...; Submission of Audit Reports--Part 248 AGENCY: Research & Innovative Technology Administration (RITA),...

  12. Californium Recovery from Palladium Wire

    Energy Technology Data Exchange (ETDEWEB)

    Burns, Jon D. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States)

    2014-08-01

    The recovery of 252Cf from palladium-252Cf cermet wires was investigated to determine the feasibility of implementing it into the cermet wire production operation at Oak Ridge National Laboratory’s Radiochemical Engineering Development Center. The dissolution of Pd wire in 8 M HNO3 and trace amounts of HCl was studied at both ambient and elevated temperatures. These studies showed that it took days to dissolve the wire at ambient temperature and only 2 hours at 60°C. Adjusting the ratio of the volume of solvent to the mass of the wire segment showed little change in the kinetics of dissolution, which ranged from 0.176 mL/mg down to 0.019 mL/mg. A successful chromatographic separation of 153Gd, a surrogate for 252Cf, from Pd was demonstrated using AG 50x8 cation exchange resin with a bed volume of 0.5 mL and an internal diameter of 0.8 cm.

  13. Cold valleys in the radioactive decay of 248-254Cf isotopes

    Indian Academy of Sciences (India)

    R K Biju; Sabina Sahadevan; K P Santosh; Antony Joseph

    2008-04-01

    Based on the concept of cold valley in cold fission and fusion, we have investigated the cluster decay process in 248-254Cf isotopes. In addition to alpha particle minima, other deep minima occur for S, Ar and Ca clusters. It is found that inclusion of proximity potential does not change the position of minima but minima become deeper. Taking Coulomb and proximity potential as interacting barrier for post-scission region, we computed half-lives and other characteristics for various clusters from these parents. Our study reveals that these parents are stable against light clusters and unstable against heavy clusters. Computed half-lives for alpha decay agree with experimental values within two orders of magnitude. The most probable clusters from these parents are predicted to be 46Ar, 48,50Ca which indicate the role of doubly or near doubly magic clusters in cluster radioactivity. Odd A clusters are found to be favorable for emission from odd A parents. Cluster decay model is extended to symmetric region and it is found that symmetric fission is also probable which stresses the role of doubly or near doubly magic 132Sn nuclei. Geiger-Nuttal plots were studied for various clusters and are found to be linear with varying slopes and intercepts.

  14. Multiwavelength behaviour of the blazar OJ 248 from radio to {\\gamma}-rays

    CERN Document Server

    Carnerero, M I; Villata, M; Acosta-Pulido, J A; D'Ammando, F; Smith, P S; Larionov, V M

    2015-01-01

    We present an analysis of the multiwavelength behaviour of the blazar OJ 248 at z = 0.939 in the period 2006-2013. We use low-energy data (optical, near-infrared, and radio) obtained by 21 observatories participating in the GLAST-AGILE Support Program (GASP) of the Whole Earth Blazar Telescope (WEBT), as well as data from the Swift (optical-UV and X-rays) and Fermi (gamma-rays) satellites, to study flux and spectral variability and correlations among emissions in different bands. We take into account the effect of absorption by the Damped Lyman Alpha intervening system at z = 0.525. Two major outbursts were observed in 2006-2007 and in 2012-2013 at optical and near-IR wavelengths, while in the high-frequency radio light curves prominent radio outbursts are visible peaking at the end of 2010 and beginning of 2013, revealing a complex radio-optical correlation. Cross-correlation analysis suggests a delay of the optical variations after the gamma-ray ones of about a month, which is a peculiar behaviour in blazar...

  15. Decontamination and decommissioning of rooms 62-248 and 62-250 at Ernest Orlando Lawrence Berkeley National Laboratory

    Energy Technology Data Exchange (ETDEWEB)

    Garabedian, G.

    1996-05-01

    This document details the decontamination and decommissioning (D&D) process of Rooms 248 and 250 of Building 62 at the Ernest Orlando Lawrence Berkeley National Laboratory (LBNL). The document describes the D&D efforts for the rooms, their contents, and adjacent areas containing ancillary equipment. The rooms and equipment, before being released, were required to meet the unrestricted release criteria and requirements set forth in DOE orders 5400.5 and 5480.11, LBNL`s internal release-criteria procedure (EH&S Procedure 708), and the LBNL Radiological Control Manual. The radioactive material and items not meeting the release criteria were either sent to the Hazardous Waste Handling Facility (HWHF) for disposal or transferred to other locations approved for radioactive material. The D&D was undertaken by the Radiation Protection Group of LBNL`s Environment, Health and Safety (EH&S) Division at the request of the Materials Sciences Division. Current and past use of radioactive material in both Rooms 248 and 250 necessitated the D&D in order to release both rooms for nonradioactive work. (1) Room 248 was designated a {open_quotes}controlled area.{close_quotes} There was contained radioactive material in some of the equipment. The previous occupants of Room 248 had worked with radioactive materials. (2) Room 250 was designated a {open_quotes}Radioactive Materials Management Area{close_quotes} (RMMA) because the current occupants used potentially dispersible radioisotopes. Both laboratories, during the occupancy of U.C. Berkeley Professor Leo Brewer and Ms. Karen Krushwitz, were kept in excellent condition. There was a detailed inventory of all radioactive materials and chemicals. All work and self surveys were documented. The labs were kept extremely orderly, clean, and in compliance. In October 1993 Ms. Krushwitz received an award in recognition of her efforts in Environmental Protection, Health, and Safety at LBNL.

  16. Formation of copper tin sulfide films by pulsed laser deposition at 248 and 355 nm

    DEFF Research Database (Denmark)

    Ettlinger, Rebecca Bolt; Crovetto, Andrea; Canulescu, Stela; Cazzaniga, Andrea Carlo; Ravnkilde, Lasse; Youngman, Tomas Hugh; Hansen, Ole; Pryds, Nini; Schou, Jørgen

    2016-01-01

    The influence of the laser wavelength on the deposition of copper tin sulfide (CTS) and SnS-rich CTS with a 248-nm KrF excimer laser (pulse length τ = 20 ns) and a 355-nm frequency-tripled Nd:YAG laser (τ = 6 ns) was investigated. A comparative study of the two UV wavelengths shows that the CTS...

  17. X-Ray Emission from Stellar Jets by Collision against High-density Molecular Clouds: an Application to HH 248

    Science.gov (United States)

    López-Santiago, J.; Bonito, R.; Orellana, M.; Miceli, M.; Orlando, S.; Ustamujic, S.; Albacete-Colombo, J. F.; de Castro, E.; Gómez de Castro, A. I.

    2015-06-01

    We investigate the plausibility of detecting X-ray emission from a stellar jet that impacts a dense molecular cloud, a scenario that may be typical for classical T Tauri stars with jets in dense star-forming complexes. We first model the impact of a jet against a dense cloud using two-dimensional axisymmetric hydrodynamic simulations, exploring different configurations of the ambient environment. Then, we compare our results with XMM-Newton observations of the Herbig-Haro object HH 248, where extended X-ray emission aligned with the optical knots is detected at the edge of the nearby IC 434 cloud. Our simulations show that a jet can produce plasma with temperatures up to 107 K, consistent with production of X-ray emission, after impacting a dense cloud. We find that jets denser than the ambient medium but less dense than the cloud produce detectable X-ray emission only at impact with the cloud. From an exploration of the model parameter space, we constrain the physical conditions (jet density and velocity and cloud density) that reproduce the intrinsic luminosity and emission measure of the X-ray source possibly associated with HH 248 well. Thus, we suggest that the extended X-ray source close to HH 248 corresponds to a jet impacting a dense cloud.

  18. Hysteresis in the spectral states of the neutron star low-mass X-ray binary EXO 1745-248

    CERN Document Server

    Mukherjee, Arunava

    2011-01-01

    We study the low-frequency timing properties and the spectral state evolution of the transient neutron star low-mass X-ray binary EXO 1745-248 using the entire Rossi X-ray Timing Explorer Proportional Counter Array data. We tentatively conclude that EXO 1745-248 is an atoll source, and report the discovery of a ~ 0.45 Hz low-frequency quasi-periodic oscillation and ~ 10 Hz peaked noises. If it is an atoll, this source is unusual because (1) instead of a `C'-like curve, it traced a clear overall clockwise hysteresis curve in each of the colour-colour diagram and the hardness-intensity diagram; and (2) the source took at least 2.5 months to trace the softer banana state, as opposed to a few hours to a day, which is typical for an atoll source. The shape of the hysteresis track was intermediate between the characteristic `q'-like curves of several black hole systems and `C'-like curves of atolls, implying that EXO 1745-248 is an important source for the unification of the black hole and neutron star accretion pr...

  19. Production of Hs-isotopes (Z=108) in the reaction 26Mg+248Cm

    International Nuclear Information System (INIS)

    Chemical studies of superheavy elements (SHE) are most convincing if, after chemical isolation, a nuclide is unambiguously identified by its nuclear decay properties. Thus chemists contribute not only new data on chemical properties of SHE but also nuclear structure information. Since chemists usually work with neutron-rich, longer-lived isotopes of SHE which are accessible only in asymmetric reactions with actinide targets and thus hard to access with recoil separators, this contribution is especially valuable. We have used the so-called In-situ Volatilization and On-line detection (IVO) technique to study the excitation function of the reaction 248Cm(26Mg,xn)274-xHs (x-5) thereby measuring the decay properties of the new nuclide 270Hs and its daughter 266Sg. It appears as if in earlier experiments our tentative assignment of two decay chains to 270Hs was not correct. This assignment was based on the decay properties of 266Sg reported by Lazarev et al., where the discovery of265Sg and 266Sg was described. Our new data indicates now, that due to an isomeric state in 261Rf which decays mostly by spontaneous fission, two decay chains tentatively assigned earlier to 270Hs and 266Sg are actually due to 269Hs and 265Sg. In addition, we observed several decay chains which were tentatively assigned to 271Hs and its decay daughters. The measured cross sections are of the order of few picobarns. Prospects to apply the IVO technique to other nuclides of SHE will be discussed. In addition, an overview about the status of the gas-filled separator TASCA (TransActinide Separator and Chemistry Apparatus) which is currently under construction at Gesellschaft fuer Schwerionenforschung (GSI) will be presented

  20. Multiwavelength behaviour of the blazar OJ 248 from radio to γ-rays

    Science.gov (United States)

    Carnerero, M. I.; Raiteri, C. M.; Villata, M.; Acosta-Pulido, J. A.; D'Ammando, F.; Smith, P. S.; Larionov, V. M.; Agudo, I.; Arévalo, M. J.; Arkharov, A. A.; Bach, U.; Bachev, R.; Benítez, E.; Blinov, D. A.; Bozhilov, V.; Buemi, C. S.; Bueno Bueno, A.; Carosati, D.; Casadio, C.; Chen, W. P.; Damljanovic, G.; Paola, A. Di; Efimova, N. V.; Ehgamberdiev, Sh. A.; Giroletti, M.; Gómez, J. L.; González-Morales, P. A.; Grinon-Marin, A. B.; Grishina, T. S.; Gurwell, M. A.; Hiriart, D.; Hsiao, H. Y.; Ibryamov, S.; Jorstad, S. G.; Joshi, M.; Kopatskaya, E. N.; Kurtanidze, O. M.; Kurtanidze, S. O.; Lähteenmäki, A.; Larionova, E. G.; Larionova, L. V.; Lázaro, C.; Leto, P.; Lin, C. S.; Lin, H. C.; Manilla-Robles, A. I.; Marscher, A. P.; McHardy, I. M.; Metodieva, Y.; Mirzaqulov, D. O.; Mokrushina, A. A.; Molina, S. N.; Morozova, D. A.; Nikolashvili, M. G.; Orienti, M.; Ovcharov, E.; Panwar, N.; Pastor Yabar, A.; Puerto Giménez, I.; Ramakrishnan, V.; Richter, G. M.; Rossini, M.; Sigua, L. A.; Strigachev, A.; Taylor, B.; Tornikoski, M.; Trigilio, C.; Troitskaya, Yu. V.; Troitsky, I. S.; Umana, G.; Valcheva, A.; Velasco, S.; Vince, O.; Wehrle, A. E.; Wiesemeyer, H.

    2015-07-01

    We present an analysis of the multiwavelength behaviour of the blazar OJ 248 at z = 0.939 in the period 2006-2013. We use low-energy data (optical, near-infrared, and radio) obtained by 21 observatories participating in the Gamma-Ray Large Area Space Telescope (GLAST)-AGILE Support Program of the Whole Earth Blazar Telescope, as well as data from the Swift (optical-UV and X-rays) and Fermi (γ-rays) satellites, to study flux and spectral variability and correlations among emissions in different bands. We take into account the effect of absorption by the Damped Lyman α intervening system at z = 0.525. Two major outbursts were observed in 2006-2007 and in 2012-2013 at optical and near-IR wavelengths, while in the high-frequency radio light curves prominent radio outbursts are visible peaking at the end of 2010 and beginning of 2013, revealing a complex radio-optical correlation. Cross-correlation analysis suggests a delay of the optical variations after the γ-ray ones of about a month, which is a peculiar behaviour in blazars. We also analyse optical polarimetric and spectroscopic data. The average polarization percentage P is less than 3 per cent, but it reaches ˜19 per cent during the early stage of the 2012-2013 outburst. A vague correlation of P with brightness is observed. There is no preferred electric vector polarization angle and during the outburst the linear polarization vector shows wide rotations in both directions, suggesting a complex behaviour/structure of the jet and possible turbulence. The analysis of 140 optical spectra acquired at the Steward Observatory reveals a strong Mg II broad emission line with an essentially stable flux of 6.2 × 10- 15 erg cm- 2 s- 1 and a full width at half-maximum of 2053 km s- 1.

  1. Design of a homogeneous subcritical nuclear reactor based on thorium with a source of californium 252; Diseno de un reactor nuclear subcritico homogeneo a base de Torio con una fuente de Californio 252

    Energy Technology Data Exchange (ETDEWEB)

    Delgado H, C. E.; Vega C, H. R. [Universidad Autonoma de Zacatecas, Unidad Academica de Estudios Nucleares, Cipres No. 10, Fracc. La Penuela, 98068 Zacatecas, Zac. (Mexico); Sajo B, L., E-mail: ce_delgado89@hotmail.com [Universidad Simon Bolivar, Laboratorio de Fisica Nuclear, Apdo. 89000, 1080A Caracas (Venezuela, Bolivarian Republic of)

    2015-10-15

    Full text: One of the energy alternatives to fossil fuels which do not produce greenhouse gases is the nuclear energy. One of the drawbacks of this alternative is the generation of radioactive wastes of long half-life and its relation to the generation of nuclear materials to produce weapons of mass destruction. An option to these drawbacks of nuclear energy is to use Thorium as part of the nuclear fuel which it becomes in U{sup 233} when capturing neutrons, that is a fissile material. In this paper Monte Carlo methods were used to design a homogeneous subcritical reactor based on thorium. As neutron reflector graphite was used. The reactor core is homogeneous and is formed of 70% light water as moderator, 12% of enriched uranium UO{sub 2}(NO{sub 3}){sub 4} and 18% of thorium Th(NO{sub 3}){sub 4} as fuel. To start the nuclear fission chain reaction an isotopic source of californium 252 was used with an intensity of 4.6 x 10{sup 7} s{sup -1}. In the design the value of the effective multiplication factor, whose value turned out k{sub eff} <1 was calculated. Also, the neutron spectra at different distances from the source and the total fluence were calculated, as well as the values of the ambient dose equivalent in the periphery of the reactor. (Author)

  2. Manganese determination om minerals by activation analysis, using the californium-252 as a neutron source; Determinacao de manganes em minerios, por analise por ativacao, usando californio-252 como fonte de neutrons

    Energy Technology Data Exchange (ETDEWEB)

    Cardoso, Antonio

    1976-07-01

    Neutron Activation Analysis, using a Californium-252 neutron source, has been applied for the determination of manganese in ores such as pyrolusite, rodonite (manganese silicate)' and blending used in dry-batteries The favorable nuclear properties of manganese, such as high thermal neutron cross-section for the reaction {sup 55}Mn (n.gamma){sup 56} Mn, high concentration of manganese in the matrix and short half - life of {sup 56}Mn, are an ideal combination for non-destructive analysis of manganese in ores. Samples and standards of manganese dioxide were irradiated for about 20 minutes, followed by a 4 to 15 minutes decay and counted in a single channel pulse-height discrimination using a NaI(Tl) scintillation detector. Counting time was equal to 10 minutes. The interference of nuclear reactions {sup 56}Fe(n,p){sup 56}Mn and {sup 59} Co (n, {alpha}){sup 56} were studied, as well as problems in connection with neutron shadowing during irradiation, gamma-rays attenuation during counting and influence of granulometry of samples. One sample,was also analysed by wet-chemical method (sodium bismuthate) in order to compare results. As a whole, i t was shown that the analytical method of neutron activation for manganese in ores and blending, is a method simple, rapid and with good precision and accuracy. (author)

  3. A Compact Group of Galaxies at z = 2.48 Hosting an AGN-driven Outflow

    Science.gov (United States)

    Shih, Hsin-Yi; Stockton, Alan

    2015-12-01

    We present observations of a remarkable compact group of galaxies at z = 2.48. Four galaxies, all within 40 kpc of each other, surround a powerful high-redshift radio source. This group comprises two compact red passive galaxies and a pair of merging galaxies. One of the red galaxies, with an apparent stellar mass of 3.6 × 1011M⊙ and an effective radius of 470 pc, is one of the most extreme examples of a massive quiescent compact galaxy found so far. One of the pair of merging galaxies hosts the active galactic nucleus (AGN) producing the large powerful radio structure. The merger is massive and enriched, consistent with the mass-metallicity relation expected at this redshift. Close to the merging nuclei, the emission lines exhibit broad and asymmetric profiles that suggest outflows powered either by a very young expanding radio jet or by AGN radiation. At ≳50 kpc from the system, we found a fainter extended-emission region that may be a part of a radio-jet-driven outflow. Some of the data presented herein were obtained at the W. M. Keck Observatory, which is operated as a scientific partnership among the California Institute of Technology, the University of California, and the National Aeronautics and Space Administration. The Observatory was made possible by the generous financial support of the W. M. Keck Foundation. The work is also based, in part, on data collected at the Subaru Telescope, which is operated by the National Astronomical Observatory of Japan, and on observations obtained at the Gemini Observatory, which is operated by the Association of Universities for Research in Astronomy, Inc., under a cooperative agreement with the NSF on behalf of the Gemini partnership: the National Science Foundation (United States), the National Research Council (Canada), CONICYT (Chile), the Australian Research Council (Australia), Ministério da Ciência, Tecnologia e Inovação (Brazil), and Ministerio de Ciencia, Tecnología e Innovación Productiva (Argentina).

  4. Search for surviving actinides and superheavy nuclei in damped collisions of 238U with 238U and 248Cm

    International Nuclear Information System (INIS)

    In the present talk aspects of the reaction mechanism related to the survival probability of the heaviest fragments in 238U + 238U collisions are discussed first. This is followed by a description of the experiments that have been performed to search for surviving superheavy fragments in the 238U + 238U reaction and by a presentation of the results obtained so far. In a third section our recent first attempts with the 238U + 248Cm reaction are described and preliminary results are discussed. (orig.)

  5. Influence of nuclear dissipation on fission dynamics of the excited nucleus $^{248}$Cf within a stochastic approach

    Indian Academy of Sciences (India)

    ESLAMIZADEH HADI

    2016-07-01

    A stochastic approach to fission dynamics based on two-dimensional Langevin equations was applied to calculate the anisotropy of the fission fragments angular distribution and average pre-scission neutron multiplicities for the compound nucleus 248Cf formed in the $${16}$O+$^{232}$Th reactions. Postsaddle nuclear dissipation strength of $(12–14) \\times 10^{21} s^{−1}$ was extracted for Cf nucleus by fitting the results of calculations with the experimentaldata. Furthermore, it was found that the results of calculations for the anisotropy of the fission fragments angular distribution and pre-scission neutron multiplicities are very sensitive to the magnitude of post-saddle nucleardissipation.

  6. Disc-Jet Coupling in the Terzan 5 Neutron Star X-ray Binary EXO 1745$-$248

    CERN Document Server

    Tetarenko, A J; Sivakoff, G R; Tremou, E; Linares, M; Tudor, V; Miller-Jones, J C A; Heinke, C O; Chomiuk, L; Strader, J; Altamirano, D; Degenaar, N; Maccarone, T; Patruno, A; Sanna, A; Wijnands, R

    2016-01-01

    We present the results of VLA, ATCA, and Swift XRT observations of the 2015 outburst of the transient neutron star X-ray binary (NSXB), EXO 1745$-$248, located in the globular cluster Terzan 5. Combining (near-) simultaneous radio and X-ray measurements we measure a correlation between the radio and X-ray luminosities of $L_R\\propto L_X^\\beta$ with $\\beta=1.68^{+0.10}_{-0.09}$, linking the accretion flow (probed by X-ray luminosity) and the compact jet (probed by radio luminosity). While such a relationship has been studied in multiple black hole X-ray binaries (BHXBs), this work marks only the third NSXB with such a measurement. Constraints on this relationship in NSXBs are strongly needed, as comparing this correlation between different classes of XB systems is key in understanding the properties that affect the jet production process in accreting objects. Our best fit disc-jet coupling index for EXO 1745$-$248 is consistent with the measured correlation in NSXB 4U 1728$-$34 ($\\beta=1.5\\pm 0.2$) but inconsi...

  7. Rapid fabrication of rigid biodegradable scaffolds by excimer laser mask projection technique: a comparison between 248 and 308 nm

    Science.gov (United States)

    Beke, S.; Anjum, F.; Ceseracciu, L.; Romano, I.; Athanassiou, A.; Diaspro, A.; Brandi, F.

    2013-03-01

    High-resolution photocrosslinking of the biodegradable poly(propylene fumarate) (PPF) and diethyl fumarate (DEF), using pulsed laser light at 248 and 308 nm is presented. The curing depth can be modulated between a few hundreds of nm and a few μm when using 248 nm and ten to a hundred μm when using 308 nm. By adjusting the total fluence (pulse numbers×laser fluence) dose and the weight ratios of PPF, DEF, and the photoinitiator in the photocrosslinkable mixtures, the height of polymerized structures can be precisely tuned. The lateral resolution is evaluated by projecting a pattern of a grid with a specified line width and line spacing. Young’s modulus of the cured parts is measured and found to be several GPa for both wavelengths, high enough to support bone formation. Several 2D and 2.5D microstructures, as well as porous 3D scaffolds fabricated by a layer-by-layer method, are presented. The results demonstrate that excimer laser-based photocuring is suitable for the fabrication of stiff and biocompatible structures with defined patterns of micrometer resolution in all three spatial dimensions.

  8. 节能BCD-248/H、BCD-218/H电冰箱的研究开发%Research and development the super energy- saving fridge BCD-218/H and BCD-248/H

    Institute of Scientific and Technical Information of China (English)

    赵先美

    2002-01-01

    运用项目管理方法及ERA电冰箱分析设计软件来科学决策BCD-248/H、BCD-218/H超级节能冰箱的开发设计方案,对采用压缩机、发泡层厚度、门封结构、门一体发泡、电子温控及数显、采用二位三通电磁阀及制冷系统最优化设计等进行了详细的经济技术分析,根据成本与性能综合最优化原则确定了上述两种冰箱的开发设计方案,据此开发出的样机总体能效水平处于国内领先水平.

  9. Production of new superheavy Z=108-114 nuclei with $^{238}$U, $^{244}$Pu and $^{248,250}$Cm targets

    CERN Document Server

    Feng, Zhao-Qing; Li, Jun-Qing

    2009-01-01

    Within the framework of the dinuclear system (DNS) model, production cross sections of new superheavy nuclei with charged numbers Z=108-114 are analyzed systematically. Possible combinations based on the actinide nuclides $^{238}$U, $^{244}$Pu and $^{248,250}$Cm with the optimal excitation energies and evaporation channels are pointed out to synthesize new isotopes which lie between the nuclides produced in the cold fusion and the $^{48}$Ca induced fusion reactions experimentally, which are feasible to be constructed experimentally. It is found that the production cross sections of superheavy nuclei decrease drastically with the charged numbers of compound nuclei. Larger mass asymmetries of the entrance channels enhance the cross sections in 2n-5n channels.

  10. Yrast spectroscopy of N=82,83 isotopes 136Xe and 137Xe from 248Cm fission

    International Nuclear Information System (INIS)

    Prompt γ-ray cascades in neutron-rich nuclei around doubly magic 132Sn have been studied at Eurogam II using a 248Cm fission source. Here we report results for the four-valence-proton N=82 nucleus 136Xe and for its N=83 neighbor 137Xe. For both nuclei, the yrast level spectra have been considerably extended, and empirical nucleon-nucleon interactions have been used to assign probable shell model configurations. The 136Xe level energies are compared with those calculated using different sets of proton-proton interaction matrix elements, both diagonal and nondiagonal, obtained by fitting experimental data for other N=82 isotones. copyright 1999 The American Physical Society

  11. First observation of new heavy multi-nucleon transfer products in the 48Ca+248Cm reaction performed at SHIP

    International Nuclear Information System (INIS)

    Heavy ion fusion reactions have been successfully used to synthesise super heavy elements (SHE). The heaviest element produced up to now is element Z=118 and the production cross-section limit using conventional HI-fusion has been reached experimentally. Since these methods cannot be applied to reach neutron-rich super heavy nuclei due to the lack of sufficiently neutron-rich projectile and target nuclei. New calculations suggest the use of Multi Nucleon Transfer (MNT) reactions as a promising pathway to the synthesis of new neutron-rich SHE with proton numbers up to about Z=106. In this work, we present results from the analysis of experimental data on MNT reactions with the 48Ca projectile incident on 248Cm target. The experiment was performed at SHIP, GSI in 2010

  12. Experimental Cross Sections for Reactions of Heavy Ions and 208Pb, 209Bi, 238U, and 248Cm Targets

    International Nuclear Information System (INIS)

    The study of the reactions between heavy ions and 208Pb, 209Bi, 238U, and 248 Cm targets was performed to look at the differences between the cross sections of hot and cold fusion reactions. Experimental cross sections were compared with predictions from statistical computer codes to evaluate the effectiveness of the computer code in predicting production cross sections. Hot fusion reactions were studied with the MG system, catcher foil techniques and the Berkeley Gas-filled Separator (BGS). 3n- and 4n-exit channel production cross sections were obtained for the 238U(18O,xn)256-xFm, 238U(22Ne,xn)260-xNo, and 248Cm(15N,xn)263-xLr reactions and are similar to previous experimental results. The experimental cross sections were accurately modeled by the predictions of the HIVAP code using the Reisdorf and Schaedel parameters and are consistent with the existing systematics of 4n exit channel reaction products. Cold fusion reactions were examined using the BGS. The 208Pb(48Ca,xn)256-xNo, 208Pb(50Ti,xn)258-xRf, 208Pb(51V,xn)259-xDb, 209Bi(50Ti,xn)259-xDb, and 209Bi(51V,xn)260-xSg reactions were studied. The experimental production cross sections are in agreement with the results observed in previous experiments. It was necessary to slightly alter the Reisdorf and Schaedel parameters for use in the HIVAP code in order to more accurately model the experimental data. The cold fusion experimental results are in agreement with current 1n- and 2n-exit channel systematics

  13. TP53 gene polymorphisms at codons 11, 72, and 248 and association with endometriosis in a Brazilian population.

    Science.gov (United States)

    Camargo-Kosugi, C M; D'Amora, P; Kleine, J P F O; Carvalho, C V; Sato, H; Schor, E; Silva, I D C G

    2014-01-01

    We evaluated the association between TP53 gene polymorphisms and endometriosis in Brazilian women. Genomic DNA was extracted from swabs of buccal cells collected from hospital patients. TP53 gene polymorphisms were investigated at three codons: TP53 11 Glu/Gln or Lys (GAG->CAG or AAG), TP53 72 Arg/Pro (CCG->CCC), and TP53 248 Arg/Thr (CGG->TCG) using the polymerase chain reaction-restriction fragment length polymorphism method. TP53 11 presented the following genotypic distribution: the control group was 98.28% homozygous wild-type (Glu) and 1.72% homozygous variant (Gln/Lys), and the heterozygous genotype was not identified. The genotypic distribution in the endometriosis group was 96% homozygous wild-type (Glu) and 4% heterozygous (Glu-Gln/Lys); the homozygous variant genotype was not identified (P = 0.02). TP53 72 showed the following genotypic distribution: the control group was 29.75% homozygous wild-type (Arg), 47.11% heterozygous (Arg-Pro), and 23.14% homozygous variant (Pro). The genotypic distribution in the endometriosis group was 16.15% homozygous wild-type (Arg), 51.54% heterozygous (Arg-Pro), and 32.31% homozygous variant (Pro) (odds ratio = 2.26; 95% confidence interval = 1.19-4.03; P = 0.02). Only one patient had the homozygous TP53 248 genotype (Arg-Trp/Gln); all other patients were homozygous wild-type in both the control and endometriosis groups (P = 0.51; NS). We found that TP53 72 polymorphism may be associated with susceptibility to endometriosis; the presence of at least 1 polymorphic allele increased the chance of disease development by 2.26-fold. Hence, this genetic variant is a potential candidate marker for endometriosis. PMID:25177931

  14. Experimental Cross Sections for Reactions of Heavy Ions and 208Pb, 209Bi, 238U, and 248Cm Targets

    Energy Technology Data Exchange (ETDEWEB)

    Patin, Joshua B.

    2002-05-24

    The study of the reactions between heavy ions and {sup 208}Pb, {sup 209}Bi, {sup 238}U, and {sup 248} Cm targets was performed to look at the differences between the cross sections of hot and cold fusion reactions. Experimental cross sections were compared with predictions from statistical computer codes to evaluate the effectiveness of the computer code in predicting production cross sections. Hot fusion reactions were studied with the MG system, catcher foil techniques and the Berkeley Gas-filled Separator (BGS). 3n- and 4n-exit channel production cross sections were obtained for the {sup 238}U({sup 18}O,xn){sup 256-x}Fm, {sup 238}U({sup 22}Ne,xn){sup 260-x}No, and {sup 248}Cm({sup 15}N,xn){sup 263-x}Lr reactions and are similar to previous experimental results. The experimental cross sections were accurately modeled by the predictions of the HIVAP code using the Reisdorf and Schaedel parameters and are consistent with the existing systematics of 4n exit channel reaction products. Cold fusion reactions were examined using the BGS. The {sup 208}Pb({sup 48}Ca,xn){sup 256-x}No, {sup 208}Pb({sup 50}Ti,xn){sup 258-x}Rf, {sup 208}Pb({sup 51}V,xn){sup 259-x}Db, {sup 209}Bi({sup 50}Ti,xn){sup 259-x}Db, and {sup 209}Bi({sup 51}V,xn){sup 260-x}Sg reactions were studied. The experimental production cross sections are in agreement with the results observed in previous experiments. It was necessary to slightly alter the Reisdorf and Schaedel parameters for use in the HIVAP code in order to more accurately model the experimental data. The cold fusion experimental results are in agreement with current 1n- and 2n-exit channel systematics.

  15. Sub-micron period grating structures in Ta2O5 and InOx thin oxide films fabricated using 248nm interferometric excimer laser ablation

    OpenAIRE

    Pissadakis, S.; Reekie, L.; J. S. Wilkinson; Kiriakidis, G.

    2000-01-01

    High quality relief gratings of period 500nm have been patterned in InOx and Ta2O5 thin films using interferometric 248nm excimer laser ablation. Details of the ablation process and the morphology of the gratings are presented.

  16. Bacterial curli protein promotes the conversion of PAP248-286 into the amyloid SEVI: cross-seeding of dissimilar amyloid sequences

    Directory of Open Access Journals (Sweden)

    Kevin Hartman

    2013-02-01

    Full Text Available Fragments of prostatic acid phosphatase (PAP248-286 in human semen dramatically increase HIV infection efficiency by increasing virus adhesion to target cells. PAP248-286 only enhances HIV infection in the form of amyloid aggregates termed SEVI (Semen Enhancer of Viral Infection, however monomeric PAP248-286 aggregates very slowly in isolation. It has therefore been suggested that SEVI fiber formation in vivo may be promoted by exogenous factors. We show here that a bacterially-produced extracellular amyloid (curli or Csg acts as a catalytic agent for SEVI formation from PAP248-286 at low concentrations in vitro, producing fibers that retain the ability to enhance HIV (Human Immunodeficiency Virus infection. Kinetic analysis of the cross-seeding effect shows an unusual pattern. Cross-seeding PAP248-286 with curli only moderately affects the nucleation rate while significantly enhancing the growth of fibers from existing nuclei. This pattern is in contrast to most previous observations of cross-seeding, which show cross-seeding partially bypasses the nucleation step but has little effect on fiber elongation. Seeding other amyloidogenic proteins (IAPP (islet amyloid polypeptide and Aβ1−40 with curli showed varied results. Curli cross-seeding decreased the lag-time of IAPP amyloid formation but strongly inhibited IAPP elongation. Curli cross-seeding exerted a complicated concentration dependent effect on Aβ1−40 fibrillogenesis kinetics. Combined, these results suggest that the interaction of amyloidogenic proteins with preformed fibers of a different type can take a variety of forms and is not limited to epitaxial nucleation between proteins of similar sequence. The ability of curli fibers to interact with proteins of dissimilar sequences suggests cross-seeding may be a more general phenomenon than previously supposed.

  17. X-ray emission from stellar jets by collision against high-density molecular clouds: an application to HH 248

    CERN Document Server

    Lopez-Santiago, Javier; Orellana, Mariana; Miceli, Marco; Orlando, Salvatore; Ustamujic, Sabina; Albacete-Colombo, Juan Facundo; de Castro, Elisa; de Castro, Ana Ines Gomez

    2015-01-01

    We investigate the plausibility of detecting X-ray emission from a stellar jet that impacts against a dense molecular cloud. This scenario may be usual for classical T Tauri stars with jets in dense star-forming complexes. We first model the impact of a jet against a dense cloud by 2D axisymmetric hydrodynamic simulations, exploring different configurations of the ambient environment. Then, we compare our results with XMM-Newton observations of the Herbig-Haro object HH 248, where extended X-ray emission aligned with the optical knots is detected at the edge of the nearby IC 434 cloud. Our simulations show that a jet can produce plasma with temperatures up to 10 MK, consistent with production of X-ray emission, after impacting a dense cloud. We find that jets denser than the ambient medium but less dense than the cloud produce detectable X-ray emission only at the impact onto the cloud. From the exploration of the model parameter space, we constrain the physical conditions (jet density and velocity, cloud den...

  18. Plume diagnostics and room-temperature deposition of carbon nanotubes and nano-onions at 248 nm

    International Nuclear Information System (INIS)

    We report on the deposition of carbon nanotubes and nano-onions at room temperature using excimer laser radiation at 248 nm to ablate mixed graphite-nickel/cobalt targets in the presence of O2 gas. The carbon nanotubes are frequently seen to connect individual onions and have a wall thickness on the order of 20-25 nm, with an overall external tube diameter of 100-200 nm. These tubes have notably large channel diameters and are significantly larger than typically reported single and multi-walled carbon nanotubes. The observed onion structures are both single and clustered and are 100-200 nm in diameter. Ablation of the same targets in comparable pressures of Ar does not result in these nanostructures but instead produces amorphous carbon. Ablating a pure graphite target under the same laser conditions, with or without metal, also does not yield the tubes and onions. In-situ time-resolved emission spectroscopy has been used to follow the emission from molecular carbon such as C2, as well as metals such as Ni or Co in the different ambients

  19. Surfactant Protein B Deficiency Caused by Homozygous C248X Mutation—A Case Report and Review of the Literature

    Directory of Open Access Journals (Sweden)

    Stefan Kurath-Koller

    2015-04-01

    Full Text Available Objective - Surfactant protein B (SP-B deficiency is a rare autosomal recessive disorder that is usually rapidly fatal. The c.397delCinsGAA mutation (121ins2 in exon 4 is found in more than two-thirds of patients. Design - We report on a fatal case of SP-B deficiency caused by a homozygous C248X mutation in exon 7 of the SP-B gene. In addition, we provide an update of the current literature. The EMBASE, MEDLINE, and CINAHL databases were systematically searched to identify all papers published in the English and German literature on SP-B deficiency between 1989 and 2013. Results - SP-B deficiency is characterized by progressive hypoxemic respiratory failure generally in full-term infants. They present with symptoms of respiratory distress and hypoxemia; chest X-ray resembles hyaline membrane disease. Prenatal diagnosis is possible from amniotic fluid or chorionic villi sampling. Conclusion - Thirty-four mutations have been published in the literature. Treatment options are scarce. Gene therapy is hoped to be an option in the future.

  20. Cervical foraminal steroid injections under CT guidance: retrospective study of in situ contrast aspects in a serial of 248 cases

    International Nuclear Information System (INIS)

    To describe all the CT findings after in situ contrast injection just before steroid injection and to recognize the abnormal aspects associated with intravascular contamination. We retrospectively evaluated 248 cervical transforaminal steroid injections done at the university hospital in Dijon, France, in 2008-2012, to treat cervicobrachial neuralgia inadequately improved by optimal medical treatment for at least 3 weeks. Features describing the opacification patterns were recorded. Five main nonvascular opacification patterns were identified: clumps of contrast agent outside the foramen (16 %), a crab claw pattern surrounding the ganglion (13 %), a ''French'' circumflex accent pattern (15 %), reflux along the needle (7 %), and facet joint capsule opacification (22 %). Concerning the situations requiring a change in needle position, intravenous injection occurred in 26 % of the patients, with a crab claw pattern in half the cases and a clump pattern in half the cases. Intraarteriolar injection was noted in two patients. CT after in situ contrast injection ensures proper needle positioning outside the blood vessels before steroid injection. Penetration of the needle tip into a vein is very common, whereas arteriolar puncture is extremely rare. (orig.)

