WorldWideScience

Sample records for californium 247

  1. Magnetism in californium

    International Nuclear Information System (INIS)

    A SQUID-based magnetic susceptometer has been constructed for studying small radioactive samples at temperatures below 350 K and in magnetic fields up to 50 kilogauss. The device has been used to study californium (element 98) in a number of solid-state forms: the dhcp metal, several oxides (Cf2O3 in both the bcc and monoclinic structures, Cf7O12, CfO2 and BaCfO3), several monopnictides (CfN, CfAs and CfSb) and the trichloride (in both the hexagonal and orthorhombic structures). All of these materials were studied in polycrystalline form, and hexagonal CfCl3 was studied in single-crystal form as well. The susceptometer has the sensitivity to measure samples containing less than 10 micrograms of californium. The magnetic susceptibilities of all of the californium materials at temperatures above about 100 K are described well by the Curie-Weiss relationship. This behavior is consistent with the assumption that the magnetic 5f electrons are localized and that the paramagnetic behavior can be interpreted in terms of the properties of the free ion. The measured values of the effective paramagnetic moment, μ/sub eff/, for all the californium materials that were studied are reasonably consistent with theoretical values based on intermediate coupling models. All of the californium materials showed some indications of cooperative magnetic effects. The dhcp metal was observed to order ferromagnetically at 52 K, and all of the californium compounds studied showed signs of antiferromagnetic ordering, mostly at temperatures below 25 K. 91 refs., 50 figs., 19 tabs

  2. Californium Multiplier (CFX)

    International Nuclear Information System (INIS)

    The availability of 252Cf as an economical high-intensity neutron source has made it possible to construct compact neutron irradiation devices with widespread applications. The simplest such device consists of a single 252Cf source within a moderating and shielding medium. Higher neutron flux levels can be attained either through the use of more 252Cf or through source multiplication by means of a subcritical uranium assembly. Although the use of larger 252Cf sources to achieve higher neutron flux is technically straightforward, an economic penalty is paid as the source strength is increased. Larger californium sources imply larger initial investments to cover the cost of source material and larger operating costs resulting from the decay of the 252Cf source. A Californium Multiplier, the CFX, which produces a flux enhancement of 30 when compared to a conventional moderated 252Cf system has been designed, licensed, built, and tested by IRT Corporation. Such systems are now available on a commercial basis for both neutron radiography and neutron activation analysis. The first commercial CFX system was installed at the Research Laboratories of Eastman Kodak Company in Rochester, NY, in March 1975. This device, using 1 mg of 252Cf, is very stable and the neutron flux generated by the CFX is very reproducible. The performance characteristics of this system are summarized

  3. Californium--palladium metal neutron source material

    Science.gov (United States)

    Dahlen, B.L.; Mosly, W.C. Jr.; Smith, P.K.; Albenesius, E.L.

    1974-01-22

    Californium, as metal or oxide, is uniformly dispersed throughout a noble metal matrix, provided in compact, rod or wire form. A solution of californium values is added to palladium metal powder, dried, blended and pressed into a compact having a uni-form distribution of californium. The californium values are decomposed to californium oxide or metal by heating in an inert or reducing atmosphere. Sintering the compact to a high density closes the matrix around the dispersed californium. The sintered compact is then mechanically shaped into an elongated rod or wire form. (4 claims, no drawings) (Official Gazette)

  4. Californium-252 progress, report No. 7, April 1971

    Energy Technology Data Exchange (ETDEWEB)

    1971-12-31

    This report contains discusses of the following topics on Californium-252: First sales of californium-252; encapsulation services discussed; three new participants in market evaluation program; summer training programs to use californium; Californium-252 shipping casks available; Californium-252 questions and answers, radiotherapy; neutron radiography; natural resources exploration; nuclear safeguards; process control; dosimetry; neutron radiography; neutron shielding; and nuclear safeguards.

  5. Californium Electrodepositions at Oak Ridge National Laboratory

    Energy Technology Data Exchange (ETDEWEB)

    Boll, Rose Ann [ORNL

    2015-01-01

    Electrodepositions of californium isotopes were successfully performed at Oak Ridge National Laboratory (ORNL) during the past year involving two different types of deposition solutions, ammonium acetate (NH4C2H3O2) and isobutanol ((CH3)2CHCH2OH). A californium product that was decay enriched in 251Cf was recovered for use in super-heavy element (SHE) research. This neutron-rich isotope, 251Cf, provides target material for SHE research for the potential discovery of heavier isotopes of Z=118. The californium material was recovered from aged 252Cf neutron sources in storage at ORNL. These sources have decayed for over 30 years, thus providing material with a very high 251Cf-to-252Cf ratio. After the source capsules were opened, the californium was purified and then electrodeposited using the isobutanol method onto thin titanium foils for use in an accelerator at the Joint Institute for Nuclear Research in Dubna, Russia. Another deposition method, ammonium acetate, was used to produce a deposition containing 1.7 0.1 Ci of 252Cf onto a stainless steel substrate. This was the largest single electrodeposition of 252Cf ever prepared. The 252Cf material was initially purified using traditional ion exchange media, such as AG50-AHIB and AG50-HCl, and further purified using a TEVA-NH4SCN system to remove any lanthanides, resulting in the recovery of 3.6 0.1 mg of purified 252Cf. The ammonium acetate deposition was run with a current of 1.0 amp, resulting in a 91.5% deposition yield. Purification and handling of the highly radioactive californium material created additional challenges in the production of these sources.

  6. Historical Review of Californium-252 Discovery and Development

    Science.gov (United States)

    Stoddard, D. H.

    1985-01-01

    This paper discusses the discovery and history of californium 252. This isotope may be synthesized by irradiating plutonium 239, plutonium 242, americium 243, or curium 244 with neutrons in a nuclear reactor. Various experiments and inventions involving Cf conducted at the Savannah River Plant are discussed. The evolution of radiotherapy using californium 252 is reviewed. (PLG)

  7. Historical review of californium-252 discovery and development

    International Nuclear Information System (INIS)

    This paper discusses the discovery and history of californium 252. This isotope may be synthesized by irradiating plutonium 239, plutonium 242, americium 243, or curium 244 with neutrons in a nuclear reactor. Various experiments and inventions involving 252Cf conducted at the Savannah River Plant are discussed. The evolution of radiotherapy using californium 252 is reviewed

  8. Californium-252: a remarkable versatile radioisotope

    Energy Technology Data Exchange (ETDEWEB)

    Osborne-Lee, I.W.; Alexander, C.W.

    1995-10-10

    A product of the nuclear age, Californium-252 ({sup 252}Cf) has found many applications in medicine, scientific research, industry, and nuclear science education. Californium-252 is unique as a neutron source in that it provides a highly concentrated flux and extremely reliable neutron spectrum from a very small assembly. During the past 40 years, {sup 252}Cf has been applied with great success to cancer therapy, neutron radiography of objects ranging from flowers to entire aircraft, startup sources for nuclear reactors, fission activation for quality analysis of all commercial nuclear fuel, and many other beneficial uses, some of which are now ready for further growth. Californium-252 is produced in the High Flux Isotope Reactor (HFIR) and processed in the Radiochemical Engineering Development Center (REDC), both of which are located at the Oak Ridge National Laboratory (ORNL) in Oak Ridge, Tennessee. The REDC/HFIR facility is virtually the sole supplier of {sup 252}Cf in the western world and is the major supplier worldwide. Extensive exploitation of this product was made possible through the {sup 252}Cf Market Evaluation Program, sponsored by the United States Department of Energy (DOE) [then the Atomic Energy Commission (AEC) and later the Energy Research and Development Administration (ERDA)]. This program included training series, demonstration centers, seminars, and a liberal loan policy for fabricated sources. The Market Evaluation Program was instituted, in part, to determine if large-quantity production capability was required at the Savannah River Laboratory (SRL). Because of the nature of the product and the means by which it is produced, {sup 252}Cf can be produced only in government-owned facilities. It is evident at this time that the Oak Ridge research facility can meet present and projected near-term requirements. The production, shipment, and sales history of {sup 252}Cf from ORNL is summarized herein.

  9. Californium-252: a remarkable versatile radioisotope

    International Nuclear Information System (INIS)

    A product of the nuclear age, Californium-252 (252Cf) has found many applications in medicine, scientific research, industry, and nuclear science education. Californium-252 is unique as a neutron source in that it provides a highly concentrated flux and extremely reliable neutron spectrum from a very small assembly. During the past 40 years, 252Cf has been applied with great success to cancer therapy, neutron radiography of objects ranging from flowers to entire aircraft, startup sources for nuclear reactors, fission activation for quality analysis of all commercial nuclear fuel, and many other beneficial uses, some of which are now ready for further growth. Californium-252 is produced in the High Flux Isotope Reactor (HFIR) and processed in the Radiochemical Engineering Development Center (REDC), both of which are located at the Oak Ridge National Laboratory (ORNL) in Oak Ridge, Tennessee. The REDC/HFIR facility is virtually the sole supplier of 252Cf in the western world and is the major supplier worldwide. Extensive exploitation of this product was made possible through the 252Cf Market Evaluation Program, sponsored by the United States Department of Energy (DOE) [then the Atomic Energy Commission (AEC) and later the Energy Research and Development Administration (ERDA)]. This program included training series, demonstration centers, seminars, and a liberal loan policy for fabricated sources. The Market Evaluation Program was instituted, in part, to determine if large-quantity production capability was required at the Savannah River Laboratory (SRL). Because of the nature of the product and the means by which it is produced, 252Cf can be produced only in government-owned facilities. It is evident at this time that the Oak Ridge research facility can meet present and projected near-term requirements. The production, shipment, and sales history of 252Cf from ORNL is summarized herein

  10. Californium-252 Neutron Therapy in China

    International Nuclear Information System (INIS)

    Californium-252 brachytherapy, believed to be the most successful source for neutron therapy, gives most of the cures as well as long-term and complication-free survivals. Chinese radiation oncologists were interested in californium neutron therapy (Cf-NT) in the early 1980s, but 252Cf sources for medical use were not available in China until 1992 when a californium joint venture was established by the China Institute of Atomic Energy (Beijing) and the Research Institute for Nuclear Reactors (Dimitrovgrad) of Russia. In 1995, 25 seeds of 252Cf with a strength of 3 μg each were sent to China for preclinical investigation. Three years later, a high dose rate (HDR) 252Cf source was imported and transferred into a home-made remote after-loader for intracavitary treatment in Chongqing, and a clinical trail was started in February 1999. This is the first time that Cf-NT was performed for cancer patients in China. Since then, Cf-NT in China has developed rapidly. It is estimated that one-tenth of those radiation oncology centers with brachytherapy practice will be equipped with californium units in 5 yr. That means more than 30 units will be in use in hospitals. That is significant compared with other countries, but it is just one, on average, for each province or one per 40 million people in China. Progress also has been achieved in the 252Cf treatment delivery equipment. Preliminary clinical trails showed complete response observed in all cases treated, with a rapid clearance of tumors and mild reactions in normal tissues. The short-term results are quite encouraging. To deal with problems due to the demand for Cf-NT in China, attention should be paid to the following particulars: (1) A high-strength miniature source is needed for HDR/MDR interstitial therapy to extend the Cf-NT coverage. (2) Basic work on radiophysics and radiobiology needs to be done, including source calibration, clinical dosimetry, clinical RBE determination, and Cf-NT quality assurance

  11. Californium-252 sales and loans at Oak Ridge National Laboratory

    International Nuclear Information System (INIS)

    The production and distribution in the United States of 252Cf has recently been consolidated at the Oak Ridge National Laboratory (ORNL). The 252Cf Industrial Sales/Loan Program and the 252Cf University Load Program, which were formerly located at the Savannah River Plant (SRP), have been combined with the californium production and distribution activities of the Transuranium Element Production Program at ORNL. Californium-252 is sold to commercial users in the form of bulk californium oxide, palladium-californium alloy pellets, or alloy wires. Neutron source capsules, which are fabricated for loans to DOE or other US government agencies, are still available in all forms previously available. The consolidation of all 252Cf distribution activities at the production site is expected to result in better service to users. In particular, customers for neutrons sources will be ale to select from a wider range of neutron source forms, including custom designs, through a single contact point

  12. Californium-252 encapsulation at the Savannah River Laboratory

    International Nuclear Information System (INIS)

    More than 1 g of the neutron-emitting isotope californium-252 has been encapsulated at SRL for worldwide medical, industrial, and research uses. Bulk sales packages have been prepared for the USDOE sales program since 1971. Doubly-encapsulated sources have been prepared for USDOE's market evaluation program since 1968. Californium-252 sources for loan and sales packages satisfy the criteria for Special Form Radioactive Material. Encapsulation is performed in special neutron-shielded containment facilities at SRL. Development of improved source and shipping package designs and processes is continuing. 17 figures

  13. Production, distribution and applications of californium-252 neutron sources

    International Nuclear Information System (INIS)

    The radioisotope 252Cf is routinely encapsulated into compact, portable, intense neutron sources with a 2.6-yr half-life. A source the size of a person's little finger can emit up to 1011 neutrons s-1. Californium-252 is used commercially as a reliable, cost-effective neutron source for prompt gamma neutron activation analysis (PGNAA) of coal, cement and minerals, as well as for detection and identification of explosives, land mines and unexploded military ordnance. Other uses are neutron radiography, nuclear waste assays, reactor start-up sources, calibration standards and cancer therapy. The inherent safety of source encapsulations is demonstrated by 30 yr of experience and by US Bureau of Mines tests of source survivability during explosions. The production and distribution center for the US Department of Energy (DOE) Californium Program is the Radiochemical Engineering Development Center (REDC) at Oak Ridge National Laboratory (ORNL). DOE sells 252Cf to commercial reencapsulators domestically and internationally. Sealed 252Cf sources are also available for loan to agencies and subcontractors of the US government and to universities for educational, research and medical applications. The REDC has established the Californium User Facility (CUF) for Neutron Science to make its large inventory of 252Cf sources available to researchers for irradiations inside uncontaminated hot cells. Experiments at the CUF include a land mine detection system, neutron damage testing of solid-state detectors, irradiation of human cancer cells for boron neutron capture therapy experiments and irradiation of rice to induce genetic mutations

  14. Production, distribution and applications of californium-252 neutron sources.

    Science.gov (United States)

    Martin, R C; Knauer, J B; Balo, P A

    2000-01-01

    The radioisotope 252Cf is routinely encapsulated into compact, portable, intense neutron sources with a 2.6-yr half-life. A source the size of a person's little finger can emit up to 10(11) neutrons s(-1). Californium-252 is used commercially as a reliable, cost-effective neutron source for prompt gamma neutron activation analysis (PGNAA) of coal, cement and minerals, as well as for detection and identification of explosives, land mines and unexploded military ordinance. Other uses are neutron radiography, nuclear waste assays, reactor start-up sources, calibration standards and cancer therapy. The inherent safety of source encapsulations is demonstrated by 30 yr of experience and by US Bureau of Mines tests of source survivability during explosions. The production and distribution center for the US Department of Energy (DOE) Californium Program is the Radiochemical Engineering Development Center (REDC) at Oak Ridge National Laboratory (ORNL). DOE sells 252Cf to commercial reencapsulators domestically and internationally. Sealed 252Cf sources are also available for loan to agencies and subcontractors of the US government and to universities for educational, research and medical applications. The REDC has established the Californium User Facility (CUF) for Neutron Science to make its large inventory of 252Cf sources available to researchers for irradiations inside uncontaminated hot cells. Experiments at the CUF include a land mine detection system, neutron damage testing of solid-state detectors, irradiation of human cancer cells for boron neutron capture therapy experiments and irradiation of rice to induce genetic mutations. PMID:11003521

  15. Production, Distribution, and Applications of Californium-252 Neutron Sources

    Energy Technology Data Exchange (ETDEWEB)

    Balo, P.A.; Knauer, J.B.; Martin, R.C.

    1999-10-03

    The radioisotope {sup 252}Cf is routinely encapsulated into compact, portable, intense neutron sources with a 2.6-year half-life. A source the size of a person's little finger can emit up to 10{sup 11} neutrons/s. Californium-252 is used commercially as a reliable, cost-effective neutron source for prompt gamma neutron activation analysis (PGNAA) of coal, cement, and minerals, as well as for detection and identification of explosives, laud mines, and unexploded military ordnance. Other uses are neutron radiography, nuclear waste assays, reactor start-up sources, calibration standards, and cancer therapy. The inherent safety of source encapsulations is demonstrated by 30 years of experience and by U.S. Bureau of Mines tests of source survivability during explosions. The production and distribution center for the U. S Department of Energy (DOE) Californium Program is the Radiochemical Engineering Development Center (REDC) at Oak Ridge National Laboratory (ORNL). DOE sells The radioisotope {sup 252}Cf is routinely encapsulated into compact, portable, intense neutron sources with a 2.6- year half-life. A source the size of a person's little finger can emit up to 10 neutrons/s. Californium-252 is used commercially as a reliable, cost-effective neutron source for prompt gamma neutron activation analysis (PGNAA) of coal, cement, and minerals, as well as for detection and identification of explosives, laud mines, and unexploded military ordnance. Other uses are neutron radiography, nuclear waste assays, reactor start-up sources, calibration standards, and cancer therapy. The inherent safety of source encapsulations is demonstrated by 30 years of experience and by U.S. Bureau of Mines tests of source survivability during explosions. The production and distribution center for the U. S Department of Energy (DOE) Californium Program is the Radiochemical Engineering Development Center (REDC) at Oak Ridge National Laboratory(ORNL). DOE sells {sup 252}Cf to commercial

  16. Production of extra pure curium and californium preparations

    International Nuclear Information System (INIS)

    Preparations of curium-244,245,248 and californium-249,252 are used for the production of ionizing radiation sources for different applications and fundamental nuclear-physical investigations, placing high requirements on the radiochemical and chemical purity of the preparations. Extraction chromatography using di-(2-ethylhexyl)phosphoric acid (D2EHPA) as extractant was chosen to prepare extra pure curium and californium preparations. In order to identify the optimal conditions of Cm-Cf separation and to remove impurities from them (reagent and other impurities), investigations were performed into the effect of impurities (Na+, Ca2+, Al3+, Fe2+, Fe3+ taken as example), extractant and eluent concentration and solution flow rate on the efficiency of mutual purification of Cm and Cf. Both theoretical and experimental estimations were made of the maximum concentration at which the impurities do not affect the process. The conditions chosen allow mutual purification of milligram amounts of Cm and Cf from impurity elements at E(pur) =102 - 103 during a single chromatographic cycle (E(pur) =>103) using a column with 5 - 10 cm3 volume. In this case the production yield exceeds 98%. The purification of milligram amounts of curium and californium from fission products (lanthanides in general, cerium in particular) was performed in D2EHPA-decane-PbO2-HNO3 and D2EHPA-decane-DTPA-H3-Cit extraction chromatography systems. In order to establish the optimal conditions, the effect of [D2EHPA] and eluent on the mutual purification of Cm and Cf and on their purification from cerium and impurity elements was studied in the D2EHPA-decane-PbO2-HNO3 system. During a single chromatographic cycle the mutual purification factors of TPE and of their purification from impurity cations achieve 102-103, from cerium - E(pur) > 10. In the D2EHPA-decane-DTPA-H3Cit system, the effect of concentration of extractant and eluent pH on the efficiency of Cm and Cf purification from lanthanides was

  17. Prompt neutron spectrum of the spontaneous fission of californium-252

    International Nuclear Information System (INIS)

    The californium-252 spontaneous fission neutron spectrum was measured in the energy range of 0.01 to 10 MeV by the time-of-flight technique using various neutron detectors. The measurements of 252Cf neutron spectrum at energies of 0.01 to 5 MeV were performed as a function of fission fragment kinetic energy. The mean neutron spectrum energy in the range of 0.7 to 10 MeV was found from the results of measurements. The irregularity in the 252Cf neutron spectrum in the neutron energy range of less than 0.7 MeV compared to theoretical values is discussed. The mechanism of 252Cf neutron emission is also discussed on the basis of neutron yield angle measurements. 12 references

  18. 32 CFR 247.5 - Responsibilities.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false Responsibilities. 247.5 Section 247.5 National... DEPARTMENT OF DEFENSE NEWSPAPERS, MAGAZINES AND CIVILIAN ENTERPRISE PUBLICATIONS § 247.5 Responsibilities. (a... Commands shall: (1) Publish Combatant Command newspapers, if authorized. In discharging this...

  19. 7 CFR 247.27 - Financial management.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Financial management. 247.27 Section 247.27... AGRICULTURE CHILD NUTRITION PROGRAMS COMMODITY SUPPLEMENTAL FOOD PROGRAM § 247.27 Financial management. (a) What are the Federal requirements for State and local agencies with regard to financial...

  20. 7 CFR 247.18 - Nutrition education.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Nutrition education. 247.18 Section 247.18 Agriculture... CHILD NUTRITION PROGRAMS COMMODITY SUPPLEMENTAL FOOD PROGRAM § 247.18 Nutrition education. (a) What are the State agency's responsibilities in ensuring that nutrition education is provided? The State...

  1. Solving the Hydration Structure of the Heaviest Actinide Aqua Ion Known: The Californium(III) Case

    Energy Technology Data Exchange (ETDEWEB)

    Den Auwer, Ch.; Guillaumont, D. [CEA Marcoule, Nucl Energy Div, Radiochem Proc Dept, SCPS LILA, 30 (France); Galbis, E.; Pappalardo, Rafael R.; Marcos Sanchez, E. [Univ Seville, Dept Quim Fis, E-41012 Seville (Spain); Hernandez-Cobos, J. [Inst Ciencias Fis, Cuernavaca 62251, Morelos (Mexico); Le Naour, C.; Simoni, E. [Univ Paris Sud, Inst Phys Nucl Orsay, Paris (France)

    2010-07-01

    In summary, the first MC simulation of the trivalent cation of californium, based on an exchangeable hydrated ion-water intermolecular potential, has been shown to extend and improve the hydrated ion model. Likewise, the CfL{sub III}-edge EXAFS spectrum of an acidic 1 mm Cf(ClO{sub 4}){sub 3} aqueous solution recorded under optimized experimental conditions has greatly improved the signal/noise ratio of the only previously recorded spectrum. The comparison of the experimental EXAFS spectrum with the two computed ones, obtained from two different intermolecular potentials that predict eight (BP86) or nine (MP2) water molecules in the first coordination shell, leads to the conclusion that the lowest hydration number is preferred. Then, as Cf{sup III} is the heaviest actinide aqua ion for which there is experimental information, the actinide contraction is supported by the present study. (For U{sup III}, R{sub U-O}=2.56 Angstroms, and CN=9{+-}1; for Pu{sup III}, R{sub Pu-O}=2.51 Angstroms and CN=9{+-}1; for Cm{sup III}, R{sub Cm-O}=2.47 Angstroms and CN=9{+-}1). The role of the second hydration shell is important in defining the structure and dynamics of the Cf{sup III} aqua ion, but the contribution of second-shell water molecules to the EXAFS signal as back-scatters is marginal. Finally, this work gives an illustrative example of the benefits which can be achieved from the combination of experimental X-ray absorption spectroscopy and computer simulations. The usefulness of the simultaneous analysis of the results as well as the importance of the structural statistical average has been clearly demonstrated herein. Each technique independently was not adequate. We believe that this study traces out a still poorly explored combined methodology which may be extremely useful for many other complexes and chemical problems. A systematic theoretical and experimental examination of the other known actinide cations on the same basis should be undertaken to confirm the

  2. Separation of californium from actinides and lanthanides in aqueous solution by electrochemical formation of amalgams

    International Nuclear Information System (INIS)

    The electrochemical reduction of transneptunium elements (Pu to Cf) and rare earths (Eu, Tm) from aqueous complexing solutions to amalgams was studied over a wide range of cathodic potentials in order to achieve optimal separation of californium. The reduction in acetate media (pH 4.5-4.6) at potentials around -1.7 to -1.9 V1 leads to a quantitative extraction of californium into the mercury phase, while more negative potentials are required for the reduction of the lighter transuranium elements and of the lanthanides. Hence, the optimal conditions for the separation of californium from the investigated actinides and lanthanides were determined. Separation factors α between 25 and 90 were found except in the case of Cf/Eu, where poor values (α varying from 7 to 12) were observed. More negative cathodic potentials decrease the selectivity of the reduction process. A similar study with lithium citrate solutions (pH ∝6) shows that satisfactory separation of californium from lighter and heavier actinides is achievable. A separation factor of 88 is obtained for Cf/Am at -1.98 V. The anodic stripping of mixed amalgams (Pu, Am, Cm, Bk, Tm and Cf) Hg in nitric and acetic acid soultions at potentials ranging from +0.1 to -0.7 V proceeds slowly and proved to be ineffective for the separation of californium from light actinides under conditions described. (orig.)