  1. Cervical foraminal steroid injections under CT guidance: retrospective study of in situ contrast aspects in a serial of 248 cases

    Energy Technology Data Exchange (ETDEWEB)

    Pottecher, Pierre; Krause, Denis; Di Marco, Lucy; Loffroy, Romaric; Estivalet, Louis [CHU Dijon Bocage Central, Departement de Radiologie et Imagerie Diagnostique et Interventionnelle, Dijon (France); Duhal, Romain; Demondion, Xavier [CHRU de Lille, Service de Radiologie Musculosquelettique, CCIAL, Laboratoire d' Anatomie, Faculte de Medecine de Lille, Hopital Roger Salengro, Lille (France)

    2015-01-15

    To describe all the CT findings after in situ contrast injection just before steroid injection and to recognize the abnormal aspects associated with intravascular contamination. We retrospectively evaluated 248 cervical transforaminal steroid injections done at the university hospital in Dijon, France, in 2008-2012, to treat cervicobrachial neuralgia inadequately improved by optimal medical treatment for at least 3 weeks. Features describing the opacification patterns were recorded. Five main nonvascular opacification patterns were identified: clumps of contrast agent outside the foramen (16 %), a crab claw pattern surrounding the ganglion (13 %), a ''French'' circumflex accent pattern (15 %), reflux along the needle (7 %), and facet joint capsule opacification (22 %). Concerning the situations requiring a change in needle position, intravenous injection occurred in 26 % of the patients, with a crab claw pattern in half the cases and a clump pattern in half the cases. Intraarteriolar injection was noted in two patients. CT after in situ contrast injection ensures proper needle positioning outside the blood vessels before steroid injection. Penetration of the needle tip into a vein is very common, whereas arteriolar puncture is extremely rare. (orig.)

  2. Molecular genetics and functional anomalies in a series of 248 Brugada cases with 11 mutations in the TRPM4 channel.

    Directory of Open Access Journals (Sweden)

    Hui Liu

    Full Text Available Brugada syndrome (BrS is a condition defined by ST-segment alteration in right precordial leads and a risk of sudden death. Because BrS is often associated with right bundle branch block and the TRPM4 gene is involved in conduction blocks, we screened TRPM4 for anomalies in BrS cases. The DNA of 248 BrS cases with no SCN5A mutations were screened for TRPM4 mutations. Among this cohort, 20 patients had 11 TRPM4 mutations. Two mutations were previously associated with cardiac conduction blocks and 9 were new mutations (5 absent from ~14'000 control alleles and 4 statistically more prevalent in this BrS cohort than in control alleles. In addition to Brugada, three patients had a bifascicular block and 2 had a complete right bundle branch block. Functional and biochemical studies of 4 selected mutants revealed that these mutations resulted in either a decreased expression (p.Pro779Arg and p.Lys914X or an increased expression (p.Thr873Ile and p.Leu1075Pro of TRPM4 channel. TRPM4 mutations account for about 6% of BrS. Consequences of these mutations are diverse on channel electrophysiological and cellular expression. Because of its effect on the resting membrane potential, reduction or increase of TRPM4 channel function may both reduce the availability of sodium channel and thus lead to BrS.

  3. Analysis of damage threshold of K9 glass irradiated by 248-nm KrF excimer laser

    Science.gov (United States)

    Wang, Xi; Shao, Jingzhen; Li, Hua; Nie, Jinsong; Fang, Xiaodong

    2016-02-01

    The theoretical model of K9 glass irradiated by a 248-nm KrF excimer laser was established, and a numerical simulation was performed to calculate temperature and thermal stress fields in the K9 glass sample using the finite element method. The laser-induced damage thresholds were defined and calculated, and the effect of repetition frequency and the number of pulses on the damage threshold were also studied. Furthermore, the experiment research was carried out to confirm the numerical simulation. The damage threshold and damage morphology were analyzed by means of a metallurgical microscope and scanning electron microscopy. The simulation and experimental results indicated that the damage mechanism of K9 glass irradiated by a KrF excimer laser was melting damage and stress damage, and the stress damage first appeared inside the K9 glass sample. The tensile stress damage threshold, the compressive stress damage threshold, and the melting damage threshold were 0.64, 0.76, and 1.05 J/cm2, respectively. The damage threshold decreased with increasing repetition frequency and number of laser pulses. The experimental results indicated that the damage threshold of K9 glass was 2.8 J/cm2.

  4. GMRT and VLA Observations at 49 cm and 20 cm of the HII Region near = 24.8°, = 0.1°

    Indian Academy of Sciences (India)

    N. G. Kantharia; W. M. Goss; D. Anish Roshi; Niruj R. Mohan; Francois Viallefond

    2007-03-01

    We report multi-frequency radio continuum and hydrogen radio recombination line observations of HII regions near = 24.8°, = 0.1° using the Giant Metrewave Radio Telescope(GMRT) at 1.28 GHz ( = 172), 0.61 GHz ( = 220) and the Very Large Array (VLA) at 1.42 GHz ( = 166). The region consists of a large number of resolved HII regions and a few compact HII regions as seen in our continuum maps, many of which have associated infrared (IR) point sources. The largest HII region at = 24.8° and = 0.1° is a few arcmins in size and has a shell-type morphology. It is a massive HII region enclosing ∼ 550 M⊙ with a linear size of 7 pc and an rms electron density of ∼ 110 cm-3 at a kinematic distance of 6 kpc. The required ionization can be provided by a single star of spectral type O5.5. We also report detection of hydrogen recombination lines from the HII region at = 24.8° and = 0.1° at all observed frequencies near = 100 km s-1. We model the observed integrated line flux density as arising in the diffuse HII region and find that the best fitting model has an electron density comparable to that derived from the continuum.We also report detection of hydrogen recombination lines from two other HII regions in the field.

  5. Measurement of intensity-dependent rates of above-threshold ionization (ATI) of atomic hydrogen at 248 nm

    International Nuclear Information System (INIS)

    Measured rates of multiphoton ionization (MPI) from the ground state of atomic hydrogen by a linearly polarized, subpicosecond KrF laser pulse at 248 nm wavelength are compared to predictions of lowest-order perturbation theory, Floquet theory, and Keldysh-Faisal-Reiss (KFR) theory with and without Coulomb correction for peak irradiance of 3 x 1012W/cm2 to 2 x 1014W/cm2. The Coulomb-corrected Keldysh model falls closest to the measured rates, the others being much higher or much lower. At 5 x 1013W/cm2, the number of ATI electrons decreased by a factor of approximately 40 with each additional photon absorbed. ATI of the molecular hydrogen background and of atoms from photodissociation of the molecules were also observed. The experiment employed a crossed-beam technique at ultrahigh vacuum with an rf-discharge atomic hydrogen source and a magnetic-bottle type electron time-of-flight spectrometer to count the electrons in the different ATI channels separately. The apparatus was calibrated to allow comparison of absolute as well as relative ionization rates to the theoretical predictions. This calibration involved measuring the distribution of irradiance in a focal volume that moved randomly and changed its size from time to time. A data collection system under computer control divided the time-of-flight spectra into bins according to the energy of each laser pulse. This is the first measurement of absolute rates of ATI in atomic hydrogen, and the first measurement of absolute test of MPI in atomic hydrogen without a large factor to account for multiple modes in the laser field. As such, the results of this work are important to the development of ATI theories, which presently differ by orders of magnitude in their prediction of the ionization rates. They are also important to recent calculations of temperatures in laser-heated plasmas, many of which incorporate KFR theory

  6. Measurement of intensity-dependent rates of above-threshold ionization (ATI) of atomic hydrogen at 248 nm

    Energy Technology Data Exchange (ETDEWEB)

    Nichols, T.D.

    1991-04-01

    Measured rates of multiphoton ionization (MPI) from the ground state of atomic hydrogen by a linearly polarized, subpicosecond KrF laser pulse at 248 nm wavelength are compared to predictions of lowest-order perturbation theory, Floquet theory, and Keldysh-Faisal-Reiss (KFR) theory with and without Coulomb correction for peak irradiance of 3 {times} 10{sup 12}W/cm{sup 2} to 2 {times} 10{sup 14}W/cm{sup 2}. The Coulomb-corrected Keldysh model falls closest to the measured rates, the others being much higher or much lower. At 5 {times} 10{sup 13}W/cm{sup 2}, the number of ATI electrons decreased by a factor of approximately 40 with each additional photon absorbed. ATI of the molecular hydrogen background and of atoms from photodissociation of the molecules were also observed. The experiment employed a crossed-beam technique at ultrahigh vacuum with an rf-discharge atomic hydrogen source and a magnetic-bottle type electron time-of-flight spectrometer to count the electrons in the different ATI channels separately. The apparatus was calibrated to allow comparison of absolute as well as relative ionization rates to the theoretical predictions. This calibration involved measuring the distribution of irradiance in a focal volume that moved randomly and changed its size from time to time. A data collection system under computer control divided the time-of-flight spectra into bins according to the energy of each laser pulse. This is the first measurement of absolute rates of ATI in atomic hydrogen, and the first measurement of absolute test of MPI in atomic hydrogen without a large factor to account for multiple modes in the laser field. As such, the results of this work are important to the development of ATI theories, which presently differ by orders of magnitude in their prediction of the ionization rates. They are also important to recent calculations of temperatures in laser-heated plasmas, many of which incorporate KFR theory.

  7. Competition between photochemistry and energy transfer in ultraviolet-excited diazabenzenes. I. Photofragmentation studies of pyrazine at 248 nm and 266 nm

    International Nuclear Information System (INIS)

    The quantum yield for the formation of HCN from the photodissociation of pyrazine excited at 248 nm and 266 nm is determined by IR diode probing of the HCN photoproduct. HCN photoproducts from excited pyrazine are produced via three different dissociation channels, one that is extremely ''prompt'' and two others that are ''late.'' The total quantum yield from all reaction channels obtained at low quencher gas pressures, φ=1.3±0.2 for 248 nm and 0.5±0.3 for 266 nm, is in agreement with preliminary studies of this process as well as recent molecular beam studies. To investigate if HCN production is the result of pyrazine multiphoton absorption, this photodissociation process has been further studied by observing the HCN quantum yield as a function of total quencher gas pressure (10 mTorr pyrazine, balance SF6) and as a function of 248 nm laser fluence from 2.8 to 82 mJ/cm2. At the highest SF6 pressures, the HCN quantum yield shows strong positive correlation with laser fluence, indicating that the ''prompt'' channel is the result of multiphoton absorption; however, at low pressure, the HCN quantum yield is affected little by changing laser fluence, indicating that the majority of the HCN photoproducts at low pressure are produced from pyrazine which has absorbed only one UV photon. At the lowest pressures sampled, HCN produced from the one-photon ''late'' process accounts for more than 95% of all HCN formed (at low laser fluence). At high pressures the single photon ''late'' pyrazine dissociation is quenched, and HCN produced at high quencher gas pressures comes only from the multiphoton absorption channel, which can be clearly observed to depend on laser fluence. The HCN quantum yield as a function of laser intensity at high pressure has been fit to a quadratic function that can be used to determine the amount of ''prompt'' ''unquenched'' HCN produced from multiphoton photodissociation. Additionally, the information theoretic prior functions for energy disposal

  8. Decay Properties of 266Bh and 262Db Produced in the 248Cm+23Na Reaction - Further Confirmation of the 278113 Decay Chain

    International Nuclear Information System (INIS)

    Decay properties of an isotope 266Bh and its daughter nucleus 262Db produced by the 248Cm(23Na,5n) reaction were studied by using a gas-filled recoil separator coupled with a position-sensitive semiconductor detector. 266Bh was clearly identified from the correlation of the known nuclide, 262Db. The obtained decay properties of 266Bh and 262Db are consistent with those observed in the 278113 chain by RIKEN collaboration, which provided further confirmation of the discovery of 278113.

  9. A comparison of the femto-, pico- and nano-second multiphoton ionization and dissociation processes of NO 2 at 248 and 496 nm

    Science.gov (United States)

    Ledingham, K. W. D.; Kosmidis, C.; Georgiou, S.; Couris, S.; Singhal, R. P.

    1995-12-01

    The multiphoton ionization and dissociation of NO 2 at 248 nm ( B˜2B 2←X 2A 1) and 496 nm has been carried out for a number of different laser pulsewidths from 15 ns to 300 fs by time-of-flight mass spectrometry in a molecular beam. At 248 nm the NO 2/NO ion ratio (NO 2+/NO +) varies from about 1% using nanosecond laser pulses to about 60% for the shortest pulses used (300 fs). In contrast, at 496 nm the NO 2+/NO + ratio remains very small for excitation with both 5 ps and 500 fs pulses. These results are interpreted in terms of the limited knowledge of the dissociation rates above the NO(X)+O( 1D) fragmentation threshold at 40126 cm -1 using a simple rate equation model. The results can be described using dissociation rates which increase with decreasing pulsewidth, an idea which conforms with the distinction that has been drawn between time and frequency domain experiments. The implications of the results for the analytical potential of femtosecond mass spectrometry are discussed.

  10. Aminodisilanes as silylating agents for dry-developed positive-tone resists for deep-ultraviolet (248-nm) and extreme ultraviolet (13.5-nm) microlithography

    Science.gov (United States)

    Wheeler, David R.; Hutton, Richard S.; Boyce, Craig H.; Stein, Susan M.; Cirelli, Raymond A.; Taylor, Gary N.

    1995-06-01

    Disilanes are used as silylating reagents for near-surface imaging with deep-UV (248 nm) and EUV (13.5 nm) lithography. A relatively thin imaging layer of a photo-cross-linking resist is spun over a thicker layer of hard-baked resist that functions as a planarizing layer and antireflective coating. Photoinduced acid generation and subsequent heating crosslinks render exposed areas impermeable to an aminodisilane that reacts with the unexposed regions. Subsequent silylation and reactive ion etching affords a positive-tone image. The use of disilanes introduces a higher concentration of silicon into the polymer than is possible with silicon reagents that incorporate only one silicon atom per reactive site. The higher silicon content in the silylated polymer increases etching selectivity between exposed and unexposed regions and thereby increases the contrast. The synthesis and reactivity of `smaller' disilanes, N,N-dimethylamino-1,2-dimethyldisilane, (DMADMDS), and N,N-diethylamino-1,2- dimethyldisilane also are described. Additional silylation improvements that minimize flow during silylation also are discussed including the addition of bifunctional disilanes to the monofunctional DMAPMDS. This causes the crosslinking to occur during silylation which minimizes flow. We have resolved high aspect ratio, very high quality 0.20 micrometers line and space patterns at 248 nm with a stepper having a numerical aperture (NA) equals 0.53 and have resolved EQ 0.15 micrometers line and spaces at 13.5 nm.

  11. Structural and magnetic properties of the new ternary silicide Gd{sub 3}Co{sub 2.48}Si{sub 1.52}

    Energy Technology Data Exchange (ETDEWEB)

    Gaudin, E., E-mail: gaudin@icmcb-bordeaux.cnrs.fr [CNRS, Universite de Bordeaux, ICMCB, 87 avenue du Docteur Albert Schweitzer, 33608 Pessac Cedex (France); Mayer, C.; Weill, F.; Chevalier, B. [CNRS, Universite de Bordeaux, ICMCB, 87 avenue du Docteur Albert Schweitzer, 33608 Pessac Cedex (France)

    2012-12-25

    Highlights: Black-Right-Pointing-Pointer The existence of the new intermetallic Gd{sub 3}Co{sub 2.48}Si{sub 1.52} is reported. Black-Right-Pointing-Pointer Its structure derives from the W{sub 3}CoB{sub 3}-type structure. Black-Right-Pointing-Pointer Mixed occupancy between Co- and Si-atoms is observed for two crystallographic sites. Black-Right-Pointing-Pointer A ferromagnetic transition occurs at 180 K. - Abstract: Gd{sub 3}Co{sub 2.48}Si{sub 1.52} was obtained by arc-melting of the elements and subsequent annealing at 1073 K during 1 month. Its structure, determined from single-crystal X-ray diffraction data, derives from the W{sub 3}CoB{sub 3}-type structure with the space group Cmcm and the unit cell parameters a = 4.1185(3), b = 10.2970(7) and c = 12.8166(8) A. Mixed occupancy between Co- and Si-atoms is observed for two crystallographic sites. Only few ternary compounds are known to crystallize with this structure-type. Magnetization measurements reveal at least one ferromagnetic transition at 180 K.

  12. A strong emission line near 24.8 angstrom in the X-ray binary system MAXI J0556--332: gravitational redshift or unusual donor?

    CERN Document Server

    Maitra, Dipankar; Raymond, John C; Reynolds, Mark T

    2011-01-01

    We report the discovery of a strong emission line near 24.8 angstrom (0.5 keV) in the newly discovered X-ray binary system MAXI J0556-332 with the reflection grating spectrometer onboard the XMM-Newton observatory. The X-ray light curve morphology during these observations is complex and shows occasional dipping behavior. Here we present time- and rate-selected spectra from the RGS and show that this strong emission line is unambiguously present in all the XMM observations. The measured line center is consistent with the Ly-alpha transition of N VII in the rest frame. While the spectra contain imprints of absorption lines and edges, there appear to be no other significantly prominent narrow line due to the source itself, thus making the identification of the 24.8 angstrom line uncertain. We discuss possible physical scenarios, including a gravitationally redshifted O VIII Ly-alpha line originating at the surface of a neutron star or an unusual donor with an extremely high N/O abundance (>57) relative to solar...

  13. A STRONG EMISSION LINE NEAR 24.8 Å IN THE X-RAY BINARY SYSTEM MAXI J0556–332: GRAVITATIONAL REDSHIFT OR UNUSUAL DONOR?

    International Nuclear Information System (INIS)

    We report the discovery of a strong emission line near 24.8 Å (0.5 keV) in the newly discovered X-ray binary system MAXI J0556–332 with the reflection grating spectrometer (RGS) on board the XMM-Newton observatory. The X-ray light curve morphology during these observations is complex and shows occasional dipping behavior. Here we present time- and rate-selected spectra from the RGS and show that this strong emission line is unambiguously present in all the XMM observations. The measured line center is consistent with the Lyα transition of N VII in the rest frame. While the spectra contain imprints of absorption lines and edges, there appear to be no other significantly prominent narrow line due to the source itself, thus making the identification of the 24.8 Å line uncertain. We discuss possible physical scenarios, including a gravitationally redshifted O VIII Lyα line originating at the surface of a neutron star or an unusual donor with an extremely high N/O abundance (>57) relative to solar that may have produced this comparatively strong emission line.

  14. Electron Photodetachment from Aqueous Anions. I. Quantum Yields for Generation of Hydrated Electron by 193 and 248 nm Laser Photoexcitation of Miscellaneous Inorganic Anions

    CERN Document Server

    Sauer, M C; Shkrob, I A; Sauer, Myran C.; Shkrob, Ilya A.

    2004-01-01

    Time resolved transient absorption spectroscopy has been used to determine quantum yields for electron photodetachment in 193 nm and (where possible) 248 nm laser excitation of miscellaneous aqueous anions, including hexacyanoferrate(II), sulfate, sulfite, halide anions (Cl-, Br-, and I-), pseudohalide anions (OH-, HS-, CNS-), and several common inorganic anions for which no quantum yields have been reported heretofore: SO3=, NO2-, NO3-, ClO3- and ClO4-. Molar extinction coefficients for these anions and photoproducts of electron detachment from these anions at the excitation wavelengths were also determined. These results are discussed in the context of recent ultrafast kinetic studies and compared with the previous data obtained by product analyses. We suggest using electron photodetachment from the aqueous halide and pseudohalide anions as actinometric standard for time-resolved studies of aqueous photosystems in the UV.

  15. Probing the MSP prenatal stage: the optical identification of the X-ray burster EXO 1745-248 in Terzan 5

    CERN Document Server

    Ferraro, F R; Lanzoni, B; Cadelano, M; Massari, D; Dalessandro, E; Mucciarelli, A; -,

    2015-01-01

    We report on the optical identification of the neutron star burster EXO 1745-248 in Terzan 5. The identification was performed by exploiting HST/ACS images acquired in Director's Discretionary Time shortly after (approximately 1 month) the Swift detection of the X-ray burst. The comparison between these images and previous archival data revealed the presence of a star that currently brightened by ~3 magnitudes, consistent with expectations during an X-ray outburst. The centroid of this object well agrees with the position, in the archival images, of a star located in the Turn-Off/Sub Giant Branch region of Terzan 5. This supports the scenario that the companion should has recently filled its Roche Lobe. Such a system represents the pre-natal stage of a millisecond pulsar, an evolutionary phase during which heavy mass accretion on the compact object occurs, thus producing X-ray outbursts and re-accelerating the neutron star.

  16. Photodissociation of CH3CHO at 248 nm by time-resolved Fourier-transform infrared emission spectroscopy: Verification of roaming and triple fragmentation

    Science.gov (United States)

    Hung, Kai-Chan; Tsai, Po-Yu; Li, Hou-Kuan; Lin, King-Chuen

    2014-02-01

    By using time-resolved Fourier-transform infrared emission spectroscopy, the HCO fragment dissociated from acetaldehyde (CH3CHO) at 248 nm is found to partially decompose to H and CO. The fragment yields are enhanced by the Ar addition that facilitates the collision-induced internal conversion. The channels to CH2CO + H2 and CH3CO + H are not detected significantly. The rotational population distribution of CO, after removing the Ar collision effect, shows a bimodal feature comprising both low- and high-rotational (J) components, sharing a fraction of 19% and 81%, respectively, for the vibrational state v = 1. The low-J component is ascribed to both roaming pathway and triple fragmentation. They are determined to have a branching ratio of 0.06, respectively, relative to the whole v = 1 population. The CO roaming is accompanied by a highly vibrational population of CH4 that yields a vibrational bimodality.

  17. Optimization of power compression and stability of relativistic and ponderomotive self-channeling of 248 nm laser pulses in underdense plasmas

    International Nuclear Information System (INIS)

    The controlled formation in an underdense plasma of stable multi-PW relativistic micrometer-scale channels, which conduct a confined power at 248 nm exceeding 104 critical powers and establish a peak channel intensity of ∼1023 W/cm2, can be achieved with the use of an appropriate gradient in the electron density in the initial launching phase of the confined propagation. This mode of channel formation optimizes both the power compression and the stability by smoothing the transition from the incident spatial profile to that associated with the lowest channel eigenmode, the dynamically robust structure that governs the confined propagation. A chief outcome is the ability to stably conduct coherent energy at fluences greater than 109 J/cm2

  18. Effects of temperature on the p53-DNA binding interactions and their dynamical behavior: comparing the wild type to the R248Q mutant.

    Directory of Open Access Journals (Sweden)

    Khaled Barakat

    Full Text Available BACKGROUND: The protein p53 plays an active role in the regulation of cell cycle. In about half of human cancers, the protein is inactivated by mutations located primarily in its DNA-binding domain. Interestingly, a number of these mutations possess temperature-induced DNA-binding characteristics. A striking example is the mutation of Arg248 into glutamine or tryptophan. These mutants are defective for binding to DNA at 310 K although they have been shown to bind specifically to several p53 response elements at sub-physiological temperatures (298-306 K. METHODOLOGY/PRINCIPAL FINDINGS: This important experimental finding motivated us to examine the effects of temperature on the structure and configuration of R248Q mutant and compare it to the wild type protein. Our aim is to determine how and where structural changes of mutant variants take place due to temperature changes. To answer these questions, we compared the mutant to the wild-type proteins from two different aspects. First, we investigated the systems at the atomistic level through their DNA-binding affinity, hydrogen bond networks and spatial distribution of water molecules. Next, we assessed changes in their long-lived conformational motions at the coarse-grained level through the collective dynamics of their side-chain and backbone atoms separately. CONCLUSIONS: The experimentally observed effect of temperature on the DNA-binding properties of p53 is reproduced. Analysis of atomistic and coarse-grained data reveal that changes in binding are determined by a few key residues and provide a rationale for the mutant-loss of binding at physiological temperatures. The findings can potentially enable a rescue strategy for the mutant structure.

  19. Oxalyl chloride, ClC(O)C(O)Cl: UV/vis spectrum and Cl atom photolysis quantum yields at 193, 248, and 351 nm

    Science.gov (United States)

    Ghosh, Buddhadeb; Papanastasiou, Dimitrios K.; Burkholder, James B.

    2012-10-01

    Oxalyl chloride, (ClCO)2, has been used as a Cl atom photolytic precursor in numerous laboratory kinetic and photochemical studies. In this study, the UV/vis absorption spectrum of (ClCO)2 and the Cl atom quantum yields in its photolysis at 193, 248, and 351 nm are reported. The UV/vis spectrum was measured between 200 and 450 nm at 296 K using diode array spectroscopy in conjunction with an absolute cross section obtained at 213.9 nm. Our results are in agreement with the spectrum reported by Baklanov and Krasnoperov [J. Phys. Chem. A 105, 97-103 (2001), 10.1021/jp0019456], which was obtained at 11 discrete wavelengths between 193.3 and 390 nm. Cl atom quantum yields, Φ(λ), were measured using pulsed laser photolysis coupled with time resolved atomic resonance fluorescence detection of Cl. The UV photolysis of (ClCO)2 has been shown in previous studies to occur via an impulsive three-body dissociation mechanism, (COCl)2 + hv → ClCO* + Cl + CO (2), where the excited ClCO radical, ClCO*, either dissociates or stabilizes ClCO* → Cl + CO (3a), → ClCO (3b). ClCO is thermally unstable at the temperatures (253-298 K) and total pressures (13-128 Torr) used in our experiments ClCO + M → Cl + CO + M (4) leading to the formation of a secondary Cl atom that was resolvable in the Cl atom temporal profiles obtained in the 248 and 351 nm photolysis of (ClCO)2. Φ(193 nm) was found to be 2.07 ± 0.37 independent of bath gas pressure (25.8-105.7 Torr, N2), i.e., the branching ratio for channel 2a or the direct formation of 2Cl + 2CO in the photolysis of (ClCO)2 is >0.95. At 248 nm, the branching ratio for channel 2a was determined to be 0.79 ± 0.15, while the total Cl atom yield, i.e., following the completion of reaction (4), was found to be 1.98 ± 0.26 independent of bath gas pressure (15-70 Torr, N2). Φ(351 nm) was found to be pressure dependent between 7.8 and 122.4 Torr (He, N2). The low-pressure limit of the total Cl atom quantum yield, Φ0(351 nm), was 2.05

  20. Measurements of prompt neutron multiplicity distributions in correlation with mass-energy distribution of fission fragments in spontaneous fission of 252Cf, 244Cm and 248Cm

    International Nuclear Information System (INIS)

    The number of prompt neutrons emitted in the fission event have been measured separately for each complementary fragment in coincidence with fragment mass and kinetic energies in spontaneous fission of 252Cf, 244Cm and 248Cm. Two high efficient Gd-loaded liquid scintillator tanks were used for the neutron registration. Approximately 3x106 fission events coincident with prompt neutron emission have been accumulated for each isotope. The mean neutron multiplicity, the dispersion and the covariance of the multiplicity distributions have been obtained as a function of fission fragment mass and kinetic energy. The neutron multiplicity data have been corrected for neutron registration efficiency, background and pile-up. Dependencies of the moments of the multiplicity distributions on the fragment mass and total kinetic energy for different mass bins, as well as mass and total kinetic energy distributions of the fission fragments are presented, discussed and compared for the different isotopes investigated. The results showed a different behavior of the moments of the multiplicity distribution depending on the fragment mass asymmetry that reflects changes in the dynamical effects for different fission modes. (author)

  1. Wilms' tumor: natural history and prognostic factors. A retrospective study of 248 cases treated at the Institut Gustave-Roussy 1952--1967

    International Nuclear Information System (INIS)

    A statistical analysis of 248 histologically proven cases of Wilms' tumor treated at the Institut Gustave-Roussy, Villejuif, France, from 1952 to 1967 is presented. Two years recurrence-free survival and five years survival have been selected as prognostic criteria. Patients under two years of age have significantly fewer metastases and a better five-year survival rate than those over two. Stage is strongly correlated with recurrences and survival. Influence of tumor size, number of tumor nodules, tumor rupture, adhesions, regional lymph node involvement, and renal vein infiltration is shown. Detailed analysis of histopathologic features indicates that a favorable clinical course is significantly related to the number of different varieties of epithelial differentiation (tubular, glomerular, microcystic) found in any tumor, whatever the abundance of each of them. Presence of striated muscular cells, however abundant, does not influence survival or metastatic rates. Cases where irradiation given prior to surgery resulted in complete destruction of tumor cells form a distinctive group of very unfavorable prognosis. Relapse of tumor occurs in 54 percent of cases, 10 percent presenting metastases. Involved sites are listed. No correlation is found between date of metastases and other parameters. The three major prognostic factors of age, stage, histologic pattern, bear prognostic value separately. Stage and age are linked, as well as histology and age. Stage and histology are not linked. Age in itself therefore seems less important. It is concluded that these well-defined parameters should be employed in defining treatment for each individual case

  2. Odd oxygen formation in the laser irradiation of O2 at 248 nm - Evidence for reactions of O2 in the Herzberg states with ground state O2

    Science.gov (United States)

    Shi, Jichun; Barker, John R.

    1992-01-01

    Two O3 formation processes (initiation and autocatalytic) are studied in pure O2 and in O2+N2 and O2+Ar mixtures at pressures between 200 and 1600 torr and at temperatures between 298 and 370 K. Evidence is presented that the initiation process produces O3 through chemical reactions between ground state O2 and excited O2 in the Herzberg states, which are produced by the photoabsorption of O2 at 248 nm. For the autocatalytic process, the results are consistent with the proposal that the O3 formation is accelerated by photodissociating vibrationally excited O2(nu), produced in the photolysis of O3 following its initial formation. It is argued that the O2 Herzberg states and O2(nu) may play important roles in the odd oxygen chemistry in the middle atmosphere. It is estimated that the O2(A3Sigma-u(+))+O2 reaction may yield up to about 6 percent of the total odd oxygen production rate near 50 km.

  3. I2 molecular elimination in single-photon dissociation of CH2I2 at 248 nm by using cavity ring-down absorption spectroscopy

    International Nuclear Information System (INIS)

    Following single-photon dissociation of CH2I2 at 248 nm, I2 molecular elimination is detected by using cavity ring-down absorption spectroscopy. The technique comprises two laser beams propagating in a perpendicular configuration, in which a tunable laser beam along the axis of the ring-down cell probes the I2 fragment in the B 3Πou+- X 1Σg+ transition. The nascent vibrational populations for v = 0, 1, and 2 levels are obtained with a population ratio of 1:(0.65 ± 0.10):(0.30 ± 0.05), corresponding to a Boltzmann-like vibrational temperature of 544 ± 73 K. The quantum yield of the ground state I2 elimination reaction is determined to be 0.0040 ± 0.0025. With the aid of ab initio potential energy calculations, the pathway of molecular elimination is proposed on the energetic ground state CH2I2 via internal conversion, followed by asynchronous three-center dissociation. A positive temperature effect supports the proposed mechanism.

  4. Molecular elimination of Br2 in photodissociation of CH2BrC(O)Br at 248 nm using cavity ring-down absorption spectroscopy

    International Nuclear Information System (INIS)

    The primary elimination channel of bromine molecule in one-photon dissociation of CH2BrC(O)Br at 248 nm is investigated using cavity ring-down absorption spectroscopy. By means of spectral simulation, the ratio of nascent vibrational population in v = 0, 1, and 2 levels is evaluated to be 1:(0.5 ± 0.1):(0.2 ± 0.1), corresponding to a Boltzmann vibrational temperature of 581 ± 45 K. The quantum yield of the ground state Br2 elimination reaction is determined to be 0.24 ± 0.08. With the aid of ab initio potential energy calculations, the obtained Br2 fragments are anticipated to dissociate on the electronic ground state, yielding vibrationally hot Br2 products. The temperature-dependence measurements support the proposed pathway via internal conversion. For comparison, the Br2 yields are obtained analogously from CH3CHBrC(O)Br and (CH3)2CBrC(O)Br to be 0.03 and 0.06, respectively. The trend of Br2 yields among the three compounds is consistent with the branching ratio evaluation by Rice-Ramsperger-Kassel-Marcus method. However, the latter result for each molecule is smaller by an order of magnitude than the yield findings. A non-statistical pathway so-called roaming process might be an alternative to the Br2 production, and its contribution might account for the underestimate of the branching ratio calculations.

  5. Br2 molecular elimination in photolysis of (COBr)2 at 248 nm by using cavity ring-down absorption spectroscopy: A photodissociation channel being ignored

    International Nuclear Information System (INIS)

    A primary dissociation channel of Br2 elimination is detected following a single-photon absorption of (COBr)2 at 248 nm by using cavity ring-down absorption spectroscopy. The technique contains two laser beams propagating in a perpendicular configuration. The tunable laser beam along the axis of the ring-down cell probes the Br2 fragment in the B3Πou+-X1Σg+ transition. The measurements of laser energy- and pressure-dependence and addition of a Br scavenger are further carried out to rule out the probability of Br2 contribution from a secondary reaction. By means of spectral simulation, the ratio of nascent vibrational population for v = 0, 1, and 2 levels is evaluated to be 1:(0.65 ± 0.09):(0.34 ± 0.07), corresponding to a Boltzmann vibrational temperature of 893 ± 31 K. The quantum yield of the ground state Br2 elimination reaction is determined to be 0.11 ± 0.06. With the aid of ab initio potential energy calculations, the pathway of molecular elimination is proposed on the energetic ground state (COBr)2 via internal conversion. A four-center dissociation mechanism is followed synchronously or sequentially yielding three fragments of Br2+ 2CO. The resulting Br2 is anticipated to be vibrationally hot. The measurement of a positive temperature effect supports the proposed mechanism.

  6. Ion-forming processes on 248 nm laser excitation of uracil and methyl-monosubstituted uracils: a time-resolved transient conductivity study in aqueous solution

    International Nuclear Information System (INIS)

    Uracil, thymine and 1-, 3-, and 6-methyluracil were studied by time-resolved optical and conductometric methods after 248 nm excitation with 20 ns laser pulses. The transient conductivity in argon-saturated aqueous solution, showing a maximum increase (ΔKmax) during the pulse, is ascribed to the generation of hydrated electrons (eaq-) and protons. Biphotonic photoionization as the primary process is inferred from the almost linear dependence of ΔKmax on the square of the laser intensity (IL2). The quantum yield varies by a factor of about two for the five pyrimidines. The neutralization kinetics depends strongly on pH and the concentrations of laser-induced eaq- and H+, i.e. on IL. At pH 6-7 the ΔK signal decays by second-order kinetics. Under argon the electron adds to the (methyl)uracil and neutralization occurs by reaction of the radical anion with a proton, which originates from a fast decay of the radical cation. (author)

  7. Study of regulatory promoter polymorphism (-248 G>A) of Bax gene in patients with gastric cancer in the northern provinces of Iran

    Science.gov (United States)

    Mirmajidi, Seyedeh Habibeh; Najafi, Mojtaba; Mirmajidi, Seyedeh Tahereh; Nasri Nasrabadi, Nafiseh

    2016-01-01

    Aim: The aim of this study is to evaluate the polymorphism in Bax gene and its association with some clinical pathology traits in gastric cancer. Background: Gastric cancer is considered as the fourth most common cancer in the north and northwest of Iran. Bcl2 family has a key role in regulation of apoptosis, and any changes in the expression of Bcl2 lead to cancer. Patients and methods: Blood samples were collected from 100 cases and 89 controls in the northern provinces of Iran to evaluate promoter polymorphism (-248G

  8. Characterization of the in vitro expressed autoimmune rippling muscle disease immunogenic domain of human titin encoded by TTN exons 248-249

    International Nuclear Information System (INIS)

    Highlights: → Affinity purification of the autoimmune rippling muscle disease immunogenic domain of titin. → Partial sequence analysis confirms that the peptides is in the I band region of titin. → This region of the human titin shows high degree of homology to mouse titin N2-A. -- Abstract: Autoimmune rippling muscle disease (ARMD) is an autoimmune neuromuscular disease associated with myasthenia gravis (MG). Past studies in our laboratory recognized a very high molecular weight skeletal muscle protein antigen identified by ARMD patient antisera as the titin isoform. These past studies used antisera from ARMD and MG patients as probes to screen a human skeletal muscle cDNA library and several pBluescript clones revealed supporting expression of immunoreactive peptides. This study characterizes the products of subcloning the titin immunoreactive domain into pGEX-3X and the subsequent fusion protein. Sequence analysis of the fusion gene indicates the cloned titin domain (GenBank ID: (EU428784)) is in frame and is derived from a sequence of N2-A spanning the exons 248-250 an area that encodes the fibronectin III domain. PCR and EcoR1 restriction mapping studies have demonstrated that the inserted cDNA is of a size that is predicted by bioinformatics analysis of the subclone. Expression of the fusion protein result in the isolation of a polypeptide of 52 kDa consistent with the predicted inferred amino acid sequence. Immunoblot experiments of the fusion protein, using rippling muscle/myasthenia gravis antisera, demonstrate that only the titin domain is immunoreactive.

  9. Characterization of the in vitro expressed autoimmune rippling muscle disease immunogenic domain of human titin encoded by TTN exons 248-249

    Energy Technology Data Exchange (ETDEWEB)

    Zelinka, L. [Biomedical Sciences Program, Kent State University, Kent, OH (United States); McCann, S.; Budde, J.; Sethi, S.; Guidos, M.; Giles, R. [Center for Applied Chemical Biology, Department of Biological Sciences, Youngstown State University, One University Plaza, Youngstown, OH 44555 (United States); Walker, G.R., E-mail: grwalker@ysu.edu [Center for Applied Chemical Biology, Department of Biological Sciences, Youngstown State University, One University Plaza, Youngstown, OH 44555 (United States); Biomedical Sciences Program, Kent State University, Kent, OH (United States)

    2011-08-05

    Highlights: {yields} Affinity purification of the autoimmune rippling muscle disease immunogenic domain of titin. {yields} Partial sequence analysis confirms that the peptides is in the I band region of titin. {yields} This region of the human titin shows high degree of homology to mouse titin N2-A. -- Abstract: Autoimmune rippling muscle disease (ARMD) is an autoimmune neuromuscular disease associated with myasthenia gravis (MG). Past studies in our laboratory recognized a very high molecular weight skeletal muscle protein antigen identified by ARMD patient antisera as the titin isoform. These past studies used antisera from ARMD and MG patients as probes to screen a human skeletal muscle cDNA library and several pBluescript clones revealed supporting expression of immunoreactive peptides. This study characterizes the products of subcloning the titin immunoreactive domain into pGEX-3X and the subsequent fusion protein. Sequence analysis of the fusion gene indicates the cloned titin domain (GenBank ID: (EU428784)) is in frame and is derived from a sequence of N2-A spanning the exons 248-250 an area that encodes the fibronectin III domain. PCR and EcoR1 restriction mapping studies have demonstrated that the inserted cDNA is of a size that is predicted by bioinformatics analysis of the subclone. Expression of the fusion protein result in the isolation of a polypeptide of 52 kDa consistent with the predicted inferred amino acid sequence. Immunoblot experiments of the fusion protein, using rippling muscle/myasthenia gravis antisera, demonstrate that only the titin domain is immunoreactive.

  10. RRS Discovery Cruise 248, 07 Jul-10 Aug 2000. A multidisciplinary study of the environment and ecology of deep-water coral ecosystems and associated seabed facies and features (The Darwin Mounds, Porcupine Bank and Porcupine Seabight)

    OpenAIRE

    B. J. Bett; Billett, D. S. M.; Masson, D.G.; Tyler, P. A.

    2001-01-01

    RRS Discovery Cruise 248 aimed to carry out a multidisciplinary study of the environment and ecology of deep-water coral ecosystems and associated seabed features in the northeast Atlantic. The study was primarily focused on the Darwin Mounds area, northern Rockall Trough (59° 49’N, 07° 22’W), but also examined a number of sites in the Porcupine Seabight area. The cruise was divided into two legs (Govan-Stornoway, 8 Jul-21 Jul 2000; Stornoway-Southampton, 22 Jul-10 Aug 2000). Leg 1 focused on...

  11. Forme di tutela giuridica per le banche dati fra diritto d'autore e diritto sui generis: il Decreto Legislativo n. 169/99 del 15 giugno 1999 e la Legge n. 248 del 18 agosto 2000 [Italian

    OpenAIRE

    De Robbio, Antonella

    2000-01-01

    The legislative decree 169/99, which acknowledges the European directive 9/96, edits some parts of the law on author rights (n. 633, 22nd April 1941). The new law (n. 248, 18th August 2000) doesn’t modify anything concerning with database as it only reconfirms the legislative decree 169/99 as far as the penal aspects are concerned. Summary: History and presuppositions – Double-protection system – Definition of the word database – Principle and Criteria of the Italian legislative decree – ...

  12. Survey of potential markets for devices using Californium-252

    International Nuclear Information System (INIS)

    Potential applications for devices or systems containing 252Cf in the years from 1975 to 1980 are estimated. The estimated number of devices and associated business value were derived from a survey of 46 industrial, educational and governmental organizations conducted from Jan. to May, 1975. Applications for devices and systems based on 252Cf are expected to increase by a factor of 7 in the 6-y period from 1975 to 1980. The annual business value of 252Cf devices should increase from 1.5 million dollars in 1975 to 10.8 million dollars in 1980. The potential European market should be several times as large as the US market, based on actual sales of 252Cf, which have been two to four times greater in Europe than in the US

  13. The protective cell petrus for the production of californium 252

    International Nuclear Information System (INIS)

    The alpha, beta, gamma, neutron cell which is described in the present paper is devoted to the transplutonium element production and study. It is located at the CEN in Fontenay-aux-Roses (France). The 4 feet ordinary concrete shielding made of stacked blocs allows the manipulation of radioactive sources as high as 1000 curies of 1 MeV gamma rays and with a fast neutrons flux of 109 n.cm-2.s-1. The airtight alpha containment box is equipped with two transfer systems, one consists of a parallelepiped shaped airtight box located in a turntable, the other uses standard cylindrical containers made of polyethylene. The general equipment and the main setting up are also described. (authors)

  14. Californium-252 neutron activation facility at the Savannah River Laboratory

    International Nuclear Information System (INIS)

    A neutron irradiation facility has been established to develop new analytical methods and for the support of research programs. A major component of this facility is a 252Cf source which provides both fission spectrum and thermal neutrons. (U.S.)

  15. Californium-252 brachytherapy for anal and ano-rectal carcinoma

    International Nuclear Information System (INIS)

    Surgery has historically been the standard treatment for anal, ano-rectal and rectal carcinoma but is prone to local or regional failure. Over the past 15 years there has been increasing interest in and success with radiation therapy and combined chemoradiotherapy for treatment of anal and ano-rectal cancers. Cf-252 brachytherapy combined with external beam teletherapy has been investigated for anal and ano-rectal lesions at the Univ. of Kentucky with encouraging results

  16. Mobile equipment for neutron radiography using a californium-252 source

    International Nuclear Information System (INIS)

    The basic requirements for successful neutron radiography are first summarised and the use of 252Cf is placed in perspective by comparing its properties with those of sources based on the Be (γ, n) and Be (α, n) reactions which have a broadly similar range of applications. The more essential design features of mobile neutron radiography equipment are next examined in some detail, to show how the often conflicting requirements of optimum beam production and adequate shielding may be reconciled. An assembly with a maximum dimension around 1 m with a source of 1 mg is used as an example. The design data used are reproduced in graphical form to permit designs to be scaled to suit the source available and the requirements. The selection of suitable image recorders for 252Cf radiography is discussed with the conclusion that the gadolinium foil-film combinations are likely to remain the normal choice. Demonstration radiographs are presented with particular reference to the location of residual casting sand in gas-cooled turbine blades. Finally, it is suggested that other applications for mobile 252Cf-based neutron radiography equipment will be found in the ordnance, aero-space, chemical and nuclear fuel manufacturing industries. (author)

  17. Automated absolute activation analysis with californium-252 sources

    Energy Technology Data Exchange (ETDEWEB)

    MacMurdo, K.W.; Bowman, W.W.

    1978-09-01

    A 100-mg /sup 252/Cf neutron activation analysis facility is used routinely at the Savannah River Laboratory for multielement analysis of many solid and liquid samples. An absolute analysis technique converts counting data directly to elemental concentration without the use of classical comparative standards and flux monitors. With the totally automated pneumatic sample transfer system, cyclic irradiation-decay-count regimes can be pre-selected for up to 40 samples, and samples can be analyzed with the facility unattended. An automatic data control system starts and stops a high-resolution gamma-ray spectrometer and/or a delayed-neutron detector; the system also stores data and controls output modes. Gamma ray data are reduced by three main programs in the IBM 360/195 computer: the 4096-channel spectrum and pertinent experimental timing, counting, and sample data are stored on magnetic tape; the spectrum is then reduced to a list of significant photopeak energies, integrated areas, and their associated statistical errors; and the third program assigns gamma ray photopeaks to the appropriate neutron activation product(s) by comparing photopeak energies to tabulated gamma ray energies. Photopeak areas are then converted to elemental concentration by using experimental timing and sample data, calculated elemental neutron capture rates, absolute detector efficiencies, and absolute spectroscopic decay data. Calculational procedures have been developed so that fissile material can be analyzed by cyclic neutron activation and delayed-neutron counting procedures. These calculations are based on a 6 half-life group model of delayed neutron emission; calculations include corrections for delayed neutron interference from /sup 17/O. Detection sensitivities of < or = 400 ppB for natural uranium and 8 ppB (< or = 0.5 (nCi/g)) for /sup 239/Pu were demonstrated with 15-g samples at a throughput of up to 140 per day. Over 40 elements can be detected at the sub-ppM level.

  18. Californium-based neutron radiography for corrosion detection in aircraft

    International Nuclear Information System (INIS)

    In support of an overall program aimed at minimizing disassembly and reducing inspection time during aircraft maintenance, a series of projects has been carried out to determine the feasibility of applying neutron radiographic techniques to the nondestructive (NDT) inspection of aircraft and aircraft components. These investigations have clearly demonstrated the superiority of neutron radiography over all other NDT techniques in its ability to detect surface and subsurface corrosion in aircraft structure. This capability is particularly significant where the corrosion is hidden behind thick metallic structural members. The neutron radiographic technique has been applied successfully to detect corrosion in the wing tank of E-2C, C-130, and DC-9 aircraft; rear stabilators of F-4 and F-111 aircraft; aft spar, starboard and port wing, and rudder of the F-8; fuselage skin of the 727; rotary blades of AH-1 and SH-3 helicopters; rotary tail flaps of the UH-2 helicopter; and nose landing gear of A-7 aircraft

  19. Automated absolute activation analysis with californium-252 sources

    International Nuclear Information System (INIS)

    A 100-mg 252Cf neutron activation analysis facility is used routinely at the Savannah River Laboratory for multielement analysis of many solid and liquid samples. An absolute analysis technique converts counting data directly to elemental concentration without the use of classical comparative standards and flux monitors. With the totally automated pneumatic sample transfer system, cyclic irradiation-decay-count regimes can be pre-selected for up to 40 samples, and samples can be analyzed with the facility unattended. An automatic data control system starts and stops a high-resolution gamma-ray spectrometer and/or a delayed-neutron detector; the system also stores data and controls output modes. Gamma ray data are reduced by three main programs in the IBM 360/195 computer: the 4096-channel spectrum and pertinent experimental timing, counting, and sample data are stored on magnetic tape; the spectrum is then reduced to a list of significant photopeak energies, integrated areas, and their associated statistical errors; and the third program assigns gamma ray photopeaks to the appropriate neutron activation product(s) by comparing photopeak energies to tabulated gamma ray energies. Photopeak areas are then converted to elemental concentration by using experimental timing and sample data, calculated elemental neutron capture rates, absolute detector efficiencies, and absolute spectroscopic decay data. Calculational procedures have been developed so that fissile material can be analyzed by cyclic neutron activation and delayed-neutron counting procedures. These calculations are based on a 6 half-life group model of delayed neutron emission; calculations include corrections for delayed neutron interference from 17O. Detection sensitivities of 239Pu were demonstrated with 15-g samples at a throughput of up to 140 per day. Over 40 elements can be detected at the sub-ppM level

  20. Comparación de variables físicas, culinarias y amilográficas del cultivar de arroz (Oryza sativa L. MD248 con dos cultivares comerciales de arroz en Venezuela

    Directory of Open Access Journals (Sweden)

    Manuel Ávila

    2014-12-01

    Full Text Available El objetivo del estudio fue evaluar las variables físicas culinarias y amilográficas del cultivar MD248 y su potencial como arroz de mesa en Venezuela. Para ello, MD248 se sembró bajo un diseño completamente aleatorizado, en Calabozo (Estado Guárico, Venezuela, junto con 2 cultivares empleados como testigos de buena (D-Sativa y baja (D-Primera calidad culinaria. De cada cultivar se cosecharon 2.500 g de arroz paddy y se procesaron hasta obtener una fracción de arroz entero pulido la cual fue evaluada para: largo, ancho, espesor, relación largo/ancho (L/A, peso de 100 granos, contenido de amilosa aparente, tiempo de cocción, relación de expansión volumétrica (REV, relación de absorción de agua (RAA, viscosidades pico, media, final, ‘breakdown’, ‘setback’, consistencia y temperatura de empaste del perfil amilográfico. Además, atributos sensoriales descriptivos (brillo, percepción visual de la adhesividad, adhesividad manual, adhesividad entre los granos y preferenciales (apariencia, adhesividad, calidad global del arroz cocido. Los resultados indicaron diferencias estadísticas altamente significativas (p ≤ 0,01 entre los cultivares para largo, relación L/A, peso de 100 granos, contenido de amilosa aparente, tiempo de cocción, REV, RAA y todas las variables amilográficas, excepto para viscosidad media y temperatura de empaste (p > 0,05. En los perfiles descriptivo y preferencial hubo diferencias altamente significativas (p ≤ 0,01 para todos los atributos evaluados. MD248 estuvo asociado con los mayores valores de largo de grano (7,07 mm, relación L/A (3,43, peso de 100 granos (2,20 g y amilosa aparente (19,14 %, y con los menores valores de tiempo de cocción (22,90 min, REV (3,07, RAA (1,55, viscosidad pico (159,61 RVU, media (130,10 RVU, p > 0,05 y ‘breakdown’ (29,51 RVU. MD248 presentó un perfil descriptivo comparable al cultivar de buena calidad culinaria y se diferenció ampliamente del cultivar de baja

  1. Molecular elimination of Br{sub 2} in photodissociation of CH{sub 2}BrC(O)Br at 248 nm using cavity ring-down absorption spectroscopy

    Energy Technology Data Exchange (ETDEWEB)

    Fan He; Tsai, Po-Yu; Lin, King-Chuen [Department of Chemistry, National Taiwan University, Taipei 106, Taiwan and Institute of Atomic and Molecular Sciences, Academia Sinica, Taipei 106, Taiwan (China); Lin, Cheng-Wei; Yan, Chi-Yu; Yang, Shu-Wei; Chang, A. H. H. [Department of Chemistry, National Dong Hwa University, Shoufeng, Hualien 974, Taiwan (China)

    2012-12-07

    The primary elimination channel of bromine molecule in one-photon dissociation of CH{sub 2}BrC(O)Br at 248 nm is investigated using cavity ring-down absorption spectroscopy. By means of spectral simulation, the ratio of nascent vibrational population in v = 0, 1, and 2 levels is evaluated to be 1:(0.5 {+-} 0.1):(0.2 {+-} 0.1), corresponding to a Boltzmann vibrational temperature of 581 {+-} 45 K. The quantum yield of the ground state Br{sub 2} elimination reaction is determined to be 0.24 {+-} 0.08. With the aid of ab initio potential energy calculations, the obtained Br{sub 2} fragments are anticipated to dissociate on the electronic ground state, yielding vibrationally hot Br{sub 2} products. The temperature-dependence measurements support the proposed pathway via internal conversion. For comparison, the Br{sub 2} yields are obtained analogously from CH{sub 3}CHBrC(O)Br and (CH{sub 3}){sub 2}CBrC(O)Br to be 0.03 and 0.06, respectively. The trend of Br{sub 2} yields among the three compounds is consistent with the branching ratio evaluation by Rice-Ramsperger-Kassel-Marcus method. However, the latter result for each molecule is smaller by an order of magnitude than the yield findings. A non-statistical pathway so-called roaming process might be an alternative to the Br{sub 2} production, and its contribution might account for the underestimate of the branching ratio calculations.

  2. Use of the selected overlap LIDAR experiment (SOLEX) system with the 248 nm krypton fluoride and the 355 nm neodymium:yttrium aluminum garnet lasers for the calibration of LIDAR systems for water vapor determination

    Science.gov (United States)

    Mensah, Francis Emmanuel Tofodji

    Water vapor is one of the most important atmospheric variables that play a key role in air quality, global warming, climate change and hurricane formation. In this dissertation, use was made of two laser systems, the 248-nm KrF laser and the 355 nm Nd-YAG laser, with the use of Raman scattering to measure water vapor in the atmosphere. These two systems have been calibrated more accurately, using the LIDAR approach named SOLEX (Selected Overlap LIDAR Experiment). All the experiments were carried out at the Howard University Beltsville campus located on a 107 acre research site, at Beltsville, MD, 15 miles from downtown Washington DC, near the National Agricultural Research Center (NARC), and the NASA Goddard Space Flight Center (GSFC). The geographical coordinates are: 39°04.01'N latitude, and 76°52.31'W longitude. The receiver system used during these experiments is a 30" (76.2 cm), f/ 9 Cassegranian telescope, while the detector system uses a prism spectrometer (Beckman), with a 2-meter, double-fold optical path and a variable slit width is placed at the image plane of the telescope. With the use of the SOLEX system, this dissertation provides an accurate calibration of the two LIDAR Systems for water vapor measurement in the troposphere at the following ranges: 83.7 ft, 600 ft, 800 ft, 1000 ft and 1080 ft. Data analysis shows a pretty high sensitivity of the LIDAR system for water vapor measurement and the efficiency of the SOLEX method.

  3. 24 CFR 248.201 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... 24 CFR part 5. Adjusted Income. Annual income, as specified in § 251.21 of this chapter, less... Commissioner under part 221 of this chapter and bearing a below market interest rate as provided under § 221... allowable distributions. Return on Investment. The amount of allowable distributions, tax benefits,...

  4. 7 CFR 248.2 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... means any of the 50 States, the District of Columbia, the Commonwealth of Puerto Rico, the Virgin... harvesting and cleaning processes. Honey, maple syrup, cider, nuts, seeds, eggs, meat, cheese and seafood...

  5. 17 CFR 248.3 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... for personal, family, or household purposes. (2) Examples—(i) Continuing relationship. A consumer has... AND S-AM Regulation S-P: Privacy of Consumer Financial Information and Safeguarding Personal... or limited partnership, association, or similar organization. (g)(1) Consumer means an individual...

  6. Women: The Fifth World. Headline Series 248.

    Science.gov (United States)

    Boulding, Elise

    The document addresses past, present, and future issues concerning women througout the world. It is presented in seven chapters. Chapter I discusses women as the invisible "fifth world." The author contends that this fifth world exists, uncounted and unassisted, on every continent. Chapter II traces the role of women throughout history. The…

  7. 24 CFR 248.101 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... mobility, taking into account the need for vacancies resulting from turnover and to meet growth in renter... moderate income families. Notice of Intent. An owner's notification to the Commissioner of its intention...

  8. QTL Information Table: 248 [Q-TARO

    Lifescience Database Archive (English)

    Full Text Available ntitative characters in rice using RFLP markers. Euphytica V89, 349-354. http://dx.doi.org/10.1007/BF00022292 ... ...ant RFLP C)Interval F2 Palawan IR42 A RG143 RG214 pha Wu, P., Zhang, G., and Huang, N. (1996). Identification of QTLs controlling qua

  9. 17 CFR 248.120 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... group of affiliated companies makes a telephone call to the centralized call center for the affiliated... company, and provides contact information to the call center, the call constitutes an inquiry to the... makes a telephone call to a centralized call center for a group of affiliated companies to inquire...

  10. Measurements of cross sections and decay properties of the isotopes of elements 112, 114, and 116 produced in the fusion reactions 233,238U, 242Pu, and 248Cm+48Ca

    International Nuclear Information System (INIS)

    We have studied the dependence of the production cross sections of the isotopes 282,283112 and 286,287114 on the excitation energy of the compound nuclei 286112 and 290114. The maximum cross section values of the xn-evaporation channels for the reaction 238U(48Ca,xn)286-x112 were measured to be σ3n=2.5-1.1+1.8 pb and σ4n=0.6-0.5+1.6 pb; for the reaction 242Pu(48Ca,xn)290-x114: σ2n∼0.5 pb, σ3n=3.6-1.7+3.4 pb, and σ4n=4.5-1.9+3.6 pb. In the reaction 233U(48Ca,2-4n)277-279112 at E*=34.9=2.2 MeV we measured an upper cross section limit of σxn≤0.6 pb. The observed shift of the excitation energy associated with the maximum sum evaporation residue cross section σER(E*) to values significantly higher than that associated with the calculated Coulomb barrier can be caused by the orientation of the deformed target nucleus in the entrance channel of the reaction. An increase of σER in the reactions of actinide targets with 48Ca is consistent with the expected increase of the survivability of the excited compound nucleus upon closer approach to the closed neutron shell N=184. In the present work we detected 33 decay chains arising in the decay of the known nuclei 282112, 283112, 286114, 287114, and 288114. In the decay of 287114(α)→283112(α)→279110(SF), in two cases out of 22, we observed decay chains of four and five sequential α transitions that end in spontaneous fission of 271Sg (Tα/SF=2.4-1.0+4.3 min) and 267Rf (TSF∼2.3 h), longer decay chains than reported previously. We observed the new nuclide 292116 (Tα=18-6+16 ms,Eα=10.66±0.07 MeV) in the irradiation of the 248Cm target at a higher energy than in previous experiments. The observed nuclear decay properties of the nuclides with Z=104-118 are compared with theoretical nuclear mass calculations and the systematic trends of spontaneous fission properties. As a whole, they give a consistent pattern of decay of the 18 even-Z neutron-rich nuclides with Z=104-118 and N=163-177. The experiments were

  11. Measurements of cross sections and decay properties of the isotopes of elements 112, 114 and 116 produced in the fusion reactions 233,238U, 242Pu, and 248Cm + 48Ca

    International Nuclear Information System (INIS)

    We have studied the dependence of the production cross sections of the isotopes 282,283112 and 286,287114 on the excitation energy of the compound nuclei 286112 and 290114. The maximum cross-section values of the xn-evaporation channels for the reaction 238U(48Ca, xn)286-x112 were measured to be: σ3n = 2.5-1.1+1.8 pb and σ4n = 0.6-0.5+1.6 pb; for the reaction 242Pu(48Ca, xn)290-x114: σ2n ∼ 0.5 pb, σ3n 3.6-1.7+3.4 pb and σ4n = 4.5-1.9+3.6 pb. In the reaction 233U(48Ca, 2-4n)277-279112 at E* = 34.9±2.2 MeV we measured an upper cross-section limit of σxn ≤ 0.6 pb. The observed shift of the excitation energy associated with the maximum sum evaporation residue cross section σER(E*) to values significantly higher than that associated with the calculated Coulomb barrier can be caused by the orientation of the deformed target nucleus in the entrance channel of the reaction. An increase of σER in the reactions of actinide targets with 48Ca is consistent with the expected increase of the survivability of the excited compound nucleus upon closer approach to the closed neutron shell N = 184. In the present work we detected 33 decay chains arising in the decay of the known nuclei: 282112, 283112, 286114, and 288114. In the decay of 287114(α) → 283112(α) → 279110(SF), in two cases out of 22, we observed decay chains of four and five sequential α transitions that end in spontaneous fission of 271Sg(Tα/SF = 2.4 -1.0+4.3 min) and 267Rf(TSF ∼ 2.3 h), longer decay chains than reported previously. We observed the new nuclide 292116(Tα = 18-6+16 ms, Eα = 10.66 ± 0.07 MeV in the irradiation of 248Cm target at a higher energy than in previous experiments. The observed nuclear decay properties of the nuclides with Z = 104-118 are compared with theoretical nuclear mass calculations and the systematic trends of spontaneous fission properties. As a whole, they give a consistent pattern of decay of the 18 even-Z neutron-rich nuclides with Z = 104-118 and N = 163

  12. Capture cross section measurement analysis in the Californium-252 spectrum with the Monte Carlo method

    International Nuclear Information System (INIS)

    Absolute average capture cross sections of gold, thorium, tantalum, molybdenum, copper and strontium in 252Cf spontaneous fission neutron spectrum were simulated for two types of experiment setups preformed by Z. Dezso and J. Csikai and by L. Green. The experiments were simulated with MCNP5 using cross section data from the ENDF/B-VII.0 library. The determination of neutron backscattering was calculated with the use of neutron flagging. Correction factors to experimentally measured values were determined to obtain average cross sections in a pure 252Cf spontaneous fission spectrum. Influence of concrete wall thickness, air moisture and room size on the average cross section was analyzed. Correction factors amounted to about 30%. Corrected values corresponding to average cross sections in a pure 252Cf spectrum were calculated for 197Au, 232Th, 181Ta, 98Mo, 65Cu and 84Sr. Average cross sections were also calculated with the RR-UNC software using IRDFF-v.1.05 and ENDF/B-VII.0 libraries. The revised average radiative capture cross sections are 75.5±0.1 mb for 197Au, 87.0±1.6 mb for 232Th , 98.0±4.5 mb for 181Ta, 21.2±0.5 mb for 98Mo, 10.3±0.3 mb for 63Cu, and 34.9±6.5 mb for 84Sr. - Highlights: • Average capture cross sections in 252Cf spontaneous fission spectrum were simulated. • Calculations were done using MCNP5 code and ENDF/B-VII.0 library. • Correction factors for self-shielding and room return effects were taken into account. • The revised average radiative capture cross sections for different materials are published

  13. Multi-element neutron activation analysis of sediment using a californium-252 source

    International Nuclear Information System (INIS)

    The application of a 252Cf source to the neutron activation analysis of several elements in small (approximately 1.5 in. in dia) cores was studied using high-resolution gamma ray spectroscopy and manual data reduction. (U.S.)

  14. OER of californium-252 at low dose rate for growth inhibition in Vicia faba

    International Nuclear Information System (INIS)

    OER of 252Cf, at low dose rate, has been determined for growth inhibition in Vicia faba roots. A new strain ''BelB'' was used; it was found to be more resistant to prolonged anoxia. Two sets of linear 252Cf sources were used (linear activity 0.31 and 0.47 (μg.cm-1)) in somewhat different geometrical arrangements. The (n+γ) 252Cf dose rates at the level of the root tips were 0.11 and 0.13 Gy.h-1 respectively. The relative contribution of the γ component Dsub(γ) to the total absorbed dose Dsub(n+γ) at the level of the root tips was evaluated Dsub(γ)/Dsub(n+γ)=0.35 for the first source-geometry and 0.42 for the second source-geometry. The reference radiation was the γ emission of 192Ir, used in the same geometrical conditions and for similar irradiation times. Irradiations performed in aerobic and anoxic conditions were alternated. OER values of 1.4 +- 0.1 and 1.5 +- 0.1 were observed for the 252Cf emission with the first and second source-geometry respectively. The corresponding OER values for 192Ir were 2.3 +- 0.2 and 2.6 +- 0.1; the derived oxygen gain factors were then equal to 1.6 and 1.7 repectively

  15. 17 CFR 248.124 - Reasonable opportunity to opt out.

    Science.gov (United States)

    2010-04-01

    ... means. (3) At the time of an electronic transaction. The opt out notice is provided to the consumer at the time of an electronic transaction, such as a transaction conducted on an Internet Web site. The... date the notice is mailed to elect to opt out by any reasonable means. (2) By electronic means. (i)...

  16. Dicty_cDB: VFK248 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available X sequence update 2001.11.22 Translated Amino Acid sequence pkctiltfsylhqnhnilifqkl*iefcni*pt*iklktikikpqifl...*kifw*h*k ld*kyratcyrlc**n--- Frame C: pkctiltfsylhqnhnilifqkl*iefcni*pt*iklktikikpqifl*iylfsqpinq* ttnl*YRY

  17. 7 CFR 248.23 - Records and reports.

    Science.gov (United States)

    2010-01-01

    ..., FMNP coupon issuance and redemption, equipment purchases and inventory, nutrition education, and civil... Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS WIC FARMERS' MARKET NUTRITION PROGRAM (FMNP) Miscellaneous Provisions §...

  18. 7 CFR 248.17 - Management evaluations and reviews.

    Science.gov (United States)

    2010-01-01

    ..., evaluation of management, accountability, certification, nutrition education, financial management systems....17 Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS WIC FARMERS' MARKET NUTRITION PROGRAM (FMNP)...

  19. Thin film type 248-nm bottom antireflective coatings

    Science.gov (United States)

    Enomoto, Tomoyuki; Nakayama, Keisuke; Mizusawa, Kenichi; Nakajima, Yasuyuki; Yoon, Sangwoong; Kim, Yong-Hoon; Kim, Young-Ho; Chung, Hoesik; Chon, Sang Mun

    2003-06-01

    A frequent problem encountered by photoresists during the manufacturing of semiconductor device is that activating radiation is reflected back into the photoresist by the substrate. So, it is necessary that the light reflection is reduced from the substrate. One approach to reduce the light reflection is the use of bottom anti-reflective coating (BARC) applied to the substrate beneath the photoresist layer. The BARC technology has been utilized for a few years to minimize the reflectivity. As the chip size is reduced to sub 0.13-micron, the photoresist thickness has to decrease with the aspect ratio being less than 3.0. Therefore, new Organic BARC is strongly required which has the minimum reflectivity with thinner BARC thickness and higher etch selectivity towards resist. SAMSUNG Electronics has developed the advanced Organic BARC with Nissan Chemical Industries, Ltd. and Brewer Science, Inc. for achieving the above purpose. As a result, the suitable high performance SNAC2002 series KrF Organic BARCs were developed. Using CF4 gas as etchant, the plasma etch rate of SNAC2002 series is about 1.4 times higher than that of conventional KrF resists and 1.25 times higher than the existing product. The SNAC2002 series can minimize the substrate reflectivity at below 40nm BARC thickness, shows excellent litho performance and coating properties.

  20. Dicty_cDB: SSK248 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available rom adult infected midgut library, clone Tse38a11_q1c. 70 4e-17 4 BF294231 |BF294231.1 001PbG02 Pb cDNA #17, Tommaso Pace, Marta... Ponzi, and Clara Frontali Plasmodium berghei cDNA 5', mRNA s...RNA sequence. 50 4e-12 4 T18202 |T18202.1 0812c3 czapPFDd2.1, Debopam Chakrabarti Plasmodium falcipar...07.y1 Xenopus laevis oocyte non normalized Xenopus laevis cDNA clone IMAGE:3747157 5' similar...00 m3a: 0.00 m3b: 0.00 m_ : 1.00 64.0 %: nuclear 28.0 %: cytoplasmic 4.0 %: cytoskeletal 4.0 %: mitochondrial

  1. Dicty_cDB: SFF248 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available PPDQQRLIFA G--- ---KRTPSPFSLKIKRXYANFC*tsxw*txplgsgr*l*h*kxqsqnpxqxrxsprsttf hfrw*tikkwpyxx*lqhpkxipxpfsxxikrwxanxcknlxw*xxpxgsxrf...xxx*kcq sqnsxqxrfsprstxixfxwxtikxwxdxxxlqxskgipxpfsxxxkrxxanxc*nxxr* nxpxgsrrx Transla...*fsl v--- ---KRTPSPFSLKIKRXYANFC*tsxw*txplgsgr*l*h*kxqsqnpxqxrxsprsttf hfrw*tikkwpyxx*lqhpkxipxpfsxxikrwxanxcknlxw*xxpxgsxrf...xxx*kcq sqnsxqxrfsprstxixfxwxtikxwxdxxxlqxskgipxpfsxxxkrxxanxc*nx

  2. 48 CFR 52.248-1 - Value Engineering.

    Science.gov (United States)

    2010-10-01

    ... VECP, such as any net increases in the cost of testing, operations, maintenance, and logistics support... Contracting Officer's forecast of the number of units that will be delivered during the sharing period....

  3. 24 CFR 248.123 - Determination of Federal cost limit.

    Science.gov (United States)

    2010-04-01

    ... rents in the local market area. The relevant local market, and the prevailing rents in such relevant local market, shall be determined on the basis of the appraisal conducted by the appraiser selected by... appropriate. If there are no comparables in the relevant local market and it is not otherwise possible...

  4. 17 CFR 248.126 - Delivery of opt out notices.

    Science.gov (United States)

    2010-04-01

    ... be provided in compliance with either the electronic disclosure provisions in this subpart or the provisions in section 101 of the Electronic Signatures in Global and National Commerce Act, 15 U.S.C. 7001... electronic disclosures by e-mail from the affiliate providing the notice; or (4) Posts the notice on...

  5. Dicty_cDB: VHK248 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available kvlfvmkt*evsvsifmmspst lmpstevvvkssqllvvyxmlln*lppqlx*nqxt**kllpqktllvvftlysivvxvll lvknvvsvphyxlskliyqy*nps...n*rffrwcfpmghqrrccl**kherypfqsl*chpph *chpqrwwsnhpncssctxcc*inclpnxxrtnxlsrnycprk...rywwyllctqssxrycy w*rtsyrfpiixcqssftsirilrfhr*ftfphcrssfptmclrslgfnwccqqr*esh* srfshqkxkrfsprnprs*qiprktlnxls

  6. The determination of americium, curium and californium in biological samples by combined solvent extraction-liquid scintillation counting

    International Nuclear Information System (INIS)

    A method has been developed to extract Am, Cm and Cf from ashed biological samples dissolved in 8 M LiN03-10-2 M HN03 into a liquid/scintillation cocktail. This new method reduces tissue and instrument background and allows use of a larger sample for analysis than when using a commercial gelling cocktail. The extractant cocktail is 20% N,N,N-trioctyl-N-methylammonium chloride dissolved in toluene containing the scintillators p-terphenyl and 1,4-bis-2-(5-phenyl-oxazolyl)-benzene. Several different types of biological samples were analyzed and radionuclide recoveries greater than 90% were obtained in all cases. (author)

  7. Oxidation-reduction properties of americium, curium, berkelium, californium, einsteinium and fermium, and thermodynamic consequences for the 5f series

    International Nuclear Information System (INIS)

    The amalgamation of 5f elements from Am to Fm has been studied by using 241Am, 244Cm, 249Bk, 249Cf, 252Cf, 253Es, 254Es, 252Fm and 255Fm with two electrochemical methods, radiocoulometry and radiopolarography, perfectly adapted to investigate extremely diluted solutions when the concentration of electroactive species is as low as 10-16M. The theory of radiocoulometry has been developed in the general cases of reversible and irreversible electrode process. It has been used to interpret the experimental data on the kinetic curves of amalgamation, and to estimate the standard rate constant of the electrode process in complexing medium (citric). On the other hand the radiopolarographic method has been applied to study the mechanism of reduction at the dropping mercury electrode of cations M3+ in aqueous medium to the metal M with formation of amalgam. The results are exploited into two directions: 1- Acquisition of some data concerning the oxidation-reduction properties of elements from Am to Fm. Therefore the standard electrode E0 [M(III-0)] potentials for Bk, Cf and Es, and the standard electrode E0 [M(II-0)] potential for Fm are estimated and the relative stability of each oxidation state (from II to VII) of 5f elements is discussed; 2- Acquisition of unknown thermodynamic data on transcalifornium elements. Correlations between 4f and 5f elements are precised and some divergences appear for the second half of 4f and 5f series (i.e. for 65<=Z<=71 and 97<=Z<=103)

  8. Raman and absorption spectrophotometric studies of selected lanthanide, californium-doped lanthanide, and actinide trihalides in the solid state

    International Nuclear Information System (INIS)

    The solid-state absorption spectra of Cf(III) ions as a dopant in lanthanide trihalide hosts (LnCl3: Ln = Ce, Sm, and Y; LnBr3: Ln = Ce, Sm, Tb, and Y; LnI3: Ln = Ce and Y) have been recorded. The spectra of Cf(III) have been correlated with the various crystal structures. The phonon Raman spectra and solid-state absorption spectra of PmF3, PmCl3, PmBr3, and two crystal modifications of PmI3 have been recorded. Symmetry assignments have been made for the Raman-active bands for these trihalides and also the sesquioxide. The room-temperature absorption spectra have been correlated to crystal field effects. The symmetry assignments of the Raman-active phonon modes have been made based on polarized Raman spectra from single crystals of YF3-type orthorhombic TbF3 and PuBr3-type orthorhombic NdBr3. Raman spectra of other isostructural lanthanide compounds have been recorded and compared. Symmetry assignments for these compounds have been made by analogy to the single-crystal assignments. Raman spectra have been obtained and catalogued for a number of actinide compounds. Symmetry assignments have been made for the observed Raman-active phonon bands in this work based on the assignments made for isostructural lanthanide compounds. 29 figs., 22 tabs

  9. Optical Transitions in Highly Charged Californium Ions with High Sensitivity to Variation of the Fine-Structure Constant

    Science.gov (United States)

    Berengut, J. C.; Dzuba, V. A.; Flambaum, V. V.; Ong, A.

    2012-08-01

    We study electronic transitions in highly charged Cf ions that are within the frequency range of optical lasers and have very high sensitivity to potential variations in the fine-structure constant, α. The transitions are in the optical range despite the large ionization energies because they lie on the level crossing of the 5f and 6p valence orbitals in the thallium isoelectronic sequence. Cf16+ is a particularly rich ion, having several narrow lines with properties that minimize certain systematic effects. Cf16+ has very large nuclear charge and large ionization energy, resulting in the largest α sensitivity seen in atomic systems. The lines include positive and negative shifters.

  10. Optical transitions in highly-charged californium ions with high sensitivity to variation of the fine-structure constant

    CERN Document Server

    Berengut, J C; Flambaum, V V; Ong, A

    2012-01-01

    We study electronic transitions in highly-charged Cf ions that are within the frequency range of optical lasers and have very high sensitivity to potential variations in the fine-structure constant, alpha. The transitions are in the optical despite the large ionisation energies because they lie on the level-crossing of the 5f and 6p valence orbitals in the thallium isoelectronic sequence. Cf16+ is a particularly rich ion, having several narrow lines with properties that minimize certain systematic effects. Cf16+ has very large nuclear charge and large ionisation energy, resulting in the largest alpha-sensitivity seen in atomic systems. The lines include positive and negative shifters.

  11. Integral range, energy, residual range, and linear energy transfer distributions for Californium fission fragments in microelectronics materials

    International Nuclear Information System (INIS)

    This report discusses the advantages and limitations of using Cf-252 radiation sources for single event testing of microelectronics for space environments. Integral distributions for the range, energy, residual range, and linear energy transfer of Cf-252 fission fragments in absorber and microelectronic materials have been calculated. Techniques are suggested for determining when single event testing using Cf-252 is appropriate; also, techniques are given for estimating the saturation cross section and thresh old linear energy transfer from test data. 10 refs., 25 figs., 2 tabs

  12. Research and experimental work at Groote Schuur Hospital and the University of Cape Town using californium-252 sources

    International Nuclear Information System (INIS)

    Experiments have been undertaken to determine the high-LET and low-LET components of the absorbed dose from neutron beams. This is achieved by measuring the fluxes of the high-LET and low-LET radiations in a tissue-equivalent phantom individually and simultaneously using a scintillation probe fitted with a pulse shape discriminator. This system was successfully used with a 22 MeV neutron beam from the T(d,n) reaction and has been employed with 252Cf sources. Results obtained in the low-energy ranges (up to 3 MeV) indicate that the electron counts exceed the high-LET counts by a factor of 2 to 3. These results are related to the absorbed dose. Calculations have also been undertaken to establish whether the Paterson-Parker system could be used for the design of 252Cf treatments and the optimum needle activities to yield the desired dose. Experiments are under way to determine the variation of RBE and OER for 252Cf radiations around the source. The inhibition of root growth in Vicia Faba is being used to determine any such effects. Dose rates comparable to that employed in interstitial radiotherapy are being aimed at. A study of dose fractionation effects is also being undertaken. (author)

  13. К ВОПРОСУ О ПОНЯТИИ ПРЕДМЕТА И ОБЪЕКТА ПРЕСТУПЛЕНИЯ, ПРЕДУСМОТРЕННОГО СТ. 248 УГОЛОВНОГО КОДЕКСА РФ

    OpenAIRE

    Андреева, Л.