  3. Biomedical neutron research at the Californium User Facility for neutron science

    International Nuclear Information System (INIS)

    The Californium User Facility for Neutron Science has been established at Oak Ridge National Laboratory (ORNL). The Californium User Facility (CUF) is a part of the larger Californium Facility, which fabricates and stores compact 252Cf neutron sources for worldwide distribution. The CUF can provide a cost-effective option for research with 252Cf sources. Three projects at the CUF that demonstrate the versatility of 252Cf for biological and biomedical neutron-based research are described: future establishment of a 252Cf-based neutron activation analysis system, ongoing work to produce miniature high-intensity, remotely afterloaded 252Cf sources for tumor therapy, and a recent experiment that irradiated living human lung cancer cells impregnated with experimental boron compounds to test their effectiveness for boron neutron capture therapy

  4. Biomedical neutron research at the Californium User Facility for neutron science

    Energy Technology Data Exchange (ETDEWEB)

    Martin, R.C. [Oak Ridge National Lab., TN (United States); Byrne, T.E. [Roane State Community College, Harriman, TN (United States); Miller, L.F. [Univ. of Tennessee, Knoxville, TN (United States)

    1997-04-01

    The Californium User Facility for Neutron Science has been established at Oak Ridge National Laboratory (ORNL). The Californium User Facility (CUF) is a part of the larger Californium Facility, which fabricates and stores compact {sup 252}Cf neutron sources for worldwide distribution. The CUF can provide a cost-effective option for research with {sup 252}Cf sources. Three projects at the CUF that demonstrate the versatility of {sup 252}Cf for biological and biomedical neutron-based research are described: future establishment of a {sup 252}Cf-based neutron activation analysis system, ongoing work to produce miniature high-intensity, remotely afterloaded {sup 252}Cf sources for tumor therapy, and a recent experiment that irradiated living human lung cancer cells impregnated with experimental boron compounds to test their effectiveness for boron neutron capture therapy.

  5. Emergence of californium as the second transitional element in the actinide series.

    Science.gov (United States)

    Cary, Samantha K; Vasiliu, Monica; Baumbach, Ryan E; Stritzinger, Jared T; Green, Thomas D; Diefenbach, Kariem; Cross, Justin N; Knappenberger, Kenneth L; Liu, Guokui; Silver, Mark A; DePrince, A Eugene; Polinski, Matthew J; Van Cleve, Shelley M; House, Jane H; Kikugawa, Naoki; Gallagher, Andrew; Arico, Alexandra A; Dixon, David A; Albrecht-Schmitt, Thomas E

    2015-01-01

    A break in periodicity occurs in the actinide series between plutonium and americium as the result of the localization of 5f electrons. The subsequent chemistry of later actinides is thought to closely parallel lanthanides in that bonding is expected to be ionic and complexation should not substantially alter the electronic structure of the metal ions. Here we demonstrate that ligation of californium(III) by a pyridine derivative results in significant deviations in the properties of the resultant complex with respect to that predicted for the free ion. We expand on this by characterizing the americium and curium analogues for comparison, and show that these pronounced effects result from a second transition in periodicity in the actinide series that occurs, in part, because of the stabilization of the divalent oxidation state. The metastability of californium(II) is responsible for many of the unusual properties of californium including the green photoluminescence. PMID:25880116

  6. Dicty_cDB: SSI247 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSI247 (Link to dictyBase) - - - Contig-U12269-1 SSI247Z (Link... to Original site) - - SSI247Z 692 - - - - Show SSI247 Library SS (Link to library) Clone ID SSI247 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSI2-B/SSI247Q.Seq.d/ Representative seq. ID SSI24...7Z (Link to Original site) Representative DNA sequence >SSI247 (SSI247Q) /CSM/SS/SSI2-B/SSI247Q.Seq.d/ XXXXX...f*kgrsitifsccsfw yrfvayfwlhckgilqdnqqsnrqshrrfsssllpm*wfrlvakwwfnafhysihfishy as**eitiqrt*ylc**yssiigsmg*itf

  7. Fissile analysis of Hanford waste using Californium Multiplier/Delayed Neutron Counter system

    International Nuclear Information System (INIS)

    Measurement of low-level (10 ng/g or lower) fissile material (mainly plutonium) in Hanford waste and process samples is becoming increasingly important. A system has been designed consisting of a Californium Multiplier (CFX) and a Delayed Neutron Counter (DNC) to characterize these samples. This report describes hardware and analytical capability of the CFX/DNC system

  8. 7 CFR 247.4 - Agreements.

    Science.gov (United States)

    2010-01-01

    ... provide, or cause to be provided, nutrition education to participants, as required in § 247.18; (2) An... Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS COMMODITY SUPPLEMENTAL FOOD PROGRAM § 247.4 Agreements. (a) What agreements...

  9. Dicty_cDB: CFD247 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFD247 (Link to dictyBase) - - - Contig-U16273-1 CFD247P (Link to Original site) CFD...247F 623 CFD247Z 396 CFD247P 1019 - - Show CFD247 Library CF (Link to library) Clone ID CFD...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CF/CFD2-B/CFD247Q.Seq.d/ Representative seq. ID CFD...247P (Link to Original site) Representative DNA sequence >CFD247 (CFD247Q) /CSM/CF/CFD2-B/CFD... Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value CFD247 (CFD247Q) /CSM/CF/CFD2-B/CFD

  10. Erythroderma: analysis of 247 cases

    Directory of Open Access Journals (Sweden)

    Cidia Vasconcellos

    1995-06-01

    Full Text Available The profile of 247 patients with erythroderma during a 23 year period from January, 1962 through March, 1985, with a follow-up period ranging from 1 to 26 years were analysed. The patients presented with diffuse erythema, scaling and pruritus of more than 2 months' duration, and the age ranged from 16 to 60 years. Psoriasis was the most frequent underlying disease with an estimated frequency of 44.9%, the reaction to the use of drugs appeared in 7.3% of total cases and association with reticulosis showed a frequency of 4.1%. The cause of the erythroderma could not be determined in 29.2% of the cases. Sex differences in terms of underlying diseases were not observed. One or more skin biopsies along with the clinical findings were diagnostic or suggestive of the underlying disease in 63.6% of the cases. Repeated skin biopsies are recommended as the best method for etiologic diagnosis of erythroderma. At P=0.05 significance level, masculine/feminine ratio of 2 : 1 was found. The question arises wether causal agent of erythroderma may not be somehow related to different exposure by sex to environmental antigens.

  11. Dicty_cDB: AFM247 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AF (Link to library) AFM247 (Link to dictyBase) - - - - - (Link to Original site) - - AFM...247Z 829 - - - - Show AFM247 Library AF (Link to library) Clone ID AFM247 (Link to dictyBase) Atlas ID... - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/AF/AFM2-B/AFM...247Q.Seq.d/ Representative seq. ID - (Link to Original site) Representative DNA sequence >AFM...247 (AFM247Q) /CSM/AF/AFM2-B/AFM247Q.Seq.d/ XXXXXXXXXXTCCCTTTAGTCCTANATAANAGGTGGTACCAATTT

  12. 48 CFR 247.572 - Policy.

    Science.gov (United States)

    2010-10-01

    ...) DoD contractors must transport supplies, as defined in the clause at 252.247-7023, Transportation of... Army determines that the proposed freight charges are excessive or unreasonable in accordance with...

  13. Emergence of californium as the second transitional element in the actinide series

    OpenAIRE

    Cary, Samantha K.; Vasiliu, Monica; Baumbach, Ryan E.; Stritzinger, Jared T.; GREEN, THOMAS D.; Diefenbach, Kariem; Cross, Justin N.; Knappenberger, Kenneth L.; Liu, Guokui; Silver, Mark A.; DePrince, A. Eugene; Polinski, Matthew J.; Van Cleve, Shelley M.; House, Jane H.; Kikugawa, Naoki

    2015-01-01

    A break in periodicity occurs in the actinide series between plutonium and americium as the result of the localization of 5f electrons. The subsequent chemistry of later actinides is thought to closely parallel lanthanides in that bonding is expected to be ionic and complexation should not substantially alter the electronic structure of the metal ions. Here we demonstrate that ligation of californium(III) by a pyridine derivative results in significant deviations in the properties of the resu...

  14. Dicty_cDB: SSC247 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSC247 (Link to dictyBase) - - - Contig-U16341-1 SSC247F (Link to Original site) SSC...247F 326 - - - - - - Show SSC247 Library SS (Link to library) Clone ID SSC247 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSC2-B/SSC247Q.Seq.d/ Representative seq. ID SSC24...7F (Link to Original site) Representative DNA sequence >SSC247 (SSC247Q) /CSM/SS/SSC2-B/SSC247Q.Seq.d/ CTATG...cell wall 4.0 %: cytoskeletal 4.0 %: vacuolar 4.0 %: plasma membrane >> prediction for SSC

  15. 40 CFR 247.12 - Construction products.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Construction products. 247.12 Section... Construction products. (a) Building insulation products, including the following items: (1) Loose-fill... ash, recovered rubber, recovered steel, recovered wood, or recovered plastic. (k) Modular...

  16. 48 CFR 247.301-70 - Definition.

    Science.gov (United States)

    2010-10-01

    ..., DEPARTMENT OF DEFENSE CONTRACT MANAGEMENT TRANSPORTATION Transportation in Supply Contracts 247.301-70 Definition. “Integrated logistics managers” or “third-party logistics providers” means providers of multiple logistics services. Some examples of logistics services are the management of transportation,...

  17. 7 CFR 247.6 - State Plan.

    Science.gov (United States)

    2010-01-01

    ... serving women, infants, and children, program outreach, and nutrition education. (Collaboration with the... commodities; (7) A description of plans for providing nutrition education to participants; (8) A description... CHILD NUTRITION PROGRAMS COMMODITY SUPPLEMENTAL FOOD PROGRAM § 247.6 State Plan. (a) What is the...

  18. 25 CFR 247.18 - What are the sanitation prohibitions?

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false What are the sanitation prohibitions? 247.18 Section 247.18 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR FISH AND WILDLIFE USE OF COLUMBIA RIVER TREATY FISHING ACCESS SITES § 247.18 What are the sanitation prohibitions? (a) You cannot...

  19. 48 CFR 52.247-57 - Transportation Transit Privilege Credits.

    Science.gov (United States)

    2010-10-01

    ... Privilege Credits. 52.247-57 Section 52.247-57 Federal Acquisition Regulations System FEDERAL ACQUISITION... Clauses 52.247-57 Transportation Transit Privilege Credits. As prescribed in 47.305-13(b)(4), insert the... of the trade, that offerors may have potential transit credits available and the Government...

  20. 48 CFR 52.247-60 - Guaranteed Shipping Characteristics.

    Science.gov (United States)

    2010-10-01

    ... Characteristics. 52.247-60 Section 52.247-60 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION....247-60 Guaranteed Shipping Characteristics. As prescribed in 47.305-16(b)(1), insert the following clause: Guaranteed Shipping Characteristics (DEC 1989) (a) The offeror is requested to...

  1. 47 CFR 90.247 - Mobile repeater stations.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 5 2010-10-01 2010-10-01 false Mobile repeater stations. 90.247 Section 90.247... MOBILE RADIO SERVICES Non-Voice and Other Specialized Operations § 90.247 Mobile repeater stations. A... repeater to extend the communications range of hand-carried units subject to the following: (a)...

  2. 43 CFR 2.47 - Records subject to Privacy Act.

    Science.gov (United States)

    2010-10-01

    ... 43 Public Lands: Interior 1 2010-10-01 2010-10-01 false Records subject to Privacy Act. 2.47 Section 2.47 Public Lands: Interior Office of the Secretary of the Interior RECORDS AND TESTIMONY; FREEDOM OF INFORMATION ACT Privacy Act § 2.47 Records subject to Privacy Act. The Privacy Act applies to...

  3. Spontaneous Partitioning of Californium from Curium: Curious Cases from the Crystallization of Curium Coordination Complexes

    Energy Technology Data Exchange (ETDEWEB)

    Cary, Samantha K.; Silver, Mark A.; Liu, Guokui; Wang, Jamie C.; Bogart, Justin A.; Stritzinger, Jared T.; Arico, Alexandra A.; Hanson, Kenneth; Schelter, Eric J.; Albrecht-Schmitt, Thomas E.

    2015-12-07

    The reaction of 248CmCl3 with excess 2,6-pyridinedicarboxylic acid (DPA) under mild solvothermal conditions results in crystallization of the tris-chelate complex Cm(HDPA)3·H2O. Approximately half of the curium remains in solution at the end of this process, and evaporation of the mother liquor results in crystallization of the bis-chelate complex [Cm(HDPA)- (H2DPA)(H2O)2Cl]Cl·2H2O. 248Cm is the daughter of the α decay of 252Cf and is extracted in high purity from this parent. However, trace amounts of 249,250,251Cf are still present in all samples of 248Cm. During the crystallization of Cm(HDPA)3·H2O and [Cm(HDPA)(H2DPA)(H2O)2Cl]Cl·2H2O, californium(III) spontaneously separates itself from the curium complexes and is found doped within crystals of DPA in the form of Cf(HDPA)3. These results add to the growing body of evidence that the chemistry of californium is fundamentally different from that of earlier actinides.

  4. The Dusty Disc of NGC 247

    Science.gov (United States)

    2011-03-01

    This image of NGC 247, taken by the Wide Field Imager on the MPG/ESO 2.2-metre telescope at ESO's La Silla Observatory in Chile, reveals the fine details of this highly inclined spiral galaxy and its rich backdrop. Astronomers say this highly tilted orientation, when viewed from Earth, explains why the distance to this prominent galaxy was previously overestimated. The spiral galaxy NGC 247 is one of the closest spiral galaxies of the southern sky. In this new view from the Wide Field Imager on the MPG/ESO 2.2-metre telescope in Chile large numbers of the galaxy's component stars are clearly resolved and many glowing pink clouds of hydrogen, marking regions of active star formation, can be made out in the loose and ragged spiral arms. NGC 247 is part of the Sculptor Group, a collection of galaxies associated with the Sculptor Galaxy (NGC 253, also shown in eso0902 and eso1025). This is the nearest group of galaxies to our Local Group, which includes the Milky Way, but putting a precise value on such celestial distances is inherently difficult. To measure the distance from the Earth to a nearby galaxy, astronomers have to rely on a type of variable star called a Cepheid to act as a distance marker. Cepheids are very luminous stars, whose brightness varies at regular intervals. The time taken for the star to brighten and fade can be plugged into a simple mathematical relation that gives its intrinsic brightness. When compared with the measured brightness this gives the distance. However, this method isn't foolproof, as astronomers think this period-luminosity relationship depends on the composition of the Cepheid. Another problem arises from the fact that some of the light from a Cepheid may be absorbed by dust en route to Earth, making it appear fainter, and therefore further away than it really is. This is a particular problem for NGC 247 with its highly inclined orientation, as the line of sight to the Cepheids passes through the galaxy's dusty disc. However, a

  5. 14 CFR 125.247 - Inspection programs and maintenance.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Inspection programs and maintenance. 125.247 Section 125.247 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF... CAPACITY OF 6,000 POUNDS OR MORE; AND RULES GOVERNING PERSONS ON BOARD SUCH AIRCRAFT Maintenance §...

  6. 7 CFR 247.12 - Rights and responsibilities.

    Science.gov (United States)

    2010-01-01

    ... § 247.33(a); (2) The local agency will make nutrition education available to all adult participants, and... Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS COMMODITY SUPPLEMENTAL FOOD PROGRAM § 247.12 Rights and...

  7. 48 CFR 952.247-70 - Foreign travel.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Foreign travel. 952.247-70... SOLICITATION PROVISIONS AND CONTRACT CLAUSES Text of Provisions and Clauses 952.247-70 Foreign travel. As prescribed in 947.7002, insert the following clause: Foreign Travel (JUN 2010) Contractor foreign...

  8. 48 CFR 3452.247-70 - Foreign travel.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 7 2010-10-01 2010-10-01 false Foreign travel. 3452.247... 3452.247-70 Foreign travel. As prescribed in 3447.7000, insert the following clause in all solicitations and resultant cost-reimbursement contracts: Foreign Travel (AUG 1987) Foreign travel shall not...

  9. 48 CFR 252.247-7025 - Reflagging or repair work.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Reflagging or repair work... of Provisions And Clauses 252.247-7025 Reflagging or repair work. As prescribed in 247.574(d), use the following clause: Reflagging or Repair Work (JUN 2005) (a) Definition. Reflagging or repair...

  10. 40 CFR 247.14 - Park and recreation products.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Park and recreation products. 247.14 Section 247.14 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES... and recreation products. (a) Playground surfaces and running tracks containing recovered rubber...

  11. 7 CFR 247.28 - Storage and inventory of commodities.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Storage and inventory of commodities. 247.28 Section..., DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS COMMODITY SUPPLEMENTAL FOOD PROGRAM § 247.28 Storage and inventory of commodities. (a) What are the requirements for storage of commodities? State and local...

  12. 40 CFR 247.10 - Paper and paper products.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Paper and paper products. 247.10... COMPREHENSIVE PROCUREMENT GUIDELINE FOR PRODUCTS CONTAINING RECOVERED MATERIALS Item Designations § 247.10 Paper and paper products. Paper and paper products, excluding building and construction paper grades....

  13. 8 CFR 247.14 - Surrender of documents.

    Science.gov (United States)

    2010-01-01

    ... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Surrender of documents. 247.14 Section 247.14 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS ADJUSTMENT OF... I-551 or any other form of Permanent Resident Card, immigrant identification card, resident...

  14. Manganese determination om minerals by activation analysis, using the californium-252 as a neutron source

    International Nuclear Information System (INIS)

    Neutron Activation Analysis, using a Californium-252 neutron source, has been applied for the determination of manganese in ores such as pyrolusite, rodonite (manganese silicate)' and blending used in dry-batteries The favorable nuclear properties of manganese, such as high thermal neutron cross-section for the reaction 55Mn (n.gamma)56 Mn, high concentration of manganese in the matrix and short half - life of 56Mn, are an ideal combination for non-destructive analysis of manganese in ores. Samples and standards of manganese dioxide were irradiated for about 20 minutes, followed by a 4 to 15 minutes decay and counted in a single channel pulse-height discrimination using a NaI(Tl) scintillation detector. Counting time was equal to 10 minutes. The interference of nuclear reactions 56Fe(n,p)56Mn and 59 Co (n, α)56 were studied, as well as problems in connection with neutron shadowing during irradiation, gamma-rays attenuation during counting and influence of granulometry of samples. One sample,was also analysed by wet-chemical method (sodium bismuthate) in order to compare results. As a whole, i t was shown that the analytical method of neutron activation for manganese in ores and blending, is a method simple, rapid and with good precision and accuracy. (author)

  15. Long-term effects of an intracavitary treatment with californium-252 on normal tissue

    International Nuclear Information System (INIS)

    About one hundred fifty swine were exposed to either radium-226 or californium-252 sources in the uterine cervix to determine an RBE for both acute and long-term effects. That value for early changes in the tissues at risk in the treatment of cervical cancer was between 6.2 and 6.8. The incidence of complications increased with time after exposure, especially among animals treated with 252Cf. Analysis of rectal injury showed that ulceration occurred frequently within a year postexposure at doses between 1600 and 2400 rad calculated at 2 cm lateral to the source midline. Fat necrosis and smooth muscle atrophy, resulting in a local rectal stricture, were delayed changes observed in some animals. The lower ureter was the site for a greater frequency of complications than the GI tract. Ureteral stricture often occurred at doses of 1200 rad from 252Cf and 7000 rad from 226Ra. Observation of delayed effects in the uterine-cervix in animals held up to 4 years postexposure indicate that the RBE for 252Cf may be increased to a value as high as 18, while repair may have even decreased it to about 5.6 in the rectum. Fifty swine are still being observed for long-term effects after doses above 800 rad from 252Cf and 5000 rad from 226Ra

  16. Application of TSH bioindicator for studying the biological efficiency of neutrons from californium-252 source

    Energy Technology Data Exchange (ETDEWEB)

    Cebulska-Wasilewska, A.; Rekas, K. [Institute of Nuclear Physics, Cracow (Poland); Kim, J.K. [Korea Atomic Energy Research Inst., Taejon (Korea, Republic of)

    1997-12-31

    The effectiveness of neutrons from a Californium-252 source in the induction of various abnormalities in the Tradescantia clone 4430 stamen hair cells (TSH-assay) was studied. The special attention was paid to check whether any enhancement in effects caused by process of boron neutron capture is visible in the cells enriched with boron ions. Two chemicals (borax and BSH) were applied to introduce boron-10 ions into cells. Inflorescence, normal or pretreated with chemicals containing boron, were irradiated in the air with neutrons from a Cf-252 source at KAERI, Taejon, Korea. To estimate the relative biological effectiveness (RBE) in the induction of gene mutations of the neutron beam under the study, Tradescantia inflorescences, without any chemical pretreatment, were irradiated with various doses of X-rays. The ranges of radiation doses used were 0-0.1 Gy in neutrons and 0-0.5 Gy in X-rays. After the time needed to complete the postirradiation repair Tradescantia cuttings were transferred to Cracow, where screening of gene and lethal; mutations, cell cycle alterations in somatic cells have been done, and dose response relationships were figured. The maximal RBE values were estimated in the range of 4.6-6.8. Alterations of RBE value were observed; from 6.8 to 7.8 in the case of plants pretreated with 240 ppm of B-10 from borax, and 4.6 to 6.1 in the case of 400 ppm of B-10 from BSH. Results showed a slight, although statistically insignificant increase in biological efficacy of radiation from the Cf-252 source in samples pretreated with boron containing chemicals. (author)

  17. Application of TSH bioindicator for studying the biological efficiency of neutrons from californium-252 source

    International Nuclear Information System (INIS)

    The effectiveness of neutrons from a Californium-252 source in the induction of various abnormalities in the Tradescantia clone 4430 stamen hair cells (TSH-assay) was studied. The special attention was paid to check whether any enhancement in effects caused by process of boron neutron capture is visible in the cells enriched with boron ions. Two chemicals (borax and BSH) were applied to introduce boron-10 ions into cells. Inflorescence, normal or pretreated with chemicals containing boron, were irradiated in the air with neutrons from a Cf-252 source at KAERI, Taejon, Korea. To estimate the relative biological effectiveness (RBE) in the induction of gene mutations of the neutron beam under the study, Tradescantia inflorescences, without any chemical pretreatment, were irradiated with various doses of X-rays. The ranges of radiation doses used were 0-0.1 Gy in neutrons and 0-0.5 Gy in X-rays. After the time needed to complete the postirradiation repair Tradescantia cuttings were transferred to Cracow, where screening of gene and lethal; mutations, cell cycle alterations in somatic cells have been done, and dose response relationships were figured. The maximal RBE values were estimated in the range of 4.6-6.8. Alterations of RBE value were observed; from 6.8 to 7.8 in the case of plants pretreated with 240 ppm of B-10 from borax, and 4.6 to 6.1 in the case of 400 ppm of B-10 from BSH. Results showed a slight, although statistically insignificant increase in biological efficacy of radiation from the Cf-252 source in samples pretreated with boron containing chemicals. (author)