    2010-01-01

    В статье рассматривается понятие предмета и объекта преступления, предусмотренного ст. 248 УК РФ (Нарушение правил безопасности при обращении с микробиологическими либо другими биологическими агентами или токсинами). Автор сопоставляет разные точки зрения ученых-исследователей в этой области, анализирует их, делает свои выводы....

  14. Wavelength tuning of photonic crystal waveguides fabricated using 248-nm deep UV lithography

    DEFF Research Database (Denmark)

    Zhuang, Yanxin; Frandsen, Lars Hagedorn; Harpøth, Anders;

    2004-01-01

    Wavelength tuning of characteristic features of straight photonic crystal waveguides has been obtained by varying the exposure dose in deep UV lithography. The experimental results agree very well with numerical simulations....

  15. 17 CFR 248.6 - Information to be included in privacy notices.

    Science.gov (United States)

    2010-04-01

    ... the types of third parties in each category: (i) Financial service providers; (ii) Non-financial... (CONTINUED) REGULATIONS S-P AND S-AM Regulation S-P: Privacy of Consumer Financial Information and... party to market products or services that you offer alone or jointly with another financial...

  16. Laser-induced condensation by ultrashort laser pulses at 248 nm

    OpenAIRE

    Joly, P; Petrarca, M.; Vogel, A.(Physikalisches Institut, University of Bonn, Bonn, Germany); Pohl, T; Nagy, T.; Jusforgues, Q.; Simon, P.; Kasparian, J.; Weber, K.; Wolf, J.-P.

    2013-01-01

    We compare laser-induced condensation by UV laser pulses of femtosecond, sub-picosecond, and nanosecond duration between each other, as well as with respect to near-infrared (NIR) (800 nm) ultrashort laser pulses. Particle nucleation by UV pulses is so efficient that their growth beyond several hundreds of nm is limited by the local concentration of water vapour molecules. Furthermore, we evidence a dual mechanism: While condensation induced by ultrashort UV pulses rely on nitrogen photo-oxid...

  17. Design of 24.8-kW, 3.8 K cryogenic system for ISABELLE

    International Nuclear Information System (INIS)

    ISABELLE will consist of two proton accelerator/storage rings in a common tunnel. There will be 1084 superconducting magnets installed in the 3.8 km circumference tunnel. The protons will be accelerated to an energy of 400 GeV in each ring and stored for 24 hours. The two beams are counter-rotating and intersect at six places around the ring. The particles which emerge from proton interactions at these intersecting points are studied using various types of detectors

  18. Prompt Neutron Emission from Fragments in Spontaneous Fission of 244, 248Cm and 252Cf

    Science.gov (United States)

    Vorobyev, A. S.; Dushin, V. N.; Hambsch, F.-J.; Jakovlev, V. A.; Kalinin, V. A.; Laptev, A. B.; Petrov, B. F.; Shcherbakov, O. A.

    2005-11-01

    Neutrons emitted in fission were measured separately for each complementary fragment in correlation with fission fragment energies. Two high efficient Gd-loaded liquid scintillator tanks were used for neutron registration. Fission fragment energies were measured using a twin Frisch gridded ionization chamber with a pin-hole collimator. The neutron multiplicity distributions were obtained for each value of the fission fragment mass and energy and corrected for neutron registration efficiency, background and pile-up. The dependencies of these distributions on fragment mass and energy for different energy and mass bins, as well as the mass and energy distribution of the fission fragments are presented and discussed.

  19. 7 CFR 248.22 - Nonprocurement debarment/suspension, drug-free workplace, and lobbying restrictions.

    Science.gov (United States)

    2010-01-01

    ... requirements of the Department's regulations governing nonprocurement debarment/suspension (7 CFR part 3017), drug-free workplace (7 CFR part 3017), and the Department's regulations governing restrictions on lobbying (7 CFR part 3018), where applicable....

  20. 17 CFR 248.4 - Initial privacy notice to consumers required.

    Science.gov (United States)

    2010-04-01

    ... to be used primarily for personal, family, or household purposes, you satisfy the initial notice... reflects your privacy policies and practices to: (1) Customer. An individual who becomes your customer, not later than when you establish a customer relationship, except as provided in paragraph (e) of...

  1. SU-E-J-248: Contributions of Tumor and Stroma Phenotyping in Computer-Aided Diagnosis

    Energy Technology Data Exchange (ETDEWEB)

    Li, H; Lan, L; Sennett, C; Giger, M [Univ Chicago, Chicago, IL (United States)

    2015-06-15

    Purpose: To gain insight into the role of parenchyma stroma in the characterization of breast tumors by incorporating computerized mammographic parenchyma assessment into breast CADx in the task of distinguishing between malignant and benign lesions. Methods: This study was performed on 182 biopsy-proven breast mass lesions, including 76 benign and 106 malignant lesions. For each full-field digital mammogram (FFDM) case, our quantitative imaging analysis was performed on both the tumor and a region-of-interest (ROI) from the normal contralateral breast. The lesion characterization includes automatic lesion segmentation and feature extraction. Radiographic texture analysis (RTA) was applied on the normal ROIs to assess the mammographic parenchymal patterns of these contralateral normal breasts. Classification performance of both individual computer extracted features and the output from a Bayesian artificial neural network (BANN) were evaluated with a leave-one-lesion-out method using receiver operating characteristic (ROC) analysis with area under the curve (AUC) as the figure of merit. Results: Lesion characterization included computer-extracted phenotypes of spiculation, size, shape, and margin. For parenchymal pattern characterization, five texture features were selected, including power law beta, contrast, and edge gradient. Merging of these computer-selected features using BANN classifiers yielded AUC values of 0.79 (SE=0.03) and 0.67 (SE=0.04) in the task of distinguishing between malignant and benign lesions using only tumor phenotypes and texture features from the contralateral breasts, respectively. Incorporation of tumor phenotypes with parenchyma texture features into the BANN yielded improved classification performance with an AUC value of 0.83 (SE=0.03) in the task of differentiating malignant from benign lesions. Conclusion: Combining computerized tumor and parenchyma phenotyping was found to significantly improve breast cancer diagnostic accuracy highlighting the need to consider both tumor and stroma in decision making. Funding: University of Chicago Dean Bridge Fund, NCI U24-CA143848-05, P50-CA58223 Breast SPORE program, and Breast Cancer Research Foundation. COI: MLG is a stockholder in R2 technology/Hologic and receives royalties from Hologic, GE Medical Systems, MEDIAN Technologies, Riverain Medical, Mitsubishi, and Toshiba. MLG is a cofounder and stockholder in Quantitative Insights.

  2. SU-E-J-248: Contributions of Tumor and Stroma Phenotyping in Computer-Aided Diagnosis

    International Nuclear Information System (INIS)

    Purpose: To gain insight into the role of parenchyma stroma in the characterization of breast tumors by incorporating computerized mammographic parenchyma assessment into breast CADx in the task of distinguishing between malignant and benign lesions. Methods: This study was performed on 182 biopsy-proven breast mass lesions, including 76 benign and 106 malignant lesions. For each full-field digital mammogram (FFDM) case, our quantitative imaging analysis was performed on both the tumor and a region-of-interest (ROI) from the normal contralateral breast. The lesion characterization includes automatic lesion segmentation and feature extraction. Radiographic texture analysis (RTA) was applied on the normal ROIs to assess the mammographic parenchymal patterns of these contralateral normal breasts. Classification performance of both individual computer extracted features and the output from a Bayesian artificial neural network (BANN) were evaluated with a leave-one-lesion-out method using receiver operating characteristic (ROC) analysis with area under the curve (AUC) as the figure of merit. Results: Lesion characterization included computer-extracted phenotypes of spiculation, size, shape, and margin. For parenchymal pattern characterization, five texture features were selected, including power law beta, contrast, and edge gradient. Merging of these computer-selected features using BANN classifiers yielded AUC values of 0.79 (SE=0.03) and 0.67 (SE=0.04) in the task of distinguishing between malignant and benign lesions using only tumor phenotypes and texture features from the contralateral breasts, respectively. Incorporation of tumor phenotypes with parenchyma texture features into the BANN yielded improved classification performance with an AUC value of 0.83 (SE=0.03) in the task of differentiating malignant from benign lesions. Conclusion: Combining computerized tumor and parenchyma phenotyping was found to significantly improve breast cancer diagnostic accuracy highlighting the need to consider both tumor and stroma in decision making. Funding: University of Chicago Dean Bridge Fund, NCI U24-CA143848-05, P50-CA58223 Breast SPORE program, and Breast Cancer Research Foundation. COI: MLG is a stockholder in R2 technology/Hologic and receives royalties from Hologic, GE Medical Systems, MEDIAN Technologies, Riverain Medical, Mitsubishi, and Toshiba. MLG is a cofounder and stockholder in Quantitative Insights

  3. Morphology of Copper Tin Sulfide Films Grown by Pulsed Laser Deposition at 248 and 355 nm

    DEFF Research Database (Denmark)

    Ettlinger, Rebecca Bolt; Cazzaniga, Andrea Carlo; Crovetto, Andrea;

    Thin films solar cells based on Cu2ZnSnS4 (CZTS) as absorber layer have seen a rapid development leading to a world record of 8.8% [1]. However, other p-type semiconductors with fewer elements and reduced complexity compared to CZTS are also available, such as ternary Cu–Sn–S systems, i.e. Cu2SnS3...

  4. 7 CFR 2.48 - Administrator, Rural Business-Cooperative Service.

    Science.gov (United States)

    2010-01-01

    ... Loan program (7 U.S.C. 6616). (11) Administer programs authorized by the Cooperative Marketing Act of... Agricultural Marketing Act of 1946 (7 U.S.C. 1621-1627). (13) Work with institutions and international... Executive Order 12088, 3 CFR, 1978 Comp., p. 243, to enter into an inter-agency agreement with the...

  5. 17 CFR 248.121 - Affiliate marketing opt out and exceptions.

    Science.gov (United States)

    2010-04-01

    ... response to this communication. (iii) A registered investment adviser makes a marketing call to the... marketing solicitations would respond to the consumer-initiated communication about mutual funds. (4... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Affiliate marketing opt...

  6. 26 CFR 1.248-1T - Election to amortize organizational expenditures (temporary).

    Science.gov (United States)

    2010-04-01

    ... irrevocable and applies to all organizational expenditures of the corporation. A change in the characterization of an item as an organizational expenditure is a change in method of accounting to which sections... as a change in method of accounting if the corporation amortized organizational expenditures for...

  7. Morphology of Copper Tin Sulfide Films Grown by Pulsed Laser Deposition at 248 and 355 nm

    OpenAIRE

    Ettlinger, Rebecca Bolt; Cazzaniga, Andrea Carlo; Crovetto, Andrea; Ravnkilde, Lasse; Youngman, Tomas Hugh; Canulescu, Stela; Hansen, Ole; Pryds, Nini; Schou, Jørgen

    2015-01-01

    Thin films solar cells based on Cu2ZnSnS4 (CZTS) as absorber layer have seen a rapid development leading to a world record of 8.8% [1]. However, other p-type semiconductors with fewer elements and reduced complexity compared to CZTS are also available, such as ternary Cu–Sn–S systems, i.e. Cu2SnS3 (CTS) [2].

  8. Two-photon-absorption of frequency converter crystals at 248 nm

    Science.gov (United States)

    Divall, M.; Osvay, K.; Kurdi, G.; Divall, E. J.; Klebniczki, J.; Bohus, J.; Péter, Á.; Polgár, K.

    2005-12-01

    The two-photon-absorption coefficient of KDP, BBO, LTB, and CLBO crystals has been determined from the measurement of the intensity dependent transmission through long samples. The intensity of the sub-picosecond KrF excimer laser pulses on the samples was varied from 0.2-80 GW/cm2. The linear absorption of the samples was determined by using a low intensity, long pulse KrF laser. The first-principle simulations to the experimental data show a TPA value of 0.48 cm/GW for KDP, 0.5 cm/GW (o-ray) and 0.34 cm/GW (e-ray) in BBO, 0.22 cm/GW in LTB and 0.53 cm/GW in CLBO.

  9. 17 CFR 248.15 - Other exceptions to notice and opt out requirements.

    Science.gov (United States)

    2010-04-01

    ... COMMISSION (CONTINUED) REGULATIONS S-P AND S-AM Regulation S-P: Privacy of Consumer Financial Information and... to judicial process or government regulatory authorities having jurisdiction over you for examination..., service, product, or transaction; (ii) To protect against or prevent actual or potential...

  10. 27 CFR 24.248 - Processes authorized for the treatment of wine, juice, and distilling material.

    Science.gov (United States)

    2010-04-01

    ... into low Brix and high Brix juice fractions The low Brix fraction derived from such processing may be used in wine production. The high Brix fraction derived from such processing shall not be diluted with water for use in wine production. Thin-film evaporation under reduced pressure 1 To separate wine into...

  11. Ingraham v. Wright, 498 F.2d 248 (5th Cir. 1974)

    Science.gov (United States)

    Federal Reporter, 2d. Series, 1974

    1974-01-01

    Text of a Federal Appeals Court case in which parents sought damages and injunctive relief as to use of corporal punishment in a county school system. The evidence established that use of corporal punishment at one school violated due process and the constitutional prohibition against cruel and unusual punishment. (JF)

  12. 17 CFR 248.9 - Delivering privacy and opt out notices.

    Science.gov (United States)

    2010-04-01

    ... you deliver the notice with or in a stockholder or shareholder report under the conditions in 17 CFR 270.30d-1(f) or 17 CFR 270.30d-2(b), or with or in a prospectus under the conditions in 17 CFR 230.154... expectation of actual notice. You may reasonably expect that a consumer will receive actual notice if you:...

  13. People and things. CERN Courier, Oct 1984, v. 24(8)

    International Nuclear Information System (INIS)

    The article reports on achievements of various people, staff changes and position opportunities within the CERN organization and contains news updates on upcoming or past events. The second Jerusalem Winter School of Theoretical Physics, sponsored by Israel's Ministry of Science and the Institute for Advanced Studies of the Hebrew University of Jerusalem will take place form 27 December 1984 to 4 January 1985, with the title 'Physics in Higher Dimensions '. Formed this year in the University of Tokyo is ICEPP - International Centre for Elementary Particle Physics - under Masatoshi Koshiba. With sports commentators exhausted after the long grind of the British football season, the 10th UK National Bubble Chamber Fivea-Side Soccer Tournament held in London earlier this year did not attract the media coverage it deserved

  14. COS Observations of Molecular H2 at z = 0.248

    Science.gov (United States)

    Kruse, Ethan; Tumlinson, J.; Thom, C.; Sembach, K.

    2011-01-01

    We present HST/COS observations of a QSO sightline through the halo of two merging galaxies at z = 0.25 at impact parameter 90 kpc. This sightline presents the first example of strong H2 absorption features in our large COS survey of galaxy halo gas at low redshift (COS-Halos, Tumlinson et al.). COS spectra reveal a sub-DLA at z = 0.2478 which splits into two components separated by 70 km/s. One component appears to contain more high-ionization states and less neutral H I while the other favors neutral atoms and contains a strong H2 signature (J = 0-3) along with the majority of the H I. Aside from H2 we detect O I, N I and N II, Si II and Si III, and C II. We find a total H2 column density of N(H2) = 16.89 and an H2 fraction of f_{H2} = 0.0034. Fitting the unblended H2 lines from 0-0 to 15-0 to a curve of growth we find a best fit with b = 11.8 km s-1. Due to the full saturation of all Lyman lines, we are unable to separate the H I column density into the two components and therefore cannot get a direct metallicity for either cloud. However through Cloudy modelling we are able to estimate a H I column density and ionization correction in each component and therefore obtain an approximate metallicity through O I absorption. This system shows similar features to a portion of the Magellanic Stream studied by Sembach et al. 2006. Both sightlines have comparable H I and H2 columns, H2 excitation temperatures, and similar metallicities, suggesting this sightline could be a distant counterpart to the Magellanic Stream, perhaps stripped from an unseen companion galaxy to the two merger partners.

  15. Radiological Characterization Technical Report on Californium-252 Sealed Source Transuranic Debris Waste for the Off-Site Source Recovery Project at Los Alamos National Laboratory

    Energy Technology Data Exchange (ETDEWEB)

    Feldman, Alexander [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2014-04-24

    This document describes the development and approach for the radiological characterization of Cf-252 sealed sources for shipment to the Waste Isolation Pilot Plant. The report combines information on the nuclear material content of each individual source (mass or activity and date of manufacture) with information and data on the radionuclide distributions within the originating nuclear material. This approach allows for complete and accurate characterization of the waste container without the need to take additional measurements. The radionuclide uncertainties, developed from acceptable knowledge (AK) information regarding the source material, are applied to the summed activities in the drum. The AK information used in the characterization of Cf-252 sealed sources has been qualified by the peer review process, which has been reviewed and accepted by the Environmental Protection Agency.

  16. The development and medical applications of a simple facility for partial body in vivo neutron activation analysis using californium-252 sources

    International Nuclear Information System (INIS)

    A simple and cheap facility for partial body neutron activation analysis has been designed, based on the use of two 100 μg 252Cf neutron sources. The results reported show that calcium can be measured in parts of the body such as the tibia with a precision as good as +- 1.6 % for a radiation dose of 2 rem. The uniformity of the thermal neutron flux density is better than +- 3 % over 10 cm. Some applications of this irradiation facility for studies of trace elements, in particular cadmium in liver and aluminium in liver or brain, have also been explored. However, the sensitivity attainable is not yet sufficient for the study of normal levels, but could be of interest in toxicological investigations

  17. Analysis on related factors of 248 cases of failed drug abortion%药物流产失败248例患者的相关因素分析

    Institute of Scientific and Technical Information of China (English)

    高继燕

    2013-01-01

    [Objective]To analyze the reasons of failed drug abortion,master its indication and contraindication.[Methods]2366 patients with failed drug abortion,who received the drug abortion (mifepristone combined with misoprostol) in Tanggu Dahua Hospital of Tianjin,were collected,and a retrospective analysis was conducted to analyze their gestational age,times of pregnancy,diameter of the gestational sac,age of pregnant women and uterine position.[Results] The rate of failed drug abortion in patients with the factors of long time of menopause,more pregnant rimes,diameter of the gestational sac > 2 cm,over 35 years old,uterine retroversion retroflexion increased significantly (P < 0.05).[Conclusion] The factors which affect the success rate of drug abortion include gestational age,times of pregnancy,diameter of the gestational sac,age of pregnant women and uterine position.%目的 分析药物流产失败的原因,以严格掌握其适应证及禁忌证.方法 对2366例在天津市塘沽大华院门诊行药物(米非司酮配合米索前列醇)流产失败患者的孕龄、孕产次数、孕囊直径、孕妇年龄、子宫位置方式等进行回顾性分析.结果 停经时间长、孕产次数越多、孕囊直径>2 cm、年龄≥35岁、子宫后倾后屈位者,使用药物流产失败率明显增高(P<0.05).结论 影响药物流产成功的因素有孕龄、孕产次数、孕囊直径、孕妇年龄、子宫位置.

  18. 17 CFR 248.14 - Exceptions to notice and opt out requirements for processing and servicing transactions.

    Science.gov (United States)

    2010-04-01

    ... collection of amounts charged, debited, or otherwise paid using a debit, credit, or other payment card, check... private label credit card program or other extension of credit on behalf of such entity; or (3) A proposed... therein; or (C) The audit of debit, credit, or other payment information....

  19. SU-E-T-248: Near Real-Time Analysis of Radiation Delivery and Imaging, Accuracy to Ensure Patient Safety

    International Nuclear Information System (INIS)

    Purpose: To develop and optimize an effective software method for comparing planned to delivered control point machine parameters for all VARIAN TrueBeam treatments so as to permit (1) assessment of a large patient pool throughout their treatment course to quantify treatment technique specific systematic and random uncertainty of observables, (2) quantify the site specific daily imaging shifts required for target alignment, and (3) define tolerance levels for mechanical parameters and imaging parameters based on statistical analysis data gathered, and the dosimetric impact of variations. Methods: Treatment and imaging log files were directly compared to plan parameters for Eclipse and Pinnacle planned treatments via 3D, IMRT, control point, RapidArc, and electrons. Each control point from all beams/arcs (7984) for all fractions (1940) of all patients treated over six months were analyzed. At each control point gantry angle, collimator angle, couch angle, jaw positions, MLC positions, MU were compared. Additionally per-treatment isocenter shifts were calculated. Results were analyzed as a whole in treatment type subsets: IMRT, 3D, RapidArc; and in treatment site subsets: brain, chest/mediastinum, esophagus, H and N, lung, pelvis, prostate. Results: Daily imaging isocenter shifts from initial external tattoo alignment were dependent on the treatment site with < 0.5 cm translational shifts for H and N, Brain, and lung SBRT, while pelvis, esophagus shifts were ∼1 cm. Mechanical delivery parameters were within tolerance levels for all sub-beams. The largest variations were for RapidArc plans: gantry angle 0.11±0.12,collimator angle 0.00±0.00, jaw positions 0.48±0.26, MLC leaf positions 0.66±0.08, MU 0.14±0.34. Conclusion: Per-control point validation reveals deviations between planned and delivered parameters. If used in a near real-time error checking system, patient safety can be improved by equipping the treatment delivery system with additional forcing functions which by-pass human error avenues

  20. Distribution of Prompt Neutron Emission Probability for Fission Fragments in Spontaneous Fission of 252Cf and 244,248Cm

    Science.gov (United States)

    Vorobyev, A. S.; Dushin, V. N.; Hambsch, F.-J.; Jakovlev, V. A.; Kalinin, V. A.; Laptev, A. B.; Petrov, B. F.; Shcherbakov, O. A.

    2005-05-01

    Neutrons emitted in fission events were measured separately for each complementary fragment in correlation with fission fragment energies. Two high-efficiency Gd-loaded liquid scintillator tanks were used for neutron registration. Fission fragment energies were measured using a twin Frisch gridded ionization chamber with a pinhole collimator. The neutron multiplicity distributions were obtained for each value of the fission fragment mass and energy and corrected for neutron registration efficiency, background, and pile-up. The dependency of these distributions on fragment mass and energy for different energy and mass bins as well as mass and energy distribution of fission fragments are presented and discussed.

  1. 30 CFR 250.248 - What solid and liquid wastes and discharges information and cooling water intake information must...

    Science.gov (United States)

    2010-07-01

    ..., sanitary and domestic wastes, produced waters, and chemical product wastes) likely to be generated by your..., and rate of discharge for each waste type; and (2) A description of the discharge method (such...

  2. 24 CFR 203.438 - Mortgages on Indian land insured pursuant to section 248 of the National Housing Act.

    Science.gov (United States)

    2010-04-01

    ...-FEDERAL HOUSING COMMISSIONER, DEPARTMENT OF HOUSING AND URBAN DEVELOPMENT MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES SINGLE FAMILY MORTGAGE INSURANCE Contract Rights... receive insurance benefits, a mortgagee shall be entitled to receive such benefits on a mortgage...

  3. SU-E-T-248: Near Real-Time Analysis of Radiation Delivery and Imaging, Accuracy to Ensure Patient Safety

    Energy Technology Data Exchange (ETDEWEB)

    Wijesooriya, K; Seitter, K; Desai, V; Read, P; Larner, J [University of Virginia Health Systems, Charlottesville, VA (United States)

    2014-06-01

    Purpose: To develop and optimize an effective software method for comparing planned to delivered control point machine parameters for all VARIAN TrueBeam treatments so as to permit (1) assessment of a large patient pool throughout their treatment course to quantify treatment technique specific systematic and random uncertainty of observables, (2) quantify the site specific daily imaging shifts required for target alignment, and (3) define tolerance levels for mechanical parameters and imaging parameters based on statistical analysis data gathered, and the dosimetric impact of variations. Methods: Treatment and imaging log files were directly compared to plan parameters for Eclipse and Pinnacle planned treatments via 3D, IMRT, control point, RapidArc, and electrons. Each control point from all beams/arcs (7984) for all fractions (1940) of all patients treated over six months were analyzed. At each control point gantry angle, collimator angle, couch angle, jaw positions, MLC positions, MU were compared. Additionally per-treatment isocenter shifts were calculated. Results were analyzed as a whole in treatment type subsets: IMRT, 3D, RapidArc; and in treatment site subsets: brain, chest/mediastinum, esophagus, H and N, lung, pelvis, prostate. Results: Daily imaging isocenter shifts from initial external tattoo alignment were dependent on the treatment site with < 0.5 cm translational shifts for H and N, Brain, and lung SBRT, while pelvis, esophagus shifts were ∼1 cm. Mechanical delivery parameters were within tolerance levels for all sub-beams. The largest variations were for RapidArc plans: gantry angle 0.11±0.12,collimator angle 0.00±0.00, jaw positions 0.48±0.26, MLC leaf positions 0.66±0.08, MU 0.14±0.34. Conclusion: Per-control point validation reveals deviations between planned and delivered parameters. If used in a near real-time error checking system, patient safety can be improved by equipping the treatment delivery system with additional forcing functions which by-pass human error avenues.

  4. Discovery of an Excess of Halpha Emitters around 4C 23.56 at z=2.48

    CERN Document Server

    Tanaka, Ichi; Kurk, Jaron D; Taniguchi, Yoshiaki; Kodama, Tadayuki; Matsuda, Yuichi; Packham, Chris; Zirm, Andrew; Kajisawa, Masaru; Ichikawa, Takashi; Seymour, Nick; Stern, Daniel; Stockton, Alan; Venemans, Bram P; Vernet, Joël

    2010-01-01

    We report the discovery of a significant excess of candidate Halpha emitters (HAEs) in the field of the radio galaxy 4C 23.56 at z=2.483. Using the MOIRCS near-infrared imager on the Subaru Telescope we found 11 candidate emission-line galaxies to a flux limit of ~7.5 10^-17 erg s-1 cm-2, which is about 5 times excess from the expected field counts with ~3-sigma significance. Three of these are spectroscopically confirmed as redshifted Halpha at z=2.49. The distribution of candidate emitters on the sky is tightly confined to a 1.2-Mpc-radius area at z=2.49, locating 4C 23.56 at the western edge of the distribution. Analysis of the deep Spitzer MIPS 24 mu m imaging shows that there is also an excess of faint MIPS sources. All but two of the 11 HAEs are also found in the MIPS data. The inferred star-formation rate (SFR) of the HAEs based on the extinction-corrected Halpha luminosity (median SFR >~100 M_solar yr-1) is similar to those of HAEs in random fields at z~2. On the other hand, the MIPS-based SFR for the...

  5. Ras signaling enhances the activity of C/EBPalpha to induce granulocytic differentiation by phosphorylation of serine 248

    OpenAIRE

    Singh, Sheo Mohan

    2003-01-01

    The transcription factor C/EBPa regulates early steps of normal granulocyte differentiation since mice with a disruption of the C/EBPa gene do not express detectable levels of the G-CSF receptor and produce no neutrophils. We have recently shown that C/EBPa function is also impaired in acute myeloid leukemias. However, how the transcriptional activity of C/EBPa is regulated both in myelopoiesis and leukemogenesis, is not fully understood. The current study demonstrates th...

  6. SU-E-J-248: Comparative Study of Two Image Registration for Image-Guided Radiation Therapy in Esophageal Cancer

    International Nuclear Information System (INIS)

    Purpose: Image-guided radiation therapy (IGRT) is one of the major treatment of esophageal cancer. Gray value registration and bone registration are two kinds of image registration, the purpose of this work is to compare which one is more suitable for esophageal cancer patients. Methods: Twenty three esophageal patients were treated by Elekta Synergy, CBCT images were acquired and automatically registered to planning kilovoltage CT scans according to gray value or bone registration. The setup errors were measured in the X, Y and Z axis, respectively. Two kinds of setup errors were analysed by matching T test statistical method. Results: Four hundred and five groups of CBCT images were available and the systematic and random setup errors (cm) in X, Y, Z directions were 0.35, 0.63, 0.29 and 0.31, 0.53, 0.21 with gray value registration, while 0.37, 0.64, 0.26 and 0.32, 0.55, 0.20 with bone registration, respectively. Compared with bone registration and gray value registration, the setup errors in X and Z axis have significant differences. In Y axis, both measurement comparison results of T value is 0.256 (P value > 0.05); In X axis, the T value is 5.287(P value < 0.05); In Z axis, the T value is −5.138 (P value < 0.05). Conclusion: Gray value registration is recommended in image-guided radiotherapy for esophageal cancer and the other thoracic tumors. Manual registration could be applied when it is necessary. Bone registration is more suitable for the head tumor and pelvic tumor department where composed of redundant interconnected and immobile bone tissue

  7. Freeze drying method for preparing radiation source material

    International Nuclear Information System (INIS)

    Fabrication of a neutron source is specifically claimed. A palladium/californium solution is freeze dried to form a powder which, through conventional powder metallurgy, is shaped into a source containing the californium evenly distributed through a palladium metal matrix. (E.C.B.)

  8. Review of RBE and OER values for Cf-neutrons

    International Nuclear Information System (INIS)

    Californium-252, an isotope emitting neutrons, gamma photons and alpha particles, is being investigated for its practical use in intracavitary and interstitial brachytherapy. A review of published RBE and OER values for californium neutrons as a function of dose rate for a variety of biological endpoints is given. (Auth.)

  9. Collecting high-order interactions in an effective pairwise intermolecular potential using the hydrated ion concept: The hydration of Cf{sup 3+}

    Energy Technology Data Exchange (ETDEWEB)

    Galbis, Elsa; Pappalardo, Rafael R.; Marcos, Enrique Sánchez, E-mail: sanchez@us.es [Departmento de Química Física, Universidad de Sevilla, 41012 Seville (Spain); Hernández-Cobos, Jorge [Instituto de Ciencias Físicas, UNAM, Apartado Postal 48-3, 62251 Cuernavaca (Mexico)

    2014-06-07

    This work proposes a new methodology to build interaction potentials between a highly charged metal cation and water molecules. These potentials, which can be used in classical computer simulations, have been fitted to reproduce quantum mechanical interaction energies (MP2 and BP86) for a wide range of [M(H{sub 2}O){sub n}]{sup m+}(H{sub 2}O){sub ℓ} clusters (n going from 6 to 10 and ℓ from 0 to 18). A flexible and polarizable water shell model (Mobile Charge Density of Harmonic Oscillator) has been coupled to the cation-water potential. The simultaneous consideration of poly-hydrated clusters and the polarizability of the interacting particles allows the inclusion of the most important many-body effects in the new polarizable potential. Applications have been centered on the californium, Cf(III) the heaviest actinoid experimentally studied in solution. Two different strategies to select a set of about 2000 structures which are used for the potential building were checked. Monte Carlo simulations of Cf(III)+500 H{sub 2}O for three of the intermolecular potentials predict an aquaion structure with coordination number close to 8 and average R{sub Cf−−O} in the range 2.43–2.48 Å, whereas the fourth one is closer to 9 with R{sub Cf−−O} = 2.54 Å. Simulated EXAFS spectra derived from the structural Monte Carlo distribution compares fairly well with the available experimental spectrum for the simulations bearing 8 water molecules. An angular distribution similar to that of a square antiprism is found for the octa-coordination.

  10. A Pacemaker with P=2.48 hour Modulated the Generator of Flares in the X-ray Light Curve of Sgr A* in the year 2012

    CERN Document Server

    Leibowitz, Elia M

    2016-01-01

    In an intensive observational campaign in the 9 month duration of Chandra X-ray Visionary Project that was conducted in the year 2012, 39 large X-ray flares of Sgr A* were recorded. An analysis of the times of the observed flares reveals that the 39 flares are separated in time by intervals that are grouped around integer numbers times 0.10333 days. This time interval is thus the period of a uniform grid of equally spaced points on the time axis. The grouping of the flares around tic marks of this grid is derived from the data with at least a 3.2 {\\sigma} level of statistical significance. No signal of any period can be found among 22 flares recorded by Chandra in the years 2013-2014. If the 0.10333 d period is that of a nearly circular Keplerian orbit around the blackhole at the center of the Galaxy, its radius is at 7.6 Schwarzschild radii. Large flares were more likely to be triggered when the agent responsible for their outbursts was near the peri-center phase of its slightly eccentric orbit.

  11. Residues 248–252 and 300–304 of the cardiac Na+/Ca2+ exchanger are involved in its regulation by phospholemman

    OpenAIRE

    Zhang, Xue-Qian; Wang, JuFang; Song, Jianliang; Ji, Angi M.; Chan, Tung O.; Cheung, Joseph Y.

    2011-01-01

    Using split cardiac Na+/Ca2+ exchangers (NCX1), we previously demonstrated that phospholemman (PLM) regulates NCX1 by interacting with the proximal linker domain (residues 218–358) of the intracellular loop of NCX1. With the use of overlapping loop deletion mutants, interaction sites are localized to two regions spanning residues 238–270 and residues 300–328 of NCX1. In this study, we used alanine (Ala) linker scanning to pinpoint the residues in the proximal linker domain involved in regulat...

  12. Conflitos Sociais na Europa: uma paz impossível? 10.5102/uri.v4i1.248

    Directory of Open Access Journals (Sweden)

    Leila Bijos

    2007-08-01

    Full Text Available Análise dos movimentos sociais na França e na América Latina, num contexto de ausência de programas políticos de inserção de imigrantes. Por meio da violência, os jovens manifestantes expressam seu inconformismo com o desemprego, o fracasso escolar e outros sintomas da discriminação de que se julgam vítimas, inclusive por parte da polícia. A passagem do estado de natureza até o estado social produz no homem uma mudança bem acentuada, substituindo, em sua conduta, o instinto pelo sentimento de justiça, e outorgando a suas ações relações morais que antes estavam ausentes. À medida que a repressão se intensifique, fica ainda mais difícil a percepção da realidade. A França, como sociedade pode converter-se em uma ameaça a si própria ao não combinar integração e diferenças socioeconômicas, superando a oposição entre um modelo republicano e um comunitarismo carregado de agressividade. A América Latina vivenciou uma longa era de repressão militar, de violência, oprimida por um Estado distante dos indivíduos; incapaz de suprí-los com políticas públicas e sociais. Na sociedade civil é onde surgem e se desenvolvem os conflitos econômicos, sociais, ideológicos, religiosos, que as instituições públicas têm o dever de equacionar.

  13. Phosphorylation of Serine 248 of C/EBPa Is Dispensable for Myelopoiesis but Its Disruption Leads to a Low Penetrant Myeloid Disorder with Long Latency

    DEFF Research Database (Denmark)

    Hasemann, Marie S; Schuster, Mikkel B; Frank, Anne-Katrine; Theilgaard-Mönch, Kim; Pedersen, Thomas Å; Nerlov, Claus; Porse, Bo T

    2012-01-01

    are simultanously recruited and activated to ensure timely gene expression. The transcription factor CCAAT/enhancer binding protein a (C/EBPa) is such a factor and is essential for the development of granulocytic/monocytic cells. The activity of C/EBPa is regulated on several levels including gene...

  14. A linkage map of cultivated cucumber (cucumis sativus l.) with 248 microsatellite marker loci and seven genes for horticulturally important traits

    Science.gov (United States)

    Marker assisted selection (MAS) is playing an increasingly important role in expedite and increase the efficiency of classical plant breeding. In cucumber, MAS is lagging behind as compared with other field crops. In the present study, a genetic map was developed with microsatellite (or simple seque...

  15. A new shipping container for an intense neutron emitter

    International Nuclear Information System (INIS)

    Californium-252 is an intense neutron emitter (2.34 x 1012 n/s·g) used in medicine, research, and industry. The western world's sole source of this rare radioisotope is the Californium Facility at Oak Ridge National Laboratory's Radiochemical Engineering Development Center (REDC). A project has been initiated at the REDC to design a new Type B Californium Shipping Container. This effort is essential for future transportation of californium to meet the needs of users all over the world. The shipping container must meet all requirements for transport by motor freight, air, vessel, and rail, both domestic and foreign. There are unique problems in the design, fabrication, and licensing of a new Type B shipping container that will accommodate up to 60 milligrams of californium-252. One of the first challenges in the design phase of the project is the selection of a material to shield the high neutron flux. The more stringent safety precautions of today's world impel us to consider more exotic materials for such a purpose. The candidate materials must be examined not just for their neutron shielding properties, but also in conjunction with other properties such as thermal and structural requirements to withstand the hypothetical accident conditions. The design and building of such a container is a formidable task requiring much planning. The licensing process, with the complex, interactive federal codes, is a special challenge and may be the biggest on the project in terms of time and money

  16. Application of Cf for the quantitative measurement of nuclear reactor fuel materials

    International Nuclear Information System (INIS)

    Sensitive and rapid measurements of the quantity and geometric distribution of nuclear reactor fuel materials can be made using neutrons from californium. The neutron-induced fission rate in these materials may be measured by detection of either prompt radiations from fission or delayed radiations from radioactive fission products. A number of californium-based instruments are presently in use by the nuclear industry for purposes of process control, quality control, nuclear materials safeguards, and environmentl assessment. An Automated Fuel Rod Scanner (AFRS) is used for high-speed measurement of the uniformity of loading and total fissile content of reactor fuel rods. The fuel rods are moved first through an irradiator containing about 1 mg of californium, and subsequently through high-efficiency detectors for the measurement of fission-product gamma-rays. Multiple detectors on each of two irradiation channels are used to reduce the californium source strength requirement. The fuel loading of each 15-mm-long pellet is tested to +-10% on 100% of the plant throughput. By summing the response over length, the total fissile material content of the fuel rod is measured to better than 0.5%. An on-line computer for data processing allows the instrument to measure about 150 rods per hour with a single operator. The same activation concept is used with a 25-μg californium source in a Small Sample Assay System (SSAS) which measures the fissile content of fuel pellet sized samples with a precision of 0.5%

  17. Directive of the Minister of Justice of 16 December 1969, Stcrt. 248 concerning the implementation of Section 83 of the Nuclear Energy Act (Civil Servants Competent for the Prosecution of Criminal Acts)

    International Nuclear Information System (INIS)

    This Directive, made in implementation of the Nuclear Energy Act, Lays down that Chief Inspectors and Regional Inspectors of the Ministry of Social Affairs and Public health are competent in respect of the prosecution of criminal acts. (NEA)

  18. Thermosalinograph data of the Hawaii Ocean Time-series (HOT) program in the North Pacific 100 miles north of Oahu, Hawaii for cruises HOT239-248 during 2012 (NODC Accession 0120323)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The HOT program makes repeated observations of the physics, biology and chemistry at a site approximately 100 km north of Oahu, Hawaii. Two stations are visited...