  18. Oxygen enhancement ratio (OER) and therapeutic gain factor (GF) for californium-252 at low dose rate

    International Nuclear Information System (INIS)

    The potential benefit of the introduction of californium-252 in interstitial and intracavitary therapy is related to the greater efficiency of its neutron emission against anoxic cancer cells. In that respect, the oxygen enhancement ratio (OER) of the 252Cf emission has been determined for a continuous low dose rate irradiation. The biological system is growth inhibition in Vicia faba bean roots. A new Vicia faba ''BelB'' strain has been used, which better tolerates long periods (up to about 10 hours) of anoxia. In a first series of experiments, for a 252Cf (Dsub(n+γ)) dose rate of 0.11 Gy.h-1, an OER of 1.4+-0.1 was observed (the γ contribution Dγ to the total absorbed dose Dsub(n+γ) was 0.35 at the position of the root tips). In a second series of experiments, in somewhat different geometrical conditions with a 252Cf (Dsub(n+γ)) dose rate of 0.13 Gy.h-1, an OER of 1.5+-0.1 was observed (Dγ/Dsub(n+γ)=0.42). The OER values observed for similar irradiation times, with iridium-192 γ-rays, were 2.3+-0.2 and 2.6+-0.1 respectively, which leads to therapeutic gain factors (GF) of 1.6 and 1.7 respectively. These GF values are slightly lower than those previously obtained (GF=1.8) on the same system, with d(50)-Be p(75)-Be and 15 MeV neutron beams

  19. Clinical Report on Californium-252 Neutron Intraluminal Brachytherapy Combined with External Irradiation for Cervical Carcinoma Treatment

    Institute of Scientific and Technical Information of China (English)

    Huanyu Zhao; Keming Wang; Jian Sun; Xin Geng; Weiming Zhang

    2006-01-01

    OBJECTIVE To observe the curative effects and complications of californium-252 (252Cf) neutron intraluminal brachytherapy (IBT) combined with external irradiation (El) for treatment of cervical carcinoma.METHODS From December 2000 to December 2004, 128 cases of cervical carcinoma staged into ⅡA~ⅢB according to the International Federation of Gynecology and Obstetrics (FIGO) standards were treated with 252Cf neutron IBT using 8~10 Gy per fraction, once a week. The total dose at reference A point was 36~40 Gy in 4~5 fractions. From the second day after 252Cf neutron IBT treatment, the whole pelvic cavity was treated with 60Co γ-ray El, applying 2 Gy per fraction, 4 times per week. After 20~25 Gy of El, the center of the whole pelvic field was blocked with 4 cm of lead in width. The total dose of El was 45~50 Gy.RESULTS The short-term therapeutic effects were CR 95.3% and PR 4.7%. The 3 and 5-year local control rates were 93.5% and 87.9%. The overall 3-year survival rate was 87.5% and for Stages Ⅱ and Ⅲ , 90.9%and 81.5% respectively; the overall 5-year survival rate was 70% and for Stages Ⅱ and Ⅲ, 76.2% and 61% respectively. The rate of radiation complications was 4.7% for radiation cystitis, 7.8% for radiation proctitis, 6.3%for vagina contracture and adhesion and 5.5% for protracted radiation proctitis.CONCLUSION An combination of 252Cf neutron IBT with El for treatment of cervical carcinoma can be well-tolerated by cervical carcinoma patients. The rate of local tumor control is high and radiation complications are few.

  20. 48 CFR 252.247-7023 - Transportation of supplies by sea.

    Science.gov (United States)

    2010-10-01

    ... by sea. 252.247-7023 Section 252.247-7023 Federal Acquisition Regulations System DEFENSE ACQUISITION... of Provisions And Clauses 252.247-7023 Transportation of supplies by sea. As prescribed in 247.573(b)(1), use the following clause: Transportation of Supplies by Sea (MAY 2002) (a) Definitions. As...

  1. Divalent and trivalent gas-phase coordination complexes of californium: evaluating the stability of Cf(ii).

    Science.gov (United States)

    Dau, Phuong D; Shuh, David K; Sturzbecher-Hoehne, Manuel; Abergel, Rebecca J; Gibson, John K

    2016-08-01

    The divalent oxidation state is increasingly stable relative to the trivalent state for the later actinide elements, with californium the first actinide to exhibit divalent chemistry under moderate conditions. Although there is evidence for divalent Cf in solution and solid compounds, there are no reports of discrete complexes in which Cf(II) is coordinated by anionic ligands. Described here is the divalent Cf methanesulfinate coordination complex, Cf(II)(CH3SO2)3(-), prepared in the gas phase by reductive elimination of CH3SO2 from Cf(III)(CH3SO2)4(-). Comparison with synthesis of the corresponding Sm and Cm complexes reveals reduction of Cf(III) and Sm(III), and no evidence for reduction of Cm(III). This reflects the comparative 3+/2+ reduction potentials: Cf(3+) (-1.60 V) ≈ Sm(3+) (-1.55 V) ≫ Cm(3+) (-3.7 V). Association of O2 to the divalent complexes is attributed to formation of superoxides, with recovery of the trivalent oxidation state. The new gas-phase chemistry of californium, now the heaviest element to have been studied in this manner, provides evidence for Cf(II) coordination complexes and similar chemistry of Cf and Sm. PMID:27424652

  2. Evidence for live 247Cm in the early solar system

    Science.gov (United States)

    Tatsumoto, M.; Shimamura, T.

    1980-01-01

    Variations of the 238U/235U ratio in the Allende meteorite, ranging from -35% to + 19%, are interpreted as evidence of live 247Cm in the early Solar System. The amounts of these and other r-products in the Solar System indicate values of (9,000??3,000) Myr for the age of the Galaxy and ??? 8 Myr for the time between the end of nucleosynthesis and the formation of meteoritic grains. Three possible explanations are presented for the different values of the latter time period which are indicated by the decay products of 247Cm, 26Al, 244Pu and 129I. ?? 1980 Nature Publishing Group.

  3. 48 CFR 52.247-51 - Evaluation of Export Offers.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Evaluation of Export....247-51 Evaluation of Export Offers. As prescribed in 47.305-6(e), insert the following provision: Evaluation of Export Offers (JAN 2001) (a) Port handling and ocean charges—other than DOD water...

  4. CDC 24/7: Saving Lives, Protecting People

    Centers for Disease Control (CDC) Podcasts

    2012-06-04

    24/7, CDC provides health information, responds to public health emergencies and natural disasters, and monitors disease.  Created: 6/4/2012 by Office of the Associate Director of Communciation (OADC).   Date Released: 6/4/2012.

  5. 48 CFR 52.247-12 - Supervision, Labor, or Materials.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Supervision, Labor, or....247-12 Supervision, Labor, or Materials. As prescribed in 47.207-5(b), insert a clause substantially... when the contractor is required to furnish supervision, labor, or materials: Supervision, Labor,...

  6. 7 CFR 247.5 - State and local agency responsibilities.

    Science.gov (United States)

    2010-01-01

    ... providing nutrition education to participants; (10) Establishing appeals and fair hearing procedures for...) Providing nutrition education and information on the availability of other nutrition and health assistance..., DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS COMMODITY SUPPLEMENTAL FOOD PROGRAM § 247.5 State...

  7. 9 CFR 354.247 - Table showing types of materials.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Table showing types of materials. 354... Sanitary Conditions and Precautions Against Contamination of Products § 354.247 Table showing types of materials. Equipment, utensils, and facilities Iron Stainless steel and monel metal Aluminum Galvanized...

  8. 48 CFR 247.301-71 - Evaluation factor or subfactor.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Evaluation factor or... Contracts 247.301-71 Evaluation factor or subfactor. For contracts that will include a significant requirement for transportation of items outside CONUS, include an evaluation factor or subfactor that...

  9. 48 CFR 1852.247-71 - Protection of the Florida manatee.

    Science.gov (United States)

    2010-10-01

    ... manatee. 1852.247-71 Section 1852.247-71 Federal Acquisition Regulations System NATIONAL AERONAUTICS AND... and Clauses 1852.247-71 Protection of the Florida manatee. As prescribed in 1847.7001, insert the following clause: Protection of the Florida Manatee (MAR 1989) (a) Pursuant to the Endangered Species Act...

  10. 48 CFR 252.247-7024 - Notification of transportation of supplies by sea.

    Science.gov (United States)

    2010-10-01

    ... transportation of supplies by sea. 252.247-7024 Section 252.247-7024 Federal Acquisition Regulations System... supplies by sea. As prescribed in 247.574(c), use the following clause: Notification of Transportation of Supplies by Sea (MAR 2000) (a) The Contractor has indicated by the response to the solicitation...

  11. 48 CFR 252.247-7022 - Representation of extent of transportation by sea.

    Science.gov (United States)

    2010-10-01

    ... of transportation by sea. 252.247-7022 Section 252.247-7022 Federal Acquisition Regulations System... transportation by sea. As prescribed in 247.574(a), use the following provision: Representation of Extent of Transportation By Sea (AUG 1992) (a) The Offeror shall indicate by checking the appropriate blank in paragraph...

  12. 48 CFR 52.247-40 - Ex Dock, Pier, or Warehouse, Port of Importation.

    Science.gov (United States)

    2010-10-01

    ... Warehouse, Port of Importation. 52.247-40 Section 52.247-40 Federal Acquisition Regulations System FEDERAL... Provisions and Clauses 52.247-40 Ex Dock, Pier, or Warehouse, Port of Importation. As prescribed in 47.303-12..., pier, or warehouse, port of importation: Ex Dock, Pier, or Warehouse, Port of Importation (APR 1984)...

  13. Property Enrichment of Aged Nickel Base Superalloy Supercast 247A

    Directory of Open Access Journals (Sweden)

    Lavakumar Avala

    2013-12-01

    Full Text Available The commercial nickel-base superalloy Supercast 247A can be used for applications in which is required high mechanical strength and corrosion resistance at elevated temperatures, such as turbine blades and automotive turbocharger rotors. The mechanical properties are totally connected to the morphology, size and distribution of γ' phase and carbides. In order to improve the mechanical properties, the material is subjected to solution and aging heat treatment, to raise the volume fraction of γ' phase in the matrix and to form carbides at grain boundaries. In the present study the Supercast 247A superalloy was remelted and cast to obtain the desired polycrystalline test bars by controlling casting parameters, followed by the investigation of precipitation morphology and mechanical properties with respect to solution treatment and aging treatment. The experimental results show that by well controlled casting parameters the Supercast 247A owns excellent castability to form a superalloy with fine grain structure, resistance to indentation as well as superior strength.

  14. Development of electron beam ion source charge breeder for rare isotopes at Californium Rare Isotope Breeder Upgrade

    Energy Technology Data Exchange (ETDEWEB)

    Kondrashev, S.; Dickerson, C.; Levand, A.; Ostroumov, P. N.; Pardo, R. C.; Savard, G.; Vondrasek, R. [Physics Division, Argonne National Laboratory, Argonne, Illinois 60439 (United States); Alessi, J.; Beebe, E.; Pikin, A. [Collider-Accelerator Department, Brookhaven National Laboratory, Upton, New York 11973 (United States); Kuznetsov, G. I.; Batazova, M. A. [Budker Institute of Nuclear Physics, Novosibirsk 630090 (Russian Federation)

    2012-02-15

    Recently, the Californium Rare Isotope Breeder Upgrade (CARIBU) to the Argonne Tandem Linac Accelerator System (ATLAS) was commissioned and became available for production of rare isotopes. Currently, an electron cyclotron resonance ion source is used as a charge breeder for CARIBU beams. To further increase the intensity and improve the purity of neutron-rich ion beams accelerated by ATLAS, we are developing a high-efficiency charge breeder for CARIBU based on an electron beam ion source (EBIS). The CARIBU EBIS charge breeder will utilize the state-of-the-art EBIS technology recently developed at Brookhaven National Laboratory (BNL). The electron beam current density in the CARIBU EBIS trap will be significantly higher than that in existing operational charge-state breeders based on the EBIS concept. The design of the CARIBU EBIS charge breeder is nearly complete. Long-lead components of the EBIS such as a 6-T superconducting solenoid and an electron gun have been ordered with the delivery schedule in the fall of 2011. Measurements of expected breeding efficiency using the BNL Test EBIS have been performed using a Cs{sup +} surface ionization ion source for external injection in pulsed mode. In these experiments we have achieved {approx}70% injection/extraction efficiency and breeding efficiency into the most abundant charge state of {approx}17%.

  15. Development of electron beam ion source charge breeder for rare isotopes at Californium Rare Isotope Breeder Upgrade

    Energy Technology Data Exchange (ETDEWEB)

    Kondrashev S.; Alessi J.; Dickerson, C.; Levand, A.; Ostroumov, P.N.; Pardo, R.C.; Savard, G.; Vondrasek, R.; Beebe, E.; Pikin, A.; Kuznetsov, G.I.; Batazova, M.A.

    2012-02-03

    Recently, the Californium Rare Isotope Breeder Upgrade (CARIBU) to the Argonne Tandem Linac Accelerator System (ATLAS) was commissioned and became available for production of rare isotopes. Currently, an electron cyclotron resonance ion source is used as a charge breeder for CARIBU beams. To further increase the intensity and improve the purity of neutron-rich ion beams accelerated by ATLAS, we are developing a high-efficiency charge breeder for CARIBU based on an electron beam ion source (EBIS). The CARIBU EBIS charge breeder will utilize the state-of-the-art EBIS technology recently developed at Brookhaven National Laboratory (BNL). The electron beam current density in the CARIBU EBIS trap will be significantly higher than that in existing operational charge-state breeders based on the EBIS concept. The design of the CARIBU EBIS charge breeder is nearly complete. Long-lead components of the EBIS such as a 6-T superconducting solenoid and an electron gun have been ordered with the delivery schedule in the fall of 2011. Measurements of expected breeding efficiency using the BNL Test EBIS have been performed using a Cs{sup +} surface ionization ion source for external injection in pulsed mode. In these experiments we have achieved {approx}70% injection/extraction efficiency and breeding efficiency into the most abundant charge state of {approx}17%.

  16. Long-term effects of an intracavitary treatment with californium-252 on normal tissue. [Swine, /sup 226/Ra

    Energy Technology Data Exchange (ETDEWEB)

    Sullivan, M.F.; Beamer, J.L.; Mahony, T.D.; Cross, F.T.; Lund, J.E.; Endres, G.W.R.

    1976-01-01

    About one hundred fifty swine were exposed to either radium-226 or californium-252 sources in the uterine cervix to determine an RBE for both acute and long-term effects. That value for early changes in the tissues at risk in the treatment of cervical cancer was between 6.2 and 6.8. The incidence of complications increased with time after exposure, especially among animals treated with /sup 252/Cf. Analysis of rectal injury showed that ulceration occurred frequently within a year postexposure at doses between 1600 and 2400 rad calculated at 2 cm lateral to the source midline. Fat necrosis and smooth muscle atrophy, resulting in a local rectal stricture, were delayed changes observed in some animals. The lower ureter was the site for a greater frequency of complications than the GI tract. Ureteral stricture often occurred at doses of 1200 rad from /sup 252/Cf and 7000 rad from /sup 226/Ra. Observation of delayed effects in the uterine-cervix in animals held up to 4 years postexposure indicate that the RBE for /sup 252/Cf may be increased to a value as high as 18, while repair may have even decreased it to about 5.6 in the rectum. Fifty swine are still being observed for long-term effects after doses above 800 rad from /sup 252/Cf and 5000 rad from /sup 226/Ra.

  17. 24 CFR 247.10 - Inapplicability to substantial rehabilitation or demolition; right of disposition unimpaired.

    Science.gov (United States)

    2010-04-01

    ... rehabilitation or demolition; right of disposition unimpaired. 247.10 Section 247.10 Housing and Urban... FOR HOUSING-FEDERAL HOUSING COMMISSIONER, DEPARTMENT OF HOUSING AND URBAN DEVELOPMENT MORTGAGE AND... or demolition; right of disposition unimpaired. This subpart shall not apply in any case in which...

  18. 32 CFR Appendix D to Part 247 - AFIS Print Media Directorate

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false AFIS Print Media Directorate D Appendix D to.... 247, App. D Appendix D to Part 247—AFIS Print Media Directorate A. General. The Print Media Directorate (PMD), an element of AFIS, develops, publishes, and distributes a variety of print media...

  19. 7 CFR 247.10 - Distribution and use of CSFP commodities.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Distribution and use of CSFP commodities. 247.10... SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS COMMODITY SUPPLEMENTAL FOOD PROGRAM § 247.10 Distribution and use of CSFP commodities. (a) What are the requirements for distributing CSFP commodities...

  20. 32 CFR Appendix E to Part 247 - DoD Command Newspaper and Magazine Review System

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false DoD Command Newspaper and Magazine Review System... OF DEFENSE (CONTINUED) MISCELLANEOUS DEPARTMENT OF DEFENSE NEWSPAPERS, MAGAZINES AND CIVILIAN ENTERPRISE PUBLICATIONS Pt. 247, App. E Appendix E to Part 247—DoD Command Newspaper and Magazine...

  1. 25 CFR 247.15 - May I reserve a campsite or drying shed?

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false May I reserve a campsite or drying shed? 247.15 Section... RIVER TREATY FISHING ACCESS SITES § 247.15 May I reserve a campsite or drying shed? No. You may not reserve a campsite, drying shed, or other facility. (a) You must use campsites, drying sheds, and...

  2. Ab initio full-potential study of mechanical properties and magnetic phase stability of californium monopnictides (CfN and CfP)

    Science.gov (United States)

    Amari, S.; Bouhafs, B.

    2016-09-01

    Based on the first-principles methods, the structural, elastic, electronic, properties and magnetic ordering of californium monopnictides CfX (X = P) have been studied using the full-potential augmented plane wave plus local orbitals (FP-L/APW + lo) method within the framework of density functional theory (DFT). The electronic exchange correlation energy is described by generalized gradient approximation GGA and GGA+U (U is the Hubbard correction). The GGA+U method is applied to the rare-earth 5f states. We have calculated the lattice parameters, bulk modulii and the first pressure derivatives of the bulk modulii. The elastic properties of the studied compounds are only investigated in the most stable calculated phase. In order to gain further information, we have calculated Young's modulus, shear modulus, anisotropy factor and Kleinman parameter by the aid of the calculated elastic constants. The results mainly show that californium monopnictides CfX (X = P) have an antiferromagnetic spin ordering. Density of states (DOS) and charge densities for both compounds are also computed in the NaCl (B1) structure.

  3. Protective effect of CV247 against cisplatin nephrotoxicity in rats.

    Science.gov (United States)

    Máthé, C; Szénási, G; Sebestény, A; Blázovics, A; Szentmihályi, K; Hamar, P; Albert, M

    2014-08-01

    CV247 (CV), an aqueous mixture of copper (Cu) and manganese (Mn) gluconates, vitamin C and sodium salicylate increased the antitumour effects of cisplatin (CDPP; cis-diamminedichloroplatinum) in vitro. We hypothesized that the antioxidant and cyclooxygenase-2 (COX-2; prostaglandin-endoperoxide synthase 2) inhibitory components of CV can protect the kidneys from CDPP nephrotoxicity in rats. CDPP (6.5 mg/kg, intraperitoneally) slightly elevated serum creatinine (Crea) and blood urea nitrogen (BUN) 12 days after treatment. Kidney histology demonstrated extensive tubular epithelial damage and COX-2 immunoreactivity increased 14 days after treatment. A large amount of platinum (Pt) accumulated in the kidney of CDPP-treated rats. Furthermore, CDPP decreased renal iron (Fe), molybdenum (Mo), zinc (Zn), Cu and Mn concentrations and increased plasma Fe and Cu concentrations. CDPP elevated plasma free radical concentration. Treatment with CV alone for 14 days (twice 3 ml/kg/day orally) did not influence these parameters. Chronic CV administration after CDPP reduced renal histological damage and slightly decreased COX-2 immunoreactivity, while failed to prevent the increase in Crea and BUN levels. Blood free radical concentration was reduced, that is, CV improved redox homeostasis. CV restored plasma Fe and renal Fe, Mo and Zn, while decreased Pt and elevated Cu and Mn concentrations in the kidney. Besides the known synergistic antitumour effects with CDPP, CV partially protected the kidneys from CDPP nephrotoxicity probably through its antioxidant effect.

  4. Anatomy of a controversy: Application of the Langevin technique to the analysis of the Californium-252 Source-Driven Noise Analysis method for subcriticality determination

    International Nuclear Information System (INIS)

    The expressions for the power spectral density of the noise equivalent sources have been calculated explicitly for the (a) stochastic transport equation, (b) the one-speed transport equaton, (c) the one-speed P1 equations, (d) the one-speed diffusion equation and (e) the point kinetic equation. The stochastic nature of Fick's law in (d) has been emphasized. The Langevin technique has been applied at various levels of approximation to the interpretation of the Californium-252 Source-Driven Noise Analysis (CSDNA) experiment for determining the reactivity in subcritical media. The origin of the controversy surrounding this method has been explained. The foundations of the CSDNA method as a viable experimental technique to infer subcriticality from a measured ratio of power spectral densities of the outputs of two neutron detectors and a third external source detector has been examined by solving the one-speed stochastic diffusion equation for a point external Californium-252 source and two detectors in an infinite medium. The expression relating reactivity to the measured ratio of PSDs was found to depend implicitly on k itself. Through a numerical analysis fo this expression, the authors have demonstrated that for a colinear detector-source-detector configuration for neutron detectors far from the source, the expression for the subcritical multiplication factor becomes essentially insensitive to k, hence, demonstrating some possibility for the viability of this technique. However, under more realistic experimental conditions, i.e., for finite systems in which diffusion theroy is not applicable, the measurement of the subcritical multiplication factor from a single measured ratio of PSDs, without extensive transport calculations, remains doubtful

  5. Californium-252 neutron sources

    International Nuclear Information System (INIS)

    Major production programs for the Savannah River reactors and the High Flux Isotopes Reactor at Oak Ridge have made 252Cf one of the most available and, at the USAEC's sales price of $10/μg, one of the least-expensive isotopic neutron sources. Reactor production has totaled approximately 2 g, and, based on expected demand, an additional 10 g will be produced in the next decade. The approximately 800 mg chemically separated to date has been used to prepare over 600 neutron sources. Most, about 500, have been medical sources containing 1 to 5 μg of 252Cf plated in needles for experimental cancer therapy studies. The remainder have generally been point sources containing 10 μg to 12 mg of oxide for activation, well logging, or radiography uses. Bulk sources have also been supplied to the commercial encapsulators. The latest development has been the production of 252Cf cermet wire which can be cut into almost contamination-free lengths of the desired 252Cf content. Casks are available for transport of sources up to 50 mg. Subcritical assemblies have been developed to multiply the source neutrons by a factor of 10 to 40, and collimators and thermalizers have also been extensively developed to shape the neutron flux and energy distributions for special applications. (U.S.)