  19. Niskin bottle data of the Hawaii Ocean Time-series (HOT) program in the North Pacific 100 miles north of Oahu, Hawaii for cruises HOT239-248 during 2012 (NCEI Accession 0119430)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The HOT program makes repeated observations of the physics, biology and chemistry at a site approximately 100 km north of Oahu, Hawaii. Two stations are visited...

  20. Design and characterization of a low-viscous muscle tissue mimicking media at the ISM-band (2.4–2.48 GHz) for easy antenna displacement in in vitro measurements

    DEFF Research Database (Denmark)

    Jónasson, Sævar Þór; Zhurbenko, Vitaliy; Johansen, Tom Keinicke

    Phantoms mimicking electromagnetic properties of biological tissues are widely used in evaluation of electromagnetic field distribution in human body. In this paper, low-viscous, optically transparent liquids that mimic muscle tissue, are designed and characterized. Various mixing ratios of de-ionized...... water and diethylene glycol butyl ether are examined in range of widely used biomedical frequencies. A recipe for 2.45 GHz is given, which provides less than 5.6% deviation from the reference. With help of curve fitting of the discrete measurement points, recipes for other parts of the body can be...

  1. Measurements of Cross Sections and Decay Properties of the Isotopes of Elements 112, 114 and 116 Produced in the Fusion Reactions $^{233,238}$U, $^{242}$Pu, and $^{248}$Cm + $^{48}$Ca

    CERN Document Server

    Oganessian, Yu T; Utyonkov, V K; Lobanov, Yu V; Abdullin, F S; Polyakov, A N; Shirokovsky, I V; Tsyganov, Yu S; Gulbekyan, G G; Bogomolov, S L; Gikal, B N; Mezentsev, A N; Iliev, S; Subbotin, V G; Sukhov, A M; Voinov, A A; Buklanov, G V; Subotic, K M; Zagrebaev, V I; Itkis, M G; Patin, J B; Moody, K J; Wild, J F; Stoyer, M A; Stoyer, N J; Shaughnessy, D A; Kenneally, J M; Wilk, P A; Lougheed, R W; Ilkaev, R I; Vesnovskii, S P

    2004-01-01

    We have studied the dependence of the production cross-sections of the isotopes $^{282,283}$112 and $^{286,287}$114 on the excitation energy of the compound nuclei $^{286}$112 and $^{290}$114. The maximum cross-section values of the \\textit{xn}-evaporation channels for the reaction $^{238}$U($^{48}$Ca, \\textit{xn})$^{286 - x}$112 were measured to be: $\\sigma _{3n}=2.5_{-1.1}^{ + 1.8} $pb and $\\sigma _{4n}=0.6_{ - 0.5}^{ + 1.6} $ pb; for the reaction $^{242}$Pu($^{48}$Ca, \\textit{xn})$^{290 - x}$114: $\\sigma _{2n}\\sim 0.5$ pb, $\\sigma _{3n}=3.6_{- 1.7}^{ + 3.4} $ pb and $\\sigma _{4n}=4.5_{ - 1.9}^{ + 3.6} $ pb. In the reaction $^{233}$U($^{48}$Ca, 2--4$n$)$^{277 - 279}$112 at $E^*=34.9\\pm $2.2 MeV we measured an upper cross-section limit of $\\sigma _{xn} \\leqslant 0.6$ pb. The observed shift of the excitation energy associated with the maximum sum evaporation residue cross section $\\sigma _{\\rm {ER}}(E^*)$ to values significantly higher than that associated with the calculated Coulomb barrier can be caused by ...

  2. CTD data of the Hawaii Ocean Time-series (HOT) program in the North Pacific 100 miles north of Oahu, Hawaii for cruises HOT239-248 during 2012 (NODC Accession 0119895)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The HOT program makes repeated observations of the physics, biology and chemistry at a site approximately 100 km north of Oahu, Hawaii. Two stations are visited...

  3. Amplification at λ ∼ 2.8 A on Xe(L),(2s-bar2p-bar) double-vacancy states produced by 248 nm excitation of Xe clusters in plasma channels

    International Nuclear Information System (INIS)

    Xe(L),(2s-bar2p-bar) double-vacancy states undergo strong amplification in relativistic self-trapped plasma channels on 3d → 2p transitions in the λ = 2.78-2.81 A region. The 2P3/2 → 2S1/2 component at λ ≅ 2.786 A exhibits saturated amplification demonstrated by both (1) the observation of spectral hole-burning in the spontaneous emission profile and (2) the correlated enhancement of 3p → 2s cascade transitions (2S1/2 → 2Pj; j = 1/2, 3/2) at λ = 2.558 and λ = 2.600 A. The condition of saturation places a lower limit of ∼1017 W cm-2 on the intensity of the x-ray beam produced by the amplification in the channel. The anomalous strength of the amplification signalled by the saturation mirrors the equivalently anomalous behaviour observed for all 3d → 2p transitions corresponding to 2p-bar) single-vacancy Xeq+ arrays (q = 31, 32, 34, 35, 36) that exhibit gain. The conspicuous absence of amplification involving states with (2p-bar)2 double-vacancy configurations suggests the operation of a selective interaction that enhances the production of 2s-bar2p-bar states. Overall, the generation of double-vacancy states of this genre demonstrates that an excitation rate approaching ∼1 W/atom for ionic species is achievable in self-trapped plasma channels

  4. Application of PGNAA to preincineration assay of combustible waste for chlorine

    Energy Technology Data Exchange (ETDEWEB)

    Gehrke, R.J.; Pawelko, R.J.; Greenwood, R.C. [Idaho National Engineering Lab., Idaho Falls, ID (United States)

    1995-12-31

    A prompt gamma neutron activation analysis method is being developed for on-stream pre-incineration assay of low level radioactive combustible waste for it`s chlorine content. The assay system consists of three californium 252 sources and a germanium or scintillation gamma-ray spectrometer.

  5. Magnetic measurements of the transuranium elements. Progress report, January 1, 1984-December 31, 1984

    International Nuclear Information System (INIS)

    Measurements of the magnetic properties of dhcp californium-249 metal indicated the presence of three regions of differing magnetic character. Additional measurements are also reported. Magnetic moments and valence states of terbium in TbF3, BaTbO3, and TbO18 are discussed. Progress on high-field operation of the micro-magnetic susceptometer is reported

  6. Source storage and transfer cask: Users Guide

    International Nuclear Information System (INIS)

    The storage and shield cask for the dual californium source is designed to shield and transport up to 3.7 mg (2 Ci) of 252Cf. the cask meets Department of Transportation (DOT) license requirements for Type A materials (DOT-7A). The cask is designed to transfer sources to and from the Flourinel and Fuel Storage (FAST) facility delayed-neutron interrogator. Californium sources placed in the cask must be encapsulated in the SR-CF-100 package and attached to Teleflex cables. The cask contains two source locations. Each location contains a gear box that allows a Teleflex cable to be remotely moved by a hand crank into and out of the cask. This transfer procedure permits sources to be easily removed and inserted into the delayed-neutron interrogator and reduces personnel radiation exposure during transfer. The radiation dose rate with the maximum allowable quantity of californium (3.7 mg) in the cask is 30 mR/h at the surface and less than 2 mR/h 1 m from the cask surface. This manual contains information about the cask, californium sources, describes the method to ship the cask, and how to insert and remove sources from the cask. 28 figs

  7. Discovery of Isotopes of the Transuranium Elements with 93 <= Z <= 98

    OpenAIRE

    Fry, C; Thoennessen, M

    2012-01-01

    One hundred and five isotopes of the transuranium elements neptunium, plutonium, americium, curium, berkelium and californium have so far been observed; the discovery of these isotopes is discussed. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  8. Comment on "Nanosecond laser textured superhydrophobic metallic surfaces and their chemical sensing applications" by Duong V. Ta, Andrew Dunn, Thomas J. Wasley, Robert W. Kay, Jonathan Stringer, Patrick J. Smith, Colm Connaughton, Jonathan D. Shephard (Appl. Surf. Sci. 357 (2015) 248-254)

    Science.gov (United States)

    Boinovich, L. B.; Emelyanenko, A. M.; Emelyanenko, K. A.; Domantovsky, A. G.; Shiryaev, A. A.

    2016-08-01

    Nowadays the problem of design of durable ecologically friendly superhydrophobic surfaces is of great importance for science and technology. A recent paper in Applied Surface Science reports the method of fabricating the superhydrophobic metallic surfaces by infrared nanosecond laser surface texturing without using hydrophobic agents. Since this method of surface texturing can be considered as one of the most suitable for various industrial applications, the nature of superhydrophobic state of surfaces produced by laser texturing in the abovementioned paper deserves to be analyzed in detail. Authors of the commented paper attributed the change in wettability to the partial deoxidation of CuO into Cu2O on the surface during storage in atmosphere. However, such interpretation of the results contradicts to the basic notions in the theory of wetting and to more accurate and detailed data. In our Comment we discuss these contradictions point by point.

  9. International Electronic Journal of Elementary Educ ation, 2013, 5(3, 233-248. ISSN:1307 9298 Copyright © IEJEE www.iejee.com Relationship among Students’ Attitudes, Intentions and Behaviors towards the Inclusion of Peers with Disabilities, in Mainstream Physical Education Classes

    Directory of Open Access Journals (Sweden)

    Evangelos BEBETSOS

    2013-07-01

    Full Text Available Students’ attitudes, intentions and behaviours towards their peers with disabilities are important to their mutual co existence and development. The aim of this study was to investigate a whetherstudents’ attitudes and intentions towards their schoolmates with disabilities are related to their general and modified behavior in mainstream physical education classes, and b if the former variables could serve as predictors of the latter. The participants, 172 children without disabilities(Mage=11.15,SD=.70, completed the revised version of the Planned Behavior Theory questionnaire(PBT and the Children’s’ Attitudes towards Inclusion in Physical Education – Revised questionnaire(CAIPE R. Although results revealed several correlations among the variables under study, only general attitudes accounted for both general and modified behavior, and attitudes for modified behavior. These findings could assist in educating students to develop and perform appropriate behaviours towards their peers in order to facilitate their co existence, and their mutual developmentand learning.

  10. International Electronic Journal of Elementary Educ ation, 2013, 5(3), 233-248. ISSN:1307 9298 Copyright © IEJEE www.iejee.com Relationship among Students’ Attitudes, Intentions and Behaviors towards the Inclusion of Peers with Disabilities, in Mainstream Physical Education Classes

    OpenAIRE

    Evangelos BEBETSOS; Derri , Vassiliki; Stratos ZAFEIRIADIS; Pavlos KYRGIRIDIS

    2013-01-01

    Students’ attitudes, intentions and behaviours towards their peers with disabilities are important to their mutual co existence and development. The aim of this study was to investigate a) whetherstudents’ attitudes and intentions towards their schoolmates with disabilities are related to their general and modified behavior in mainstream physical education classes, and b) if the former variables could serve as predictors of the latter. The participants, 172 children without disabilities(Mage=...

  11. Study of Search Engine Transaction Logs Shows Little Change in How Users use Search Engines. A review of: Jansen, Bernard J., and Amanda Spink. “How Are We Searching the World Wide Web? A Comparison of Nine Search Engine Transaction Logs.” Information Processing & Management 42.1 (2006: 248‐263.

    Directory of Open Access Journals (Sweden)

    David Hook

    2006-09-01

    Full Text Available Objective – To examine the interactions between users and search engines, and how they have changed over time. Design – Comparative analysis of search engine transaction logs. Setting – Nine major analyses of search engine transaction logs. Subjects – Nine web search engine studies (4 European, 5 American over a seven‐year period, covering the search engines Excite, Fireball, AltaVista, BWIE and AllTheWeb. Methods – The results from individual studies are compared by year of study for percentages of single query sessions, one term queries, operator (and, or, not, etc. usage and single result page viewing. As well, the authors group the search queries into eleven different topical categories and compare how the breakdown has changed over time. Main Results – Based on the percentage of single query sessions, it does not appear that the complexity of interactions has changed significantly for either the U.S.‐based or the European‐based search engines. As well, there was little change observed in the percentage of one‐term queries over the years of study for either the U.S.‐based or the European‐based search engines. Few users (generally less than 20% use Boolean or other operators in their queries, and these percentages have remained relatively stable. One area of noticeable change is in the percentage of users viewing only one results page, which has increased over the years of study. Based on the studies of the U.S.‐based search engines, the topical categories of ‘People, Place or Things’ and ‘Commerce, Travel, Employment or Economy’ are becoming more popular, while the categories of ‘Sex and Pornography’ and ‘Entertainment or Recreation’ are declining. Conclusions – The percentage of users viewing only one results page increased during the years of the study, while the percentages of single query sessions, oneterm sessions and operator usage remained stable. The increase in single result page viewing implies that users are tending to view fewer results per web query. There was also a significant difference in the percentage of queries using Boolean operators between the US‐based and the European‐based search engines. One of the study’s findings was that results from a study of a particular search engine cannot necessarily be applied to all search engines. Finally, web search topics show a trend towards information or commerce searching rather than entertainment.

  12. Oxidation of microquantities of transplutonium elements to tetravalent state in mineral acid solutions and their stability

    International Nuclear Information System (INIS)

    Kinetics of americium(3) microquantity oxidation and stability of forming americium(4), as well as possibility of curium and californium oxidation to tetravalent state in solutions of sulfuric and nitric acids depending on the concentration of mineral acid, potassium tungstophosphate and ammonium persulfate are studied by the extraction method. It is shown that curium(3) and californium(3) in solutions of 0.05-2.5 mol/l H2SO4 and HNO3 containing 10-3 mol/l potassium tungstophosphate is not practically oxidized by the mixture of silver nitrate and ammonium persulfate. Americium(3) is oxidized to the utmost to Am(4) for 2-3 min at room temperature, but stability of Am(4) depends on the concentration of sulfuric acid and potassium tungstophosphate

  13. Characterization of berkelium(III) dipicolinate and borate compounds in solution and the solid state.

    Science.gov (United States)

    Silver, Mark A; Cary, Samantha K; Johnson, Jason A; Baumbach, Ryan E; Arico, Alexandra A; Luckey, Morgan; Urban, Matthew; Wang, Jamie C; Polinski, Matthew J; Chemey, Alexander; Liu, Guokui; Chen, Kuan-Wen; Van Cleve, Shelley M; Marsh, Matthew L; Eaton, Teresa M; van de Burgt, Lambertus J; Gray, Ashley L; Hobart, David E; Hanson, Kenneth; Maron, Laurent; Gendron, Frédéric; Autschbach, Jochen; Speldrich, Manfred; Kögerler, Paul; Yang, Ping; Braley, Jenifer; Albrecht-Schmitt, Thomas E

    2016-08-26

    Berkelium is positioned at a crucial location in the actinide series between the inherently stable half-filled 5f(7) configuration of curium and the abrupt transition in chemical behavior created by the onset of a metastable divalent state that starts at californium. However, the mere 320-day half-life of berkelium's only available isotope, (249)Bk, has hindered in-depth studies of the element's coordination chemistry. Herein, we report the synthesis and detailed solid-state and solution-phase characterization of a berkelium coordination complex, Bk(III)tris(dipicolinate), as well as a chemically distinct Bk(III) borate material for comparison. We demonstrate that berkelium's complexation is analogous to that of californium. However, from a range of spectroscopic techniques and quantum mechanical calculations, it is clear that spin-orbit coupling contributes significantly to berkelium's multiconfigurational ground state. PMID:27563098

  14. Neutron activation determination of gold in technogenic raw materials with different mineral composition

    OpenAIRE

    Yudakov Aleksandr A.; Ivannikov Sergey I.; Zheleznov Veniamin V.; Taskin Andrei V.; Tsybulskaya Oksana N.

    2015-01-01

    The methods used to determine the gold content in the technogenic objects of gold mining were analyzed regarding their non-homogeneity and complexity of chemical and mineral compositions. A possible application of the neutron activation analysis with the use of the californium source of neutrons for determining the content of fine-grained and extra-fine-grained gold in the technogenic objects, including the bottom-ash waste of energy providers, is considere...

  15. Jak bylo objeveno spontánní štěpení

    Czech Academy of Sciences Publication Activity Database

    Vobecký, Miloslav

    Praha: Spektroskopická společnost J.M. Marci, 2010 - (Vobecký, M.), s. 5-10 ISBN 978-80-904539-0-6. [Seminář Radioanalytické metody IAA 10. Praha (CZ), 30.06.2010-01.07.2010] Institutional research plan: CEZ:AV0Z40310501 Keywords : spontaneous fission * fission -track dating method * californium 252 neutron source Subject RIV: CB - Analytical Chemistry, Separation

  16. Study of heavy particle decay from superheavy elements by SK model

    International Nuclear Information System (INIS)

    Heavy nuclei usually decay by alpha decay or spontaneous fission. These two decay modes are generally the most probable competing processes. Another less probable decay process is cluster radioactivity in which nuclei from carbon to silicon are emitted from Radium to Californium leading to the most stable daughter nucleus, lead. This work reports such a study using the cubic plus Yukawa plus exponential model of Shanmugam and Kamalaharan (SK)

  17. Measurement of the energy spectra of fission fragments using nuclear track detectors and digital image processing

    International Nuclear Information System (INIS)

    Energy spectra of fission fragments were determined using a Nuclear Track Methodology (NTM) supported by digital image analysis and numerical data processing using a standard personal computer. The analysis of a californium (252Cf) spectrum with this approach shows improvement compared with the values reported previously using the standard procedure, in terms of resolution and accuracy. This new method adds full automation to the technical advantages and cost effectiveness of an NTM.

  18. Heavy ion tests on programmable VLSI

    International Nuclear Information System (INIS)

    The radiation from space environment induces operation damages in onboard computers systems. The definition of a strategy, for the Very Large Scale Integrated Circuitry (VLSI) qualification and choice, is needed. The 'upset' phenomena is known to be the most critical integrated circuit radiation effect. The strategies for testing integrated circuits are reviewed. A method and a test device were developed and applied to space applications candidate circuits. Cyclotron, synchrotron and Californium source experiments were carried out

  19. Properties of neutron sources

    International Nuclear Information System (INIS)

    The Conference presentations were divided into sessions devoted to the following topics: white neutron sources, primarily pulsed (6 papers); fast neutron fields (5 papers); Californium-252 prompt fission neutron spectra (14 papers); monoenergetic sources and filtered beams (11 papers); 14 MeV neutron sources (10 papers); selected special application (one paper); and a general interest session (4 papers). Individual abstracts were prepared separately for the papers

  20. Neutron multiplicities for the transplutonium nuclides

    International Nuclear Information System (INIS)

    This paper continues, with respect to the transplutonium nuclides, earlier efforts to collate and evaluate data from the scientific literature on the prompt neutron multiplicity distribution from fission and its first moment = ΣnuPnu. The isotopes considered here for which P/sub nu/ and or data (or both) were found in the literature are of americium (Am), curium (Cm), berkelium (Bk), californium (Cf), einsteinium (Es), fermium (Fm), and nobelium (No)

  1. AcEST: DK955984 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST39A01NGRL0024_I21 545 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0024_I21. 5' end seq ... 21/159 (76%) Frame = +3 Query: 69 MLVYQXXXXXXXXXXXXFPY KEIQNGILWEVEGKWVVKGAVDVDIGANPSAXXXXXXXXX 248 MLVYQ ... LWEV+GKWVV+GA+DVDIGANPSA Sbjct: 1 MLVYQDLLTGDELLSDSFPY REIENGILWEVDGKWVVQGAIDVDIGANPSAEGGGDDEGV 60 Query: ... 20/159 (75%) Frame = +3 Query: 69 MLVYQXXXXXXXXXXXXFPY KEIQNGILWEVEGKWVVKGAVDVDIGANPSAXXXXXXXXX 248 MLVYQ ... 21/159 (76%) Frame = +3 Query: 69 MLVYQXXXXXXXXXXXXFPY KEIQNGILWEVEGKWVVKGAVDVDIGANPSAXXXXXXXXX 248 MLVYQ ...

  2. Dependence of metal partition coefficients in D2EHPA capacity on extraction from acid solutions

    International Nuclear Information System (INIS)

    In devising solvent-extraction schemes for extracting the transplutonium elements (TPE), one usually employs the partition coefficients K/sub p/ for trace amounts; when the results are transferred to weighable amounts of the elements, there are difficulties because one lacks capacity characteristics for the extractants under the conditions used. They have determined the capacity of D2EHPA over a wide range in acidity (0.001-2 mole/liter) in relation to dysprosium (the analog of californium) in the system formed by D2EHPA with nitric acid by saturating a set volume of the extractant with dysprosium in nitric acid containing the necessary amount of free acid

  3. TOWARD AN IMPROVED UNDERSTANDING OF STRUCTURE AND MAGNETISM IN NEPTUNIUM AND PLUTONIUM PHOSPHONATES AND SULFONATES

    Energy Technology Data Exchange (ETDEWEB)

    Albrecht-Schmitt, Thomas

    2012-03-01

    This grant supported the exploratory synthesis of new actinide materials with all of the actinides from thorium to californium with the exceptions of protactinium and berkelium. We developed detailed structure-property relationships that allowed for the identification of novel materials with selective ion-exchange, selective oxidation, and long-range magnetic ordering. We found novel bonding motifs and identified periodic trends across the actinide series. We identified structural building units that would lead to desired structural features and novel topologies. We also characterized many different spectroscopic trends across the actinide series. The grant support the preparation of approximately 1200 new compounds all of which were structurally characterized.

  4. NONDESTRUCTIVE IDENTIFICATION OF CHEMICAL WARFARE AGENTS AND EXPLOSIVES BY NEUTRON GENERATOR-DRIVEN PGNAA

    International Nuclear Information System (INIS)

    Prompt gamma-ray neutron activation analysis (PGNAA) is now a proven method for the identification of chemical warfare agents and explosives in military projectiles and storage containers. Idaho National Laboratory is developing a next-generation PGNAA instrument based on the new Ortec Detective mechanically-cooled HPGe detector and a neutron generator. In this paper we review PGNAA analysis of suspect chemical warfare munitions, and we discuss the advantages and disadvantages of replacing the californium-252 radioisotopic neutron source with a compact accelerator neutron generator

  5. NONDESTRUCTIVE IDENTIFICATION OF CHEMICAL WARFARE AGENTS AND EXPLOSIVES BY NEUTRON GENERATOR-DRIVEN PGNAA

    Energy Technology Data Exchange (ETDEWEB)

    T. R. Twomey; A. J. Caffrey; D. L. Chichester

    2007-02-01

    Prompt gamma-ray neutron activation analysis (PGNAA) is now a proven method for the identification of chemical warfare agents and explosives in military projectiles and storage containers. Idaho National Laboratory is developing a next-generation PGNAA instrument based on the new Ortec Detective mechanically-cooled HPGe detector and a neutron generator. In this paper we review PGNAA analysis of suspect chemical warfare munitions, and we discuss the advantages and disadvantages of replacing the californium-252 radioisotopic neutron source with a compact accelerator neutron generator.

  6. Composition containing transuranic elements for use in the homeopathic treatment of aids

    International Nuclear Information System (INIS)

    A homeopathic remedy consisting of a composition containing one or more transuranic elements, particularly plutonium, for preventing and treating acquired immunodeficiency syndrome (AIDS) in humans, as well as seropositivity for human immunodeficiency virus (HIV). Said composition is characterized in that it uses any chemical or isotopic form of one or more transuranic elements (neptunium, plutonium, americium, curium, berkelium, californium or einsteinium), particularly plutonium, said form being diluted and dynamized according to conventional homeopathic methods, particularly the so-called Hahnemann and Korsakov methods, and provided preferably but not exclusively in the form of lactose and/or saccharose globules or granules impregnated with the active principle of said composition. (author)

  7. Neutron nondestructive essay of the plutonium metal parts

    International Nuclear Information System (INIS)

    Based on the principle of neutron multiplicity and data unfolding mathematics, this paper developed the software which can execute the neutron multiplicity analysis, neutron attenuation analysis, parameter calibration, Pu mass solution with the neutron pulse sequence acquisition method. The measurement system consisted of detector,nuclear electronic apparatus, pulsed sequence acquisition and analysis software was tested and calibrated by californium source. Three mental plutonium components with different mass were used for experimental assay and validation, which showed that the assay bias was within 15% against the nominal value of the samples. (authors)

  8. Physical-chemical studies of transuranium elements. Progress report, April 1, 1982-March 31, 1983

    International Nuclear Information System (INIS)

    Progress is reported on the following topics: electrochemical and spectroscopic studies of less-stable higher oxidation states of transuranium elements in complexing aqueous media; spectroscopic and electrochemical studies of selected lanthanides and actinides in molten dimethyl sulfone; spectroelectronchemical studies of the Ce(IV)/Ce(III) couple in aqueous carbonate solutions; characterization of actinide orthophosphates by Raman and absorption spectrophotometries and by x-ray diffraction; relativistic multiple scattering calculations on transuranium element compounds; Raman spectroscopic studies of natural minerals containing the uranyl ion; and solution calorimetry of californium metal

  9. Transuranium element production. II. Chemical processing of targets

    International Nuclear Information System (INIS)

    The chemical processing described concerns small experimental targets irradiated in OSIRIS or EL-III and industrial targets irradiated in the CELESTIN reactors. In view of the difficulties encountered when processing highly irradiated targets (760MWd.kg-1) by liquid-liquid extraction (interface sludges leading to stable emulsion) the new processes developed are based on inverse phase chromatography. This technique applied to targets of americium 241, plutonium 239 and a plutonium mixture rich in isotope 242 has given tens of milligrams of curium 242, grams of americium 243 and curium 244 and micrograms of californium 252

  10. Detection of rare earth elements in Powder River Basin sub-bituminous coal ash using laser-induced breakdown spectroscopy (LIBS)

    Energy Technology Data Exchange (ETDEWEB)

    Tran, Phuoc [National Energy Technology Lab. (NETL), Pittsburgh, PA, (United State; Mcintyre, Dustin [National Energy Technology Lab. (NETL), Pittsburgh, PA, (United State

    2015-10-01

    We reported our preliminary results on the use of laser-induced breakdown spectroscopy to analyze the rare earth elements contained in ash samples from Powder River Basin sub-bituminous coal (PRB-coal). We have identified many elements in the lanthanide series (cerium, europium, holmium, lanthanum, lutetium, praseodymium, promethium, samarium, terbium, ytterbium) and some elements in the actinide series (actinium, thorium, uranium, plutonium, berkelium, californium) in the ash samples. In addition, various metals were also seen to present in the ash samples

  11. Radiation protection data sheet. Radiation protection data sheets for the use of radionuclides in unsealed sources

    International Nuclear Information System (INIS)

    These radiation protection data sheet are devoted to responsible persons and employees of various laboratories or medical, pharmaceutical, university and industrial departments where radionuclides are handled as well as all the persons who attend to satisfy in this field. They contain the essential radiation protection data for the use of unsealed sources: physical characteristics, risk assessment, administrative procedures, recommendations, regulations and bibliography. This new series includes the following radionuclides: californium 252, curium 244, gallium 67, indium 113m, plutonium 238, plutonium 239, polonium 210, potassium 42, radium 226, thorium 232, uranium 238 and zinc 65. (O.M.)

  12. Study by thermochromatography of fluorides of transuranium elements

    International Nuclear Information System (INIS)

    Thermochromatography was made suitable for fluoride study. So, an investigation of actinide tetrafluorides was accomplished from uranium to californium. Pentavalent and hexavalent fluorospecies of uranium, neptunium, plutonium and ruthenium were studied. Some new compounds have been identified in gaseous phase, whose: PuF5, PuOF3 and PaOF3. Furthermore, some presomptions as for the existence in gaseous phase of EsF4 and of an heptavalent fluorospecies of plutonium have been established. An important analogy between plutonium and ruthenium behaviour with fluorine have been shown, these results could explain the difficulties encountered in the fluoride-volatility processes

  13. PROCEEDINGS OF THE SYMPOSIUM COMMEMORATING THE 25th ANNIVERSARY OF ELEMENTS 97 and 98 HELD ON JAN. 20, 1975

    Energy Technology Data Exchange (ETDEWEB)

    Seaborg, Glenn T.; Street Jr., Kenneth; Thompson, Stanley G.; Ghiorso, Albert

    1976-07-01

    This volume includes the talks given on January 20, 1975, at a symposium in Berkeley on the occasion of the celebration of the 25th anniversary of the discovery of berkelium and californium. Talks were given at this symposium by the four people involved in the discovery of these elements and by a number of people who have made significant contributions in the intervening years to the investigation of their nuclear and chemical properties. The papers are being published here, without editing, in the form in which they were submitted by the authors in the months following the anniversary symposium, and they reflect rather faithfully the remarks made on that occasion.

  14. Method for measuring multiple scattering corrections between liquid scintillators

    Science.gov (United States)

    Verbeke, J. M.; Glenn, A. M.; Keefer, G. J.; Wurtz, R. E.

    2016-07-01

    A time-of-flight method is proposed to experimentally quantify the fractions of neutrons scattering between scintillators. An array of scintillators is characterized in terms of crosstalk with this method by measuring a californium source, for different neutron energy thresholds. The spectral information recorded by the scintillators can be used to estimate the fractions of neutrons multiple scattering. With the help of a correction to Feynman's point model theory to account for multiple scattering, these fractions can in turn improve the mass reconstruction of fissile materials under investigation.

  15. Surface fission tracks in diamond

    International Nuclear Information System (INIS)

    Scanning Probe Microscope (SPM) images reveal important fingerprint features of latent tracks induced in diamond by fission fragments from a californium source. Collimated fission fragments with a binary distribution of the predominant energies of 79.4 and 103.8 MeV, are assumed. Cavities, reticular formations around these cavities, and black spots of graphite were found. A brief discussion on the possible track formation mechanism is given on the basis of the explosion spike theory; an attempt to determine latent track core and halo parameters is included

  16. Use of trioctylphosphine oxide for transplutonium element extraction and purification

    International Nuclear Information System (INIS)

    Investigated was extraction of tri-valent curium, berkelium, californium, einsteinium as well as cerium and europium with trioctylphosphin oxide from lactic acid solutions, containing DTPA and aluminium nitrate depending on the aluminium nitrate and TOPO concentrations and nitric acid solutions of variable concentration as well. Under optimum conditions of extraction chromatography of berkelium studied was the distribution of cobalt, nickel, chromium, iron, aluminium, titanium, zirconium and niobium ions, and the coefficients of berkelium purification from cations investigated were determined. The effect of weight quantities of cation impurities on extraction chromatographic yield of berkelium has been investigated. Examples of practice application of the extraction chromatography with the use of TOPO are given

  17. Dicty_cDB: Contig-U10615-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Expect = 2e-66 Identities = 248/248 (100%) Strand = Plus / Plus Query: 11 acaaccanaaaanatttccgnatcatcacatgnatgganatcnccna...anaaaanatttccgnatcatcacatgnatgganatcnccnaatgnattcaattc 70 Query: 71 atcntttgggatccntntganattacnccna...|||| Sbjct: 71 atcntttgggatccntntganattacnccnacntccnctggngnanantcaatcccttta 130 Query: 131 ncaaaaccnnangctgg...212 (95%) Strand = Plus / Plus Query: 12 caaccanaaaanatttccgnatcatcacatgnatgganatcnccnaatgnattcaattca 71 |||...||||||||||||||||||||||| || ||||||||||||||||| |||||||||||| Sbjct: 11 caaccanaaaanatttccgnatcatcncangnatgganatcnccna

  18. Drug: D05945 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available rial; Coccidiostat [for poultry] CAS: 127-77-5 PubChem: 47207603 LigandBox: D05945 NIKKAJI: J5.401A ATOM 17 ...D05945 Drug Sulfabenz (USAN/INN) C12H12N2O2S 248.0619 248.3009 D05945.gif Antibacte

  19. Unigene BLAST: CBRC-CELE-05-0613 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CELE-05-0613 gnl|UG|Cel#S5712587 Caenorhabditis elegans Serpentine Receptor, c...lass H family member (srh-248) (srh-248) mRNA, complete cds /cds=p(1,978) /gb=NM_071402 /gi=17561853 /ug=Cel.3249 /len=978 1e-77 44% ...

  20. Unigene BLAST: CBRC-CELE-05-0029 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CELE-05-0029 gnl|UG|Cel#S5712587 Caenorhabditis elegans Serpentine Receptor, c...lass H family member (srh-248) (srh-248) mRNA, complete cds /cds=p(1,978) /gb=NM_071402 /gi=17561853 /ug=Cel.3249 /len=978 1e-60 36% ...

  1. Gclust Server: 201207 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available 201207 TET_248.m00028 Cluster Sequences - 203 hypothetical protein chr_0_8253855_24...8; no annotation 1 1.00e-80 0.0 11.11 0.0 0.0 0.0 0.0 Show 201207 Cluster ID 201207 Sequence ID TET_248.m000

  2. 78 FR 64242 - Outer Continental Shelf (OCS), Gulf of Mexico (GOM), Oil and Gas Lease Sales, Western Planning...

    Science.gov (United States)

    2013-10-28

    ... Bureau of Ocean Energy Management Outer Continental Shelf (OCS), Gulf of Mexico (GOM), Oil and Gas Lease Sales, Western Planning Area (WPA) Lease Sales 238, 246, and 248 AGENCY: Bureau of Ocean Energy... proposed OCS oil and gas Lease Sales 238, 246, and 248, which are tentatively scheduled to be held...

  3. AcEST: DK944203 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU02A01NGRL0005_E21 586 Adiantum capillus-veneris mRNA. clone: YMU02A01NGRL0005_E21. 5' end seq ... VSIREGLHYNPYFPGGAIAMPKMLN 244 Query: 248 DGAVEYEDEVPAT ESQMAKDVVTFLSWAAEPEMEERKLMGFKVMFVLSLALLQAGYYKRW 427 ... DGAVEYED +PAT E+QM KDVV+FLSWAAEPEMEERKLMGFK +FVLSLALLQA YY+R Sbjc ... t: 245 DGAVEYEDGIPAT EAQMGKDVVSFLSWAAEPEMEERKLMGFKWIFVLSLALLQAAYYRRL 304 ... VSIREGLHYNPYFPGGAIAMPKMLN 184 Query: 248 DGAVEYEDEVPAT ESQMAKDVVTFLSWAAEPEMEERKLMGFKVMFVLSLALLQAGYYKRW 427 ...

  4. Monte Carlo aided enhanced design of an neutron scatterometer

    International Nuclear Information System (INIS)

    This paper will present a particular example for the use of the Monte Carlo Method to enhance the performance of a neutron scatterometer, currently employed to detect the void fraction in fast-transient high-pressure water-vapour flow in a rod-bundle channel. The scatterometer relies on measuring the slowing-down of californium-252 neutrons by the hydrogen in the water to determine the liquid, hence vapour (void) content. However, californium-252 is a relatively fast-decaying source and alternative isotopic sources are typically too energetic to provide sufficient moderation given the small amount of liquid in the channel. Monte Carlo simulation were utilized to examine various design enhancement possibilities, including: filtering out unthermalized fast neutrons, amplifying by a fissionable material the amount of detected thermal neutrons, adding a dissolvable contrast material to the liquid phase, or relying on the scattering of fast neutrons by oxygen in water. In addition, methods to determine the distribution of the pattern of liquid-vapour phase in the channel are devised

  5. Level structures of neutron-rich Xe isotopes

    Energy Technology Data Exchange (ETDEWEB)

    Ahmad, I.; Lister, C.J.; Morss, L.R. [and others

    1995-08-01

    The level structures of neutron-rich Xe isotopes were determined by observing prompt gamma-ray coincidences in {sup 248}Cm fission fragments. A 5-mg {sup 248}Cm, in the form of {sup 248}Cm-KCl pellet, was placed inside Eurogam array which consisted of 45 Compton-suppressed Ge detectors and 5 Low-Energy Photon Spectrometers. Transitions in Xe isotopes were identified by the appearance of new peaks in the {gamma}-ray spectra obtained by gating on the gamma peaks of the complementary Mo fragments.

  6. Characterization of Indoor/Outdoor Particulate Matter Characteristics in Two Residential Houses in Oslo, Norway

    Czech Academy of Sciences Publication Activity Database

    Lazaridis, M.; Dahlin, E.; Hanssen, J. E.; Smolík, Jiří; Schmidbauer, N.; Moravec, Pavel; Ždímal, Vladimír; Hermansen, O.; Glytsos, T.; Dye, C.