  6. Radiology 24/7 In-House Attending Coverage: Do Benefits Outweigh Cost?

    Science.gov (United States)

    Coleman, Stephanie; Holalkere, Nagaraj Setty; O׳Malley, Julie; Doherty, Gemma; Norbash, Alexander; Kadom, Nadja

    2016-01-01

    Many radiology practices, including academic centers, are moving to in-house 24/7 attending coverage. This could be costly and may not be easily accepted by radiology trainees and attending radiologists. In this article, we evaluated the effects of 24/7 in-house attending coverage on patient care, costs, and qualitative aspects such as trainee education. We retrospectively collected report turnaround times (TAT) and work relative value units (wRVU). We compared these parameters between the years before and after the implementation of 24/7 in-house attending coverage. The cost to provide additional attending coverage was estimated from departmental financial reports. A qualitative survey of radiology residents and faculty was performed to study perceived effects on trainee education. There were decreases in report TAT following 24/7 attending implementation: 69% reduction in computed tomography, 43% reduction in diagnostic radiography, 7% reduction in magnetic resonance imaging, and 43% reduction in ultrasound. There was an average daytime wRVU decrease of 9%, although this was compounded by a decrease in total RVUs of the 2013 calendar year. The financial investment by the institution was estimated at $850,000. Qualitative data demonstrated overall positive feedback from trainees and faculty in radiology, although loss of independence was reported as a negative effect. TAT and wRVU metrics changed with implementation of 24/7 attending coverage, although these metrics do not directly relate to patient outcomes. Additional clinical benefits may include fewer discrepancies between preliminary and final reports that may improve emergency and inpatient department workflows and liability exposure. Radiologists reported the impression that clinicians appreciated 24/7 in-house attending coverage, particularly surgical specialists. Loss of trainee independence on call was a perceived disadvantage of 24/7 attending coverage and raised a concern that residency education

  7. Association of CD247 polymorphisms with rheumatoid arthritis: a replication study and a meta-analysis.

    Directory of Open Access Journals (Sweden)

    María Teruel

    Full Text Available Given the role of CD247 in the response of the T cells, its entailment in autoimmune diseases and in order to better clarify the role of this gene in RA susceptibility, we aimed to analyze CD247 gene variants previously associated with other autoimmune diseases (rs1052237, rs2056626 and rs864537 in a large independent European Caucasian population. However, no evidence of association was found for the analyzed CD247 single-nucleotide polymorphisms (SNPs with RA and with the presence/absence of anti-cyclic citrullinated polypeptide. We performed a meta-analysis including previously published GWAS data from the rs864537 variant, revealing an overall genome-wide significant association between this CD247 SNP and RA with anti-CCP (OR = 0.90, CI 95% = 0.87-0.93, Poverall = 2.1×10(-10. Our results show for first time a GWAS-level association between this CD247 polymorphism and RA risk.

  8. Library open 24/7: A study of user needs and library management concerns

    Institute of Scientific and Technical Information of China (English)

    BAO; Xueming

    2009-01-01

    Facing competition from Web-based information service development,academic librarians need to find ways to attract more users to the physical library buildings.This study investigated user needs and library management concerns for a 24/7 service through two surveys:1)User feedback survey at Seton Hall University Library,and 2)Survey of Academic Library Deans and Directors in the USA.Based on these two surveys,the paper not only discussed the current status of libraries open 24/7 in the USA and showed the demographics of users of the 24/7 service at Seton Hall University,it also stated reasons to use the 24/7 service.In addition,the paper revealed library management concerns of the24/7 service.Three implications,which have been guided by Scott Bennett’s theory of learning commons for planning library space,were drawn from the findings in this paper.

  9. Californium interrogation prompt neutron (CIPN) instrument for non-destructive assay of spent nuclear fuel-Design concept and experimental demonstration

    Science.gov (United States)

    Henzlova, D.; Menlove, H. O.; Rael, C. D.; Trellue, H. R.; Tobin, S. J.; Park, Se-Hwan; Oh, Jong-Myeong; Lee, Seung-Kyu; Ahn, Seong-Kyu; Kwon, In-Chan; Kim, Ho-Dong

    2016-01-01

    This paper presents results of the first experimental demonstration of the Californium Interrogation Prompt Neutron (CIPN) instrument developed within a multi-year effort launched by the Next Generation Safeguards Initiative Spent Fuel Project of the United States Department of Energy. The goals of this project focused on developing viable non-destructive assay techniques with capabilities to improve an independent verification of spent fuel assembly characteristics. For this purpose, the CIPN instrument combines active and passive neutron interrogation, along with passive gamma-ray measurements, to provide three independent observables. This paper describes the initial feasibility demonstration of the CIPN instrument, which involved measurements of four pressurized-water-reactor spent fuel assemblies with different levels of burnup and two initial enrichments. The measurements were performed at the Post-Irradiation Examination Facility at the Korea Atomic Energy Institute in the Republic of Korea. The key aim of the demonstration was to evaluate CIPN instrument performance under realistic deployment conditions, with the focus on a detailed assessment of systematic uncertainties that are best evaluated experimentally. The measurements revealed good positioning reproducibility, as well as a high degree of insensitivity of the CIPN instrument's response to irregularities in a radial burnup profile. Systematic uncertainty of individual CIPN instrument signals due to assembly rotation was found to be orientation in the instrument.

  10. 17 CFR 247.722 - Exemption allowing banks to calculate trust and fiduciary compensation on a bank-wide basis.

    Science.gov (United States)

    2010-04-01

    ... calculate trust and fiduciary compensation on a bank-wide basis. 247.722 Section 247.722 Commodity and... calculate trust and fiduciary compensation on a bank-wide basis. (a) General. A bank is exempt from meeting... for the bank's trust and fiduciary business is at least 70 percent. (b) Aggregate...

  11. 12 CFR 303.247 - Continue or resume status as an insured institution following termination under section 8 of the...

    Science.gov (United States)

    2010-01-01

    ... institution following termination under section 8 of the FDI Act. 303.247 Section 303.247 Banks and Banking... the FDI Act. (a) Scope. This section relates to an application by a depository institution whose insured status has been terminated under section 8 of the FDI Act (12 U.S.C. 1818) for permission...

  12. 40 CFR 408.247 - Effluent limitations guidelines representing the degree of effluent reduction attainable by the...

    Science.gov (United States)

    2010-07-01

    ... control technology (BCT). 408.247 Section 408.247 Protection of Environment ENVIRONMENTAL PROTECTION... 40 Protection of Environment 28 2010-07-01 2010-07-01 true Effluent limitations guidelines... degree of effluent reduction attainable by the application of the best conventional pollutant...

  13. Switching Investigations on a SiC MOSFET in a TO-247 Package

    DEFF Research Database (Denmark)

    Anthon, Alexander; Hernandez Botella, Juan Carlos; Zhang, Zhe;

    2014-01-01

    package, has a major influence on the switching energy. Crucial design guidelines for an improved double pulse test circuit are introduced which are used for practical investigations on the switching behavior. Switching energies of a SiC MOSFET in a TO-247 package is measured depending on varying gate...

  14. 48 CFR 247.372 - DD Form 1654, Evaluation of Transportation Cost Factors.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false DD Form 1654, Evaluation... Transportation in Supply Contracts 247.372 DD Form 1654, Evaluation of Transportation Cost Factors. Contracting personnel may use the DD Form 1654 to furnish information to the transportation office for development...

  15. 48 CFR 247.371 - DD Form 1653, Transportation Data for Solicitations.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false DD Form 1653... Supply Contracts 247.371 DD Form 1653, Transportation Data for Solicitations. The transportation specialist prepares the DD Form 1653 to accompany requirements for the acquisition of supplies. The...

  16. 48 CFR 247.370 - DD Form 1384, Transportation Control and Movement Document.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false DD Form 1384... Transportation in Supply Contracts 247.370 DD Form 1384, Transportation Control and Movement Document. The transportation office of the shipping activity prepares the DD Form 1384 to accompany all shipments made...

  17. 7 CFR 247.13 - Provisions for non-English or limited-English speakers.

    Science.gov (United States)

    2010-01-01

    ... significant proportion of the population in an area is comprised of non-English or limited-English speaking... 7 Agriculture 4 2010-01-01 2010-01-01 false Provisions for non-English or limited-English speakers... § 247.13 Provisions for non-English or limited-English speakers. (a) What must State and local...

  18. 48 CFR 3052.247-72 - F.o.b. destination only.

    Science.gov (United States)

    2010-10-01

    ... CLAUSES Text of Provisions and Clauses 3052.247-72 F.o.b. destination only. As prescribed in (HSAR) 48 CFR 3047.305-70(c), insert the following provision: F.O.B. Destination Only (DEC 2003) Offers are invited... 48 Federal Acquisition Regulations System 7 2010-10-01 2010-10-01 false F.o.b. destination...

  19. 48 CFR 52.247-8 - Estimated Weights or Quantities Not Guaranteed.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Estimated Weights or... Provisions and Clauses 52.247-8 Estimated Weights or Quantities Not Guaranteed. As prescribed in 47.207-3(e... transportation-related services when weights or quantities are estimates: Estimated Weights or Quantities...

  20. Formation and characterization of Y:247 film through spray pyrolysis technique

    Indian Academy of Sciences (India)

    Suman Anand; O N Srivastava

    2004-04-01

    The synthesis of high temperature superconducting films of Y:247 (c ∼ K) have been successfully achieved. The difficulty in synthesis owing to narrow range of stability of Y:247 has been taken care of through several quenching modes, e.g. quenching of the films synthesized at ∼ 850°C, in air or in liquid nitrogen. The energy dispersive analysis of X-rays (EDAX) and transmission electron microscopy (TEM) studies of the as processed film, Y2Ba4Cu7O14+, exhibit nearly correct cationic stoichiometry of 2 : 4 : 7; also narrow regions (< 50 Å) of minority Y:124 phase and stacking faults capable of working as flux pinning sites have been invariably found to be present. In addition to Y:247, Ag admixed films have also been investigated. The c here is ∼ 70–75 K which is similar to that of the film without silver. Representative estimates of transport critical current density (c) for Y:247 films is ∼ 103 A/cm2, and with silver corresponding to Y2Ba4Cu7O14+ (Ag0.1) is found to be ∼ 104 A/cm2.

  1. Prevalence of Plasmodium vivax VK210 and VK247 subtype in Myanmar

    Directory of Open Access Journals (Sweden)

    Kang Yoon-Joong

    2010-07-01

    Full Text Available Abstract Background Plasmodium vivax is divided into two subtypes, a dominant form, VK210 and a variant form, VK247. This division is dependent on the amino acid composition of the circumsporozoite (CS protein. In this study, the prevalence of the VK247 variant form of P. vivax was investigated in Myanmar. Methods The existence of malaria parasites in blood samples was determined by microscopic examination, polymerase chain reaction (PCR and DNA hybridization assays. To test for antibodies against P. vivax and Plasmodium falciparum in blood samples, an indirect immunofluorescence antibody test (IFAT was performed using asexual blood antigens. An enzyme-linked immunosorbent assay with synthetic VK210 and VK247 antigens was carried out to discriminate between the P. vivax subtypes. Results By thick smear examination, 73 (n = 100 patients were single infected with P. vivax, one with P. falciparum and 13 with both species. By thin smear, 53 patients were single infected with P. vivax, eight with only P. falciparum and 16 with both. Most of the collected blood samples were shown to be P. vivax positive (n = 95 by PCR. All cases that were positive for P. falciparum by PCR (n = 43 were also positive for P. vivax. However, 52 cases were single infected with P. vivax. IFAT showed antibody titres from 1:32 to 1:4,096. Additionally, using specific antibodies for VK210 and VK247, ELISA showed that 12 patients had antibodies for only the VK210 subtype, 4 patients had only VK247 subtype antibodies and 21 patients had antibodies for both subtypes. Using a DNA hybridization test, 47 patients were infected with the VK210 type, one patient was infected with VK247 and 23 patients were infected with both subtypes. Conclusions The proportion of the VK247 subtype in Myanmar was 43.1% (n = 25 among 58 positive cases by serodiagnosis and 25.6% (n = 24 among 94 positive cases by genetic diagnosis. In both diagnostic methods, the infection status of malaria patients is

  2. Biological Efficiency of Californium-252 Source Evaluated by Comet Assay, Classical Cytogenetics and FISH in Human Lymphocytes Irradiated without and with BSH Pretreatment

    International Nuclear Information System (INIS)

    Biological effectiveness of californium-252 source was evaluated after irradiations in vitro of normal or pre-treated with compound enriched in B-10 ion cells. Peripheral blood lymphocytes were used as a model for human cells. DNA and chromosomal damage were studied to compare biological effectiveness of irradiation. Human blood samples or isolated lymphocytes were irradiated with the isotopic source of 252Cf, at the Faculty of Physics and Nuclear Techniques at the University of Mining and Metallurgy (both neutron source and samples were placed in ''infinite'' polyethylene block). Chemical pretreatment with Na210B12H11SH (BSH) was performed to introduce boron-10 ion into cells in order to check any enhancement effect due to the process of boron neutron capture. Single cell gel electrophoresis also known as the Comet assay was done to investigate the DNA damage. Classical cytogenetic analysis was applied to assess the frequencies of unstable aberrations (dicentrics, rings and a centric fragments). To evaluate the frequencies of stable aberrations the fluorescence in situ hybridisation (FISH) with probes for chromosomes 1, 4 (14.3% of the whole genome) was performed. Linear (or close to linear) increase with radiation dose were observed for the DNA damage and aberration frequencies in lymphocytes both untreated or pre-treated with BSH. Levels of translocations evaluated for the whole genome were comparable with the frequencies of dicentrics and rings. No significant differences were detected due to radiation dose in the frequencies of sister chromatid exchanges (SCE) detected in the second mitosis. No statistically significant differences were observed in various biological end-points between normal or boron pre-treated cells. (author)

  3. Prediction of fatigue lives of MAR-M247 LC based on the crack closure concept

    Energy Technology Data Exchange (ETDEWEB)

    Gelmedin, Domnin; Lang, Karl-Heinz [Karlsruhe Institute of Technology, Institute for Applied Materials - Materials Science and Engineering (IAM-WK) Campus Sued, Engelbert-Arnold-Strasse 4, 76131 Karlsruhe (Germany); Newman, James C. Jr. [Department of Aerospace Engineering, Mississippi State University, 314C Walker Engineering Building P. O. Box A Mississippi State, MS 39762 (United States)

    2012-10-15

    Low cycle fatigue (LCF), high cycle fatigue (HCF), and combined LCF and HCF tests are carried out on MAR-M247 LC at 650 C in air environment. Under combined LCF and HCF loading, block striations form on the fracture surface which are used to complete an effective crack growth curve by using the linear summation model. Crack growth lives starting from equivalent initial flaw sizes are calculated by the crack closure code FASTRAN and compared with experimental fatigue lives. Under HCF loading, predicted and experimental fatigue lives agree well for lifetimes above 10{sup 5} cycles. Lower lifetimes are overestimated indicating that the linear summation model is not valid for MAR-M247 LC in this loading range. Interactions between the non-crystallographic HCF crack growth and striated crack growth that is caused by the LCF loading are probably responsible for this behavior. (Copyright copyright 2012 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

  4. Evaluation of Cm-247 neutron cross sections in the resonance region

    International Nuclear Information System (INIS)

    The neutron cross sections of Cm-247 are evaluated in the resonance (resolved and unresolved) region up to 10 keV. Average resonance parameters (i.e. spacing D, fission and radiative widths, neutron strength functions) are determined for unresolved region calculations. Moreover for a better comparison with the experimental data, fission cross section is calculated up to 10 MeV. In addition, the average number of neutrons emitted per fission as a function of energy is estimated

  5. 48 CFR 3052.247-71 - F.o.b. origin only.

    Science.gov (United States)

    2010-10-01

    ... CLAUSES Text of Provisions and Clauses 3052.247-71 F.o.b. origin only. As prescribed in (HSAR) 48 CFR 3047.305-70(b), insert the following provision: F.O.B. Origin Only (DEC 2003) Offers are invited on the... 48 Federal Acquisition Regulations System 7 2010-10-01 2010-10-01 false F.o.b. origin only....

  6. A novel thymoma-associated immunodeficiency with increased naive T cells and reduced CD247 expression.

    Science.gov (United States)

    Christopoulos, Petros; Dopfer, Elaine P; Malkovsky, Miroslav; Esser, Philipp R; Schaefer, Hans-Eckart; Marx, Alexander; Kock, Sylvia; Rupp, Nicole; Lorenz, Myriam R; Schwarz, Klaus; Harder, Jan; Martin, Stefan F; Werner, Martin; Bogdan, Christian; Schamel, Wolfgang W A; Fisch, Paul

    2015-04-01

    The mechanisms underlying thymoma-associated immunodeficiency are largely unknown, and the significance of increased blood γδ Τ cells often remains elusive. In this study we address these questions based on an index patient with thymoma, chronic visceral leishmaniasis, myasthenia gravis, and a marked increase of rare γδ T cell subsets in the peripheral blood. This patient showed cutaneous anergy, even though he had normal numbers of peripheral blood total lymphocytes as well as CD4(+) and CD8(+) T cells. Despite his chronic infection, analyses of immunophenotypes and spectratyping of his lymphocytes revealed an unusual accumulation of naive γδ and αβ T cells, suggesting a generalized T cell activation defect. Functional studies in vitro demonstrated substantially diminished IL-2 and IFN-γ production following TCR stimulation of his "untouched" naive CD4(+) T cells. Biochemical analysis revealed that his γδ and αβ T cells carried an altered TCR complex with reduced amounts of the ζ-chain (CD247). No mutations were found in the CD247 gene that encodes the homodimeric ζ protein. The diminished presence of CD247 and increased numbers of γδ T cells were also observed in thymocyte populations obtained from three other thymoma patients. Thus, our findings describe a novel type of a clinically relevant acquired T cell immunodeficiency in thymoma patients that is distinct from Good's syndrome. Its characteristics are an accumulation of CD247-deficient, hyporresponsive naive γδ and αβ T cells and an increased susceptibility to infections. PMID:25732729

  7. Estimation of Al, Hf, Ta in 247Cm-alloy by ICP-AES

    International Nuclear Information System (INIS)

    The present paper discusses a new method developed for analysis of Al, Hf and Ta in Nickel based 247Cm super alloy by Inductively Coupled Plasma Atomic Emission Spectrometer (ICP-AES). The procedure employs the dissolution of alloy in a mixture of Sulphuric acid, Nitric acid and Hf and subsequent analysis by sequential ICP-AES (Model JY Ultima 2C HR, France). A Relative Standard Deviation of less than ± 5% has been achieved for all the elements. (author)

  8. Draft Genome Sequences of Three Northern German Epidemic Staphylococcus aureus (ST247) Strains Containing Multiple Copies of IS256

    Science.gov (United States)

    Kleinert, Franziska; Kallies, René; Zweynert, Annegret

    2016-01-01

    We report the draft genome sequences of three multiresistant Staphylococcus aureus strains of sequence type 247 (ST247). The methicillin-resistant S. aureus (MRSA) SA1450/94 is vancomycin susceptible, while the clinical MRSA isolate S. aureus SA137/93A and its spontaneous laboratory mutant SA137/93G are characterized by intermediate vancomycin susceptibility. PMID:27609917

  9. Deep Fabry-Perot Hα observations of two Sculptor group galaxies, NGC 247 and 300

    Science.gov (United States)

    Hlavacek-Larrondo, J.; Marcelin, M.; Epinat, B.; Carignan, C.; de Denus-Baillargeon, M.-M.; Daigle, O.; Hernandez, O.

    2011-09-01

    It has been suggested that diffuse ionized gas can extend all the way to the end of the H I disc, and even beyond, such as in the case of the warped galaxyNGC 253 (Bland-Hawthorn et al.). Detecting ionized gas at these radii could carry significant implications as to the distribution of dark matter in galaxies. With the aim of detecting this gas, we carried out a deep Hα kinematical analysis of two Sculptor group galaxies, NGC 247 and 300. The Fabry-Perot data were taken at the 36-cm Marseille Telescope in La Silla, Chile, offering a large field of view. With almost 20 hours of observations for each galaxy, very faint diffuse emission is detected. Typical emission measures of 0.1 cm-6 pc are reached. For NGC 247, emission extending up to a radius comparable with that of the H I disc (r˜ 13 arcmin) is found, but no emission is seen beyond the H I disc. For NGC 300, we detect ionized gas on the entirety of our field of view (rmax˜ 14 arcmin), and find that the bright H II regions are embedded in a diffuse background. Using the deep data, extended optical rotation curves are obtained, as well as mass models. These are the most extended optical rotation curves thus far for these galaxies. We find no evidence suggesting that NGC 247 has a warped disc, and to account for our non-detection of Hα emission beyond its H I disc, as opposed to the warped galaxy NGC 253, our results favour the model in which, only through a warp, ionization by hot young stars in the central region of a galaxy can let photons escape and ionize the interstellar medium in the outer parts.

  10. Búsqueda y análisis de asociaciones estelares en NGC247

    Science.gov (United States)

    Rodríguez, M. J.; Baume, G.; Feinstein, C.

    2016-08-01

    From ACS/HST observations, available in the Space Telescope database, the search and analysis of young stellar associations in the galaxy NGC247 have been carried out. The Path Linkage Criterion was used for the detection, identifying 147 young stellar groups. Thanks to the ACS high spatial resolution, it was possible to detect the individual components of each groups allowing the construction of the radial density profiles, the photometric diagrams decontaminated by field stars, and the initial mass function. Thus it has been possible to identify some basic properties of the groups, such as sizes, masses, etc. We also performed a global study of the behavior of these associations in the galaxy.

  11. Mesotelioma maligno: Experiencia clínico-patológica de 247 casos Malignant mesothelioma: Clinical and pathological features from 247 cases

    Directory of Open Access Journals (Sweden)

    RAÚL BARRERA R

    2010-09-01

    Full Text Available Objetivo: Este estudio describe la frecuencia, características patológicas, ocupación y exposición a asbesto en una cohorte grande de casos de mesotelioma maligno (MM admitidos en el Instituto Nacional de Enfermedades Respiratorias (INER, en México. Método: Se llevó a cabo un estudio retrospectivo y transversal en los registros médicos de pacientes diagnosticados con MM entre los años 1991-2007. Resultados: De los 247pacientes, 184 fueron hombres y 63 fueron mujeres con un promedio de edad de 51 y 60 años. Disnea y dolor torácico fueron los principales síntomas observados. Exposición a fibras de asbesto fue referida sólo en 34% de los casos, aunque una exposición directa sólo puedo ser documentada en cinco de ellos. Las características clínicas de los pacientes con MM fueron similares en aquellos con y sin exposición a asbesto reconocida. Conclusión: Aunque se observa una tendencia creciente en el número de casos con MM, en muchos de ellos no fue posible establecer una fuente de exposición a asbesto como la causa de contaminación para el desarrollo de la enfermedad.Objective: This study describes the frequency, occupational, clinical, and pathological features in a large cohort of cases of Malignant Mesothelioma (MM from the National Institute of Respiratory Diseases (INER, in México. Methods: A retrospective and transversal study was carried out in medical records of patients diagnosed with MM between the years 1991 to 2007. Results: Of the 247 patients, 184 were male and 63 were female with an average age of 51-60 years. Dyspnea and chest pain were the presenting symptoms in most of the patients. Exposure to asbestos was referred only in 34% of cases but direct exposition only was documented in five of them. Clinical features of MM patients were similar in asbestos related and non-asbestos related malignant mesothelioma. Conclusion: Although a growing tendency is observed in, the number of cases with MM, in many of them

  12. Strain-Life Assessment of Grainex Mar-M 247 for NASA's Turbine Seal Test Facility

    Science.gov (United States)

    Delgado, Irebert R.; Halford, Gary R.; Steinetz, Bruce M.; Rimnac, Clare M.

    2004-01-01

    NASA s Turbine Seal Test Facility is used to test air-to-air seals for use primarily in advanced jet engine applications. Combinations of high temperature, high speed, and high pressure limit the disk life, due to the concern of crack initiation in the bolt holes of the Grainex Mar-M 247 disk. The primary purpose of this current work is to determine an inspection interval to ensure safe operation. The current work presents high temperature fatigue strain-life data for test specimens cut from an actual Grainex Mar-M 247 disk. Several different strain-life models were compared to the experimental data including the Manson-Hirschberg Method of Universal Slopes, the Halford-Nachtigall Mean Stress Method, and the Modified Morrow Method. The Halford-Nachtigall Method resulted in only an 18 percent difference between predicted and experimental results. Using the experimental data at a 99.95 percent prediction level and the presence of 6 bolt holes it was found that the disk should be inspected after 665 cycles based on a total strain of 0.5 percent at 649 C.

  13. Microstructure and oxidation performance of a –' Pt-aluminide bond coat on directionally solidified superalloy CM-247LC

    Indian Academy of Sciences (India)

    Md Zafir Alam; N Hazari; Dipak K Das

    2014-10-01

    The microstructure of a Pt-modified -' bond coat on CM-247LC Ni-base superalloy has been examined and its cyclic oxidation performance at 1100 °C in air is comparatively evaluated with that of a conventional -(Ni, Pt)Al bond coat. The -' bond coat was effective in imparting oxidation resistance to the CM-247LC alloy for about 100 h, whereas the coating imparted oxidation resistance for significantly longer duration of about 1000 h. The nature of surface damage that occurred to the -' coating during oxidation has been compared with that reported in the case of coating.

  14. QCW diode-side-pumped Nd:YAG ceramic laser with 247 W output power at 1123 nm

    Science.gov (United States)

    Li, C. Y.; Peng, Q. J.; Wang, B. S.; Bo, Y.; Cui, D. F.; Xu, Z. Y.; Feng, X. Q.; Pan, Y. B.

    2011-05-01

    We demonstrate for the first time a diode-side-pumped quasi-continuous-wave (QCW) operation of a 1123 nm Nd:YAG ceramic laser. The single 1123 nm wavelength is acquired through precise coating. With a pump power of 1000 W, an output power of 247 W is obtained, corresponding to an optical-optical conversion efficiency of 24.7%. At the maximal output power, the pulse repetition rate and pulse width are measured to be 1.1 kHz and 180 μs, respectively. The numerical simulations for wavelength selectivity from 1112, 1116 and 1123 nm are discussed in detail.

  15. Californium Recovery from Palladium Wire

    Energy Technology Data Exchange (ETDEWEB)

    Burns, Jon D. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States)

    2014-08-01

    The recovery of 252Cf from palladium-252Cf cermet wires was investigated to determine the feasibility of implementing it into the cermet wire production operation at Oak Ridge National Laboratory’s Radiochemical Engineering Development Center. The dissolution of Pd wire in 8 M HNO3 and trace amounts of HCl was studied at both ambient and elevated temperatures. These studies showed that it took days to dissolve the wire at ambient temperature and only 2 hours at 60°C. Adjusting the ratio of the volume of solvent to the mass of the wire segment showed little change in the kinetics of dissolution, which ranged from 0.176 mL/mg down to 0.019 mL/mg. A successful chromatographic separation of 153Gd, a surrogate for 252Cf, from Pd was demonstrated using AG 50x8 cation exchange resin with a bed volume of 0.5 mL and an internal diameter of 0.8 cm.

  16. 32 CFR Appendix C to Part 247 - Mailing of DoD Newspapers, Magazines, CE Guides, and Installation Maps; Sales and Distribution of...

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false Mailing of DoD Newspapers, Magazines, CE Guides...) MISCELLANEOUS DEPARTMENT OF DEFENSE NEWSPAPERS, MAGAZINES AND CIVILIAN ENTERPRISE PUBLICATIONS Pt. 247, App. C Appendix C to Part 247—Mailing of DoD Newspapers, Magazines, CE Guides, and Installation Maps; Sales...

  17. Help at 3:00 AM! Providing 24/7 Timely Support to Online Students via a Virtual Assistant

    Science.gov (United States)

    Vu, Phu; Fredrickson, Scott; Meyer, Richard

    2016-01-01

    With a dearth of research on human-robot interaction in education and relatively high non-completion rates of online students, this study was conducted to determine the feasibility of using a virtual assistant (VA) to respond to questions and concerns of students and provide 24/7 online course content support. During a 16 week-long academic…

  18. 40 CFR 174.524 - Glyphosate Oxidoreductase GOX or GOXv247 in all plants; exemption from the requirement of a...

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 23 2010-07-01 2010-07-01 false Glyphosate Oxidoreductase GOX or... REQUIREMENTS FOR PLANT-INCORPORATED PROTECTANTS Tolerances and Tolerance Exemptions § 174.524 Glyphosate... Glyphosate Oxidoreductase GOX or GOXv247 enzyme in all plants are exempt from the requirement of a...

  19. 48 CFR 52.247-46 - Shipping Point(s) Used in Evaluation of F.o.b. Origin Offers.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Shipping Point(s) Used in... Text of Provisions and Clauses 52.247-46 Shipping Point(s) Used in Evaluation of F.o.b. Origin Offers... when price evaluation for shipments from various shipping points is contemplated: Shipping...

  20. Phosphorylation of HOX11/TLX1 on Threonine-247 during mitosis modulates expression of cyclin B1

    Directory of Open Access Journals (Sweden)

    Chesney Alden

    2010-09-01

    Full Text Available Abstract Background The HOX11/TLX1 (hereafter referred to as HOX11 homeobox gene was originally identified at a t(10;14(q24;q11 translocation breakpoint, a chromosomal abnormality observed in 5-7% of T cell acute lymphoblastic leukemias (T-ALLs. We previously reported a predisposition to aberrant spindle assembly checkpoint arrest and heightened incidences of chromosome missegregation in HOX11-overexpressing B lymphocytes following exposure to spindle poisons. The purpose of the current study was to evaluate cell cycle specific expression of HOX11. Results Cell cycle specific expression studies revealed a phosphorylated form of HOX11 detectable only in the mitotic fraction of cells after treatment with inhibitors to arrest cells at different stages of the cell cycle. Mutational analyses revealed phosphorylation on threonine-247 (Thr247, a conserved amino acid that defines the HOX11 gene family and is integral for the association with DNA binding elements. The effect of HOX11 phosphorylation on its ability to modulate expression of the downstream target, cyclin B1, was tested. A HOX11 mutant in which Thr247 was substituted with glutamic acid (HOX11 T247E, thereby mimicking a constitutively phosphorylated HOX11 isoform, was unable to bind the cyclin B1 promoter or enhance levels of the cyclin B1 protein. Expression of the wildtype HOX11 was associated with accelerated progression through the G2/M phase of the cell cycle, impaired synchronization in prometaphase and reduced apoptosis whereas expression of the HOX11 T247E mutant restored cell cycle kinetics, the spindle checkpoint and apoptosis. Conclusions Our results demonstrate that the transcriptional activity of HOX11 is regulated by phosphorylation of Thr247 in a cell cycle-specific manner and that this phosphorylation modulates the expression of the target gene, cyclin B1. Since it is likely that Thr247 phosphorylation regulates DNA binding activity to multiple HOX11 target sequences, it is

  1. Energy levels of 247Cm populated in the α decay of 98251Cf

    International Nuclear Information System (INIS)

    α -Particle, conversion-electron, and γ -ray singles spectra of 251Cf sources containing few Bq activities were measured with high-resolution semiconductor detectors. α-γ coincidence and level half-life measurements were also performed. On the basis of these measurements the following single-particle states have been identified in 247Cm : 9/2 - [734] , 0 keV; 5/2 + [622] , 227.4 keV; 7/2 + [624] , 285.4 keV; 1/2 + [620] , 404.9 keV; 1/2 + [631] , 518.6 keV . The measured single-particle energies are in good agreement with energies calculated with a Woods-Saxon single-particle potential. From the measured half-life of the 227.4-keV level and the E3 branching ratio, a B(E3) value of 5 W.u. has been deduced between the 5/2 + [622] and 9/2 - [734] bands. The large B(E3) value is an indication of octupole mixing in the 227.4-keV level

  2. Genome-wide association study of systemic sclerosis identifies CD247 as a novel susceptibility locus

    Science.gov (United States)

    Radstake, Timothy R.D.J.; Gorlova, Olga; Rueda, Blanca; Martin, Jose-Ezequiel; Alizadeh, Behrooz Z.; Palomino-Morales, Rogelio; Coenen, Marieke J.; Vonk, Madelon C.; Voskuyl, Alexandre E.; Scheurwegh, Annemie J.; Broen, Jasper C.; van Riel, Piet L.C.M.; van ‘t Slot, Ruben; Italiaander, Annet; Ophoff, Roel A.; Riemekasten, Gabriela; Hunzelmann, Nico; Simeon, Carmen P.; Ortego-Centeno, Norberto; González-Gay, Miguel A.; González-Escribano, María F.; Airo, Paolo; van Laar, Jaap; Herrick, Ariane; Worthington, Jane; Hesselstrand, Roger; Smith, Vanessa; de Keyser, Filip; Houssiau, Fredric; Chee, Meng May; Madhok, R; Shiels, Paul; Westhovens, Rene; Kreuter, Alexander; Kiener, Hans; de Baere, Elfride; Witte, Torsten; Padykov, Leonid; Klareskog, Lars; Beretta, Lorenzo; Scorza, Rafaella; Lie, Benedicte A.; Hoffman-Vold, Anna-Maria; Carreira, P; Varga, J.; Hinchcliff, M.; Gregersen, Peter; Lee, Annette T.; Ying, Jun; Han, Younghun; Weng, Shih-Feng; Amos, Christopher I.; Wigley, Fredrick M.; Hummers, Laura; Nelson, J. Lee; Agarwal, Sandeep K.; Assassi, Shervin; Gourh, Pravitt; Tan, Filemon K.; Koeleman, Bobby P.C.; Arnett, Frank C; Martin, Javier; Mayes, Maureen D.

    2010-01-01

    Systemic sclerosis (SSc) is an autoimmune disease characterized by fibrosis of the skin and internal organs that leads to profound disability and premature death. To identify novel SSc susceptibility loci we conducted the first genome wide association study (GWAS) in a population of Caucasian ancestry including a total of 2296 SSc patients and 5171 controls. Analysis of 279,621 autosomal single nucleotide polymorphisms (SNPs) followed by replication testing in an independent case-control set of European ancestry (2,753 SSc patients / 4,569 controls) identified a new susceptibility locus for systemic sclerosis at CD247 (1q22-23; rs2056626, P = 2.09 × 10−7 in the discovery samples, P = 3.39 × 10−9 in the combined analysis). Additionally, we confirm and firmly establish the role of MHC (2.31 × 10−18), IRF5 (P =1.86 × 10−13) and STAT4 (P =3.37 × 10−9) gene regions as SSc genetic risk factors. PMID:20383147

  3. Study on Application of Grey Prediction Model in Superalloy MAR-247 Machining

    Directory of Open Access Journals (Sweden)

    Chen Shao-Hsien

    2015-01-01

    Full Text Available Superalloy MAR-247 is mainly applied in the space industry and die industry. With its characteristics of mechanical property, fatigue resistance, and high temperature corrosion resistance, therefore, it is mainly applied in machine parts of high temperature and corrosion resistance, such as turbine blades and rotor of the aeroengine and turbine assembly in the nuclear power plant. However, considering that its properties of high strength, low thermal conductivity, being difficult to soften, and work hardening may reduce the life of cutting-tool and weaken the surface accuracy, the study provided minimizing experiment occurring during milling process for superalloy material. As a statistical approach used to analyse experiment data, this study used GM(1,1 in the grey prediction model to conduct simulation and then predict and analyze its characteristics based on the experimental data, focusing on the tool life and surface accuracy. Moreover, with the superalloy machining parameters of the current effective application improved grey prediction model, it can decrease the errors, extend the tool life, and improve the prediction precision of surface accuracy.

  4. P247 and p523: two in vivo-expressed megalocytivirus proteins that induce protective immunity and are essential to viral infection.

    Directory of Open Access Journals (Sweden)

    Jian Zhang

    Full Text Available Megalocytivirus is a DNA virus with a broad host range among teleost fish. Although the complete genome sequences of a number of megalocytivirus isolates have been reported, the functions of most of the genes of this virus are unknown. In this study, we selected two megalocytivirus immunogens, P247 and P523, which were expressed during host infection and, when in the form of DNA vaccines (pCN247 and pCN523 respectively, elicited strong protectivity against lethal megalocytivirus challenge in a turbot (Scophthalmus maximus model. Compared to control fish, fish vaccinated with pCN247 and pCN523 exhibited drastically reduced viral loads in tissues and high levels of survival rates. Immune response analysis showed that pCN247 and pCN523 (i induced production of specific serum antibodies, (ii caused generation of cytotoxic immune cells and specific memory immune cells that responded to secondary antigen stimulation, and (iii upregulated the expression of genes involved in innate and adaptive immunity. To examine the potential role of P247 and P523 in viral infection, the expression of P247 and P523 was knocked down by siRNA. Subsequent in vivo infection study showed that P247 and P523 knockdown significantly impaired viral replication. Furthermore, whole-genome transcriptome analysis revealed that P247 and P523 knockdown altered the expression profiles of 26 and 41 viral genes, respectively, putatively participating in diverse aspects of viral infection. Taken together, these results indicate that P247 and P523 induce protective immunity in teleost and play fundamental roles essential to viral replication. These observations provide the first evidence that suggests a likely link between the protectivity of viral immunogens and their biological significance in viral replication.

  5. Selective Cathepsin S Inhibition with MIV-247 Attenuates Mechanical Allodynia and Enhances the Antiallodynic Effects of Gabapentin and Pregabalin in a Mouse Model of Neuropathic Pain.

    Science.gov (United States)

    Hewitt, Ellen; Pitcher, Thomas; Rizoska, Biljana; Tunblad, Karin; Henderson, Ian; Sahlberg, Britt-Louise; Grabowska, Urszula; Classon, Björn; Edenius, Charlotte; Malcangio, Marzia; Lindström, Erik

    2016-09-01

    Cathepsin S inhibitors attenuate mechanical allodynia in preclinical neuropathic pain models. The current study evaluated the effects when combining the selective cathepsin S inhibitor MIV-247 with gabapentin or pregabalin in a mouse model of neuropathic pain. Mice were rendered neuropathic by partial sciatic nerve ligation. MIV-247, gabapentin, or pregabalin were administered alone or in combination via oral gavage. Mechanical allodynia was assessed using von Frey hairs. Neurobehavioral side effects were evaluated by assessing beam walking. MIV-247, gabapentin, and pregabalin concentrations in various tissues were measured. Oral administration of MIV-247 (100-200 µmol/kg) dose-dependently attenuated mechanical allodynia by up to approximately 50% reversal when given as a single dose or when given twice daily for 5 days. No behavioral deficits were observed at any dose of MIV-247 tested. Gabapentin (58-350 µmol/kg) and pregabalin (63-377 µmol/kg) also inhibited mechanical allodynia with virtually complete reversal at the highest doses tested. The minimum effective dose of MIV-247 (100 µmol/kg) in combination with the minimum effective dose of pregabalin (75 µmol/kg) or gabapentin (146 µmol/kg) resulted in enhanced antiallodynic efficacy without augmenting side effects. A subeffective dose of MIV-247 (50 µmol/kg) in combination with a subeffective dose of pregabalin (38 µmol/kg) or gabapentin (73 µmol/kg) also resulted in substantial efficacy. Plasma levels of MIV-247, gabapentin, and pregabalin were similar when given in combination as to when given alone. Cathepsin S inhibition with MIV-247 exerts significant antiallodynic efficacy alone, and also enhances the effect of gabapentin and pregabalin without increasing side effects or inducing pharmacokinetic interactions.

  6. Design of a homogeneous subcritical nuclear reactor based on thorium with a source of californium 252; Diseno de un reactor nuclear subcritico homogeneo a base de Torio con una fuente de Californio 252

    Energy Technology Data Exchange (ETDEWEB)

    Delgado H, C. E.; Vega C, H. R. [Universidad Autonoma de Zacatecas, Unidad Academica de Estudios Nucleares, Cipres No. 10, Fracc. La Penuela, 98068 Zacatecas, Zac. (Mexico); Sajo B, L., E-mail: ce_delgado89@hotmail.com [Universidad Simon Bolivar, Laboratorio de Fisica Nuclear, Apdo. 89000, 1080A Caracas (Venezuela, Bolivarian Republic of)

    2015-10-15

    Full text: One of the energy alternatives to fossil fuels which do not produce greenhouse gases is the nuclear energy. One of the drawbacks of this alternative is the generation of radioactive wastes of long half-life and its relation to the generation of nuclear materials to produce weapons of mass destruction. An option to these drawbacks of nuclear energy is to use Thorium as part of the nuclear fuel which it becomes in U{sup 233} when capturing neutrons, that is a fissile material. In this paper Monte Carlo methods were used to design a homogeneous subcritical reactor based on thorium. As neutron reflector graphite was used. The reactor core is homogeneous and is formed of 70% light water as moderator, 12% of enriched uranium UO{sub 2}(NO{sub 3}){sub 4} and 18% of thorium Th(NO{sub 3}){sub 4} as fuel. To start the nuclear fission chain reaction an isotopic source of californium 252 was used with an intensity of 4.6 x 10{sup 7} s{sup -1}. In the design the value of the effective multiplication factor, whose value turned out k{sub eff} <1 was calculated. Also, the neutron spectra at different distances from the source and the total fluence were calculated, as well as the values of the ambient dose equivalent in the periphery of the reactor. (Author)

  7. Who Should Be at the Bedside 24/7: Doctors, Families, Nurses?

    Science.gov (United States)

    Gershengorn, Hayley B; Garland, Allan

    2016-02-01

    Critical illness does not keep to regular, daytime business hours; we must provide high-quality care and support for intensive care unit (ICU) patients 24 hours per day, 7 days per week. Whether this mandates the presence of similar numbers and types of personnel throughout all hours of the day, however, has been the subject of much debate and substantial research. In this article, we review the available literature on the consequences of having three groups of care providers at a patient's bedside overnight: physicians, visitors, and nurses. Though few of the studies on this topic are randomized and prospective, several themes have emerged from the existing data. First, there is dramatic variation in practice between and within countries. Second, the weight of evidence does not indicate that patient outcomes are improved by having an intensivist present overnight in ICUs that are staffed by intensivists during the daytime hours. Third, although visitation is highly restricted in many ICUs-out of concerns for disruption of care and a negative physiological or psychological impact on patients-the available data suggest that patients and their families generally benefit from open visitation policies. And finally, although there is little debate that nurses are (and should be) available in the ICU 24/7, existing data do not provide much of a consensus about the details. Uncertainties include whether outcomes are better when each nurse is assigned only one patient (or, more generally, the optimal patient:nurse ratio), who these nurses should be (e.g., registered nurses vs. other personnel), and what their roles should entail (e.g., managing ventilators). As such, we cannot yet identify the optimal overnight nurse staffing strategy. What is clear is that the critical care community needs more and better data to further define these aspects of the relationship between ICU structure and ICU outcomes. PMID:26820278

  8. LCF- and LCF/HCF-behaviour of the superalloy MAR-M247LC

    Energy Technology Data Exchange (ETDEWEB)

    Gelmedin, Domnin; Lang, Karl-Heinz [Karlsruhe Institute of Technology (KIT), Karlsruhe (Germany). Inst. fuer Werkstoffkunde I

    2010-07-01

    The fatigue behaviour of the Nickel-base superalloy Mar-M247LC was investigated at 650 C in air environment under total strain control. Pure low cycle fatigue (LCF) loading, pure high cycle fatigue (HCF) loading and superimposed LCF/HCF loading were realised. In LCF tests with a strain ratio of zero and a hold time of 60 seconds the cyclic deformation and the lifetime behaviour was investigated. The dependence of the fatigue limit on the mean strain was estimated in HCF tests at a frequency of 60 Hz using an ultimate number of cycles of ten million. Finally the influence of superimposed HCF and LCF loadings was examined. At high total strain ranges of the HCF loading the lifetime of the superalloy as reduced about more than one magnitude compared to the lifetime under pure LCF loading. With decreasing HCF loadings the reduction of the lifetime decreases. This life time reduction can be explained by the interaction of the LCF and the superimposed HCF loading. Crack initiation and first crack propagation is predominantly induced by the LCF loading. After reaching an adequate long fatigue crack length the superimposed HCF loading contributes considerably to the crack growth. This contribution can be determined evaluating the distance between the LCF marking lines which form on the fracture surface. The higher the superimposed HCF loading was the longer the distance between the LCF marking lines and the lower the crack length were when first LCF marking lines could be recognized. On the basis of this cognition the life time under superimposed LCF/HCF loading was modelled using a model basing on fracture mechanics. (orig.)

  9. Construction of recombinants between molecular clones of murine retrovirus MCF 247 and Akv: determinant of an in vitro host range property that maps in the long terminal repeat.

    OpenAIRE

    Holland, C A; Wozney, J; Chatis, P A; Hopkins, N.; Hartley, J W

    1985-01-01

    The leukemogenic mink cell focus-forming (MCF) retroviruses such as MCF 247 have biological properties distinct from those of their ecotropic progenitors. Nucleotide sequences encoding portions of gp70, Prp15E, and the long terminal repeat differ between the two types of viruses. To investigate the role of each of these genetic elements in determining the biological properties of MCF viruses, we prepared infectious molecular clones of MCF 247 and generated a set of recombinants between these ...

  10. 24/7 Solar Minimum Polar Cap and Auroral Ion Temperature Observations

    Science.gov (United States)

    Sojka, Jan J.; Nicolls, Michael; van Eyken, Anthony; Heinselman, Craig; Bilitza, Dieter

    2011-01-01

    During the International Polar Year (IPY) two Incoherent Scatter Radars (ISRs) achieved close to 24/7 continuous observations. This presentation describes their data sets and specifically how they can provide the International Reference Ionosphere (IRI) a fiduciary E- and F-region ionosphere description for solar minimum conditions in both the auroral and polar cap regions. The ionospheric description being electron density, ion temperature and electron temperature profiles from as low as 90 km extending to several scale heights above the F-layer peak. The auroral location is Poker Flat in Alaska at 65.1 N latitude, 212.5 E longitude where the NSF s new Poker Flat Incoherent Scatter Radar (PFISR) is located. This location during solar minimum conditions is in the auroral region for most of the day but is at midlatitudes, equator ward of the cusp, for about 4-8 h per day dependent upon geomagnetic activity. In contrast the polar location is Svalbard, at 78.2 N latitude, 16.0 E longitude where the EISCAT Svalbard Radar (ESR) is located. For most of the day the ESR is in the Northern Polar Cap with a noon sector passage often through the dayside cusp. Of unique relevance to IRI is that these extended observations have enabled the ionospheric morphology to be distinguished between quiet and disturbed geomagnetic conditions. During the IPY year, 1 March 2007 - 29 February 2008, about 50 solar wind Corotating Interaction Regions (CIRs) impacted geospace. Each CIR has a two to five day geomagnetic disturbance that is observed in the ESR and PFISR observations. Hence, this data set also enables the quiet-background ionospheric climatology to be established as a function of season and local time. These two separate climatologies for the ion temperature at an altitude of 300 km are presented and compared with IRI ion temperatures. The IRI ion temperatures are about 200-300 K hotter than the observed values. However, the MSIS neutral temperature at 300 km compares favorably

  11. Curium-245 and curium-247 neutron cross sections between 10 keV and 10 MeV

    International Nuclear Information System (INIS)

    The optical model code 2PLUS and the statistical model codes COMNUC and CASCADE were used to compute neutron cross sections for Cm-245 and Cm-247 between 10 keV and 10 MeV. Cross sections for elastic and inelastic scattering, radiative capture, fission, and the (n,2n) reactions were computed. The parameters for the fission model were selected to yield agreement with the cross sections from the Physics-8 bomb shot. Pu-239 cross sections were calculated and compared with existing cross section evaluations to demonstrate the validity of the calculational methods

  12. A Luminous X-Ray Flare from the Nucleus of the Dormant Bulgeless Spiral Galaxy NGC 247

    OpenAIRE

    FENG, HUA; Ho, Luis C.; Kaaret, Philip; Tao, Lian; Yamaoka, Kazutaka; Zhang, Shuo; Grisé, Fabien

    2015-01-01

    NGC 247 is a nearby late-type bulgeless spiral galaxy that contains an inactive nucleus. We report a serendipitous discovery of an X-ray flare from the galaxy center with a luminosity of up to 2 x 10^(39) erg s^(−1) in the 0.3–10 keV band with XMM-Newton. A Chandra observation confirms that the new X-ray source is spatially coincident with the galaxy nucleus. The XMM-Newton data revealed a hard power-law spectrum with a spectral break near 3–4 keV, no pulsations on timescales longer than 150 ...