    2003. s. 248. [GNEST Conference. 08.09.2003-10.09.2003, Lemnos island] Institutional research plan: CEZ:AV0Z4072921 Keywords : indoor air quality * size distribution Subject RIV: CF - Physical ; Theoretical Chemistry

  7. Communication and Social Regulation in Termites

    Czech Academy of Sciences Publication Activity Database

    Bagneres, A. G.; Hanus, Robert

    Cham: Springer, 2015 - (Aquiloni, L.; Tricarico, E.), s. 193-248 ISBN 978-3-319-17598-0 Institutional support: RVO:61388963 Keywords : termites * communication * chemical communication * pheromones * mechanical communication * social regulation Subject RIV: CC - Organic Chemistry

  8. Review: Lorenzo Cotula, The Great African Land Grab?: Agricultural Investments and the Global Food System (2013

    Directory of Open Access Journals (Sweden)

    Kerstin Nolte

    2013-01-01

    Full Text Available Review of the monograph:Lorenzo Cotula, The Great African Land Grab?: Agricultural Investments and the Global Food System, London, New York: Zed Books, 2013, ISBN 9781780324203, 248 pages

  9. Tagasi Pariisis / Karl Rumor

    Index Scriptorium Estoniae

    Rumor, Karl, pseud., 1886-1971

    2008-01-01

    Prantsusmaa sisepoliitilisest olustikust. Poliitilistest oludest 1937. aasta Euroopas, sõjameeleoludest Vahemerel, Nyloni konverentsist. Varem ilmunud: Uus Eesti 21. juuni 1937, nr. 166; 8., 13. sept. 1937, nr. 243, 248

  10. QTL Information Table: 229 [Q-TARO

    Lifescience Database Archive (English)

    Full Text Available ). Characterization of the main effects, epistatic effects and their environmental interactions of QTLs on the genetic basis of yield traits in rice. Theor Appl Genet 105, 248-257. ...

  11. Myšlenka sjednocené Evropy. Stěžejní ideje Masarykovy "Nové Evropy"

    Czech Academy of Sciences Publication Activity Database

    Pauza, Miroslav

    Praha : Filosofia, 2013, s. 241-248 ISBN 978-80-7007-391-9. - (Filosofie a sociální vědy. 45) Institutional support: RVO:67985955 Keywords : Masaryk * Europe Subject RIV: AA - Philosophy ; Religion

  12. Radiation Exposure from Medical Exams and Procedures

    Science.gov (United States)

    ... nuclear medicine. The NCRP, the American College of Radiology, the World Health Organi- zation, and others are ... W, Yoshizumi TT, Mahesh M. Effective doses in radiology and diagnostic nuclear medicine: A catalog. Radiology 248( ...

  13. The small binary asteroid (939) Isberga

    Czech Academy of Sciences Publication Activity Database

    Carry, B.; Matter, A.; Scheirich, Peter; Pravec, Petr; Molnar, L.; Mottola, S.; Carbognani, A.; Jehin, E.; Marciniak, A.; Binzel, R. P.; DeMeo, E.F.; Birlan, M.; Delbó, M.; Barbotin, E.; Behrend, R.; Bonnardeau, M.; Colas, F.; Farissier, P.; Fauvaud, M.; Fauvaud, S.; Gillier, C.; Gillon, M.; Hellmich, S.; Hirsch, R.; Leroy, A.; Manfroid, J.; Montier, J.; Morelle, E.; Richard, F.; Sobkowiak, K.; Strajnic, J.; Vachier, F.

    2015-01-01

    Roč. 248, March (2015), s. 516-525. ISSN 0019-1035 Institutional support: RVO:67985815 Keywords : asteroids * dynamics * satellites of asteroids Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 3.038, year: 2014

  14. Study of fusion and nucleon transfer channels in the Au-197 + He-6 reaction in an energy range of He-6 to 20 Mev/A

    Czech Academy of Sciences Publication Activity Database

    Skobelev, N. K.; Penionzhkevich, Y. E.; Kulko, A. A.; Demekhina, N. A.; Kroha, Václav; Kugler, Andrej; Lukyanov, S. M.; Mrázek, Jaromír; Sobolev, Yu. G.; Maslov, V. A.; Muzychka, Yu. A.; Voskoboynik, E. I.; Fomichev, A. S.

    2013-01-01

    Roč. 10, č. 3 (2013), s. 248-255. ISSN 1547-4771 Institutional support: RVO:61389005 Keywords : nuclear reactions * gamma activity * cross section Subject RIV: BG - Nuclear, Atomic and Molecular Physics , Colliders

  15. Iron Phthalocyanine as New Efficient Catalyst for Catalytic Transfer Hydrogenation of Simple Aldehydes and Ketones

    Czech Academy of Sciences Publication Activity Database

    Bata, P.; Notheisz, F.; Klusoň, Petr; Zsigmond, A.

    2015-01-01

    Roč. 29, JAN 2015 (2015), s. 45-49. ISSN 0268-2605 Institutional support: RVO:67985858 Keywords : heterogenized complexes * catalytic transfer hydrogenation * reusable catalyst Subject RIV: CC - Organic Chemistry Impact factor: 2.248, year: 2014

  16. Optimal Mirrleesean taxation in a Ben-Porath economy

    Czech Academy of Sciences Publication Activity Database

    Kapička, Marek

    2015-01-01

    Roč. 7, č. 2 (2015), s. 219-248. ISSN 1945-7707 Institutional support: RVO:67985998 Keywords : optimal taxes * unobservable human capital * income taxes Subject RIV: AH - Economics Impact factor: 3.780, year: 2014

  17. Birth characteristics and risk of colorectal cancer: a study among Swedish twins

    OpenAIRE

    Cnattingius, S; Lundberg, F; Iliadou, A.

    2009-01-01

    Type-2 diabetes increases the risk of colorectal cancer, and is also associated with low birth weight. However, we found no evidence of associations between birth characteristics and risk of colorectal cancer (m=248) among Swedish twins.

  18. Fluorinated and trifluoromethylated CB11 carborane anions and radicals

    Czech Academy of Sciences Publication Activity Database

    Higelin, Alexander; Šembera, Filip; Tamadon, F.; Wahab, Abdul; Janoušek, Zbyněk; Ludvík, Jiří; Klíma, Jiří; Crespo, R.; Piqueras, M. C.; Michl, Josef

    San Francisco: American Chemical Society, 2014. 37FLUO. [ACS National Meeting & Exposition /248./. 10.08.2014-14.08.2014, San Francisco] Institutional support: RVO:61388963 Keywords : carborane anions Subject RIV: CC - Organic Chemistry

  19. "Kalevipoeg" Tammsaare tähendamissõnade kumas / Madis Kõiv

    Index Scriptorium Estoniae

    Kõiv, Madis, 1929-2014

    2003-01-01

    Kreutzwaldi "Kalevipoja" ja "Lembitu" filosoofilisest tagamaast. A. H. Tammsaare artiklist ""Kalevipoja" parandamise ümber" (1916). Ilmunud ka kogumikus: Kõiv, Madis. Luhta-minek. Tartu : Ilmamaa, 2005, lk. 206-248

  20. Drug: D09741 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available mones 248 Mixed hormone preparations 2482 Estrogens and progestins D09741 Drospiren...[HSA:1557] Therapeutic category of drugs in Japan [BR:br08301] 2 Agents affecting individual organs 24 Hor

  1. 40 CFR 1065.370 - CLD CO2 and H2O quench verification.

    Science.gov (United States)

    2010-07-01

    ... § 1065.248, or use good engineering judgment to develop a different protocol: (1) Use PTFE or stainless... PTFE or stainless steel tubing to make necessary connections. (2) If the CLD analyzer has an...

  2. Comparison of diatom community structure from epilithon and fish guts: implications for inferring past changes in water quality

    Czech Academy of Sciences Publication Activity Database

    Bešta, T.; Muška, Milan; Juggins, S.; Těšitel, J.

    2015-01-01

    Roč. 742, č. 1 (2015), s. 233-248. ISSN 0018-8158 Institutional support: RVO:60077344 Keywords : diatoms * fish * palaeolimnology * aquatic quality * eutrophication Subject RIV: DA - Hydrology ; Limnology Impact factor: 2.275, year: 2014

  3. Carotenoid-protein interaction alters the S1 energy of hydroxyechinenone in the Orange Carotenoid Protein

    Czech Academy of Sciences Publication Activity Database

    Polívka, Tomáš; Chábera, P.; Kerfeld, C.A.

    2013-01-01

    Roč. 1827, č. 3 (2013), s. 248-254. ISSN 0005-2728 Institutional support: RVO:60077344 Keywords : orange-carotenoid protein * excited states * photoprotection Subject RIV: BO - Biophysics Impact factor: 4.829, year: 2013

  4. SnS and SnS2 thin films deposited using a spin-coating technique from intramolecularly coordinated organotin sulfides

    Czech Academy of Sciences Publication Activity Database

    Řečica, T.; Střižík, L.; Dostál, L.; Bouška, M.; Vlček, Milan; Beneš, L.; Wágner, T.; Jambor, R.

    2015-01-01

    Roč. 29, č. 3 (2015), s. 176-180. ISSN 0268-2605 Institutional support: RVO:61389013 Keywords : organotin sulfide * single - source precursor * spin - coating process Subject RIV: CA - Inorganic Chemistry Impact factor: 2.248, year: 2014

  5. Latein als Sprache der mittelalterlichen Schriften über Wettervorhersage

    Czech Academy of Sciences Publication Activity Database

    Kocánová, Barbora

    -, č. 71 (2013), s. 237-248. ISSN 1376-7453 R&D Projects: GA MŠk(CZ) LD13043 Institutional support: RVO:67985955 Keywords : medieval weather forecasting * medieval Latin * medieval manuscripts Subject RIV: AI - Linguistics

  6. Pediatric Palliative Care: A Personal Story

    Medline Plus

    Full Text Available ... count__/__total__ Find out why Close Pediatric Palliative Care: A Personal Story NINRnews Subscribe Subscribed Unsubscribe 248 ... and her family. The story demonstrates how palliative care can positively influence a patient's and family's experience ...

  7. Mathematical Language as a Bridge between Conceptualization of Motion and Experimental Practice

    Czech Academy of Sciences Publication Activity Database

    Kvasz, Ladislav

    Dordrecht: Springer, 2015 - (Pisano, R.), s. 229-248. (History of Mechanism and Machine Science. 27). ISBN 978-94-017-9644-6 Institutional support: RVO:67985955 Keywords : Galileo * Descartes * Newton * force * interaction * experimental practice Subject RIV: AA - Philosophy ; Religion

  8. Detection and molecular analysis of Hop latent virus and Hop latent viroid in hop samples from Poland

    Czech Academy of Sciences Publication Activity Database

    Ziegler, A.; Kawka, M.; Przybys, M.; Doroszewska, T.; Skomra, U.; Kastirr, U.; Matoušek, Jaroslav; Schubert, J.

    2014-01-01

    Roč. 66, č. 7 (2014), s. 248-254. ISSN 1867-0911 Institutional support: RVO:60077344 Keywords : real-time PCR diagnosis * hop virus * Humulus lupulus * viroid Subject RIV: EB - Genetics ; Molecular Biology

  9. Clinical implementation of 4-dihydroxyborylphenylalanine synthesised by an asymetric pathway

    Czech Academy of Sciences Publication Activity Database

    Kulvik, M.; Vahatalo, J.; Buchar, Evžen; Farkkila, M.; Jarviluoma, E.; Jaaskelainen, J.; Kříž, O.; Laakso, J.; Rasilainen, M.; Kallio, M.

    2003-01-01

    Roč. 18, - (2003), s. 155-163. ISSN 0928-0987 Institutional research plan: CEZ:AV0Z5039906 Keywords : Boron neutron capture therapy Subject RIV: FR - Pharmacology ; Medidal Chemistry Impact factor: 2.248, year: 2003

  10. Effects of the Multidisciplinary Risk Assessment and Management Program for Patients with Diabetes Mellitus (RAMP-DM) on biomedical outcomes, observed cardiovascular events and cardiovascular risks in primary care: a longitudinal comparative study

    OpenAIRE

    Jiao, Fang Fang; Fung, Colman Siu Cheung; Wong, Carlos King Ho; Wan, Yuk Fai; Dai, Daisy; Kwok, Ruby; Lam, Cindy Lo Kuen

    2014-01-01

    Background To assess whether the Multidisciplinary Risk Assessment and Management Program for Patients with Diabetes Mellitus (RAMP-DM) led to improvements in biomedical outcomes, observed cardiovascular events and predicted cardiovascular risks after 12-month intervention in the primary care setting. Methods A random sample of 1,248 people with diabetes enrolled to RAMP-DM for at least 12 months was selected and 1,248 people with diabetes under the usual primary care were matched by age, sex...

  11. 黑白双色 飞利浦发布MODA系列显示器

    Institute of Scientific and Technical Information of China (English)

    冯华

    2011-01-01

    近日飞利浦发布了两款被命名为MODA摩登的显示器新品248C3L、248C3LH,无论从外观设计、制造工艺、色彩表现,还是应用体验上,都被誉为"飞利浦史上最美显示器"。

  12. Evaluation of Statens Serum Institut Enteric Medium for Detection of Enteric Pathogens

    OpenAIRE

    Blom, Marianne; Meyer, Aase; Gerner-Smidt, Peter; Gaarslev, Knud; Espersen, Frank

    1999-01-01

    The efficacy of the Statens Serum Institut (SSI) enteric medium for isolation and direct identification of enteric pathogens was evaluated. Six different biochemical reactions can be read by using the SSI enteric medium, allowing direct identification of a range of enteric pathogens. All 248 gram-negative bacterial species that were tested grew on the SSI enteric medium. Only 10 of 248 bacteria (4%) showed discrepant results in the biochemical reactions, and none of these were enteric pathoge...

  13. Supplementation with L-Glutamine and L-Alanyl-L-Glutamine Changes Biochemical Parameters and Jejunum Morphophysiology in Type 1 Diabetic Wistar Rats

    OpenAIRE

    da Rosa, Carlos Vinicius D.; Azevedo, Silvia C. S. F.; Bazotte, Roberto B.; Peralta, Rosane M.; Buttow, Nilza C.; Maria Montserrat D Pedrosa; Vilma A F de Godoi; Maria Raquel M Natali

    2015-01-01

    We evaluated the effects of the supplementation with L-glutamine and glutamine dipeptide (GDP) on biochemical and morphophysiological parameters in streptozotocin-diabetic rats. For this purpose, thirty animals were distributed into six groups treated orally (gavage) during thirty days: non diabetic rats (Control) + saline, diabetic + saline; Control + L-glutamine (248 mg/kg), Diabetic + L-glutamine (248 mg/kg), Control + GDP (400 mg/kg), Diabetic + GDP (400 mg/kg). Diabetes was induced by an...

  14. Enhancing the thermostability of a cold-active lipase from Penicillium cyclopium by in silico design of a disulfide bridge.

    Science.gov (United States)

    Tan, Zhongbiao; Li, Jianfang; Wu, Minchen; Wang, Junqing

    2014-08-01

    Cysteine mutants of a cold-active lipase (PcLipI) from Penicillium cyclopium were designed by the software Disulfide by Design Ver. 1.20 in an effort to improve enzyme thermostability by addition of a disulfide bridge. Those mutants predicted by molecular dynamics simulation to have better thermostability than the wild type were first expressed in Escherichia coli BL21(DE3) and then, for further investigation, in Pichia pastoris GS115. By replacing Val248 and Thr251 with cysteines to create a disulfide bridge, the recombinant lipases reE-PcLipV248C-T251C (expressed in E. coli) and reP-PcLipV248C-T251C (expressed in P. pastoris) were obtained. Both had enhanced thermostability with half-lives at 35 °C about 4.5- and 12.8-fold longer than that of the parent PcLipI expressed in E. coli and P. pastoris, respectively. The temperature optima of reE-PcLipV248C-T251C and reP-PcLipV248C-T251C were 35 and 30 °C, which were each 5 °C higher than those of the parent PcLipI expressed in E. coli and P. pastoris. The K ms of reE-PcLipV248C-T251C and reP-PcLipV248C-T251C toward tributyrin were 53.2 and 39.5 mM, while their V maxs were 1,460 and 3,800 U/mg, respectively. PcLipV248C-T251C had better thermostability and catalytic efficiency than the other mutants and the parent PcLipI. PMID:24867629

  15. Bk and Cf chromatographic separation and ²⁴⁹Bk/²⁴⁸Cm and ²⁴⁹Cf/²⁴⁸Cm elemental ratios determination by inductively coupled plasma quadrupole mass spectrometry.

    Science.gov (United States)

    Gourgiotis, A; Isnard, H; Nonell, A; Aubert, M; Stadelmann, G; Dupont, E; AlMahamid, I; Tiang, G; Rao, L; Lukens, W; Cassette, P; Panebianco, S; Letourneau, A; Chartier, F

    2013-03-15

    The French Atomic Energy Commission has carried out several experiments for the study of minor-actinide transmutation processes in high intensity thermal neutron flux. In this context a Cm sample enriched in (248)Cm (∼97%) was irradiated in a thermal neutron flux at the High Flux Reactor (HFR) of the Laue-Langevin Institute (ILL). The precise and accurate determination of Cf isotope ratios and of (249)Bk/(248)Cm and (249)Cf/(248)Cm elemental ratios in the (248)Cm irradiated sample is crucial for the calculation of actinide neutron capture cross-sections. This work describes an analytical procedure for the separation and the isotope ratio measurement of Bk and Cf in the irradiated sample. The Bk and Cf separation is based on a lanthanides separation protocol previously developed by the laboratory. Well-defined retention times for Bk and Cf were obtained by coupling the Ionic Chromatography (IC) with an ICP-QMS. All conditions of element separation by IC and the different steps of the analytical protocol in order to obtain the isotopic and elemental ratios are presented. Relative uncertainties of Cf isotopic ratios range from 0.3% to 0.5% and the uncertainty of the (249)Bk/(248)Cm and (249)Cf/(248)Cm elemental ratios are respectively 6.1% and 3.2%. This level of uncertainty for both isotopic and elemental ratios is in perfect agreement with the requirement for transmutation studies. PMID:23598093

  16. Neutron radiography for nondestructive testing

    International Nuclear Information System (INIS)

    Neutron radiography is similar to X-ray inspection in that both depend upon use of radiation that penetrates some materials and is absorbed by others to provide a contrast image of conditions not readily available for visual inspection. X-rays are absorbed by dense materials, such as metals, whereas neutrons readily penetrate metals, but are absorbed by materials containing hydrogen. The neutron radiography has been successfully applied to a number of inspection situations. These include the inspection of explosives, advanced composites, adhesively bonded structures and a number of aircraft engine components. With the availability of Californium-252, it has become feasible to construct mobile neutron radiography systems suitable for field use. Such systems have been used for in-situ inspection of flight line aircraft, particularly to locate and measure hidden corrosion

  17. Preparation of actinide targets by electrodeposition

    Science.gov (United States)

    Trautmann, N.; Folger, H.

    1989-10-01

    Actinide targets with varying thicknesses on different substrates have been prepared by electrodeposition either from aqueous solutions or from solutions of their nitrates in isopropyl alcohol. With these techniques the actinides can be deposited almost quantitatively on various backing materials within 15 to 30 min. Targets of thorium, uranium, neptunium, plutonium, americium, curium and californium with areal densities from almost carrier-free up to 1.4 mg/cm 2 on thin beryllium, carbon, titanium, tantalum and platinum foils have been prepared. In most cases, prior to the deposition, the actinides had to be purified chemically and for some of them, due to the limited amount of material available, recycling procedures were required. Applications of actinide targets in heavy-ion reactions are briefly discussed.

  18. An atomic beam source for actinide elements: concept and realization

    International Nuclear Information System (INIS)

    For ultratrace analysis of actinide elements and studies of their atomic properties with resonance ionization mass spectroscopy (RIMS), efficient and stable sources of actinide atomic beams are required. The thermodynamics and kinetics of the evaporation of actinide elements and oxides from a variety of metals were considered, including diffusion, desorption, and associative desorption. On this basis various sandwich-type filaments were studied. The most promising system was found to consist of tantalum as the backing material, an electrolytically deposited actinide hydroxide as the source of the element, and a titanium covering layer for its reduction to the metal. Such sandwich sources were experimentally proven to be well suited for the production of atomic beams of plutonium, curium, berkelium and californium at relatively low operating temperatures and with high and reproducible yields. (orig.)

  19. Environmental assessment of the thermal neutron activation explosive detection system for concourse use at US airports

    International Nuclear Information System (INIS)

    This document is an environmental assessment of a system designed to detect the presence of explosives in checked airline baggage or cargo. The system is meant to be installed at the concourse or lobby ticketing areas of US commercial airports and uses a sealed radioactive source of californium-252 to irradiate baggage items. The major impact of the use of this system arises from direct exposure of the public to scattered or leakage radiation from the source and to induced radioactivity in baggage items. Under normal operation and the most likely accident scenarios, the environmental impacts that would be created by the proposed licensing action would not be significant. 44 refs., 19 figs., 18 tabs

  20. A comparative study of bulk etch rate measurement methods in polycarbonate detectors

    International Nuclear Information System (INIS)

    The response of a plastic detector to an incoming charged particle is given by the ratio of track etch rate vt to bulk etch rate vg along its path. Although the accurate determination of vt offers no difficulty as cone length can be comfortably measured, there seems to be a certain ambiguity as how to measure vg. Several LEXAN and TUFFAK polycarbonate plates have been exposed to normally incident Californium-252 fission fragments, etched in a stirred aqueous NaOH solution saturated with etch products and with a 0.05% of Dowfax surfactant, for different etching times, concentrations and temperatures. We have used three methods to measure vg and we obtain consistent results in agreement with those published in the literature. Surface quality and, consequently, ellipses neatness, are far superior in TUFFAK than in LEXAN. (author)

  1. A Novel Approach to β-delayed Neutron Spectroscopy Using the Beta-decay Paul Trap

    International Nuclear Information System (INIS)

    A new approach to β-delayed neutron spectroscopy has been demonstrated that circumvents the many limitations associated with neutron detection by instead inferring the decay branching ratios and energy spectra of the emitted neutrons by studying the nuclear recoil. Using the Beta-decay Paul Trap, fission-product ions were trapped and confined to within a 1-mm3 volume under vacuum using only electric fields. Results from recent measurements of 137I+ and plans for development of a dedicated ion trap for future experiments using the intense fission fragment beams from the Californium Rare Isotope Breeder Upgrade (CARIBU) facility at Argonne National Laboratory are summarized. The improved nuclear data that can be collected is needed in many fields of basic and applied science such as nuclear energy, nuclear astrophysics, and stockpile stewardship

  2. Devices for rapid protein determination in grain products and mixed feeds by the neutron method

    International Nuclear Information System (INIS)

    Protein determination should be carried out using rapid techniques so that each truckful of grain can be checked for protein while mixed feeds can be checked for protein directly in the product flow lines with automatic correction of their work. The existing methods of protein determination do not meet the above requirements. In this connection, the Azot analyzer has beem developed based on the reaction of capture of thermal neutrons by the nuclei of the nitrogen present in the analyzed product and the registration of the resulting gamma-quanta emission of 10.8 Mev. Readings of the nitrogen will be converted to those of protein with the help of standard conversion coefficients. Alongside with protein content, the Azot can measure the test weight of the grain by absorbing californium 252 neutrons

  3. Probe for the exploration of deposits

    International Nuclear Information System (INIS)

    The exploration probes work by means of a prompt (n,γ) analysis, activation analysis or X-ray fluorescence analysis. The neutrons or gamma radiation are provided by a californium-252 source or a cobalt-57 source which are placed in the probe. The probe is in the form of a pipe consisting of single modules. Each module contains a part of the whole radiation producing, shielding, detector, detector cooling and detector electronic system. They can be screwed onto one another and can be exchanged for other parts. A melt cryostatat or a compressor is used as cooling device, a germanium-(Li) detector as detector, and bismuth and heavy water as shielding. All measuring process can thus be carried out in situ in a relatively short measuring time. (DG)

  4. Robotics and remote systems applications

    International Nuclear Information System (INIS)

    This article is a review of numerous remote inspection techniques in use at the Savannah River (and other) facilities. These include: (1) reactor tank inspection robot, (2) californium waste removal robot, (3) fuel rod lubrication robot, (4) cesium source manipulation robot, (5) tank 13 survey and decontamination robots, (6) hot gang valve corridor decontamination and junction box removal robots, (7) lead removal from deionizer vessels robot, (8) HB line cleanup robot, (9) remote operation of a front end loader at WIPP, (10) remote overhead video extendible robot, (11) semi-intelligent mobile observing navigator, (12) remote camera systems in the SRS canyons, (13) cameras and borescope for the DWPF, (14) Hanford waste tank camera system, (15) in-tank precipitation camera system, (16) F-area retention basin pipe crawler, (17) waste tank wall crawler and annulus camera, (18) duct inspection, and (19) deionizer resin sampling

  5. Utilization of radiation facilities at TNRC for shielding researches and related topics

    International Nuclear Information System (INIS)

    This paper presents the running shielding research activities at Tajura Nuclear research center. The main area of researches are concentrated on the investigation of different types of concrete made from local materials such as conventional concrete, Magnetite-Limonite concrete, and heat resistant concrete. The measuring techniques used were neutron-gamma spectrometry, and activation foils. The measurements were performed using collimated beam of reactor neutrons emitted from one of the horizontal channels, as well as from californium-252 neutron source. The transmitted neutron spectra through concrete barriers of different thicknesses were measured by a scintillation spectrometer with NE-213 liquid organic scintillator. A non-destructive testing of some reactor materials were also carried out using neutron and gamma ray computerized tomography technique (CT). Some experiments were also carried out related to measurements of neutron depth dose distributions inside tissue equivalent materials. 10 figs

  6. Nuclear fission and the transuranium elements

    International Nuclear Information System (INIS)

    Many of the transuranium elements are produced and isolated in large quantities through the use of neutrons furnished by nuclear fission reactions: plutonium (atomic number 94) in ton quantities; neptunium (93), americium (95), and curium (96) in kilogram quantities; berkelium (97) in 100 milligram quantities; californium (98) in gram quantities; and einsteinium (99) in milligram quantities. Transuranium isotopes have found many practical applications---as nuclear fuel for the large-scale generation of electricity, as compact, long-lived power sources for use in space exploration, as means for diagnosis and treatment in the medical area, and as tools in numerous industrial processes. Of particular interest is the unusual chemistry and impact of these heaviest elements on the periodic table. This account will feature these aspects. 9 refs., 5 figs

  7. Potential nuclear safeguards applications for neutron generators

    International Nuclear Information System (INIS)

    Many nuclear safeguards inspection instruments use neutron sources to interrogate the fissile material (commonly 235U and 239Pu) to be measured. The neutron sources currently used in these instruments are isotopics such as Californium-252, Americium-Lithium, etc. It is becoming increasingly more difficult to transport isotopic sources from one measurement location to another. This represents a significant problem for the International Atomic Energy Agency (IAEA) safeguards inspectors because they must take their safeguards instruments with them to each nuclear installation to make an independent measurement. Purpose of this paper is to review the possibility of replacing isotopic neutron sources now used in IAEA safeguards instruments with electric neutron sources such as deuterium-tritium (D-T, 14-MeV neutrons) or deuterium-deuterium (D-D, 2-MeV neutrons). The potential for neutron generators to interrogate spent-light water reactor fuel assemblies in storage pools is also reviewed

  8. Reliability of semiconductor and gas-filled diodes for over-voltage protection exposed to ionizing radiation

    Directory of Open Access Journals (Sweden)

    Stanković Koviljka

    2009-01-01

    Full Text Available The wide-spread use of semiconductor and gas-filled diodes for non-linear over-voltage protection results in a variety of possible working conditions. It is therefore essential to have a thorough insight into their reliability in exploitation environments which imply exposure to ionizing radiation. The aim of this paper is to investigate the influence of irradiation on over-voltage diode characteristics by exposing the diodes to californium-252 combined neutron/gamma radiation field. The irradiation of semiconductor over-voltage diodes causes severe degradation of their protection characteristics. On the other hand, gas-filled over-voltage diodes exhibit a temporal improvement of performance. The results are presented with the accompanying theoretical interpretations of the observed changes in over-voltage diode behaviour, based on the interaction of radiation with materials constituting the diodes.

  9. Measurements of the neutron capture cross sections and incineration potentials of minor-actinides in high thermal neutron fluxes: Impact on the transmutation of nuclear wastes

    International Nuclear Information System (INIS)

    This thesis comes within the framework of minor-actinide nuclear transmutation studies. First of all, we have evaluated the impact of minor actinide nuclear data uncertainties within the cases of 241Am and 237Np incineration in three different reactor spectra: EFR (fast), GT-MHR (epithermal) and HI-HWR (thermal). The nuclear parameters which give the highest uncertainties were thus highlighted. As a result of fact, we have tried to reduce data uncertainties, in the thermal energy region, for one part of them through experimental campaigns in the moderated high intensity neutron fluxes of ILL reactor (Grenoble). These measurements were focused onto the incineration and transmutation of the americium-241, the curium-244 and the californium-249 isotopes. Finally, the values of 12 different cross sections and the 241Am isomeric branching ratio were precisely measured at thermal energy point. (author)

  10. Multi-purpose neutron radiography system

    International Nuclear Information System (INIS)

    A conceptual design is given for a low cost, multipurpose radiography system suited for the needs of the Los Alamos National Laboratory (LANL). The proposed neutron source is californium-252. One purpose is to provide an in-house capability for occasional, reactor quality, neutron radiography thus replacing the recently closed Omega-West Reactor. A second purpose is to provide a highly reliable standby transportable neutron radiography system. A third purpose is to provide for transportable neutron probe gamma spectroscopy techniques. The cost is minimized by shared use of an existing x-ray facility, and by use of an existing transport cask. The achievable neutron radiography and radioscopy performance characteristics have been verified. The demonstrated image qualities range from high resolution gadolinium - SR film, with L:D = 100:1, to radioscopy using a LIXI image with L:D = 30:1 and neutron fluence 3.4 x 105 n/cm2

  11. Measurements of the neutron capture cross sections and incineration potentials of minor-actinides in high thermal neutron fluxes: Impact on the transmutation of nuclear wastes; Mesures des sections efficaces de capture et potentiels d'incineration des actinides mineurs dans les hauts flux de neutrons: Impact sur la transmutation des dechets

    Energy Technology Data Exchange (ETDEWEB)

    Bringer, O

    2007-10-15

    This thesis comes within the framework of minor-actinide nuclear transmutation studies. First of all, we have evaluated the impact of minor actinide nuclear data uncertainties within the cases of {sup 241}Am and {sup 237}Np incineration in three different reactor spectra: EFR (fast), GT-MHR (epithermal) and HI-HWR (thermal). The nuclear parameters which give the highest uncertainties were thus highlighted. As a result of fact, we have tried to reduce data uncertainties, in the thermal energy region, for one part of them through experimental campaigns in the moderated high intensity neutron fluxes of ILL reactor (Grenoble). These measurements were focused onto the incineration and transmutation of the americium-241, the curium-244 and the californium-249 isotopes. Finally, the values of 12 different cross sections and the {sup 241}Am isomeric branching ratio were precisely measured at thermal energy point. (author)

  12. Triton and alpha-particle contribution from LiF converter for neutron dosimeter

    CERN Document Server

    Camacho, M E; Balcazar, M

    1999-01-01

    A personnel neutron dosimeter prototype based on chemical and electrochemical etched CR-39 detector, combined with LiF converter, has been calibrated using an ICRP-like phantom, under a heavy-water moderated Californium source neutron spectra; A conversion factor of 1.052+-126 spots cm sup - sup 2 mSv sup - sup 1 was obtained. The sealing properties of the detector holder showed a ten-fold reduction in radon background when it was tested in a high radon atmosphere. A convenient mechanical shock resistance was achieved in LiF converters by sintering to 11 tons pressure LiF powder at 650 deg. C, during one hour.

  13. Nuclear fission and the transuranium elements

    Energy Technology Data Exchange (ETDEWEB)

    Seaborg, G.T.

    1989-02-01

    Many of the transuranium elements are produced and isolated in large quantities through the use of neutrons furnished by nuclear fission reactions: plutonium (atomic number 94) in ton quantities; neptunium (93), americium (95), and curium (96) in kilogram quantities; berkelium (97) in 100 milligram quantities; californium (98) in gram quantities; and einsteinium (99) in milligram quantities. Transuranium isotopes have found many practical applications---as nuclear fuel for the large-scale generation of electricity, as compact, long-lived power sources for use in space exploration, as means for diagnosis and treatment in the medical area, and as tools in numerous industrial processes. Of particular interest is the unusual chemistry and impact of these heaviest elements on the periodic table. This account will feature these aspects. 9 refs., 5 figs.

  14. General purpose nuclear irradiation chamber

    International Nuclear Information System (INIS)

    Nuclear technology has found a great need for use in medicine, industry, and research. Smoke detectors in our homes, medical treatments and new varieties of plants by irradiating its seeds are just a few examples of the benefits of nuclear technology. Portable neutron source such as Californium-252, available at Industrial Technology Division (BTI/ PAT), Malaysian Nuclear Agency, has a 2.645 year half-life. However, 252Cf is known to emit gamma radiation from the source. Thus, this chamber aims to provide a proper gamma shielding for samples to distinguish the use of mixed neutron with gamma-rays or pure neutron radiation. The chamber is compatible to be used with other portable neutron sources such as 241Am-Be as well as the reactor TRIGA PUSPATI for higher neutron dose. This chamber was designed through a collaborative effort of Kulliyyah Engineering, IIUM with the Industrial Technology Division (BTI) team, Malaysian Nuclear Agency. (Author)

  15. Experimental survey of the potential energy surfaces associated with fission

    International Nuclear Information System (INIS)

    Progress in the experimental determination of the properties of the potential energy surface associated with fission is reviewed. The importance of nuclear symmetry effects on the calculation of fission widths is demonstrated. Evidence is presented for the fragmentation of the mass-asymmetric second barrier in the thorium region and the axial asymmetric first barrier in the californium region. Detailed analyses of experimental data suggest the presence of two parallel second barriers; the normal mass-asymmetric, axial-symmetric barrier and a slightly higher mass-symmetric, axial-asymmetric barrier. Experimental barrier parameters are determined systematically and compared with calculations from various theoretical models. Techniques for expanding fission probability measurements to higher energies are discussed. (author)

  16. Effects of 252Cf neutrons, transmitted through an iron block on human lymphocyte chromosome

    International Nuclear Information System (INIS)

    Chromosome aberration of human peripheral blood lymphocytes exposed to californium-252 (252Cf) neutrons transmitted through a 15 cm thick iron block was analysed. The spectrum of the filtered neutrons ranged from 0.1 to 2MeV with a peak at 0.7 MeV, simulating the Hiroshima atomic bomb neutron spectrum as shown in the Dosimetry System 1986 (DS86). Chromosome aberration frequencies after exposure to filtered and unfiltered 252Cf radiation were compared. Acentric ring chromosomes were significantly increased (p 0.1). The relative biological effectiveness (RBE) of the neutrons with respect to the formation of dicentrics and centric rings was 10.9 and 12.3 in the filtered and unfiltered conditions respectively, but the difference was not statistically significant. These results provide useful information for the re-evaluation of the biological effect of the Hiroshima atomic bomb radiations. (Author)

  17. Test and evaluation results of the 252Cf shuffler at the Savannah River Plant

    International Nuclear Information System (INIS)

    The 252Cf Shuffler, a nondestructive assay instrument employing californium neutron source irradiation and delayed-neutron counting, was developed for measuring 235U content of scrap and waste items generated at the Savannah River Plant (SRP) reactor fuel fabrication facility. The scrap and waste items include high-purity uranium-aluminum alloy ingots as well as pieces of castings, saw and lathe chips from machining operations, low-purity items such as oxides of uranium or uranium intermixed with flux materials found in recovery operations, and materials not recoverable at SRP such as floor sweepings or residues from the uranium scrap recovery operation. The uranium contains about 60% 235U with the remaining isotopes being 236U, 238U, and 234U in descending order. The test and evaluation at SRP concluded that the accuracy, safety, reliability, and ease of use made the 252Cf Shuffler a suitable instrument for routine use in an industrial, production-oriented plant

  18. Highly charged ions for atomic clocks and search for variation of the fine structure constant

    CERN Document Server

    Dzuba, V A

    2015-01-01

    We review a number of highly charged ions which have optical transitions suitable for building extremely accurate atomic clocks. This includes ions from Hf$^{12+}$ to U$^{34+}$, which have the $4f^{12}$ configuration of valence electrons, the Ir$^{17+}$ ion, which has a hole in almost filled $4f$ subshell, the Ho$^{14+}$, Cf$^{15+}$, Es$^{17+}$ and Es$^{16+}$ ions. Clock transitions in most of these ions are sensitive to variation of the fine structure constant, $\\alpha$ ($\\alpha = e^2/\\hbar c$). E.g., californium and einsteinium ions have largest known sensitivity to $\\alpha$-variation while holmium ion looks as the most suitable ion for experimental study. We study the spectra of the ions and their features relevant to the use as frequency standards.

  19. The CARIBU EBIS control and synchronization system

    Science.gov (United States)

    Dickerson, Clayton; Peters, Christopher

    2015-01-01

    The Californium Rare Isotope Breeder Upgrade (CARIBU) Electron Beam Ion Source (EBIS) charge breeder has been built and tested. The bases of the CARIBU EBIS electrical system are four voltage platforms on which both DC and pulsed high voltage outputs are controlled. The high voltage output pulses are created with either a combination of a function generator and a high voltage amplifier, or two high voltage DC power supplies and a high voltage solid state switch. Proper synchronization of the pulsed voltages, fundamental to optimizing the charge breeding performance, is achieved with triggering from a digital delay pulse generator. The control system is based on National Instruments realtime controllers and LabVIEW software implementing Functional Global Variables (FGV) to store and access instrument parameters. Fiber optic converters enable network communication and triggering across the platforms.

  20. Neutrons in cancer therapy

    Science.gov (United States)

    Allen, Barry J.

    1995-03-01

    The role of neutrons in the management of cancer has a long history. However, it is only in recent years that neutrons are beginning to find an accepted place as an efficacious radiation modality. Fast neutron therapy is already well established for the treatment of certain cancers, and clinical trials are ongoing. Californium neutron sources are being used in brachytherapy. Boron neutron capture therapy has been well tested with thermal neutrons and epithermal neutron dose escalation studies are about to commence in the USA and Europe. Possibilities of neutron induced auger electron therapy are also discussed. With respect to chemotherapy, prompt neutron capture analysis is being used to study the dose optimization of chemotherapy in the management of breast cancer. The rationales behind these applications of neutrons in the management of cancer are examined.