  13. Clinical analysis of laparoscopic cholecystectomy with improved trocar position in 247 cases%改良戳卡位置腹腔镜胆囊切除术247例临床分析

    Institute of Scientific and Technical Information of China (English)

    范智峰

    2015-01-01

    目的:探讨改良戳卡位置腹腔镜胆囊切除术的临床效果.方法:收治胆囊疾病患者247例,采用改良戳卡位置腹腔镜胆囊切除术治疗,观察治疗效果.结果:所有患者均顺利完成手术,术后恢复迅速,无严重并发症.结论:改良戳卡位置腹腔镜胆囊切除术的临床效果显著.%Objective:To explore the clinical effect of laparoscopic cholecystectomy with improved trocar position trocar.Methods:247 patients with gallbladder disease were selected.They were treated by laparoscopic cholecystectomy with improved trocar position.We observed the effect of treatment.Results:The operation of all patients were successfully completed.The postoperative recovery was rapid.There was no serious complications.Conclusion:The clinical effect of laparoscopic cholecystectomy with improved trocar position trocar was significant.

  14. Vibrational spectra, theoretical calculations, and two-dimensional potential energy surface for the ring-puckering vibrations of 2,4,7-trioxa[3.3.0]octane.

    Science.gov (United States)

    Chun, Hye Jin; Meinander, Niklas; Villarreal, John R; Laane, Jaan

    2015-01-15

    2,4,7-Trioxa[3.3.0]octane (247TOO) is an unusual bicyclic molecule which can exist in four different conformational forms which are determined by the directions of the two ring- puckering motions. The vibrational assignments of 247TOO have been made based on its infrared and Raman spectra and theoretical density functional theory (DFT) calculations. The two ring-puckering motions (in-phase and out-of-phase) were observed in the Raman spectra of the liquid at 249 and 205 cm(-1) and these values correspond well to the DFT values of 247 and 198 cm(-1). Ab initio calculations were utilized to calculate the structures and conformational energies for the four energy minima and the barriers to interconversion and the data was utilized to generate a two-dimensional potential energy surface (PES) for the two ring-puckering motions. The resulting quantum state energies for this PES were then calculated in order to better understand the patterns that are produced when the PES has four energy minima at different energy values. The wave functions corresponding to the different quantum states were also calculated. The NMR spectrum of 247TOO showed the presence of the two lowest energy conformations, consistent with the results of the ab initio calculations. PMID:25514365

  15. Spatially conserved regulatory elements identified within human and mouse Cd247 gene using high-throughput sequencing data from the ENCODE project

    DEFF Research Database (Denmark)

    Pundhir, Sachin; Hannibal, Tine Dahlbæk; Bang-Berthelsen, Claus Heiner;

    2014-01-01

    The Cd247 gene encodes for a transmembrane protein important for the expression and assembly of TCR/CD3 complex on the surface of T lymphocytes. Down-regulation of CD247 has functional consequences in systemic autoimmunity and has been shown to be associated with Type 1 Diabetes in NOD mouse....... In this study, we have utilized the wealth of high-throughput sequencing data produced during the Encyclopedia of DNA Elements (ENCODE) project to identify spatially conserved regulatory elements within the Cd247 gene from human and mouse. We show the presence of two transcription factor binding sites...... from the GENCODE project in human and our expression quantification analysis performed in NOD and B6 mice using qRT-PCR. Furthermore, 17 of the 23 SNPs already known to be implicated with T1D were observed within the long non-coding RNA region in mouse. The spatially conserved regulatory elements...

  16. Fission cross section measurements of Cm-247, Cf-250 and Es-254 from 0.1 eV to 80 keV

    International Nuclear Information System (INIS)

    Fission cross section measurements were made with the RINS system over the neutron energy range from approximately 0.1 eV to 80 keV upon samples of Cm-247, Cf-250 and Es-254. The Cm-247 measurement was undertaken to complete the RINS fission cross section measurement sequence of the curium isotopes, Es-254 was measured because it is a very heavy odd-odd nucleus which might show interesting nuclear structure effects in its fission cross section, and Cf-250 was measured to account for its buildup as a daughter product from the 276-day halflife Es-254. 6 refs., 3 figs

  17. TREATMENT OF 247 CASES OF PROLAPSE OF LUMBAR INTERVERTEBRAL DISC WITH COMPREHENSIVE PLUM-BLOSSOM MAGNETIC NEEDLE THERAPY

    Institute of Scientific and Technical Information of China (English)

    张保平; 周日清; 周登芳

    2004-01-01

    Objective: To observe the therapeutic effect of comprehensive plum-blossom magnetic needle therapy on prolapse of lumbar intervertebral disc. Methods: 247 cases of prolapse of lumbar intervertebral disc were treated first with manual treatment and then with plum-blossom magnetic needle therapy and effect-increasing pad therapy at specified points and reactive points. Results: After treatment for 2 therapeutic courses,153 cases were cured accounting for 61.94%, 71 cases were markedly effective accounting for 28.75%, 22 cases were improved accounting for8.91% and the rest one failed,accounting for 0.45%. Conclusion: The comprehensive plum-blossom magnetic needle therapy has a better therapeutic effect on prolapse of lumbar intervertebral disc.

  18. Effect of Process Variables on the Inertia Friction Welding of Superalloys LSHR and Mar-M247

    Science.gov (United States)

    Mahaffey, D. W.; Senkov, O. N.; Shivpuri, R.; Semiatin, S. L.

    2016-06-01

    The effect of inertia friction welding process parameters on microstructure evolution, weld plane quality, and the tensile behavior of welds between dissimilar nickel-base superalloys was established. For this purpose, the fine-grain, powder metallurgy alloy LSHR was joined to coarse-grain cast Mar-M247 using a fixed level of initial kinetic energy, but different combinations of the flywheel moment of inertia and initial rotation speed. It was found that welds made with the largest moment of inertia resulted in a sound bond with the best microstructure and room-temperature tensile strength equal to or greater than that of the parent materials. A relationship between the moment of inertia and weld process efficiency was established. The post-weld tensile behavior was interpreted in the context of observed microstructure gradients and weld-line defects.

  19. Effect of Process Variables on the Inertia Friction Welding of Superalloys LSHR and Mar-M247

    Science.gov (United States)

    Mahaffey, D. W.; Senkov, O. N.; Shivpuri, R.; Semiatin, S. L.

    2016-08-01

    The effect of inertia friction welding process parameters on microstructure evolution, weld plane quality, and the tensile behavior of welds between dissimilar nickel-base superalloys was established. For this purpose, the fine-grain, powder metallurgy alloy LSHR was joined to coarse-grain cast Mar-M247 using a fixed level of initial kinetic energy, but different combinations of the flywheel moment of inertia and initial rotation speed. It was found that welds made with the largest moment of inertia resulted in a sound bond with the best microstructure and room-temperature tensile strength equal to or greater than that of the parent materials. A relationship between the moment of inertia and weld process efficiency was established. The post-weld tensile behavior was interpreted in the context of observed microstructure gradients and weld-line defects.

  20. Failure behaviour of the superalloy MAR-M247 LC under LCF, HCF and combined LCF/HCF loading

    Energy Technology Data Exchange (ETDEWEB)

    Gelmedin, Domnin; Lang, Karl-Heinz [Karlsruher Institut fuer Technologie (KIT), Karlsruhe (DE). Inst. fuer Angewandte Materialien (IAM-WK)

    2012-01-15

    Materials for turbine blades experience in service a combined loading of low and high cycle fatigue at high temperatures. In order to understand the failure behaviour under these loading conditions, systematic investigations were carried out. Low cycle fatigue, high cycle fatigue and combined low and high cycle fatigue tests were realised on MAR-M247 LC at 650 C in an air environment under total strain control. Surface damage and fracture surfaces were analysed. Under combined low and high cycle fatigue, the lifetime is reduced if the low cycle fatigue leads to a degradation of the high cycle fatigue strength caused by crack initiation and crack growth. By analysing the fracture surface, the crack growth rate under combined cycle fatigue loading could be determined and it was significantly higher than under pure low cycle fatigue loading. The accelerated crack growth mainly causes the lifetime reduction. (orig.)

  1. A Gene Encoding a DUF247 Domain Protein Cosegregates with the S Self-Incompatibility Locus in Perennial Ryegrass

    DEFF Research Database (Denmark)

    Manzanares, Chloe; Barth, Susanne; Thorogood, Daniel;

    2016-01-01

    genes cosegregating with the S-locus, a highly polymorphic gene encoding for a protein containing a DUF247 was fully predictive of known S-locus genotypes at the amino acid level in the seven mapping populations. Strikingly, this gene showed a frameshift mutation in self-compatible darnel (Lolium...

  2. Expression of the benign HEXA mutations, Arg247Trp and Arg249Trp, associated with beta-hexosaminidase A pseudodeficiency

    Energy Technology Data Exchange (ETDEWEB)

    Cao, Z.; Petroulakis, E.; Salo, T. [Univ. of Manitoba (Canada)] [and others

    1994-09-01

    {beta}-Hexosaminidase (Hex A) is a heterodimer of {alpha} and {beta} subunits encoded by the HEXA and HEXB genes, respectively. Mutations in the HEXA gene typically cause Tay-Sachs disease or less severe forms of G{sub M2} gangliosidosis. However, two benign mutations (Arg247Trp and Arg249Trp) in the {alpha}-subunit of Hex A account for Hex A deficiency in {approximately}36% of non-Jewish enzyme-defined Tay-Sachs disease carriers. These mutations do not result in any apparent clinical phenotype in individuals who are genetic compounds with a second disease-causing mutation. We expressed the {alpha}-subunit harboring each of the benign mutations separately to study activity toward the synthetic substrate, 4-MUGS, for comparison to activity from enzymes containing mutations associated with other forms of G{sub M2} gangliosidosis. The C739T (Arg247Trp;benign), C745T (Arg 249Trp; benign), G805A (Gly269Ser; adult-onset), G749A (Gly250Asp; juvenile), and C508T (Arg170Trp; infantile) mutations were introduced into the {alpha}-subunit cDNA. These were transfected alone, or with the {beta}-subunit cDNA, to generate Hex S ({alpha}{alpha}) or Hex A ({alpha}{beta}), respectively. The activities were monitored using 4-MUGS, and the levels of {alpha}-subunit protein were assessed by Western blotting. Repeated experiments show that the benign mutations produce approximately 35% of normal Hex S and 40% of normal Hex A activity. This level is much higher than that of Hex A harbouring the Gly169Ser adult-onset mutation (12%). A sequential decrease in expressed Hex A activity is observed as mutations associated with more severe phenotypes are expressed. The benign mutations also result in lower levels of mature {alpha}-subunit protein compared to normal, and slightly reduced levels of {alpha}-subunit precursor protein. The Hex A deficiency resulting from benign mutations is not as great as that associated with disease-causing mutations.

  3. Effects of the Hot Isostatic Pressing Process on Crack Healing of the Laser Repair-Welded CM247LC Superalloy

    Directory of Open Access Journals (Sweden)

    Keng-Tu Hsu

    2016-10-01

    Full Text Available This study investigated the effects of the hot isostatic pressing process on the crack healing, microstructure, and mechanical properties of the laser repair-welded CM247LC precipitation-hardened superalloy. To ensure the strength of the repair-welded area, this study used the direct re-melting approach, and simulated the repair welding with the filler addition, which has a chemical composition matching that of the base superalloy. As expected, different types of cracks, including the solidification crack in the weld fusion zone and various types of liquidation cracks in the heat-affected zone, were observed. Through a proper hot isostatic pressing healing process, all cracks in the weld fusion zone and the heat-affected zone of the repair-welded pieces were healed. At the same time, some nano- and micro-sized carbides tended to form discontinuously along the healed crack trace. A micro-hardness test was conducted in the repair-welded area, and the results were similar to that of the as-cast material.

  4. A massive, distant proto-cluster at z=2.47 caught in a phase of rapid formation?

    CERN Document Server

    Casey, C M; Capak, P; Fu, H; Kovac, K; Lilly, S; Sanders, D B; Scoville, N Z; Treister, E

    2015-01-01

    Numerical simulations of cosmological structure formation show that the Universe's most massive clusters, and the galaxies living in those clusters, assemble rapidly at early times (2.5 2 based on associations of 5-40 galaxies around rare sources, the observational evidence for rapid cluster formation is weak. Here we report observations of an asymmetric, filamentary structure at z = 2.47 containing seven starbursting, submillimeter-luminous galaxies and five additional AGN within a volume of 4000 Mpc$^{3}$. As the expected lifetime of both the luminous AGN and starburst phase of a galaxy is ~100 Myr, we conclude that these sources were likely triggered in rapid succession by environmental factors, or, alternatively, the duration of these cosmologically rare phenomena is much longer than prior direct measurements suggest. The stellar mass already built up in the structure is $\\sim10^{12}M_{\\odot}$ and we estimate that the cluster mass will exceed that of the Coma supercluster at $z \\sim 0$. The filamentary s...

  5. Alfa247®: Un modelo de aprendizaje diferenciado para la enseñanza del Nordic Walking

    Directory of Open Access Journals (Sweden)

    Rodolfo Iván Martínez Lemos

    2010-03-01

    Full Text Available La técnica alfa y el método de los 7 pasos constituyen un modelo de aprendizaje diferenciado para la enseñanza del Nordic Walking (NW. NW consiste en caminar con bastones especialmente diseñados y utilizando una técnica precisa que moviliza una gran parte de la masa muscular total y tiene efectos beneficiosos probados sobre la salud. Alfa247® hace posible que cualquier persona, con independencia de su nivel de habilidad o condición física, pueda familiarizarse y aprender la técnica de caminar con bastones. Este nuevo concepto de movimiento saludable está todavía dando sus primeros pasos en España y es probable que en un futuro próximo pueda jugar un papel importante dentro del currículo de la Educación Física Escolar, como ya ha hecho en otros países del entorno.

  6. Towards low-friction and wear-resistant plasma sintering dies via plasma surface co-alloying CM247 nickel alloy with V/Ag and N

    Directory of Open Access Journals (Sweden)

    Zhang Zhenxue

    2015-01-01

    Full Text Available Nickel based superalloys have good oxidation and creep resistance and hence they can function under high mechanical stress and high temperatures. However, their undesirable tribological behaviour is the major technical barrier to the challenging high-temperature, lubricant-free plasma sintering tool application. In this study, nickel based CM247 superalloy surfaces were co-alloyed using innovative active screen plasma technology with both interstitial element (e.g. N and substitutional alloying elements (e.g. V and Ag to provide a synergy effect to enhance its tribological properties. The tribological behaviour of the plasma co-alloyed CM247 superalloy surfaces were fully evaluated using reciprocal and pin-on-disc tribometers at temperatures from room temperature to 600 ∘C. The experimental results demonstrate that the co-alloyed surface with N, Ag and V can effectively lower the friction coefficient, which is expected to help demoulding during lubricant-free plasma sintering.

  7. SIA:6月全球芯片销售额247亿美元同比降0.4%

    Institute of Scientific and Technical Information of China (English)

    2011-01-01

    美国半导体行业协会(SIA)发布的最新数据显示,今年6月全球芯片销售额达到247亿美元。比5月份的250亿美元减少1.2%,然而却较去年同期下降0.4%。

  8. HPLC MS/MS method for quantification of meprobamate in human plasma: application to 24/7 clinical toxicology.

    Science.gov (United States)

    Delavenne, Xavier; Gay-Montchamp, Jean Pierre; Basset, Thierry

    2011-01-15

    We described the development and full validation of rapid and accurate liquid chromatography method, coupled with tandem mass spectrometry detection, for quantification of meprobamate in human plasma with [(13)C-(2)H(3)]-meprobamate as internal standard. Plasma pretreatment involved a one-step protein precipitation with acetonitrile. Separation was performed by reversed-phase chromatography on a Luna MercuryMS C18 (20 mm×4 mm×3 μm) column using a gradient elution mode. The mobile phase was a mix of distilled water containing 0.1% formic acid and acetonitrile containing 0.1% formic acid. The selected reaction monitoring transitions, in electrospray positive ionization, used for quantification were 219.2→158.2 m/z and 223.1→161.1m/z for meprobamate and internal standard, respectively. Qualification transitions were 219.2→97.0 and 223.1→101.1 m/z for meprobamate and internal standard, respectively. The method was linear over the concentration range of 1-300 mg/L. The intra- and inter-day precision values were below 6.4% and accuracy was within 95.3% and 103.6% for all QC levels (5, 75 and 200 mg/L). The lower limit of quantification was 1 mg/L. Total analysis time was reduced to 6 min including sample preparation. The present method is successfully applied to 24/7 clinical toxicology and demonstrated its usefulness to detect meprobamate poisoning. PMID:21185792

  9. Clinical analysis of 247 children with whooping cough and the risk factors of severe cases%儿童百日咳247例临床特点及重症百日咳危险因素分析

    Institute of Scientific and Technical Information of China (English)

    胡云鸽; 刘泉波

    2015-01-01

    Objective To summarize the clinical characteristics of whooping cough in children and analyze the risk factors for severe whooping cough.Method A retrospective analysis was made on the clinical data of 247 children with whooping cough in Children's Hospital of Chongqing Medical University between Jan 2013 and Dec 2014.Of these patients,126 were male,121 were female,the median age was 3.1 months (23 days-4 years and eight months old).The patients were divided into two groups,group 1 had infants less than 3 months of age (n =120) and group 2 had infants and young children older than 3 months (n =127) according to their age.On the other hand,the patients were also divided into two groups according to vaccination status:vaccinated group (received diphtheria toxoid,tetanus toxoid,and acellular pertussis,DTP) (n =31) and unvaccinated group (n =188).Pure Bordetella pertussis infection was seen in 106 cases,and 141 cases had mixed infection.Severe disease was seen in 13 cases,and the other 234 cases had the modest disease.Clinical data were retrospectively analyzed and compared.Result (1) Bordetella pertussis was identified in 57/680 cases (8.4%) in 2013,and 190/1 856 cases (10.2%) in 2014.The disease could be seen throughout the year,but 182 cases (73.7%) occurred in summer or autumn;202 cases (81.8%) were less than 6 months.(2) Paroxysmal cough was seen in 238 cases (96.4%),61 cases (24.7%) had inspiratory whoop.Infants in group 1 often had episodes of cyanosis,apnea and suffocation (x2 =19.999,12.081,6.508,P < 0.05),persistent cough was often seen in group 2 (x2 =9.885,P < 0.05).Complications such as severe pneumonia,pulmonary consolidation and encephalopathy were more common in the group 1 than in group 2 (x2 =17.340,6.080,11.030,23.545,P < 0.05).(3) The length of stay of group 1,and of unvaccinated group was significantly longer than that of group 2 and of vaccinated group (t =19.331,26.741,P < 0.05).(4) Leukocytosis was found in 224 cases (90.7

  10. The multifaceted effects of agmatine on functional recovery after spinal cord injury through Modulations of BMP-2/4/7 expressions in neurons and glial cells.

    Directory of Open Access Journals (Sweden)

    Yu Mi Park

    Full Text Available Presently, few treatments for spinal cord injury (SCI are available and none have facilitated neural regeneration and/or significant functional improvement. Agmatine (Agm, a guanidinium compound formed from decarboxylation of L-arginine by arginine decarboxylase, is a neurotransmitter/neuromodulator and been reported to exert neuroprotective effects in central nervous system injury models including SCI. The purpose of this study was to demonstrate the multifaceted effects of Agm on functional recovery and remyelinating events following SCI. Compression SCI in mice was produced by placing a 15 g/mm(2 weight for 1 min at thoracic vertebra (Th 9 segment. Mice that received an intraperitoneal (i.p. injection of Agm (100 mg/kg/day within 1 hour after SCI until 35 days showed improvement in locomotor recovery and bladder function. Emphasis was made on the analysis of remyelination events, neuronal cell preservation and ablation of glial scar area following SCI. Agm treatment significantly inhibited the demyelination events, neuronal loss and glial scar around the lesion site. In light of recent findings that expressions of bone morphogenetic proteins (BMPs are modulated in the neuronal and glial cell population after SCI, we hypothesized whether Agm could modulate BMP- 2/4/7 expressions in neurons, astrocytes, oligodendrocytes and play key role in promoting the neuronal and glial cell survival in the injured spinal cord. The results from computer assisted stereological toolbox analysis (CAST demonstrate that Agm treatment dramatically increased BMP- 2/7 expressions in neurons and oligodendrocytes. On the other hand, BMP- 4 expressions were significantly decreased in astrocytes and oligodendrocytes around the lesion site. Together, our results reveal that Agm treatment improved neurological and histological outcomes, induced oligodendrogenesis, protected neurons, and decreased glial scar formation through modulating the BMP- 2/4/7 expressions following

  11. Nature of the soft ULX in NGC 247: super-Eddington outflow and transition between the supersoft and soft ultraluminous regimes

    CERN Document Server

    Feng, Hua; Kaaret, Philip; Grise, Fabien

    2016-01-01

    We report on XMM-Newton/Chandra/Swift/HST observations of the ultraluminous X-ray source (ULX) in NGC 247, which is found to make transitions between the supersoft ultraluminous (SSUL) regime with a spectrum dominated by a cool ($\\sim 0.1$ keV) blackbody component and the soft ultraluminous (SUL) regime with comparable luminosities shared by the blackbody and power-law components. Multi-epoch observations revealed an anti-correlation between the blackbody radius and temperature, $R_{\\rm bb} \\propto T_{\\rm bb}^{-2.8 \\pm 0.3}$, ruling out a standard accretion disk as the origin of the soft X-ray emission. The soft X-ray emission is much more variable on both short and long timescales in the SSUL regime than in the SUL regime. We suggest that the SSUL regime may be an extension of the ultraluminous state toward the high accretion end, being an extreme case of the SUL regime, with the blackbody emission arising from the photosphere of thick outflows and the hard X-rays being emission leaked from the embedded accr...

  12. Spectroscopy and single-particle structure of the odd- Z heavy elements {sup 255}Lr, {sup 251}Md and {sup 247}Es

    Energy Technology Data Exchange (ETDEWEB)

    Chatillon, A.; Theisen, C.; Bouchez, E.; Clement, E.; Dayras, R.; Goergen, A.; Korten, W.; Le Coz, Y.; Simenel, C.; Bender, M. [CEA Saclay, DSM/DAPNIA/SPhN, Gif-sur-Yvette Cedex (France); Greenlees, P.T.; Eeckhaudt, S.; Grahn, T.; Jones, P.; Julin, R.; Juutinen, S.; Kettunen, H.; Leino, M.; Perkowski, J.; Rahkila, P.; Saren, J.; Scholey, C.; Uusitalo, J. [University of Jyvaeskylae, Department of Physics, P.O. Box 35 (Finland); Auger, G.; Bouriquet, B.; Casandjian, J.M.; Cee, R.; France, G. de; Toureil, R. de; Rejmund, M.; Saint-Laurent, M.G.; Stodel, C.; Villari, A. [GANIL, Boulevard Henri Becquerel, B.P. 55027, Caen Cedex 5 (France); Bastin, J.E.; Herzberg, R.D.; Ikin, P.J.C.; Jones, G.D.; Pritchard, A. [University of Liverpool, Oliver Lodge Laboratory, Department of Physics, Liverpool (United Kingdom); Grevy, S. [LPC, CAEN Cedex (France); Hauschild, K.; Korichi, A.; Lopez-Martens, A.; Siem, S. [CSNSM, Orsay (France); Lukyanov, S.M.; Penionzhkevich, Yu.E.; Sobolev, Yu.G. [Joint Institute for Nuclear Research, Dubna (Russian Federation); Bonche, P. [CEA Saclay, DSM/SPhT, Gif-sur-Yvette Cedex (France)

    2006-11-15

    The odd-Z isotope {sup 255}Lr, its daughter {sup 251}Md and grand-daughter {sup 247}Es were studied in two experiments performed at GANIL and the University of Jyvaeskylae. The {sup 255}Lr nuclei were produced using the cold fusion-evaporation reaction {sup 209}Bi({sup 48}Ca, 2n){sup 255}Lr at a bombarding energy of 217MeV. The single-particle structure and decay properties were investigated using {alpha}, {gamma} and electron spectroscopy. The ground-state spin and parity could be assigned for {sup 255}Lr (1/2{sup -}) and {sup 251}Md (7/2{sup -}). States corresponding to the 7/2{sup +}[633], 7/2{sup -}[514] and 1/2{sup -}[521] Nilsson orbitals were observed. Results are compared to experimental data obtained in neighbouring isotopes and to Hartree-Fock-Bogoliubov calculations using the Skyrme interaction SLy4 and a density-dependent pairing interaction. The position of the 1/2{sup -}[521] orbital from the spherical 2f{sub 5/2} shell is discussed. (orig.)

  13. Assessment of the influence of interdendritic shrinkage cavities on the thermo-mechanical fatigue behaviour of the nickel-base superalloy MAR-M247LC

    Energy Technology Data Exchange (ETDEWEB)

    Beck, M.; Lang, K.H.; Loehe, D. [Inst. fuer Werkstoffkunde 1, Univ. Karlsruhe (TH), Karlsruhe (Germany)

    2002-07-01

    Precision cast high-temperature components often contain specific imperfections like micropores or microcavities. The influence of the position, size and distribution of such micro cavities as well as of the parameters of the thermomechanical fatigue loading on the lifetime behaviour of the superalloy MAR-M247LC was investigated using two specimen series, containing a high and a low amount of microcavities and a state from which any microcavity was removed by hot isostatic pressing. Thermo-mechanical fatigue (TMF) tests with zero (''in phase'') and -135 phase shift between temperature and mechanical strain were performed. The different damage behaviour at in-phase and -135 TMF requires different methods of the assessment of microcavities. For the in-phase loading, they are regarded as cracks and their effect on the local strain distribution is determined by the crack opening displacement. This leads to very good results for both specimen states investigated. For the -135 cycle, it is taken into account that the microcavities in the core of the specimens increase the loading in the microcavity-free shell of the specimen. This method corresponds closely to the effective damage mechanism and yields good results for both microcavity contents investigated. (orig.)

  14. Structural Benchmark Creep Testing for Microcast MarM-247 Advanced Stirling Convertor E2 Heater Head Test Article SN18

    Science.gov (United States)

    Krause, David L.; Brewer, Ethan J.; Pawlik, Ralph

    2013-01-01

    This report provides test methodology details and qualitative results for the first structural benchmark creep test of an Advanced Stirling Convertor (ASC) heater head of ASC-E2 design heritage. The test article was recovered from a flight-like Microcast MarM-247 heater head specimen previously used in helium permeability testing. The test article was utilized for benchmark creep test rig preparation, wall thickness and diametral laser scan hardware metrological developments, and induction heater custom coil experiments. In addition, a benchmark creep test was performed, terminated after one week when through-thickness cracks propagated at thermocouple weld locations. Following this, it was used to develop a unique temperature measurement methodology using contact thermocouples, thereby enabling future benchmark testing to be performed without the use of conventional welded thermocouples, proven problematic for the alloy. This report includes an overview of heater head structural benchmark creep testing, the origin of this particular test article, test configuration developments accomplished using the test article, creep predictions for its benchmark creep test, qualitative structural benchmark creep test results, and a short summary.

  15. Identification of gamma-ray emission from BZB J1450+5201: the most distant gamma-ray BL Lacertae object at z=2.47

    CERN Document Server

    Liao, N H; Liu, H T; Jiang, Ning; Yuan, Z L; Chen, Liang

    2013-01-01

    $\\gamma$-ray BL Lacertae objects (BL Lacs) with high redshifts ($z\\geq2$) are rarely detected. We report on an analysis of \\fermi data from five-year observation of 2FGL J1451.0+5159 whose $\\gamma$-ray emission is doubtful in the second \\fermi catalog (2FGL). It is detected at a higher energy, 3-10 GeV, with 6.7$\\sigma$ from our analysis than at 1-3 GeV from the 2FGL. The $\\gamma$-ray emission of the source is identified to be valid. Association presented in the 2FGL, between 2FGL J1451.0+5159 and BZB J1450+5201 whose redshift is suggested as 2.47, has been confirmed. BZB J1450+5201 appears to be the most distant $\\gamma$-ray BL Lac discovered to date. Multi-wavelength data from radio to $\\gamma$-ray energies are analyzed, indicating that this intermediate synchrotron peaked (ISP) source seems to be no difference from other ISP sources at lower redshifts in the second LAT AGN catalog. The pure SSC model is likely ruled out due to the extreme value of Doppler factor. Scattering of weak external emission plus S...

  16. Hydra—The National Earthquake Information Center’s 24/7 seismic monitoring, analysis, catalog production, quality analysis, and special studies tool suite

    Science.gov (United States)

    Patton, John M.; Guy, Michelle R.; Benz, Harley M.; Buland, Raymond P.; Erickson, Brian K.; Kragness, David S.

    2016-08-18

    This report provides an overview of the capabilities and design of Hydra, the global seismic monitoring and analysis system used for earthquake response and catalog production at the U.S. Geological Survey National Earthquake Information Center (NEIC). Hydra supports the NEIC’s worldwide earthquake monitoring mission in areas such as seismic event detection, seismic data insertion and storage, seismic data processing and analysis, and seismic data output.The Hydra system automatically identifies seismic phase arrival times and detects the occurrence of earthquakes in near-real time. The system integrates and inserts parametric and waveform seismic data into discrete events in a database for analysis. Hydra computes seismic event parameters, including locations, multiple magnitudes, moment tensors, and depth estimates. Hydra supports the NEIC’s 24/7 analyst staff with a suite of seismic analysis graphical user interfaces.In addition to the NEIC’s monitoring needs, the system supports the processing of aftershock and temporary deployment data, and supports the NEIC’s quality assurance procedures. The Hydra system continues to be developed to expand its seismic analysis and monitoring capabilities.

  17. Biological, chemical and other data collected aboard the THOMAS G. THOMPSON during cruise TN247 in the Coastal Waters of SE Alaska, North Pacific Ocean and South Pacific Ocean from 2010-03-11 to 2010-04-27 (NODC Accession 0104408)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NODC accession 0104408 includes biological, chemical, optical, physical and underway data collected aboard the THOMAS G. THOMPSON during cruise TN247 in the Coastal...

  18. Survey of potential markets for devices using Californium-252

    International Nuclear Information System (INIS)

    Potential applications for devices or systems containing 252Cf in the years from 1975 to 1980 are estimated. The estimated number of devices and associated business value were derived from a survey of 46 industrial, educational and governmental organizations conducted from Jan. to May, 1975. Applications for devices and systems based on 252Cf are expected to increase by a factor of 7 in the 6-y period from 1975 to 1980. The annual business value of 252Cf devices should increase from 1.5 million dollars in 1975 to 10.8 million dollars in 1980. The potential European market should be several times as large as the US market, based on actual sales of 252Cf, which have been two to four times greater in Europe than in the US

  19. Automated absolute activation analysis with californium-252 sources

    Energy Technology Data Exchange (ETDEWEB)

    MacMurdo, K.W.; Bowman, W.W.

    1978-09-01

    A 100-mg /sup 252/Cf neutron activation analysis facility is used routinely at the Savannah River Laboratory for multielement analysis of many solid and liquid samples. An absolute analysis technique converts counting data directly to elemental concentration without the use of classical comparative standards and flux monitors. With the totally automated pneumatic sample transfer system, cyclic irradiation-decay-count regimes can be pre-selected for up to 40 samples, and samples can be analyzed with the facility unattended. An automatic data control system starts and stops a high-resolution gamma-ray spectrometer and/or a delayed-neutron detector; the system also stores data and controls output modes. Gamma ray data are reduced by three main programs in the IBM 360/195 computer: the 4096-channel spectrum and pertinent experimental timing, counting, and sample data are stored on magnetic tape; the spectrum is then reduced to a list of significant photopeak energies, integrated areas, and their associated statistical errors; and the third program assigns gamma ray photopeaks to the appropriate neutron activation product(s) by comparing photopeak energies to tabulated gamma ray energies. Photopeak areas are then converted to elemental concentration by using experimental timing and sample data, calculated elemental neutron capture rates, absolute detector efficiencies, and absolute spectroscopic decay data. Calculational procedures have been developed so that fissile material can be analyzed by cyclic neutron activation and delayed-neutron counting procedures. These calculations are based on a 6 half-life group model of delayed neutron emission; calculations include corrections for delayed neutron interference from /sup 17/O. Detection sensitivities of < or = 400 ppB for natural uranium and 8 ppB (< or = 0.5 (nCi/g)) for /sup 239/Pu were demonstrated with 15-g samples at a throughput of up to 140 per day. Over 40 elements can be detected at the sub-ppM level.

  20. Californium-252 neutron activation facility at the Savannah River Laboratory

    International Nuclear Information System (INIS)

    A neutron irradiation facility has been established to develop new analytical methods and for the support of research programs. A major component of this facility is a 252Cf source which provides both fission spectrum and thermal neutrons. (U.S.)

  1. Effects of MAR-M247 substrate (modified) composition on coating oxidation coating/substrate interdiffusion. M.S. Thesis. Final Report; [protective coatings for hot section components of gas turbine engines

    Science.gov (United States)

    Pilsner, B. H.

    1985-01-01

    The effects of gamma+gamma' Mar-M247 substrate composition on gamma+beta Ni-Cr-Al-Zr coating oxidation and coating/substrate interdiffusion were evaluated. These results were also compared to a prior study for a Ni-Cr-Al-Zr coated gamma Ni-Cr-Al substrate with equivalent Al and Cr atomic percentages. Cyclic oxidation behavior at 1130 C was investigated using change in weight curves. Concentration/distance profiles were measured for Al, Cr, Co, W, and Ta. The surface oxides were examined by X-ray diffraction and scanning electron microscopy. The results indicate that variations of Ta and C concentrations in the substrate do not affect oxidation resistance, while additions of grain boundary strengthening elements (Zr, Hf, B) increase oxidation resistance. In addition, the results indicate that oxidation phenomena in gamma+beta/gamma+gamma' Mar-M247 systems have similar characteristics to the l gamma+beta/gamma Ni-Cr-Al system.

  2. Microstructure and transformation behavior of Ni{sub 24.7}Ti{sub 50.3}Pd{sub 25} high temperature shape-memory alloy with Sc micro-addition

    Energy Technology Data Exchange (ETDEWEB)

    Ramaiah, K.V., E-mail: kvramaiah@nal.res.in [Materials Science Division, CSIR-National Aerospace Laboratories, Bangalore 560 017 (India); Saikrishna, C.N. [Materials Science Division, CSIR-National Aerospace Laboratories, Bangalore 560 017 (India); Gouthama [Department of Materials Science and Engineering, Indian Institute of Technology, Kanpur 208 016 (India); Bhaumik, S.K. [Materials Science Division, CSIR-National Aerospace Laboratories, Bangalore 560 017 (India)

    2015-08-15

    NiTiPd shape-memory alloys (SMAs) are potential functional materials for use as solid-state actuators in the temperature range 100–250 °C. The present study investigates the effect of 1.0 at.% Sc micro-addition to Ni{sub 24.7}Ti{sub 50.3}Pd{sub 25} alloy, Sc replacing either Ti or Ni. Results show that all the three alloys studied have stable transformation behavior on stress-free thermal cycling and hence, are suitable for cyclic actuation applications. However, the addition of Sc to NiTiPd alloy leads to decrease of transformation temperatures, the magnitude of decrease being greater for the alloy with Sc replacing Ni. The martensite finish (M{sub f}) temperature of 181 °C for the NiTiPd alloy decreased to 139 °C for Sc replacing Ti and 83 °C for Sc replacing Ni. Also, the indentation modulus of NiTiPdSc (Sc replacing Ni) alloy is found to be significantly low compared to the other alloys. Analysis indicates that the observed differences in the alloy properties are related to the solubility of Sc in the NiTiPd matrix. While the quaternary NiTiPdSc alloy, Sc replacing Ti, has a single phase microstructure, the alloy with Sc replacing Ni shows the presence of Sc-rich and TiPd-type second phases in the microstructure. TEM examination revealed that the TiPd-type phase has a distinct rod-like morphology (30–50 nm) arranged in a grid-like structure. The transformation and indentation behavior of the alloys is elucidated using thermodynamic calculations of frictional energy and an electronic structure based analysis. - Highlights: • TEM of Ni{sub 23.7}Ti{sub 50.3}Pd{sub 25}Sc{sub 1} showed distinct grid of TiPd-type phase nanorods < 50 nm. • Stress-free thermal cycling of all the three alloys showed stable transformation behavior. • Ni{sub 24.7}Ti{sub 49.3}Pd{sub 25}Sc{sub 1} and Ni{sub 23.7}Ti{sub 50.3}Pd{sub 25}Sc{sub 1} showed single and multiphase structures. • Sc micro-addition (1 at.%) to Ni{sub 24.7}Ti{sub 50.3}Pd{sub 25} alloy decreased TTs

  3. 肺结核患者抗结核药物治疗不良反应%The monitoring of adverse reaction in patients with pulmonary tuberculosis treated by anti-tuberculosis drugs (a report of 247cases)

    Institute of Scientific and Technical Information of China (English)

    曾安津; 董霞

    2012-01-01

    目的 探讨肺结核在抗结核药物治疗过程中发生的不良反应.方法 对247例行抗结核药物治疗的肺结核患者出现不良反应进行分类分析.结果 不良反应主要表现为肝肾功能损害,消化道症状和中枢神经症状等;年龄超过50岁者不良反应发生率明显高于年龄低于50岁者(P<0.05).结论 肺结核患者使用抗结核药治疗应加强督导和随访,定期复查肝肾功能,及时有效处理药物不良反应.%Objective To investigate the adverse reaction of patients with pulmonary tuberculosis during the processes of anti-tu berculosis drug treatment, and provide the evidence for the development of effective prevention and treatment measures. Method The ad verse reactions of 247 patients with pulmonary tuberculosis treated with anti-tuberculosis drug therapy were classified and statistical ana lyzed. Results The main adverse reactions were liver and kidney dysfunction, gastrointestinal symptoms and nervous symptoms. The in cidence of adverse reactions in patients over the age of 50 years was significantly higher than that of patients under the age of 50 years ( P < 0. 05 ). Conclusion The treatment of anti-tuberculosis drug in patients with pulmonary tuberculosis should be strengthened supervision and follow-up, reviewing the function of liver and kidney regularly, adverse and drug reactions should be treated timely and effective, par ticularly patients over the age of 50 years.

  4. Missense mutations in PBP2A Affecting ceftaroline susceptibility detected in epidemic hospital-acquired methicillin-resistant Staphylococcus aureus clonotypes ST228 and ST247 in Western Switzerland archived since 1998.

    Science.gov (United States)

    Kelley, William L; Jousselin, Ambre; Barras, Christine; Lelong, Emmanuelle; Renzoni, Adriana

    2015-04-01

    The development and maintenance of an arsenal of antibiotics is a major health care challenge. Ceftaroline is a new cephalosporin with activity against methicillin-resistant Staphylococcus aureus (MRSA); however, no reports concerning MRSA ceftaroline susceptibility have been reported in Switzerland. We tested the in vitro activity of ceftaroline against an archived set of 60 MRSA strains from the University Hospital of Geneva collected from 1994 to 2003. Our results surprisingly revealed ceftaroline-resistant strains (MIC, >1 μg/ml in 40/60 strains; EUCAST breakpoints, susceptible [S], ≤1 μg/ml; resistant [R], >1 μg/ml) were present from 1998 to 2003. The detected resistant strains predominantly belonged to sequence type 228 (ST228) (South German clonotype) but also to ST247 (Iberian clonotype). A sequence analysis of these strains revealed missense mutations in the penicillin-binding protein 2A (PBP2A) allosteric domain (N146K or E239K and N146K-E150K-G246E). The majority of our ST228 PBP2A mutations (N146K or E150K) were distinct from ST228 PBP2A allosteric domain mutations (primarily E239K) recently described for MRSA strains collected in Thailand and Spain during the 2010 Assessing Worldwide Antimicrobial Resistance Evaluation (AWARE) global surveillance program. We also found that similar allosteric domain PBP2A mutations (N146K) correlated with ceftaroline resistance in an independent external ST228 MRSA set obtained from the nearby University Hospital of Lausanne, Lausanne, Switzerland, collected from 2003 to 2008. Thus, ceftaroline resistance was observed in our archived strains (including two examples of an MIC of 4 µg/ml for the Iberian ST247 clonotype with the triple mutation N146K/E150K/G246E), at least as far back as 1998, considerably predating the commercial introduction of ceftaroline. Our results reinforce the notion that unknown parameters can potentially exert selective pressure on PBP2A that can subsequently modulate ceftaroline

  5. Did CDM particles of mass 2.47 x 10(-3) eV interact with precursor biopolymers and nucleic acids to initiate and boost lifeforms on Earth?

    Science.gov (United States)

    Rosen, Gerald

    2011-06-01

    Recent observations and theoretical studies have shown that non-baryonic Cold Dark Matter (CDM), which constitutes about 84% of all matter in the Universe, may feature a complex-scalar-field that carries particles of mass ≅ 2.47 x 10(-3)eV with the associated Compton range m(-1) ≅8.02 x 10(-3) cm, a distance on the scale of extended bionucleic acids and living cells. Such a complex-scalar-field can enter a weak-isospin Lorentz-invariant interaction that generates the flow of right-handed electrons and induces a chirality-imbued quantum chemistry on the m (-1) scale. A phenomenological Volterra-type equation is proposed for the CDM-impacted time development of N, the number of base pairs in the most advanced organism at Earth-age t. The solution to this equation suggests that the boosts in N at t ≅ 1.1 Gyr (advent of the first living prokaryotic cells), at t ≅ 2.9 Gyr (advent of eukaryotic single-celled organisms) and finally at t ≅ 4.0 Gyr (the Cambrian explosion) may be associated with three multi-Myr-duration cosmic showers of the complex-scalar-field CDM particles. If so, the signature of the particles may be detectible in Cambrian rocks. PMID:21057875

  6. Did CDM Particles of Mass 2.47 × 10-3 eV Interact with Precursor Biopolymers and Nucleic Acids to Initiate and Boost Lifeforms on Earth?

    Science.gov (United States)

    Rosen, Gerald

    2011-06-01

    Recent observations and theoretical studies have shown that non-baryonic Cold Dark Matter (CDM), which constitutes about 84% of all matter in the Universe, may feature a complex-scalar-field that carries particles of mass m ≅ 2.47 × {10^{{ - 3}}}eV with the associated Compton range {m^{{ - 1}}} ≅ 8.02 × {10^{{ - 3}}}cm, a distance on the scale of extended bionucleic acids and living cells. Such a complex-scalar-field can enter a weak-isospin Lorentz-invariant interaction that generates the flow of right-handed electrons and induces a chirality-imbued quantum chemistry on the m -1 scale. A phenomenological Volterra-type equation is proposed for the CDM-impacted time development of N, the number of base pairs in the most advanced organism at Earth-age t. The solution to this equation suggests that the boosts in N at t ≅ 1.1 Gyr (advent of the first living prokaryotic cells), at t ≅ 2.9 Gyr (advent of eukaryotic single-celled organisms) and finally at t ≅ 4.0 Gyr (the Cambrian explosion) may be associated with three multi-Myr-duration cosmic showers of the complex-scalar-field CDM particles. If so, the signature of the particles may be detectible in Cambrian rocks.

  7. 40 CFR 247.17 - Miscellaneous products.

    Science.gov (United States)

    2010-07-01

    ..., or plastic. (e) Mats containing recovered rubber and/or plastic. (f)(1) Non-road signs containing recovered plastic or aluminum and road signs containing recovered aluminum. (2) Sign supports and posts... Miscellaneous products. (a) Pallets containing recovered wood, plastic, or paperboard. (b) Sorbents...

  8. 32 CFR 247.6 - Procedures.

    Science.gov (United States)

    2010-07-01

    ... attitudes and increase knowledge. (B) News reports and feature stories on individuals and organizational... the majority of the host installation audience from publishing a separate newspaper, when...

  9. 7 CFR 247.20 - Program violations.

    Science.gov (United States)

    2010-01-01

    ...) Selling commodities obtained in the program, or exchanging them for non-food items; (4) Physical abuse, or threat of physical abuse, of program staff; or (5) Committing dual participation. (b) What are...

  10. 32 CFR 247.4 - Policy.

    Science.gov (United States)

    2010-07-01

    ..., marital status, physical handicap, political affiliation, or any other nonmerit factor of the purchaser... national and world news may include coverage of U.S. political campaign news from commercial news sources. Presentation of such political campaign news shall be made on a balanced, impartial, and nonpartisan basis....

  11. 40 CFR 247.3 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... period of time, and maintenance of a satisfactory level of competition; Printer ribbon means a nylon fabric designed to hold ink and used in dot matrix and other types of impact printers; Procurement item... inventories of paper and paperboard manufacturers, merchants, wholesalers, dealers, printers, converters,...

  12. 32 CFR 247.3 - Definitions.

    Science.gov (United States)

    2010-07-01

    ...; commanders' comments; letters to the editor; editorials; commentaries; features; sports; entertainment items... and installation maps and may contain supplements or inserts. They become the property of the command..., including digital printing. Supplements. Features, advertising sections, or morale, welfare and...

  13. OER of californium-252 at low dose rate for growth inhibition in Vicia faba

    International Nuclear Information System (INIS)

    OER of 252Cf, at low dose rate, has been determined for growth inhibition in Vicia faba roots. A new strain ''BelB'' was used; it was found to be more resistant to prolonged anoxia. Two sets of linear 252Cf sources were used (linear activity 0.31 and 0.47 (μg.cm-1)) in somewhat different geometrical arrangements. The (n+γ) 252Cf dose rates at the level of the root tips were 0.11 and 0.13 Gy.h-1 respectively. The relative contribution of the γ component Dsub(γ) to the total absorbed dose Dsub(n+γ) at the level of the root tips was evaluated Dsub(γ)/Dsub(n+γ)=0.35 for the first source-geometry and 0.42 for the second source-geometry. The reference radiation was the γ emission of 192Ir, used in the same geometrical conditions and for similar irradiation times. Irradiations performed in aerobic and anoxic conditions were alternated. OER values of 1.4 +- 0.1 and 1.5 +- 0.1 were observed for the 252Cf emission with the first and second source-geometry respectively. The corresponding OER values for 192Ir were 2.3 +- 0.2 and 2.6 +- 0.1; the derived oxygen gain factors were then equal to 1.6 and 1.7 repectively

  14. Multi-element neutron activation analysis of sediment using a californium-252 source

    International Nuclear Information System (INIS)

    The application of a 252Cf source to the neutron activation analysis of several elements in small (approximately 1.5 in. in dia) cores was studied using high-resolution gamma ray spectroscopy and manual data reduction. (U.S.)