  1. Study of reproducibility of measurements with the spectrometer of Bonner multispheres

    Energy Technology Data Exchange (ETDEWEB)

    Azevedo, G.A.; Pereira, W.W.; Patrao, K.C.S.; Fonseca, E.S., E-mail: geisadeazevedo@gmail.com, E-mail: walsan@ird.gov.br, E-mail: karla@ird.gov.br, E-mail: evaldo@ird.gov.br [Instituto de Radionprotecao e Dosimetria (IRD/CNEN-RJ), Rio de Janeiro, RJ (Brazil)

    2013-07-01

    This work aims to study the metrological behavior of the Bonner Multisphere Spectrometer (BMS) of the LN / LNMRI / IRD - Laboratorio Metrologia de Neutrons / Laboratorio Nacional de Metrologia e Radiacao Ionizante / Instituto de Radioprotecao e Dosimetria, for measurements in repeatability and reproducibility conditions. Initially, a simulation was done by applying the Monte Carlo method, using the MCNP code and respecting the ISO 8529-1 (2001), using the sources of Californium ({sup 252} Cf), Americium-Beryllium ({sup 241} AmBe) and californium in heavy water (Cf + D{sub 2}O), all located at a distance of 100 cm from the neutron detector ({sup 6}Li (Eu) - crystal scintillator). In this program, the counting of neutrons that are captured by the detector was made. The source is located in the center of a sphere of radius 300 cm. Analyzes the impact of these neutrons in a point of the sphere wall, which in this case acted as a neutron detector and from there, it is estimated the number of neutrons that collide in the whole sphere. The purpose is to obtain the neutron count for different energy bands in a solid field of neutrons, since they have a spectrum ranging from a low to a high energy that can also vary within a particular environment. Wishes to obtain new fields with different sources and moderators materials to be used as new reference fields. Measurements are being conducted for these fields, with the aim of analyzing the variability conditions of the measurement (repeatability and reproducibility) in LEN - Laboratorio de Espectrometria de Neutrons of the LN/LMNRI/IRD. Thus, the spectrometer will be used to improve both the knowledge of the spectrum as the standard of neutrons of the lab, proving that a spectrometry is essential for correct measurement.

  2. Construction of attenuated Salmonella typhimurium Strain expressing Helicobacter pylori conservative region of adhesin antigen and its immunogenicity

    Institute of Scientific and Technical Information of China (English)

    Yang Bai; Ya-Li Zhang; Ji-De Wang; Zhao-Shan Zhang; Dian-Yuan Zhou

    2004-01-01

    AIM: To construct a non-resistant and attenuated Salmonella typhimurium (S. typhimurium) strain which expresses conservative region of adhesion AB of Helicobacter pylori (H pylori) and evaluate its immunogenicity.METHODS: The AB gene amplified by PCR was inserted into the expression vector pYA248 containing asd gene and through two transformations introduced into the delta Cya, delta Crp, delta Asd attenuated Salmonella typhimurium strain, constructing balanced lethal attenuated Salmonella typhimurium strains X4072 (pYA248-AB). Bridged ELISA method was used to measure the expression of AB antigen in sonic ate and culture supernatant. According to the method described by Meacock, stability of the recombinant was evaluated. Semi-lethal capacity test was used to evaluate the safety of recombinant. The immunogenicity of recombinant was evaluated with animal experiments.RESULTS: The attenuated S. typhimurium X4072 (pYA248-AB) which expresses AB was successfully constructed.Furthermore, bridged ELISA assay showed that the content of AB in recombinant X4072 (pYA248- AB) culture supematant was higher than that was in thallus lyric liquor. And after recombinant X4072 (pYA248- AB) was cultured for 100generations without selection pressure, the entire recombinant bacteria selected randomly could grow, and the AB antigen was defected positive by ELISA. The growth curve of the recombinant bacteria showed that the growth states of X4072 (pYA248) and X4072 (pYA248-AB) were basically consistent. The survival rate of C57BL/6 was still 100%, at 30 d after mice taking X4072 (pYA248-AB) 1.0×1010 cfu orally. Oral immunization of mice with X4072 (pYA248-AB)induced a specific immune response.CONCLUSION: In vitro recombinant plasmid appears to be stable and experiments on animals showed that the recombinant strains were safe and immunogenic in vitro,which providing a new live oral vaccine candidate for protection and care of H pylori infection.

  3. Star formation in infrared bright and infrared faint starburst interacting galaxies

    Science.gov (United States)

    Lamb, Susan A.; Bushouse, Howard A.; Towns, John W.

    1990-01-01

    Short wavelength IUE spectra of Arp 248b and UGC 8315N are combined with optical spectra and interpreted using a combination of spectrum synthesis and spectral diagnostics to place constraints on the massive star populations of the central regions of these galaxies and to deduce information about the star formation histories in the last 10(exp 8) years. The authors find that both galaxies have substantial fractions of their optical light coming from massive stars and that Arp 248b may be dominated in the UV by WR stars. The UV spectra are dominated by radiation from evolved massive stars and the authors place and age on the burst in Arp 248b of a few tens of millions of years.

  4. Mass-screening techniques for early selection of banana and plantain crops resistant to major diseases and pests

    International Nuclear Information System (INIS)

    Different in vitro selection techniques that are used for selecting banana and plantain plants resistant to diseases and pests are discussed in this chapter with a focus on Black sigatoka disease. Explants that are suitable for in vitro selection include shoot meristems, micro-cross sections, callus, cell suspension and protoplasts. A double selection system using the crude filtrate and the purified host-specific toxin 2,4,8-trihydroxytetralone (2,4,8-THT) is described. The optimum concentration of the host-specific toxin 2,4,8-THT and the non-host-specific toxin juglone used for selection and the mode of action of the purified toxins are also shown. A combination of mutation induction and effective selection methods appears to be the most effective strategy to improve tolerance to diseases in banana and plantains. (author)

  5. Molecular manipulation and modification of the genes encoding the G2 and G4 glycinin subunits

    Directory of Open Access Journals (Sweden)

    Reda H. Sammour

    2006-01-01

    Full Text Available The genes encoding the glycinin subunits G2 and G4 were molecularly manipulated and modified to test the possibility of increasing the nutritional value of soybean seed proteins. The recombinant DNAs pSP65/G2HG4, pSP65/G4HG2, pSP65/248 Metl, pSP65/248 Met2,3 and pSP65/248 Metl.2,3 were used in in vitro translation to produce (i chimeric proteins consisting of reciprocally exchanged acidic and basic G2 and G4 domains and (ii Gy4 point mutants with an increased number of methionine residues. The ability of the recombinant proteins to assemble into proper quaternary structures was investigated using sucrose gradient fractionation. The data produced by this study could provide valuable clues for the potential improvement of genetically modified crops.

  6. Application of high-refractive index fluid to KrF-immersion lithography

    Science.gov (United States)

    Yada, Yuji; Ito, Koji; Yamaguchi, Yoshikazu; Furukawa, Taiichi; Miyamatsu, Takashi; Wang, Yong; Hieda, Katsuhiko; Shimokawa, Tsutomu

    2006-03-01

    This paper describes the material characteristics for KrF-immersion lithography with a high refractive index fluid. We have obtained promising results in soaking experiments involving KrF lithography without topcoat film. Although water is currently used as the immersion fluid in 193nm lithography, providing suitable refractive index (n=1.44@193nm and n=1.37@248nm) and transmittance (>99%/mm), it is found to have leaching issues when used with KrF resist. On the other hand, our high refractive index fluid (JSR-HIL-001), which was developed for ArF immersion purposes, satisfies the following requirements: HIL-001 has indicated promising characteristics as a 248nm-immmersion fluid. The refractive index is 1.54@248nm and the transmittance is >99%/mm. In this paper the physical and chemical properties of HIL-001 for KrF-immersion fluid application are discussed in detail.

  7. Erythrobacter pelagi sp. nov., a member of the family Erythrobacteraceae isolated from the Red Sea

    KAUST Repository

    Wu, H.-x.

    2011-08-05

    A novel Gram-negative, aerobic, catalase- and oxidase-positive, non-sporulating, non-motile, rod-shaped bacterium, designated strain UST081027-248(T), was isolated from seawater of the Red Sea. Phylogenetic analysis based on 16S rRNA gene sequences showed that strain UST081027-248(T) fell within the genus Erythrobacter. Levels of 16S rRNA gene sequence similarity between the novel strain and the type strains of Erythrobacter species ranged from 95.3% (with Erythrobacter gangjinensis) to 98.2% (with Erythrobacter citreus). However, levels of DNA-DNA relatedness between strain UST081027-248(T) and the type strains of closely related species were below 70%. Optimal growth of the isolate occurred in the presence of 2.0% NaCl, at pH 8.0-9.0 and at 28-36 degrees C. The isolate did not produce bacteriochlorophyll a. The predominant cellular fatty acids were C-17:1 omega 6c, summed feature 8 (C-18:1 omega 6c and/or C-18:1 omega 7c) and C-15:0 2-OH. The genomic DNA G+C content of strain UST081027-248(T) was 60.4 mol%. Phenotypic properties and phylogenetic distinctiveness clearly indicated that strain UST081027-248(T) represents a novel species of the genus Erythrobacter, for which the name Erythrobacter pelagi sp. nov. is proposed. The type strain is UST081027-248(T) (=JCM 17468(T)=NRRL 59511(T)).

  8. 比值-导数光谱法快速测定香草醛%Rapidly Determination of Vanillin by Ratio-derivative Spectrophotometry

    Institute of Scientific and Technical Information of China (English)

    姚丽平; 陈元彩

    2013-01-01

    文章用比值-导数光谱法测定香草醛的含量.实验结果表明,香草醛木素溶液在pH≤7时香草醛在230 nm处有吸收,在pH>7时在248 nm处有吸收.根据不同pH值和不同浓度条件下香草醛木素溶液的比值-导数光谱,说明在230 nm处的光谱信号在pH≤7不受pH值影响,248 nm处的光谱信号在pH>7不受pH值影响.在230 nm和248 nm处的光谱信号对浓度的变化较为敏感,在此两处吸收值可用于香草醛的测定.%Ratio-derivative spectrometry was used for determination of vanillin content. Analysis results indicated that when pH ≤7 vanillin lignin has absorption at 230 nm and when pH>7 vanillin lignin has absorption at 248 nm. Ratio derivative spectrum of vanillin under different pH and different concentrations indicated that when pH ≤ 7 the spectrum at 230 nm would not suffer from pH effect, when pH>7 the spectrum at 248 nm would not suffer from pH effect. The signals at 230 nm and 248 nm in the spectrum are more sensitive to the change of concentrations, thus the two values can be used for the determination of absorption.

  9. Early psychiatrics symptoms in familial Alzheimer's disease with presenilin 1 mutation (I83T).

    Science.gov (United States)

    Fray, Saloua; Ali, Nadia Ben; Rassas, Afef Achouri; Kechaou, Meriem; Oudiaa, Nouria; Cherif, Aroua; Echebbi, Slim; Messaoud, Taieb; Belal, Samir

    2016-04-01

    Several clinical phenotypes were associated with presenilin 1 (PSEN1) mutation in early-onset familial Alzheimer's disease (EOFAD). We report the clinical phenotype of two members of a familial dementia kindred who presented with EOFAD and early psychiatric syndrome as behavioral abnormalities. Sequence analysis of the index patient and his brother's PSEN1 transcript revealed a novel T > C transition in exon 4 which was determined as a missense substitution at position 248 of the coding sequence (cDNA. 248T > C). PMID:26695639

  10. AcEST: DK956868 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST39A01NGRL0026_N23 491 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0026_N23. 5' end seq ... s = 38/64 (59%) Frame = +3 Query: 69 NLPSWALKKLDQGMLMDI MDKRLYLNGFDEVQVQRLLYIAFWCIHEDPAMRPHAATVMQW 248 NL W ... ps = 2/75 (2%) Frame = +3 Query: 66 SNLPSWALKKLDQGMLMDI MDKRLYLNGFDEVQVQRLLYIAFWCIHEDPAMRPHAATVMQ 245 SNL + ... aps = 2/80 (2%) Frame = +3 Query: 69 NLPSWALKKLDQGMLMDI MDKRLYLNGFDEVQVQRLLYIAFWCIHEDPAMRPHAATVMQW 248 NL + ... ps = 2/75 (2%) Frame = +3 Query: 66 SNLPSWALKKLDQGMLMDI MDKRLYLNGFDEVQVQRLLYIAFWCIHEDPAMRPHAATVMQ 245 SNL + ...

  11. Photophysical and photochemical processes of riboflavin (vi-tamin B2) by means of the transient absorption spectra in aqueous solution

    Institute of Scientific and Technical Information of China (English)

    2001-01-01

    Using time-resolved techniques of 337 and 248 nm laser flashphotolysis, the photophysical and photochemical processes of riboflavin (RF, vitamin B2) were studied in detail in aqueous solution. The excited triplet state of riboflavin (3RF*) was produced with 337 nm laser, while under 248 nm irradiation, both 3RF* and hydrated electron () formed from photoionization could be detected. Photobiological implications have been inferred on the basis of reactivity of 3RF* including energy transfer, electron transfer and hydrogen abstraction. The RF·+ was gene- rated by oxidation of SO4·- radical with the aim of confirming the results of photolysis

  12. PCR-SSP法用于Dombrock血型Doa/Dob的基因分型%Study on dombrock blood group Doa and Dob genotyping by PCR-SSP technique

    Institute of Scientific and Technical Information of China (English)

    刘衍春; 许剑锋; 吴敏慧

    2009-01-01

    目的:了解Dombrock血型Doa和Dob基因在汉族人群中的分布.方法:采用PCR-SSP技术对Dombrock血型进行Doa和Dob基因分型.结果:248例Dombrock血型Doa的基因频率为0.0867,Dob的基因频率为0.9133.结论:248例Dombroek血型Doa及Dob的基因频率分别为0.0867和0.9133.PCR-SSP技术可以较好的对Dombrock血型进行DO基因分型.

  13. Moods Modelling on the Financial Markets

    Czech Academy of Sciences Publication Activity Database

    Vácha, Lukáš; Vošvrda, Miloslav

    Ostrava : Technical University of Ostrava, 2007, s. 1-7. ISBN 978-80-248-1457-5; ISBN 978-80-248-1458-2. [Mathematical Methods in Economics. Ostrava (CZ), 04.09.2007-06.09.2007] R&D Projects: GA ČR GD402/03/H057; GA ČR(CZ) GA402/06/1417 Institutional research plan: CEZ:AV0Z10750506 Keywords : efficient market s hypothesis * fractal market hypothesis * mood on the financial market Subject RIV: AH - Economics

  14. Drug: D00592 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available I-ACNE PREPARATIONS D10A ANTI-ACNE PREPARATIONS FOR TOPICAL USE D10AX Other anti-acne preparations for topic...s Dapsone D00592 Diaphenylsulfone (JAN); Dapsone (USP) Antiinfectives [BR:br08307] Antibacterials Folic acid biosynt...bacterial [leprostatic]; Suppressant [dermatitis herpetiformis] [DS:H00344] Same as: C07666 Therapeuti... Diaphenylsulfone (JAN); Dapsone (USP) USP drug classification [BR:br08302] Antimycobacterials Anti...D00592 Drug Diaphenylsulfone (JAN); Dapsone (USP); Aczone (TN) C12H12N2O2S 248.0619 248.3009 D00592.gif Anti

  15. Lack of Association between the Serotonin Transporter (5-HTT) and Serotonin Receptor (5-HT2A) Gene Polymorphisms with Smoking Behavior among Malaysian Malays

    OpenAIRE

    Rozak, Nur Iwani A; Ahmad, Imran; Gan, Siew Hua; Abu Bakar, Ruzilawati

    2014-01-01

    Abstract An insertion/deletion polymorphism in the promoter region of the serotonin transporter gene (5-HTTLPR) and a polymorphism (rs6313) in the serotonin 2A receptor gene (5-HT2A) have previously been linked to smoking behavior. The objective of this study was to determine the possible association of the 5-HTTLPR and 5-HT2A gene polymorphisms with smoking behavior within a population of Malaysian male smokers (n=248) and non-smokers (n=248). The 5-HTTLPR genotypes were determined using the...

  16. 基于NGN的VOIP系统的性能和安全分析

    Institute of Scientific and Technical Information of China (English)

    尤晓波

    2007-01-01

    本文首先介绍了NGN框架及其分层结构.VOIP网络结构及四种主要的VOIP实现技术:H.323.SIP.MGCP和H.248.然后分析和比较它们的优缺点.着重谈论了当前VOIP市场上的热点MGCP技术.从VOIP网络的安全性问题和QoS上考虑.提出H.248/MEGACO则是将来VOIP广泛接受的标准协议.

  17. GETDB: 103670 [GETDB

    Lifescience Database Archive (English)

    Full Text Available 103670 Link to Original y[*] w[*] P{GawB}NP0600 / FM7c 8F1 Link to DGRC Genome Viewer: 10367...e of Genetics. FM7c Link to clone table - 2 248 Link to cluster table 248 1 Request - sg - sg - - - - - - - - Show 10367...0 DGRC Number 103670 Link to Original Genotype y[*] w[*] P{GawB}NP060...0 / FM7c Insertion Site 8F1 Map Viewer Link to DGRC Genome Viewer: 103670 Related Genes CG3003 CG3099 Origin

  18. A new type-B cask design for transporting 252Cf

    International Nuclear Information System (INIS)

    A project to design, certify, and build a new US Department of Energy (DOE) Type B container for transporting >5 mg of 252Cf is more than halfway to completion. This project was necessitated by the fact that the existing Oak Ridge National Laboratory (ORNL) Type B containers were designed and built many years ago and thus do not have the records and supporting data that current regulations require. Once the new cask is available, it will replace the existing Type B containers. The cask design is driven by the unique properties of 252Cf, which is a very intense spontaneous fission neutron source and necessitates a large amount of neutron shielding. The cask is designed to contain up to 60 mg of 252Cf in the form of californium oxide or californium oxysulfate, in pellet, wire, or sintered material forms that are sealed inside small special-form capsules. The new cask will be capable of all modes of transport (land, sea, and air). The ORNL team, composed of technical and purchasing personnel and using rigorous selection criteria, chose NAC, International (NAC), as the subcontractor for the project. In January 1997, NAC started work on developing the conceptual design and performing the analyses. The original design concept was for a tungsten alloy gamma shield surrounded by two concentric shells of NS-4-FR neutron shield material. A visit to US Nuclear Regulatory Commission (NRC) regulators in November 1997 to present the conceptual design for their comments resulted in a design modification when the question of potential straight-line cracking in the NS-4-FR neutron shield material arose. NAC's modified design includes offset, wedgelike segments of the neutron shield material. The new geometry eliminates concerns about straight-line cracking but increases the weight of the packaging and makes the fabrication more complex. NAC has now completed the cask design and performed the analyses (shielding, structural, thermal, etc.) necessary to certify the cask. The cask

  19. The Development of Neutron Radiography and Tomography on a SLOWPOKE-2 Reactor

    Science.gov (United States)

    Bennett, L. G. I.; Lewis, W. J.; Hungler, P. C.

    Development of neutron radiography at the Royal Military College of Canada (RMC) started by trying to interest the Royal Canadian Air Force (RCAF) in this new non-destructive testing (NDT) technique. A Californium-252 based device was ordered and then installed at RMC for development of applicable techniques for aircraft by the first author. A second and transportable device was then designed, modified and used in trials at RCAF Bases and other locations for one year. This activity was the only foreign loan of the U.S. Californium Loan Program. Around this time, SLOWPOKE-2 reactors were being installed at four Canadian universities, while a new science and engineering building was being built at RMC. A reactor pool was incorporated and efforts to procure a reactor succeeded a decade later with a SLOWPOKE-2 reactor being installed at RMC. The only modification by the vendor for RMC was a thermal column replacing an irradiation site inside the reactor container for a later installation of a neutron beam tube (NBT). Development of a working NBT took several years, starting with the second author. A demonstration of the actual worth of neutron radiography took place with a CF-18 Hornet aircraft being neutron and X-radiographed at McClellan Air Force Base, Sacramento, CA. This inspection was followed by one of the rudders that had indications of water ingress being radiographed successfully at RMC just after the NBT became functional. The next step was to develop a neutron radioscopy system (NRS), initially employing film and then digital imaging, and is in use today for all flight control surfaces (FCS). With the third author, a technique capable of removing water from affected FCS was developed at RMC. Heating equipment and a vacuum system were utilized to carefully remove the water. This technique was proven using a sequence of near real time neutron images obtained during the drying process. The results of the drying process were correlated with a relative humidity

  20. Half a century of succession in a temperate oakwood: from species-rich community to mesic forest

    Czech Academy of Sciences Publication Activity Database

    Hédl, Radim; Kopecký, M.; Komárek, J.

    2010-01-01

    Roč. 16, č. 2 (2010), s. 267-276. ISSN 1366-9516 R&D Projects: GA AV ČR IAA600050812; GA ČR GD206/08/H049 Institutional research plan: CEZ:AV0Z60050516 Keywords : homogenization * long-term change * biodiversity loss Subject RIV: EF - Botanics Impact factor: 4.248, year: 2010

  1. Estrogenic activity in extracts and exudates of cyanobacteria and green algae

    Czech Academy of Sciences Publication Activity Database

    Sychrová, E.; Štěpánkdová, T.; Nováková, K.; Bláha, Luděk; Giesy, J.P.; Hilscherová, K.

    2012-01-01

    Roč. 39, č. 1 (2012), s. 134-140. ISSN 0160-4120 R&D Projects: GA ČR GA524/08/0496 Institutional support: RVO:67985939 Keywords : cyanobacteria * endocrine disruption * estrogenicity * algae * phytoplankton Subject RIV: EF - Botanics Impact factor: 6.248, year: 2012

  2. Sbírka rukopisných zlomků ve Státním okresním archivu v Kutné Hoře

    Czech Academy of Sciences Publication Activity Database

    Brodský, Pavel; Hradilová, Marta; Hrdinová, Martina; Petr, Stanislav; Tošnerová, Marie

    2013-01-01

    Roč. 43, č. 0 (2013), s. 207-248. ISSN 0585-5691 R&D Projects: GA ČR GAP405/10/0027 Institutional support: RVO:67985921 Keywords : codicology * manuscripts fragments * Státní okresní archiv Kutná Hora Subject RIV: AB - History

  3. Dicty_cDB: Contig-U12608-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ore = 216 bits (109), Expect = 1e-56 Identities = 248/253 (98%) Strand = Plus / Plus Query: 4 aaaatgctncgagcatgncccagtnaaccnagctaaccn...||||||||||||||||||||||||||||| Sbjct: 4 aaaatgctncgagcatgncccagtnaaccnagctaaccnanaacctgaaagnattgnatt 63 Query...atgatggcgataaaaanananaggatcnaaaatcnactgcttcaaccccccnaggcna 183 ||||||||||||||||||...|||||||||||||||||||||||||||||||||||||||||| Sbjct: 124 ttatgatggcgataaaaanananaggatcnaaaatcnactgcttcaaccccccna...xpect = 2e-05 Identities = 83/105 (79%) Strand = Plus / Plus Query: 150 atcnaaaatcnactgcttcaaccccccnaggcnang

  4. Foreign Science and Engineering Students in the United States. InfoBrief. NSF 10-324

    Science.gov (United States)

    Burrelli, Joan

    2010-01-01

    In 2008, about 568,000 foreign students (those holding temporary visas) studied at U.S. universities and colleges, 248,000 of them in science and engineering (S&E). There was an expectation that fall 2009 foreign enrollments might be negatively affected by the 2008-09 world financial crisis because of schools' restrictions on enrollment, declines…

  5. Functioning of 7-Year-Old Children Born at 32 to 35 Weeks' Gestational Age

    NARCIS (Netherlands)

    Cserjesi, R.; Van Braeckel, K.N.J.A.; Butcher, P.R.; Kerstjens, J.M.; Reijneveld, S.A.; Bouma, A.; Geuze, R.H.; Bos, A.F.

    2012-01-01

    OBJECTIVE: To compare neuropsychological functions in moderately preterm (32-35 weeks' gestation) and full-term children at the age of 7 years and identify gender differences. METHODS: Community-based prospective cohort study of 248 moderately preterm children (138 boys) and 130 full-term children (

  6. Microgrid Control Techniques at Power Converter Level

    Czech Academy of Sciences Publication Activity Database

    Valouch, Viktor; Šimek, Petr; Škramlík, Jiří; Tlustý, J.

    Ostrava: VŠB - TU Ostrava, 2013, s. 611-616. ISBN 978-80-248-2988-3. [Electric Power Engineering - EPE 2013. Kouty nad Desnou (CZ), 28.05.2013-30.05.2013] Institutional support: RVO:61388998 Keywords : microgrid * power converter * droop control Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering

  7. Equilibrium constant for aqueous mono fluoro complex of Am(III) by solvent extraction and ion exchange

    International Nuclear Information System (INIS)

    Stability constant of Am(III)-F has been measured by distribution method using two extractants and two cation exchangers. Distribution ratios were measured by counting γ activity from 241Am and the equilibrium free fluoride by ion selective potentiometry. The value of log β1 is 2.48 ± 0.02. (author). 5 refs., 1 tab

  8. Cognitive Ability and the Instructional Efficacy of Collaborative Concept Mapping

    Science.gov (United States)

    Haugwitz, Marion; Nesbit, John C.; Sandmann, Angela

    2010-01-01

    Data were gathered from 248 secondary students (14 years old, 56% female) who learned about the circulatory system in 77 self-selected collaborative groups. The learning outcomes of biology students who summarised by collaborative concept mapping were compared with those of students who summarised by collaborative writing. Learning groups randomly…

  9. New ideas in technology for desulphatation

    Czech Academy of Sciences Publication Activity Database

    Ďurďová, Libuše

    Ostrava: VŠB-TU, 2006 - (Fečko, P.; Čablík, V.), s. 229-234 ISBN 80-248-1214-2. [Recyklace odpadů /10./. Ostrava (CZ), 03.11.2006] Institutional research plan: CEZ:AV0Z20600510 Keywords : AMD * desulphatation * organic substrate * biotechnologies * barriers * in situ application Subject RIV: DA - Hydrology ; Limnology

  10. Drug: D04893 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D04893 Drug Mefenorex hydrochloride (USAN) C12H18ClN. HCl 247.0895 248.192 D04893.gif Anorexic A ... AND METABOLISM A08 ANTIOBESITY PREPARATIONS, EXCL. DIET ... PRODUCTS A08A ANTIOBESITY PREPARATIONS, EXCL. DIET ...

  11. WO.sub.3./sub.-doped zinc borophosphate glasses

    Czech Academy of Sciences Publication Activity Database

    Šubčík, J.; Koudelka, L.; Mošner, P.; Gregora, Ivan; Montagne, L.; Revel, B.

    2009-01-01

    Roč. 50, č. 4 (2009), 243-248. ISSN 1753-3562 R&D Projects: GA AV ČR KAN301370701 Institutional research plan: CEZ:AV0Z10100520 Keywords : tungstate zinc borophosphate glasses * Raman spectroscopy * temperature * NMR Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.553, year: 2009

  12. Biodiversity of traits and species both show weak responses to hydromorphological alteration in lowland river macroinvertebrates

    Czech Academy of Sciences Publication Activity Database

    Feld, Ch. K.; de Bello, Francesco; Dolédec, S.

    2014-01-01

    Roč. 59, č. 2 (2014), s. 233-248. ISSN 0046-5070 R&D Projects: GA ČR GAP505/12/1296 Institutional support: RVO:67985939 Keywords : taxonomic distinctness * taxonomic diversity * trait diversity Subject RIV: EH - Ecology, Behaviour Impact factor: 2.738, year: 2014

  13. QTL Information Table: 679 [Q-TARO

    Lifescience Database Archive (English)

    Full Text Available hi7b Morphological trait Seed harvest index SSR C)Interval RIL Dasanbyeo TR22183 A RM420 RM248 p ... ion of QTLs associated with physiological nitrogen use ... efficiency in rice. Mol Cells 23, 72-79. ...

  14. The effect of immobilization/mobilization processes on the temperature onset of a catalyst bed production studied with ethylene oligomerization on HZSM-5 zeolites

    Czech Academy of Sciences Publication Activity Database

    Zikánová, Arlette; Derewinski, M.; Sarv, P.; Hudec, P.; Hrabánek, Pavel; Kočiřík, Milan

    2006-01-01

    Roč. 114, 2-3 (2006), s. 248-256. ISSN 0920-5861 R&D Projects: GA AV ČR IAA400400501 Institutional research plan: CEZ:AV0Z40400503 Keywords : HZSM-5 * ethylene * oligomeration * sorption and reaction dynamics Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.148, year: 2006

  15. Measurement of alcohol hangover severity : development of the Alcohol Hangover Severity Scale (AHSS)

    NARCIS (Netherlands)

    Penning, Renske; McKinney, Adele; Bus, Lucien D.; Olivier, Berend; Slot, Karin; Verster, Joris C.

    2013-01-01

    This study aims to develop a new alcohol hangover symptom severity scale and compare its effectiveness with the Hangover Symptoms Scale (HSS), the Acute Hangover Scale (AHS), and a one-item hangover score. Data from 1,410 Dutch students (Penning et al., Alcohol Alcohol 47:248-252, 2012) on the sever

  16. Východiskové tézy k problematike slovensko-českej vzájomnosti a nevzájomnosti

    Czech Academy of Sciences Publication Activity Database

    Zelenková, Anna

    Brno: Masarykova univerzita, 2008 - (Pospíšil, I.), s. 241-248 ISBN 978-80-210-4545-3 R&D Projects: GA AV ČR IAA900920702 Institutional research plan: CEZ:AV0Z90920516 Keywords : Czech-Slovak relations * Czech-Slovak mutuality and non mutuality * methodology of research Subject RIV: AJ - Letters, Mass-media, Audiovision

  17. Ambient nitrogen oxides exposure and early childhood respiratory illnesses

    Czech Academy of Sciences Publication Activity Database

    Ghosh, R.; Joad, J.; Beneš, I.; Dostál, Miroslav; Šrám, Radim; Hertz-Picciotto, I.

    2012-01-01

    Roč. 39, č. 1 (2012), s. 96-102. ISSN 0160-4120 R&D Projects: GA MŽP(CZ) SP/1B3/50/07 Institutional research plan: CEZ:AV0Z50390703 Keywords : air pollution * bronchitis * croup Subject RIV: DN - Health Impact of the Environment Quality Impact factor: 6.248, year: 2012

  18. Poklesy povrchu vlivem hlubinné exploatace prvních slojí multislojového karbonského ložiska

    Czech Academy of Sciences Publication Activity Database

    Hortvík, Karel; Černý, I.

    Ostrava : VŠB-TUO, 2011, s. 65-70. ISBN 978-80-248-2489-5. [Konference SDMG /18./. Ostrava (CZ), 05.10.2012-07.10.2012] Institutional research plan: CEZ:AV0Z30860518 Keywords : surface subsidence * effects of undermining * mathematical modeling Subject RIV: DH - Mining , incl. Coal Mining

  19. Poklesy povrchu indukované exploatací uranového ložiska Rožná

    Czech Academy of Sciences Publication Activity Database

    Hortvík, Karel

    Ostrava : VŠB-TU Ostrava, 2010, s. 38-43. ISBN 978-80-248-2312-6. [Konference SDMG /17./. Hodonín (CZ), 12.10.2010-14.10.2010] Institutional research plan: CEZ:AV0Z30860518 Keywords : surface subsidence * effects of undermining * mathematical modeling Subject RIV: DH - Mining , incl. Coal Mining

  20. Drug: D04462 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available of drugs in Japan [BR:br08301] 2 Agents affecting individual organs 24 Hormones 248 Mixed hormone preparation...orethisterone - mestranol mixt G03FB Progestogens and estrogens, sequential preparations G03FB05 Norethisterone and estrogen D04462 Norethisterone - mestranol mixt PubChem: 17398115 ...

  1. 7 CFR 900.101 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Marketing Agreements... Agricultural Marketing Agreement Act of 1937, as amended (50 Stat. 248, as amended; 7 U.S.C. 671); (b) The term... Administrator of the Agricultural Marketing Service, with power to redelegate, or any officer or employee of...

  2. Exprese jako vtiskování signatury

    Czech Academy of Sciences Publication Activity Database

    Chrz, Vladimír

    Praha : Karolinum, 2013 - (Slavík, J.; Chrz, V.; Štech, S.), s. 223-248 ISBN 9788024623351 R&D Projects: GA ČR(CZ) GAP407/12/2432 Institutional support: RVO:68081740 Keywords : metaphorical exemplification * imprinting * signature * configuration * meaning Subject RIV: AN - Psychology

  3. Dependence of carbon dioxide sorption on the petrographic composition of bituminous coals from the Czech part of the Upper Silesian Basin, Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Weishauptová, Zuzana; Sýkorová, Ivana

    2011-01-01

    Roč. 90, č. 1 (2011), s. 312-323. ISSN 0016-2361 R&D Projects: GA ČR GA106/08/1146; GA AV ČR IAA300460804 Institutional research plan: CEZ:AV0Z30460519 Keywords : bituminous coal * sorption capacity * maceral composition Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 3.248, year: 2011

  4. Social Factors Determining the Experience of Blindness among Pregnant Women in Developing Countries: The Case of India

    Science.gov (United States)

    Pandey, Shanta; Lin, Yuan; Collier-Tenison, Shannon; Bodden, Jamie

    2012-01-01

    Approximately 10 million pregnant women around the world develop night blindness annually. In India, one in 11 pregnant women suffers from night blindness. This study used a nationally representative sample of 35,248 women from India between the ages of 15 and 49 who had given birth in the past five years to understand the effect of women's…

  5. Climate reconstruction from subsurface temperatures demonstrated on example of Cuba

    Czech Academy of Sciences Publication Activity Database

    Čermák, Vladimír; Bodri, L.

    2001-01-01

    Roč. 126, 3/4 (2001), s. 295-310. ISSN 0031-9201 Institutional research plan: CEZ:AV0Z3012916 Keywords : climate change * recent warming * borehole temperatures * inversion technique Subject RIV: DC - Siesmology, Volcanology, Earth Structure Impact factor: 1.248, year: 2001

  6. Effect of Welding Mateial on Mechanical Working Properity of Gay Cast-iron by Cold Arc Welding%灰铸铁电弧冷焊时焊材对加工性能的影响

    Institute of Scientific and Technical Information of China (English)

    李日娟

    2011-01-01

    采用Z208、Z248、Z308、Z116四种焊条对灰铸铁进行电弧冷焊试验,对比了焊缝组织、半熔化区白口硬度及宽度,并从焊接冶金角度作出分析.结果表明:Z208 、Z248所焊焊缝同母材一样为灰铸铁,Z208因白口宽度大不能进行后续机加工;Z308、Z116所焊焊缝与母材异质,Z308几乎无白口,具有优良的加工性能.%The welding tests on Gay cast-iron were made with four kinds of electrode by cold arc welding(Z208 Z248 Z308 Zl 16), metallographic microstructure, the width and microhardness of the partial fusion were compared in welding metallurgy. The results show that the welded joint by Z208 and Z248 is same with base metal, the welded joint by Z208 are not matched; the welded joint by Z308 and Zl 16 is not same with the base metal, but the machining property is better.

  7. Productions and decay studies of transactinide elements for superheavy element chemistry

    International Nuclear Information System (INIS)

    We developed a gas-jet transport system coupled to the GAs-filled Recoil Ion Separator GARIS at the RIKEN Linear Accelerator as a novel technique for superheavy element (SHE) chemistry. The isotopes of 261Rf (atomic number Z = 104), 262Db (Z = 105), and 265Sg (Z = 106) useful for chemistry studies were produced in the 248Cm(18O,5n), 248Cm(19F,5n), and 248Cm(22Ne,5n) reactions, respectively, and they were extracted to a chemistry laboratory by the gas-jet method after the separation by GARIS (1-4). The production and decay properties of those isotopes were investigated in detail for future chemistry studies using a rotating wheel apparatus for α and SF spectrometry. Recently, the chemical synthesis and gas-chromatographic analysis of the first organometallic compound of SHEs, Sg(CO)6, were successfully conducted with preseparated 265Sg. In the conference, preliminary results on the production of Bh (Z = 107) isotopes in the 248Cm(23Na,xn) reactions will also be presented. (author)

  8. Ontogenesis of the oral vestibule in the sheep (Ovis aries, Ruminantia)

    Czech Academy of Sciences Publication Activity Database

    Pavlíková, H.; Witter, K.; Míšek, Ivan

    2001-01-01

    Roč. 248, č. 3 (2001), s. 270-270. ISSN 0362-2525 R&D Projects: GA AV ČR IAA7039901; GA AV ČR KSK6005114 Keywords : striated palatal muscle Subject RIV: EG - Zoology Impact factor: 0.959, year: 2001

  9. Mootorrattad lähevad aina enam moodi / Villy Paimets

    Index Scriptorium Estoniae

    Paimets, Villy, 1972-

    2005-01-01

    Eesti Autoregistrikeskuse andmetel on 2005. aastal esmakordselt registrisse kantud 1076 mootorratast, millest 248 on uued. Diagrammid: Uhiuute mootorrataste esimese poolaasta müügitabelit juhib Yamaha; Yamaha esindaja käive tegi mullu suure hüppe; Esmakordselt arvele võetud mootorrataste hulk kasvab

  10. Saaremaa rannaala võib suureneda 200 meetrilt riigiteeni / Ain Lember

    Index Scriptorium Estoniae

    Lember, Ain

    2003-01-01

    Aasta lõpuks valmiva Saare maakonna rannaalade tsoneeringu ülesandeks on koostada rannaalade andmebaas, hinnata mõju keskkonnale, töötada välja metoodika rannaalade planeerimiseks. Tsoneering hõlmab asustust, kuhu jääb neli alevikku ja 248 küla 10 235 elanikuga

  11. Bending of Beam with Free Ends on Non-linear Subsoil

    Czech Academy of Sciences Publication Activity Database

    Sysala, Stanislav

    Ostrava: VŠB-TUO, 2010 - (Frydrýšek, K.), s. 1-17 ISBN 978-80-248-2256-3. [Mechanical Structures and Foundation Engineering 2010. Ostrava (CZ), 13.09.2010-13.09.2010] Institutional research plan: CEZ:AV0Z30860518 Keywords : beam on subsoil * non-linearity * semi-coercivity Subject RIV: BA - General Mathematics

  12. Dicty_cDB: VSC450 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VS (Link to library) VSC450 (Link to dictyBase) - - - Contig-U15034-1 VSC450Z (Link to Original ... rom clone 248E1 on chromosome 6q23.1-23.3 Contains DOPAMINE -BETA-MONOOXYGENASE PRECURSOR, EF-1-ALPHA-2 pseudog ...

  13. Study of the high-j states in 249Cm

    International Nuclear Information System (INIS)

    The authors have performed the reaction 248Cm(4He, 3He) using 98.5-MeV alpha particles from the IUCF cyclotron to populate high-j states in 249Cm. A tentative assignment of the K17/2 component of the 1/2+[880] Nilsson state has been made

  14. 78 FR 42544 - Outer Continental Shelf (OCS), Gulf of Mexico (GOM), Oil and Gas Lease Sale, Western Planning...

    Science.gov (United States)

    2013-07-16

    ... Bureau of Ocean Energy Management Outer Continental Shelf (OCS), Gulf of Mexico (GOM), Oil and Gas Lease Sale, Western Planning Area (WPA) Lease Sales 238, 246, and 248 MMAA104000 AGENCY: Bureau of Ocean... Supplemental EIS for proposed WPA lease sales beginning with Lease Sale 238 (WPA Lease Sales 238, 246, and...

  15. Dynamic evolution of telomeric sequences in the green algal order Chlamydomonadales

    Czech Academy of Sciences Publication Activity Database

    Fulnečková, Jana; Hasíková, T.; Fajkus, Jiří; Lukešová, Alena; Eliáš, M.; Sýkorová, Eva

    2012-01-01

    Roč. 4, č. 3 (2012), s. 248-264. ISSN 1759-6653 R&D Projects: GA ČR(CZ) GA521/09/1912 Institutional research plan: CEZ:AV0Z50040702; CEZ:AV0Z60660521 Keywords : telomere * algae * telomerase Subject RIV: BO - Biophysics; BO - Biophysics (BC-A) Impact factor: 4.759, year: 2012

  16. Scientific Investigations of Elementary School Children

    Science.gov (United States)

    Valanides, Nicos; Papageorgiou, Maria; Angeli, Charoula

    2014-01-01

    The study provides evidence concerning elementary school children's ability to conduct a scientific investigation. Two hundred and fifty sixth-grade students and 248 fourth-grade students were administered a test, and based on their performance, they were classified into high-ability and low-ability students. The sample of this study was…

  17. Parental Time Pressures and Depression among Married Dual-Earner Parents

    Science.gov (United States)

    Roxburgh, Susan

    2012-01-01

    This article examines whether there is an association between depression and parental time pressure among employed parents. Using a sample of 248 full-time employed parents and using the stress process framework, I also examine the extent to which gender, socioeconomic status, social support, and job conditions account for variation in the…

  18. Výchova a vzdělávání v kontextu raněobrozenské publicistiky (1786-1830)

    Czech Academy of Sciences Publication Activity Database

    Kusáková, Lenka

    Praha : Ústav pro českou literaturu AV ČR, 2004 - (Bláhová, K.; Petrbok, V.), s. 242-248 ISBN 80-85778-43-2 Institutional research plan: CEZ:AV0Z9056905 Keywords : education Subject RIV: AJ - Letters, Mass-media, Audiovision

  19. EST Table: FS935487 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available FS935487 E_FL_fwgP_43C09_F_0 10/09/28 45 %/248 aa ref|XP_001660682.1| filamin, putative [Aedes a ... gi|91079384|ref|XP_971392.1| PREDICTED: similar to jitterbug ... CG30092-PD [Tribolium castaneum] BY917108 fwgP ...

  20. Dysfunctional Relationship Beliefs in Parent-Late Adolescent Relationship and Conflict Resolution Behaviors

    Science.gov (United States)

    Hamamci, Zeynep

    2007-01-01

    The purpose of this study is to investigate the role of dysfunctional relationships beliefs on both the perceptions of their relationships with the parents and conflict resolution behaviors of late adolescence. The sample was consisted of 372 Turkish university students (248 women and 124 men). Interpersonal Cognitive Distortions Scale,…

  1. The Minipig as an Animal Model in Biomedical Stem Cell Research

    Czech Academy of Sciences Publication Activity Database

    Vodička, Petr; Hlučilová, Jana; Klíma, Jiří; Procházka, Radek; Ourednik, J.; Motlík, Jan

    Totowa, New Jersey : Humana Press, 2008 - (Conn, P.), s. 241-248 ISBN 978-1-58829-933-8. - (Medicine) R&D Projects: GA MŠk 1M0538 Institutional research plan: CEZ:AV0Z50450515 Keywords : Animal model * Minipig * Neural stem cell Subject RIV: FH - Neurology

  2. Magnetic Energy Fluctuations: Observations by Light Scattering

    Science.gov (United States)

    Lyons, K. B.; Fleury, P. A.

    1982-01-01

    The first observations of magnetic energy fluctuations by light scattering are reported. The spectra observed in antiferromagnetic KNiF3 are strongly polarized, mildly q dependent, but strongly temperature dependent near TN=248.5 K. The observed line shapes exhibit two characteristic frequencies, one less than 0.6 GHz and the other between 5 and 15 GHz, depending on temperature.

  3. QTL Information Table: 228 [Q-TARO

    Lifescience Database Archive (English)

    Full Text Available i 63 B C547 C2340 pha Xing, Z., Tan, F., Hua, P., Sun, L., Xu, G., and Zhang, Q. (2002). Characterization of the main effects..., epistatic effects and their environmental interactions of QTLs on the genetic basis of yield traits in rice. Theor Appl Genet 105, 248-257. ...

  4. Vizuální kultura: mezi lokálním a globálním pohledem

    Czech Academy of Sciences Publication Activity Database

    Kreuzzieger, Milan

    Dolní Břežany : Scriptorium, 2007 - (Prahl, R.; Winter, T.), 23-27, 248-249 ISBN 978-80-86197-89-0 Institutional research plan: CEZ:AV0Z90090514 Keywords : global isation * visual culture * history of art Subject RIV: AA - Philosophy ; Religion

  5. Diagnosing Students' Misconceptions in Number Sense via a Web-Based Two-Tier Test

    Science.gov (United States)

    Lin, Yung-Chi; Yang, Der-Ching; Li, Mao-Neng

    2016-01-01

    A web-based two-tier test (WTTT-NS) which combined the advantages of traditional written tests and interviews in assessing number sense was developed and applied to assess students' answers and reasons for the questions. In addition, students' major misconceptions can be detected. A total of 1,248 sixth graders in Taiwan were selected to…

  6. Banking sector in new EU members: a sectoral financial flows analysis

    Czech Academy of Sciences Publication Activity Database

    Hanousek, Jan; Kočenda, Evžen; Ondko, Peter

    Ostrava: VŠB - Technical University of Ostrava, 2007, s. 1-8. ISBN 978-80-248-1457-5. [Mathematical Methods in Economics. Ostrava (CZ), 04.09.2007-06.09.2007] R&D Projects: GA ČR GA402/06/1293 Institutional research plan: CEZ:MSM0021620846 Keywords : banking * financial intermediation * emerging markets Subject RIV: AH - Economics

  7. Voltammetry in Analysis of Biological Materials

    Czech Academy of Sciences Publication Activity Database

    Navrátil, Tomáš; Říčařová, B.; Šenholdová, Z.

    1. Jalgaon: Society for Science and Environment, 2009 - (Vojtisek, M.; Prakash, R.), s. 171-248 ISBN 81-85543-09-7 R&D Projects: GA ČR GA203/07/1195 Institutional research plan: CEZ:AV0Z40400503 Keywords : polarography * voltammetry * stripping voltammetry * electrodes Subject RIV: CG - Electrochemistry

  8. First-Year Male Students' Perceptions of a Rape Prevention Program 7 Months after Their Participation: Attitude and Behavior Changes

    Science.gov (United States)

    Foubert, John D.; Tatum, Jerry L.; Godin, Eric E.

    2010-01-01

    Seven months after seeing The Men's Program, a commonly used rape prevention program, 248 first-year college men responded to four open-ended questions concerning whether or not the program impacted their attitudes or behavior, particularly regarding alcohol related sexual assault. Two thirds of participants reported either attitude or behavior…

  9. K vývoji česko-bulharské a bulharsko-české lexikografie

    Czech Academy of Sciences Publication Activity Database

    Rangelova, Albena

    Bratislava : Veda, 2009 - (Šimková, M.), s. 235-248 ISBN 978-80-224-1107-3. [Slovo – Tvorba – Dynamickosť. Modra (SK), 11.03.2009-12.03.2009] Institutional research plan: CEZ:AV0Z90610521 Keywords : bilingual lexicography * Czech * Bulgarian Subject RIV: AI - Linguistics

  10. 77 FR 73558 - Sex Offender Registration Amendments

    Science.gov (United States)

    2012-12-11

    ... of the Adam Walsh Child Protection and Safety Act of 2006, (Pub. L. 109-248), requires a sex offender... SUPERVISION AGENCY FOR THE DISTRICT OF COLUMBIA 28 CFR Part 811 RIN 3225-AA10 Sex Offender Registration... requirements relating to periodic verification of registration information for sex offenders. The proposed...

  11. On periodic solutions of second-order differential equations with attractive-repulsive singularities

    Czech Academy of Sciences Publication Activity Database

    Hakl, Robert; Torres, P.J.

    2010-01-01

    Roč. 248, č. 1 (2010), s. 111-126. ISSN 0022-0396 Institutional research plan: CEZ:AV0Z10190503 Keywords : second - order ordinary differential equation * singular equation * periodic solution * positive solution Subject RIV: BA - General Mathematics Impact factor: 1.261, year: 2010 http://www.sciencedirect.com/science/article/pii/S002203960900271X

  12. 结直肠癌患者淋巴结检查数和淋巴结转移度的临床意义%Prognosis of Patients for Colorectal Cancer with Lymph Node Ratio and Number of Lymph Nodes // Reviewer:

    Institute of Scientific and Technical Information of China (English)

    潘志忠; 张华

    2009-01-01

    @@ 1 文献来源 Rosenberg R, Friederichs J, Schuster T, et al. Prognosis of patients with colorectal cancer is associated with lymph node ratio A single-center analysis of 3 026 patients over a 25-year time period [J]. Ann Surg, 2008,12(6):248:968-978.

  13. Disagreement between skin prick test and specific IgE in young children

    DEFF Research Database (Denmark)

    Schoos, Ann-Marie Malby; Chawes, BLK; Følsgaard, N V;

    2015-01-01

    points was analyzed using kappa statistics. RESULTS: The prevalence of inhalant allergen sensitization increased during childhood diagnosed by both sIgE levels (0.6% to 4.2% to 18.1% to 24.8%, P contrast, the prevalence of food...

  14. Pulmonary hemorrhage complicating radiofrequency ablation, from mild hemoptysis to life-threatening pattern

    Energy Technology Data Exchange (ETDEWEB)

    Nour-Eldin, Nour-Eldin A.; Naguib, Nagy N.N.; Mack, Martin; Abskharon, John E.; Vogl, Thomas J. [Johann Wolfgang Goethe-University Hospital, Institute for Diagnostic and Interventional Radiology, Frankfurt am Main (Germany)

    2011-01-15

    To assess risk factors and the extent of pulmonary hemorrhage complicating radiofrequency ablation (RFA) of pulmonary neoplasms. This retrospective study involved 248 ablation sessions for lung tumors (20 primary lesions and 228 metastatic lesions) in 164 patients (mean age 59.7 years, SD: 10.2). Both unipolar and bipolar radiofrequency systems were used under CT fluoroscopic guidance. Extent and underlying factors associated with development of pulmonary hemorrhage were analyzed. Incidence of intra-parenchymal pulmonary hemorrhage, pleural effusion, and hemoptysis were 17.7% (44/248 sessions), 4% (8/248 sessions), and 16.1% (40/248 sessions), respectively. Death because of massive bleeding occurred in one session (0.4%). Significant risk factors associated with intra-parenchymal hemorrhage included: lesions of <1.5 cm diameter (P = 0.007); basal and middle lung zone lesions (P = 0.026); increased needle track distance traversing the lung parenchyma >2.5 cm (P = 0.0017); traversing pulmonary vessels in the track of ablation (P < 0.001); and the use of multi-tined electrodes (P = 0.004). Concomitant incidence of pulmonary hemorrhage and pneumothorax was 29.2% (14/48 sessions). While typically safe, RFA of pulmonary neoplasms can result in pulmonary hemorrhage ranging from mild to life-threatening. Management of this complication is mainly preventive through adequate patient selection for ablation therapy and exclusion of technically avoidable risk factors. (orig.)

  15. Effect of pressure and high magnetic field on phase transitions and magnetic properties of Ni.sub.1.92./sub.Mn.sub.1.56./sub.Sn.sub.0.52./sub. and Ni.sub.2./sub.MnSn Heusler compounds

    Czech Academy of Sciences Publication Activity Database

    Kaštil, Jiří; Kamarád, Jiří; Isnard, O.; Skourski, Y.; Míšek, Martin; Arnold, Zdeněk

    2015-01-01

    Roč. 650, Nov (2015), s. 248-255. ISSN 0925-8388 R&D Projects: GA ČR GA15-03777S Institutional support: RVO:68378271 Keywords : intermetallics * crystal structure * high pressure * magnetocaloric * magentisation Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.999, year: 2014

  16. August Sauer und die Bohemistik

    Czech Academy of Sciences Publication Activity Database

    Petrbok, Václav

    Köln : Böhlau, 2010 - (Höhne, S.), s. 229-248 ISBN 978-3-412-20622-2 Institutional research plan: CEZ:AV0Z90560517 Keywords : German literature * Czech literary studies * Sauer, August Subject RIV: AJ - Letters, Mass-media, Audiovision

  17. Two panels of steroid receptor luciferase reporter cell lines for compound profiling

    Czech Academy of Sciences Publication Activity Database

    Sedlák, David; Paguio, A.; Bartůněk, Petr

    2011-01-01

    Roč. 14, č. 2 (2011), s. 248-266. ISSN 1386-2073 R&D Projects: GA MŠk(CZ) LC06077 Institutional research plan: CEZ:AV0Z50520514 Keywords : nuclear hormone receptor * steroid receptor * cell-based luciferase reporter assay Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 1.785, year: 2011

  18. EST Table: FS898353 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available 29 50 %/248 aa C28H8.11a#CE01822#WBGene00016201#tryptophan 2, 3- dioxygenase#status:Confirmed#UniProt:Q09474...FS898353 E_FL_ftes_30H20_R_0 11/12/09 GO hit GO:0004833(tryptophan 2,3-dioxygenase

  19. Actores protectores que favorecen la resiliencia de estudiantes para lograr su permanencia en la licenciatura en ciencias de la educacion de la UATX /

    OpenAIRE

    Velazquez Flores, Guadalupe

    2012-01-01

     tesis que para obtener el grado de Doctorado en Pedagogía, presenta Guadalupe Velazquez Flores ; tutora principal de tesis Dora Elena Marin Mendez248 páginas : ilustracionesDoctorado en Pedagogía Universidad Nacional Autónoma de México, 2012 Programa de Posgrado en Pedagogía

  20. High resolution Holocene paleomagnetic secular variation records from Bay of Bengal

    Digital Repository Service at National Institute of Oceanography (India)

    Usapkar, A.; Dewangan, P.; Badesab, F.K.; Mazumdar, A.; Ramprasad, T.; Krishna, K.S; Basavaiah, N.

    rates are recorded at MD161/8 (38.8 – 248.3 cm/kyr), MD161/11 (137-336 cm/ky) and MD161/13 (~573 cm/kyr). Rock magnetic data analysis suggests that the remanence signal is carried by titanomagnetite/ titanohematite grains in stable single domain (SSD...

  1. Reductions related with Hopf maps

    CERN Document Server

    Yeghikyan, Vahagn

    2011-01-01

    We consider the reductions of $2p$-dimensional particle system ($p=2,4,8$), associated with the Hopf map. For the third Hopf map we explicitly construct the functions associated to the symmetry related to the rotations in the fiber.

  2. Clinician’s perceptions of and emotional responses to online infidelity

    NARCIS (Netherlands)

    Dijkstra, Pieternel; de Zeeuw, Heleen; Barelds, Dick P.H.; Buunk, Abraham P.

    2015-01-01

    Aim of the present study was to examine the degree to which mental health workers perceive twelve online partner behaviors as different types of infidelity and to examine the degree to which these behaviors evoke two types of jealousy, that is, fait accompli and anxious jealousy among mental. 248 he

  3. EST Table: FY018012 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available FY018012 rbmov21c16 11/11/04 46 %/248 aa ref|XP_001606351.1| PREDICTED: similar to MGC64464 prot ... .1| PREDICTED: similar to regulator of microtubule dynamics ... 1 [Tribolium castaneum] FS783762 bmov ...

  4. Siblings of Disabled Children: Birth Order and Age-Spacing Effects.

    Science.gov (United States)

    Breslau, Naomi

    1982-01-01

    Siblings (N=237) of disabled children were compared to 248 siblings from a random family sampling to examine the effects of relative birth order and age spacing on psychological functioning. Younger males scored higher than older males on psychological impairment, while younger females were psychologically better off than older females. (CL)

  5. Isolation and genetic characterization of Toxoplasma gondii from the gray wolf Canis lupus

    Science.gov (United States)

    Little is known of the genetic diversity of Toxoplasma gondii circulating in wildlife. In the present study feral gray wolf (Canis lupus) from Minnesota were examined for T. gondii infection. Antibodies to T. gondii were detected in 130 (52.4%) of 248 wolves tested by the modified agglutination test...

  6. Optimal Mirrleesean taxation in a Ben-Porath economy

    Czech Academy of Sciences Publication Activity Database

    Kapička, Marek

    2015-01-01

    Roč. 7, č. 2 (2015), s. 219-248. ISSN 1945-7707 R&D Projects: GA ČR(CZ) GA13-29370S Institutional support: PRVOUK-P23 Keywords : optimal taxes * unobservable human capital * income taxes Subject RIV: AH - Economics Impact factor: 3.780, year: 2014

  7. 76 FR 70479 - Draft Environmental Assessment and Safe Harbor Agreement for the Houston Toad Within Nine Texas...

    Science.gov (United States)

    2011-11-14

    ... types that occur on the portion of the property to be enrolled, including ] accurate descriptions of vegetation, water features, and soil types; (4) current land use practices and existing development; and (5.... Box 1306, Albuquerque, New Mexico 87103 (505) 248-6651). SUPPLEMENTARY INFORMATION: Under a...

  8. The effect of oxfendazole treatment on muscle pathology in pigs infected with Taenia solium cysticercosis

    DEFF Research Database (Denmark)

    Iburg, Tine Moesgaard; Karlsson, Madeleine; Spång, Frederic;

    2012-01-01

    The aim of the present study was to test histopathologically the hypothesis that the time for clearing Taenia solium cysts in muscle tissue of pigs following treatment with oxfendazole is cyst density dependant. A total of 248 cyst lesions in the masseter muscle of 28 naturally infected pigs were...

  9. Experiment mimořádných měsíčních odečtů u zákazníků kategorie maloodběr a domácnost

    Czech Academy of Sciences Publication Activity Database

    Bečvář, J.; Blahová, L.; Pihera, M.; Pelikán, Emil; Brabec, Marek

    2007-01-01

    Roč. 87, - (2007), s. 248-250. ISSN 0032-1761 R&D Projects: GA AV ČR 1ET400300513 Institutional research plan: CEZ:AV0Z10300504 Keywords : spotřeba energie * matematické modelování * zemní plyn Subject RIV: IN - Informatics, Computer Science

  10. Pattern Definition with DUV-Lithography at DTU Danchip

    DEFF Research Database (Denmark)

    Keil, Matthias; Khomtchenko, Elena; Nyholt, Henrik;

    2014-01-01

    Deep ultra violet (DUV) illumination generated with the help of a KrF laser can be utilized to produce components having sizes of some hundreds of nanometers. This light source with its 248nm wavelength is exploited in the DUV-lithography equipment at DTU Danchip in order to fill the resolution gap...

  11. Leifsonia soli sp. nov., a yellow-pigmented actinobacterium isolated from teak rhizosphere soil.

    Science.gov (United States)

    Madhaiyan, Munusamy; Poonguzhali, Selvaraj; Lee, Jung-Sook; Senthilkumar, Murugaiyan; Lee, Keun Chul; Sundaram, Subbiah

    2010-06-01

    Two yellow-pigmented, Gram-stain-positive, aerobic, motile, short rod-shaped bacteria were isolated from natural teak tree rhizosphere soil and their taxonomic positions were determined by using a polyphasic approach. Comparative 16S rRNA gene sequence analysis showed that strains TG-S248(T) and TG-S240 formed a distinct phyletic line within the genus Leifsonia. 16S rRNA gene sequence analysis of strain TG-S248(T) with sequences from Leifsonia shinshuensis DB 102(T), L. poae VKM Ac-1401(T), L. naganoensis DB 103(T), L. aquatica DSM 20146(T) and L. xyli subsp. cynodontis JCM 9733(T) revealed pairwise similarities ranging from 98.7 to 99.1 %. The major fatty acids were anteiso-C(15 : 0), anteiso-C(17 : 0) and iso-C(16 : 0). The G+C content of the DNA of the type strain was 69.4 mol%. DNA-DNA hybridization experiments revealed low levels of DNA-DNA relatedness (32 % or less) between strain TG-S248(T) and its closest relatives. Based on differences in phenotypic and genotypic characteristics, strain TG-S248(T) (=LMG 24767(T) =JCM 15679(T)) is designated the type strain of a novel species of the genus Leifsonia, for which the name Leifsonia soli sp. nov. is proposed. PMID:19667370

  12. The Quality of Measures of Accessed Social Capital – Is the Resource Generator Appropriate for the Czech Context?

    Czech Academy of Sciences Publication Activity Database

    Häuberer, Julia

    Wiesbaden: VS Verlag für Sozialwissenschaften, 2011, s. 223-248 ISBN 978-3-531-17626-0 R&D Projects: GA MŠk 2D06014 Institutional research plan: CEZ:AV0Z70280505 Keywords : Resource Generator * reliability * validity Subject RIV: AO - Sociology, Demography

  13. Flow phantom for validation of absolute quantification in dynamic contrast-enhanced MRI

    Czech Academy of Sciences Publication Activity Database

    Jiřík, Radovan; Standara, M.; Malá, A.; Sedláková, S.; Bartoš, M.; Taxt, T.; Starčuk jr., Zenon

    2011-01-01

    Roč. 24, Suppl. 1 (2011), s. 247-248. ISSN 0968-5243. [ESMRMB 2011 Congress. 06.10.2011-08.10.2011, Leipzig] Institutional research plan: CEZ:AV0Z20650511 Keywords : DCE-MRI * flow phantom * perfusion analysis Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering

  14. Supervision Practices and Teachers' Satisfaction in Public Secondary Schools: Malaysia and China

    Science.gov (United States)

    Hamzah, Mohd Izham Mohd; Wei, Yan; Ahmad, Jamil; Hamid, Aida Hanim A.; Mansor, Azlin Norhaini

    2013-01-01

    The purpose of this study is to explore supervision practices among school management teams and teachers' satisfaction in secondary schools in Kuala Lumpur, Malaysia and He Fei, China. The samples consist of 248 managers and 367 teachers in Kuala Lumpur, and 175 managers and 346 teachers in He Fei. The study indicates that the level of supervision…

  15. Morphology of nymphs of common stored-product psocids (Psocoptera, Liposcelididae)

    Czech Academy of Sciences Publication Activity Database

    Kučerová, Z.; Li, Z.; Hromádková, Jiřina

    2009-01-01

    Roč. 45, č. 1 (2009), s. 54-60. ISSN 0022-474X Institutional research plan: CEZ:AV0Z40500505 Keywords : Liposcelis * stored-product psocids * nymphs Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.248, year: 2009

  16. Spatial distribution of absorbed dose on the spherical phantom at Russian Service Module of ISS measured by passive detectors

    Czech Academy of Sciences Publication Activity Database

    Jadrníčková, Iva; Yasuda, N.; Kawashima, H.; Kurano, M.; Uchihori, Y.; Kitamura, H.; Akatov, YU.; Shurshakov, V.; Kobayashi, I.; Ohguchi, H.; Koguchi, Y.

    Busan : AOGS, 2008. s. 216-216. ISBN N. [Annual Meeting AOGS 2008 /5./. 16.06.2008-20.06.2008, Busan] Grant ostatní: ESA(XE) ILSRA - 2004 - 248 Institutional research plan: CEZ:AV0Z10480505 Keywords : space dosimetry * passive detectors * International space station Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders www.asiaoceania.org

  17. Crystallization of poly(.i.N./i.-methyldodecano-12-lactam) in blends with poly(styrene-stat-acrylic acid)

    Czech Academy of Sciences Publication Activity Database

    Kratochvíl, Jaroslav; Sikora, Antonín

    2007-01-01

    Roč. 43, č. 5 (2007), s. 2155-2164. ISSN 0014-3057 R&D Projects: GA ČR GA106/02/1248 Institutional research plan: CEZ:AV0Z40500505 Keywords : polymer blends * crystallization * secondary crystallization Subject RIV: CD - Macromolecular Chemistry Impact factor: 2.248, year: 2007

  18. Low-mass binary X-Ray sources: Monitoring with various satellites

    Czech Academy of Sciences Publication Activity Database

    Šimon, Vojtěch

    2014-01-01

    Roč. 54, č. 3 (2014), s. 248-253. ISSN 1210-2709. [IBWS (INTEGRAL/BART) workshop. Karlovy Vary, 22.03.2013-25.3.2013] Grant ostatní: GA ČR(CZ) GA13-33324S Institutional support: RVO:67985815 Keywords : radiation mechanisms * accretion disks * X-rays Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics

  19. Demonstrating Efficacy in Preclinical Studies of Cellular Therapies for Spinal Cord Injury - How Much is Enough?

    Czech Academy of Sciences Publication Activity Database

    Kwon, B. K.; Soril, L. J. J.; Bacon, M.; Beattie, M. S.; Blesch, A.; Bresnahan, J. C.; Bunge, M. B.; Dunlop, S. A.; Fehlings, M. G.; Ferguson, A. R.; Hill, C. E.; Karimi-Abdolrezaee, S.; Lu, P.; McDonald, J. W.; Müller, H. W.; Oudega, M.; Rosenzweig, E. S.; Reier, P. J.; Silver, J.; Syková, Eva; Xu, X. M.; Guest, J. D.; Tetzlaff, W.

    2013-01-01

    Roč. 248, Oct (2013), s. 30-44. ISSN 0014-4886 R&D Projects: GA ČR GA13-00939S; GA ČR(CZ) GBP304/12/G069 Institutional support: RVO:68378041 Keywords : spinal cord injury * cell transplantation therapies * clinical trial Subject RIV: FH - Neurology Impact factor: 4.617, year: 2013

  20. AcEST: DK948569 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST38A01NGRL0003_K16 655 Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0003_K16. 5' end seq ... , Gaps = 3/81 (3%) Frame = +2 Query: 266 SREGMATEVQEPA NGNLKKEEAEPLGELRGKED--LKQA-PADLCHAGDVNGCEPVAEKE 436 ... /73 (6%) Frame = +2 Query: 248 GRRGLFSREGMA----TEVQEPA N-GNLKKEEAEPLGELRGKEDLKQAPADLCHAGDVNG 412 GR+G +R G ...

  1. 宗教観と教条主義的傾向との関連について

    OpenAIRE

    高木, 秀明; 安藤, 嘉奈子; 山口, 陽子; 井上, 果子

    1997-01-01

    This study investigates the relation between the religious belief and the tendency of dogmatism among the Japanese adolescents. 248 subjects responded to the questionnaire. According to their responses concerning attitude and interest towards religion, the subjects were divided into 6 groups. Results show that anti religion adolescent group tended to be more dogmatic.

  2. Does Bachelor's-Level Social Work Education Impact Students' Knowledge and Attitudes Regarding Substance-Abusing Clients?

    Science.gov (United States)

    Senreich, Evan; Straussner, Shulamith Lala A.

    2013-01-01

    This study compared 248 graduating seniors with 301 beginning juniors at 10 bachelor's-level social work programs in the Northeast concerning their knowledge and attitudes regarding working with substance-abusing clients. Graduating seniors demonstrated modestly higher levels of knowledge and only slightly more positive attitudes toward…

  3. Thinking about Applications: Effects on Mental Models and Creative Problem-Solving

    Science.gov (United States)

    Barrett, Jamie D.; Peterson, David R.; Hester, Kimberly S.; Robledo, Issac C.; Day, Eric A.; Hougen, Dean P.; Mumford, Michael D.

    2013-01-01

    Many techniques have been used to train creative problem-solving skills. Although the available techniques have often proven to be effective, creative training often discounts the value of thinking about applications. In this study, 248 undergraduates were asked to develop advertising campaigns for a new high-energy soft drink. Solutions to this…

  4. Longitudinal Study on Reciprocity between Personality Traits and Parenting Stress

    Science.gov (United States)

    Rantanen, Johanna; Tillemann, Kati; Metsäpelto, Riitta-Leena; Kokko, Katja; Pulkkinen, Lea

    2015-01-01

    Reciprocal associations between the Big Five personality traits and parenting stress--including both parents' feelings of their distress and perception of their incompetence as parents--were studied with 248 participants (49% of which were males). Longitudinal data, collected at ages 33/36, 42 and 50 years, were used. Cross-lagged path…

  5. An Investigation of Big Five Personality Traits and Career Decidedness among Early and Middle Adolescents

    Science.gov (United States)

    Lounsbury, John W.; Hutchens, Teresa; Loveland, James M.

    2005-01-01

    Big Five personality traits were analyzed in relation to career decidedness among adolescents in middle and high school. Participants were 248 7th-grade, 321 10th-grade, and 282 12th-grade students. As hypothesized, Conscientiousness was positively and significantly correlated with career decidedness in all three grades. Openness and Agreeableness…

  6. Reference: TEF1BOXATA1 [PLACE

    Lifescience Database Archive (English)

    Full Text Available TEF1BOXATA1 Regad F, Herve C, Marinx O, Bergounioux C, Tremousaygue D, Lescue B The tef1 box, a ... vation of plant genes that are highly expressed in cycling ... cells Mol. Gen. Genet. 248: 703-711 (1995) PubMed: ...

  7. List of Participating Institutions: Associated Schools Project in Education for International Co-operation and Peace = Liste des establissements participants: Systeme des ecoles associees appliquant un programme d'education pour la cooperation internationale et la paix = Lista de Instituciones Participantes: Plan de Escuelas Asociadas en la Educacion para la Cooperacion Internacional y la Paz.

    Science.gov (United States)

    United Nations Educational, Scientific, and Cultural Organization, Paris (France).

    A list of participating institutions at the Associated Schools Project in Education for International Co-Operation and Peace, December 31, 1985 is presented. A total of 1,970 institutions in 94 countries participated, including 47 nursery schools, 556 primary schools, 1,123 secondary schools, and 248 teacher training institutions. Addresses of…

  8. Church of San George in Kostoľany pod Tribečom

    Czech Academy of Sciences Publication Activity Database

    Maříková-Kubková, Jana; Baxa, P.; Bisták, P.; Borzová, Z.

    Rijeka : University of Rijeka, 2015 - (Vicelja-Matijašić, M.), s. 213-248 ISBN 978-953-7975-32-6 EU Projects: European Commission(XE) CU7-MULT7/2010-0653/001-001 Institutional support: RVO:67985912 Keywords : Francia Media * Early Medieval Europe * Kostoľany pod Tribečom Subject RIV: AC - Archeology, Anthropology, Ethnology

  9. 76 FR 37979 - Cooperation in USDA Studies and Evaluations, and Full Use of Federal Funds in Nutrition...

    Science.gov (United States)

    2011-06-29

    ... Service 7 CFR Parts 210, 215, 220, 225, 226, 235, 246, and 248 RIN 0584-AE20 Cooperation in USDA Studies... of 2010 (HHFK Act). The HHFK Act requires State and local cooperation in Department of Agriculture... reflect this requirement. Notice and Comment In accordance with the Secretary's Statement of Policy (36...

  10. Teacher Retention in International Schools: The Key Role of School Leadership

    Science.gov (United States)

    Mancuso, Steven V.; Roberts, Laura; White, George P.

    2010-01-01

    The purpose of this study was (1) to track teacher turnover in Near East South Asia (NESA) international schools and (2) to identify correlates of teacher turnover. We received survey responses from 22 school heads and 248 teachers in NESA schools. The average turnover rate was 17 percent from 2006 to 2009, ranging from several schools with no…

  11. Lesión del ligamento cruzado anterior y condromalacia rotulofemoral

    OpenAIRE

    ANGEL CHECA GONZALEZ; FRANCISCO AGUIAR ROMAN; OSVALDO PEREDA CARDOSO

    1995-01-01

    La lesión del ligamento anterior fue un hallazgo a considerar entre las 248 artroscopias realizadas en 24 meses. La ruptura aislada fue patente en pocos casos, en contraposición con la lesión combinada. La condromalacia rotulofemoral fue un diagnóstico endoscópico importante, pocas veces considerado clínicamente.

  12. State, firms, and corporate impact: cash or control

    Czech Academy of Sciences Publication Activity Database

    Hanousek, Jan; Kočenda, Evžen

    Ostrava: VŠB - Technical University of Ostrava, 2007, s. 1-8. ISBN 978-80-248-1457-5. [Mathematical Methods in Economics. Ostrava (CZ), 04.09.2007-06.09.2007] R&D Projects: GA ČR GA402/06/1293 Institutional research plan: CEZ:MSM0021620846 Keywords : privatization * ownership structure * control potential Subject RIV: AH - Economics

  13. Go4Life

    Medline Plus

    Full Text Available ... Go4Life Exercises — Stretching Play all Try some of these Go4Life exercises to improve your flexibility! 2:48 ... Exercises — Building Strength Play all Try some of these Go4Life exercises to improve your strength! Stronger muscles ...

  14. Femtosecond ultraviolet laser ablation of silver and comparison with nanosecond ablation

    DEFF Research Database (Denmark)

    Christensen, Bo Toftmann; Doggett, B.; Budtz-Jørgensen, C.;

    2013-01-01

    The ablation plume dynamics arising from ablation of silver with a 500 fs, 248 nm laser at ~2 J cm-2 has been studied using angle-resolved Langmuir ion probe and thin film deposition techniques. For the same laser fluence, the time-of-flight ion signals from femtosecond and nanosecond laser...

  15. Jet production in ep collisions at low Q.sup.2./sup. and determination of α.sub.S./sub..

    Czech Academy of Sciences Publication Activity Database

    Aaron, F.D.; Alexa, C.; Alimujiang, K.; Cvach, Jaroslav; Reimer, Petr; Zálešák, Jaroslav

    2010-01-01

    Roč. 65, 3-4 (2010), s. 363-383. ISSN 1434-6044 R&D Projects: GA MŠk LA09042 Institutional research plan: CEZ:AV0Z10100502 Keywords : neutral current deep-inelastic scattering * jet production * strong coupling constant Subject RIV: BF - Elementary Particles and High Energy Physics Impact factor: 3.248, year: 2010

  16. EST Table: FS832352 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available FS832352 E_FL_fmgV_40B23_R_0 10/09/28 41 %/248 aa ref|NP_001116815.1| carboxylesterase CarE -11 [ ... Bombyx mori] gb|ACB12415.1| carboxylesterase CarE -11 [Bombyx mori] 10/09/10 low homology 10/08/29 n. ...

  17. Education for a New World, 1994.

    Science.gov (United States)

    Institute of International Education, New York, NY.

    This annual report marks the 75th anniversary of the Institute of International Education (IIE) and describes the IIE's 1994 activities and programs. During 1994 more than 10,000 individuals studied, conducted research, received practical training, or provided international technical assistance under 248 programs IIE administered for 217 sponsors,…

  18. Jazyk v sociální interakci: Nad českým překladem knihy Petera Auera Jazyková interakce

    Czech Academy of Sciences Publication Activity Database

    Kaderka, Petr; Nekvapil, J.

    Praha : Nakladatelství Lidové noviny, 2014, s. 237-248. ISBN 978-80-7422-268-9 R&D Projects: GA ČR GAP406/12/1829 Institutional support: RVO:68378092 Keywords : social interaction * multimodal interaction * linguistic interaction * Peter Auer * translation strategies * terminology management Subject RIV: AI - Linguistics

  19. Vibrace vyvolané odstřelem trhavin při ražbě mělkého důlního díla

    Czech Academy of Sciences Publication Activity Database

    Kaláb, Zdeněk; Knejzlík, Jaromír; Lednická, Markéta

    Stupava : Orgware, 2006, s. 317-324. ISBN 80-248-1124-3. [Geotechnika 2006/11./. Vysoké Tatry (SK), 20.09.2006-22.09.2006] R&D Projects: GA ČBÚ(CZ) AACBU38-05 Institutional research plan: CEZ:AV0Z30860518 Keywords : surface vibrations * explosive blasting * measurements Subject RIV: DC - Siesmology, Volcanology, Earth Structure

  20. Dimenzování výztuže porubních chodeb v uhelných dolech

    Czech Academy of Sciences Publication Activity Database

    Šňupárek, Richard

    Ostrava : VŠB-TUO, FAST, 2012, s. 1-8. ISBN 978-80-248-2785-8. [Geotechnika - 2012 - Geotechnics. Vysoké Tatry (SK), 26.09.2012-28.09.2012] R&D Projects: GA MŠk ED2.1.00/03.0082 Institutional support: RVO:68145535 Keywords : design * support * roadways Subject RIV: DH - Mining, incl. Coal Mining