  15. Dicty_cDB: SHI247 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available emediation Malus x domestica cDNA clone ABNB001773, mRNA sequence. 78 1e-12 2 CN939...e-13 2 CN914665 |CN914665.1 030110ABNB001773HT (ABNB) Braeburn cultured fruit cells, boron exposed, phytor

  16. Dicty_cDB: SFJ247 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AAAGCCAAGATCCAAGATAAAGAA GGTATTCCACCAGATCAACAAAGATTAATCT sequence update 2001. 6. 1 Translated Amino Acid sequence ---m*xqxpxxxrf...kinxcr*tir rwsysf*lqyskrihspfsfkikrwyanlc*nshw*nnhfrs*rf**h*kc*sqdpr*rr ystrstkin Frame B: ---m*xqxpxxxrfppd

  17. 24/7 Negotiation in couples' transition to parenthood

    NARCIS (Netherlands)

    Wiesmann, S.M.

    2010-01-01

    How do couples negotiate about their division of paid and unpaid work when they become parents? The division of work among couples has significantly changed in the past decades. This study focused on the underlying processes that lead couples to a certain division of paid and unpaid work. To unravel

  18. 40 CFR 247.16 - Non-paper office products.

    Science.gov (United States)

    2010-07-01

    ...-paper office products. (a) Office recycling containers and office waste receptacles. (b) Plastic desktop accessories. (c) Toner cartridges. (d) Plastic-covered binders containing recovered plastic; chipboard and pressboard binders containing recovered paper; and solid plastic binders containing recovered plastic....

  19. Dicty_cDB: SSK247 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available .. 34 9.7 AB049544_1( AB049544 |pid:none) Porcine enterovirus 10 gene for RN... 3...4 9.7 AF363453_1( AF363453 |pid:none) Porcine enterovirus 9 strain UKG/4... 34 9.7 protein update 2009. 6.14

  20. 32 CFR Appendix B to Part 247 - CE Publications

    Science.gov (United States)

    2010-07-01

    ... publication any advertising of the following types: (1) paid political advertisements for a candidate, party... publication. CE publishers sell advertising to cover costs and secure earnings, print the publications, and... staff who produce the non-advertising content of the CE publication may perform certain...

  1. Maintaining Mission Critical Systems in a 247 Environment

    CERN Document Server

    Curtis, Peter M

    2011-01-01

    "This book is meant to offer Architects, Property Mangers, Facility Managers, Building Engineers, Information Technology Professionals, Data Center Personnel, Electrical & Mechanical Technicians and students in undergraduate, graduate, or continuing education programs relevant insight into the Mission Critical Environment with an emphasis on business resiliency, data center efficiency, and green power technology. Industry improvements, standards, and techniques have been incorporated into the text and address the latest issues prevalent in the Mission Critical Industry. An emphasis on green technologies and certifications is presented throughout the book. In addition, a description of the United States energy infrastructure's dependency on oil, in relation to energy security in the mission critical industry, is discussed. In conjunction with this, either a new chapter will be created on updated policies and regulations specifically related to the mission critical industry or updates to policies and regula...

  2. Web Based Prognostics and 24/7 Monitoring

    Science.gov (United States)

    Strautkalns, Miryam; Robinson, Peter

    2013-01-01

    We created a general framework for analysts to store and view data in a way that removes the boundaries created by operating systems, programming languages, and proximity. With the advent of HTML5 and CSS3 with JavaScript the distribution of information is limited to only those who lack a browser. We created a framework based on the methodology: one server, one web based application. Additional benefits are increased opportunities for collaboration. Today the idea of a group in a single room is antiquated. Groups will communicate and collaborate with others from other universities, organizations, as well as other continents across times zones. There are many varieties of data gathering and condition-monitoring software available as well as companies who specialize in customizing software to individual applications. One single group will depend on multiple languages, environments, and computers to oversee recording and collaborating with one another in a single lab. The heterogeneous nature of the system creates challenges for seamless exchange of data and ideas between members. To address these limitations we designed a framework to allow users seamless accessibility to their data. Our framework was deployed using the data feed on the NASA Ames' planetary rover testbed. Our paper demonstrates the process and implementation we followed on the rover.

  3. 7 CFR 2.47 - Administrator, Rural Utilities Service.

    Science.gov (United States)

    2010-01-01

    ...) of the Food, Agriculture, Conservation, and Trade Act of 1990 (7 U.S.C. 2279-1(e)) (b) Reservations... and programs related to watershed facilities, resource and conservation facilities, and water and.... (ix) Section 310A (7 U.S.C. 1931), relating to watershed and resource conservation and development....

  4. 7 CFR 247.37 - Civil rights requirements.

    Science.gov (United States)

    2010-01-01

    ... against should file a discrimination complaint with the USDA Director, Office of Civil Rights, Room 326W, Whitten Building, 1400 Independence Avenue, SW., Washington, DC 20250-9410, or telephone (202) 720-5964....

  5. Dicty_cDB: SFG247 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available t alignments: (bits) Value N AW759959 |AW759959.1 sl56c07.y1 Gm-c1027 Glycine max cDNA clone GENOME SYSTEM...nce. 56 9e-10 2 BF071471 |BF071471.1 st59b09.y1 Gm-c1053 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-...nce. 48 1e-08 3 BI974435 |BI974435.1 saj01e10.y1 Gm-c1065 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm...E12 5', mRNA sequence. 48 2e-08 3 AI966749 |AI966749.1 sc57c05.y1 Gm-c1016 Glycine max cDNA clone GENOME SYSTEMS

  6. 8 CFR 247.12 - Disposition of case.

    Science.gov (United States)

    2010-01-01

    ... Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS ADJUSTMENT OF STATUS OF... and shall constitute notice to him of such adjustment. The alien's nonimmigrant status shall be for... retain his status as an immigrant and files with the district director Form I-508 and, if...

  7. ED 'vending machine' sells patient meds 24/7.

    Science.gov (United States)

    2008-05-01

    A vending machine stocked with your most commonly used drugs can be a relatively inexpensive investment in patient and staff satisfaction. Rice Memorial Hospital in Willmar, MN, has installed such a machine, which includes several safeguards: * It has several internal cameras, serving as backup systems to ensure the proper drug is being dispensed to the proper patient. * The machine cannot be accessed by anyone unless they have received a magnetic swipe card from the prescribing physician. * The code is only given to a physician authorized to enter the web portal of the prescription vendor. PMID:18686529

  8. 7 CFR 247.31 - Audits and investigations.

    Science.gov (United States)

    2010-01-01

    .... (a) What is the purpose of an audit? The purpose of an audit is to ensure that: (1) Financial... are maintained; and (4) Applicable laws, regulations, and administrative requirements are followed. (b) When may the Department conduct an audit or investigation of the program? The Department may conduct...

  9. Raman and absorption spectrophotometric studies of selected lanthanide, californium-doped lanthanide, and actinide trihalides in the solid state

    International Nuclear Information System (INIS)

    The solid-state absorption spectra of Cf(III) ions as a dopant in lanthanide trihalide hosts (LnCl3: Ln = Ce, Sm, and Y; LnBr3: Ln = Ce, Sm, Tb, and Y; LnI3: Ln = Ce and Y) have been recorded. The spectra of Cf(III) have been correlated with the various crystal structures. The phonon Raman spectra and solid-state absorption spectra of PmF3, PmCl3, PmBr3, and two crystal modifications of PmI3 have been recorded. Symmetry assignments have been made for the Raman-active bands for these trihalides and also the sesquioxide. The room-temperature absorption spectra have been correlated to crystal field effects. The symmetry assignments of the Raman-active phonon modes have been made based on polarized Raman spectra from single crystals of YF3-type orthorhombic TbF3 and PuBr3-type orthorhombic NdBr3. Raman spectra of other isostructural lanthanide compounds have been recorded and compared. Symmetry assignments for these compounds have been made by analogy to the single-crystal assignments. Raman spectra have been obtained and catalogued for a number of actinide compounds. Symmetry assignments have been made for the observed Raman-active phonon bands in this work based on the assignments made for isostructural lanthanide compounds. 29 figs., 22 tabs

  10. Oxidation-reduction properties of americium, curium, berkelium, californium, einsteinium and fermium, and thermodynamic consequences for the 5f series

    International Nuclear Information System (INIS)

    The amalgamation of 5f elements from Am to Fm has been studied by using 241Am, 244Cm, 249Bk, 249Cf, 252Cf, 253Es, 254Es, 252Fm and 255Fm with two electrochemical methods, radiocoulometry and radiopolarography, perfectly adapted to investigate extremely diluted solutions when the concentration of electroactive species is as low as 10-16M. The theory of radiocoulometry has been developed in the general cases of reversible and irreversible electrode process. It has been used to interpret the experimental data on the kinetic curves of amalgamation, and to estimate the standard rate constant of the electrode process in complexing medium (citric). On the other hand the radiopolarographic method has been applied to study the mechanism of reduction at the dropping mercury electrode of cations M3+ in aqueous medium to the metal M with formation of amalgam. The results are exploited into two directions: 1- Acquisition of some data concerning the oxidation-reduction properties of elements from Am to Fm. Therefore the standard electrode E0 [M(III-0)] potentials for Bk, Cf and Es, and the standard electrode E0 [M(II-0)] potential for Fm are estimated and the relative stability of each oxidation state (from II to VII) of 5f elements is discussed; 2- Acquisition of unknown thermodynamic data on transcalifornium elements. Correlations between 4f and 5f elements are precised and some divergences appear for the second half of 4f and 5f series (i.e. for 65<=Z<=71 and 97<=Z<=103)

  11. Determination of the optimum-size californium-252 neutron source for borehole capture gamma-ray analysis

    Science.gov (United States)

    Senftle, F.E.; Macy, R.J.; Mikesell, J.L.

    1979-01-01

    The fast- and thermal-neutron fluence rates from a 3.7 ??g 252Cf neutron source in a simulated borehole have been measured as a function of the source-to-detector distance using air, water, coal, iron ore-concrete mix, and dry sand as borehole media. Gamma-ray intensity measurements were made for specific spectral lines at low and high energies for the same range of source-to-detector distances in the iron ore-concrete mix and in coal. Integral gamma-ray counts across the entire spectrum were also made at each source-to-detector distance. From these data, the specific neutron-damage rate, and the critical count-rate criteria, we show that in an iron ore-concrete mix (low hydrogen concentration), 252Cf neutron sources of 2-40 ??g are suitable. The source size required for optimum gamma-ray sensitivity depends on the energy of the gamma ray being measured. In a hydrogeneous medium such as coal, similar measurements were made. The results show that sources from 2 to 20 ??g are suitable to obtain the highest gamma-ray sensitivity, again depending on the energy of the gamma ray being measured. In a hydrogeneous medium, significant improvement in sensitivity can be achieved by using faster electronics; in iron ore, it cannot. ?? 1979 North-Holland Publishing Co.

  12. Research and experimental work at Groote Schuur Hospital and the University of Cape Town using californium-252 sources

    International Nuclear Information System (INIS)

    Experiments have been undertaken to determine the high-LET and low-LET components of the absorbed dose from neutron beams. This is achieved by measuring the fluxes of the high-LET and low-LET radiations in a tissue-equivalent phantom individually and simultaneously using a scintillation probe fitted with a pulse shape discriminator. This system was successfully used with a 22 MeV neutron beam from the T(d,n) reaction and has been employed with 252Cf sources. Results obtained in the low-energy ranges (up to 3 MeV) indicate that the electron counts exceed the high-LET counts by a factor of 2 to 3. These results are related to the absorbed dose. Calculations have also been undertaken to establish whether the Paterson-Parker system could be used for the design of 252Cf treatments and the optimum needle activities to yield the desired dose. Experiments are under way to determine the variation of RBE and OER for 252Cf radiations around the source. The inhibition of root growth in Vicia Faba is being used to determine any such effects. Dose rates comparable to that employed in interstitial radiotherapy are being aimed at. A study of dose fractionation effects is also being undertaken. (author)

  13. Radiological Characterization Technical Report on Californium-252 Sealed Source Transuranic Debris Waste for the Off-Site Source Recovery Project at Los Alamos National Laboratory

    Energy Technology Data Exchange (ETDEWEB)

    Feldman, Alexander [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2014-04-24

    This document describes the development and approach for the radiological characterization of Cf-252 sealed sources for shipment to the Waste Isolation Pilot Plant. The report combines information on the nuclear material content of each individual source (mass or activity and date of manufacture) with information and data on the radionuclide distributions within the originating nuclear material. This approach allows for complete and accurate characterization of the waste container without the need to take additional measurements. The radionuclide uncertainties, developed from acceptable knowledge (AK) information regarding the source material, are applied to the summed activities in the drum. The AK information used in the characterization of Cf-252 sealed sources has been qualified by the peer review process, which has been reviewed and accepted by the Environmental Protection Agency.

  14. Accurate determination of Curium and Californium isotopic ratios by inductively coupled plasma quadrupole mass spectrometry (ICP-QMS) in 248Cm samples for transmutation studies

    International Nuclear Information System (INIS)

    The French Atomic Energy Commission has carried out several experiments including the mini-INCA (INcineration of Actinides) project for the study of minor-actinide transmutation processes in high intensity thermal neutron fluxes, in view of proposing solutions to reduce the radiotoxicity of long-lived nuclear wastes. In this context, a Cm sample enriched in 248Cm (∼97 %) was irradiated in thermal neutron flux at the High Flux Reactor (HFR) of the Laue-Langevin Institute (ILL). This work describes a quadrupole ICP-MS (ICP-QMS) analytical procedure for precise and accurate isotopic composition determination of Cm before sample irradiation and of Cm and Cf after sample irradiation. The factors that affect the accuracy and reproducibility of isotopic ratio measurements by ICP-QMS, such as peak centre correction, detector dead time, mass bias, abundance sensitivity and hydrides formation, instrumental background, and memory blank were carefully evaluated and corrected. Uncertainties of the isotopic ratios, taking into account internal precision of isotope ratio measurements, peak tailing, and hydrides formations ranged from 0.3% to 1.3%. This uncertainties range is quite acceptable for the nuclear data to be used in transmutation studies.

  15. 25 CFR 247.1 - What definitions apply to this part?

    Science.gov (United States)

    2010-04-01

    ... least 50 years of age, and the physical site, location, or context in which they are found. Area..., personal warmth, lighting, ceremonial or aesthetic purposes. Damage means to injure, mutilate,...

  16. 27 CFR 24.247 - Materials authorized for the treatment of distilling material.

    Science.gov (United States)

    2010-04-01

    ... 184.1733 (GRAS). Enzyme activity The enzyme preparation used shall be prepared from nontoxic and... fermentable carbohydrates The amylase enzyme activity shall be derived from Aspergillus niger, Aspergillus... convent starches to fermentable carbohydrates The amylase enzyme activity shall be derived from...

  17. 17 CFR 247.741 - Exemption for banks effecting transactions in money market funds.

    Science.gov (United States)

    2010-04-01

    ... (15 U.S.C. 78c(a)(4)) to the extent that it effects transactions on behalf of a customer in securities issued by a money market fund, provided that: (1) The bank either (i) Provides the customer, directly or..., the other bank described in paragraph (a)(1)(B) of this section provides the customer, not later...

  18. Mission Overview STS-107: Providing 24/7 Space Science Research

    Science.gov (United States)

    2002-12-01

    Columbia's 16-day mission is dedicated to a mixed complement of competitively selected and commercially sponsored research in the space, life and physical sciences. An international crew of seven, including the first Israeli astronaut, will work 24 hours a day in two alternating shifts to carry out experiments in the areas of astronaut health and safety; advanced technology development; and Earth and space sciences.

  19. 48 CFR 52.247-42 - C.i.f. Destination.

    Science.gov (United States)

    2010-10-01

    ... vessel to the specified point of destination, with the cost of transportation and marine insurance paid... insurance policy or certificate providing the amount and extent of marine insurance coverage specified...

  20. 48 CFR 52.247-64 - Preference for Privately Owned U.S.-Flag Commercial Vessels.

    Science.gov (United States)

    2010-10-01

    ... deployed in connection with United Nations or North Atlantic Treaty Organization humanitarian or... operations; (B) Exercises; or (C) Forces deployed in connection with United Nations or North Atlantic Treaty... connection with United Nations or North Atlantic Treaty Organization humanitarian or peacekeeping operations.)...

  1. 32 CFR Appendix A to Part 247 - Funded Newspapers and Magazines

    Science.gov (United States)

    2010-07-01

    ... magazines support the command communication requirements of the DoD Components and their subordinate..., and other Government Agencies. Civilian community service news and announcements of benefit to... that are part of the business activities or contractual responsibilities of the contract...

  2. 49 CFR 173.247 - Bulk packaging for certain elevated temperature materials.

    Science.gov (United States)

    2010-10-01

    ... 101 and IM 102 portable tanks; UN portable tanks; marine portable tanks conforming to 46 CFR part 64... or bitumen are subject to the following requirements: (1) Low stability kettles. Kettles with a ratio... temperature likely to be encountered if the packaging were engulfed in a fire. When pressure control...

  3. Design of Motor Servo System with Multi-Channel Switching Power Based on TOP247Y%基于TOP247Y的电机伺服系统用多路开关电源设计

    Institute of Scientific and Technical Information of China (English)

    李君; 曾岳南

    2012-01-01

    文中设计了一种基于TOPSwitch-GX系列的电机伺服系统用多路单端反激式开关电源。该电源给系统控制板以及功率器件驱动电路提供5路+15 V、1路-15 V、1路+5 V独立电源,输出功率达到46 W。主要介绍了TOPS-witch-GX系列芯片的特点、开关电源辅助电路设计依据,着重分析了高频变压器的设计步骤,最后设计了基于TL431和光耦PC817的反馈补偿网络保证输出电压的稳定性。%A multi-channel single-end flyback switching power supply is designed for a motor servo system based on TOPSwitch-GX.The power supply to the system control panel and power device driving circuit 5 roads,+15 V,1 road-15V,1 road,+5 V separated power supplies and output power of 46 W.This paper mainly introduced the TOPSwitch-GX series chips feature,switching power supply auxiliary circuit design basis,focus on analyzes the design procedure of high frequency transformer,finally designes feedback compensation network based on TL431 and PC817 to ensure the stability of the output voltage.

  4. 17 CFR 247.700 - Defined terms relating to the networking exception from the definition of “broker.”

    Science.gov (United States)

    2010-04-01

    ... multiple factors or variables and: (A) Those factors or variables include multiple significant factors or...) Such measure of overall profitability or revenue is only one of multiple factors or variables used to... security; or whether it results in multiple securities transactions; provided, however, that a referral...

  5. Beverage consumption habits “24/7” among British adults: association with total water intake and energy intake

    Directory of Open Access Journals (Sweden)

    Gibson Sigrid

    2013-01-01

    Full Text Available Abstract Background Various recommendations exist for total water intake (TWI, yet it is seldom reported in dietary surveys. Few studies have examined how real-life consumption patterns, including beverage type, variety and timing relate to TWI and energy intake (EI. Methods We analysed weighed dietary records from the National Diet and Nutrition Survey of 1724 British adults aged 19–64 years (2000/2001 to investigate beverage consumption patterns over 24 hrs and 7 days and associations with TWI and EI. TWI was calculated from the nutrient composition of each item of food and drink and compared with reference values. Results Mean TWI was 2.53 L (SD 0.86 for men and 2.03 L (SD 0.71 for women, close to the European Food Safety Authority “adequate Intake” (AI of 2.5 L and 2 L, respectively. However, for 33% of men and 23% of women TWI was below AI and TWI:EI ratio was In multi-variable regression (adjusted for sex, age, body weight, smoking, dieting, activity level and mis-reporting, replacing 100 g of caloric beverages (milk, fruit juice, caloric soft drinks and alcohol with 100 g non-caloric drinks (diet soft drinks, hot beverages and water was associated with a reduction in EI of 15 kcal, or 34 kcal if food energy were unchanged. Using within-person data (deviations from 7-day mean each 100 g change in caloric beverages was associated with 29 kcal change in EI or 35 kcal if food energy were constant. By comparison the calculated energy content of caloric drinks consumed was 47 kcal/100 g. Conclusions TWI and beverage consumption are closely related, and some individuals appeared to have low TWI. Compensation for energy from beverages may occur but is partial. A better understanding of interactions between drinking and eating habits and their impact on water and energy balance would give a firmer basis to dietary recommendations.

  6. SU-E-J-247: A Simulation of X-Ray Emission with Gold Nanoparticle Irradiated by Energetic Proton Beam

    Energy Technology Data Exchange (ETDEWEB)

    Newpower, M; Ahmad, S; Chen, Y [University of Oklahoma Health Sciences Center, Oklahoma City, OK (United States)

    2014-06-01

    Purpose: To investigate the proton induced X-ray emissions in gold-water mixture materials. Methods: In this study a Monte Carlo simulation was created using the GEANT4 toolkit (version 4.9.6). The geometry in this setup includes a 2 cm × 2 cm × 2 cm target, a scoring sphere (radius = 10 cm) and a 65 MeV planar proton source (2 cm × 2 cm). Four concentrations of a gold-water solution were irradiated with 5×10{sup 5} incident protons at a distance of 0.5 cm perpendicular to the surface of the target. The solutions of gold-water mixture had 10%, 5%, 1% and 0.5% of gold by mass, respectively. The number of photon emitting for the target was counted in the scoring sphere for the energy range of 0-86.0 keV in 0.1 keV bins. For this study the reference physics list PhysListEmStandard was used together with the x-ray fluorescence, Auger electron and PIXE (particle induced xray emission) options enabled. The range cuts for photons and electrons were set at 0.5 mm and 1.0 mm, respectively. Results: In the energy spectra of emitting X-ray fluorescence, peaks from gold K shell characteristic x-rays (68.8 and 66.9 keV) were observed. The number of counts under the peaks of Ka1 and Ka2 was found to increase with the increasing of the gold concentrations in the mixture materials. The X-ray yields (for both Ka1 and Ka2) when fitted with least-square method as a function of gold concentration demonstrate a linear dependency with R{sup 2} > 0.96. The Ka1yield per incident proton was found to be 0.0016 for 10% gold-water mixture solutions. Conclusion: This preliminary study with PIXE technique with gold nanoparticle has demonstrated potentials for its utilization in the development of range and dose verification methodology that is currently of great interest in the field of proton radiation therapy.

  7. 17 CFR 247.760 - Exemption from definition of “broker” for banks accepting orders to effect transactions in...

    Science.gov (United States)

    2010-04-01

    ... a plan under 17 CFR 270.12b-1, from the bank, the executing broker or dealer, or any other person...) Advertisement means any material that is published or used in any electronic or other public media, including any Web site, newspaper, magazine or other periodical, radio, television, telephone or tape...

  8. 48 CFR 247.573-1 - Ocean transportation incidental to a contract for supplies, services, or construction.

    Science.gov (United States)

    2010-10-01

    ... Business Management Directorate, MSC; or (ii) The Commander, Military Surface Deployment and Distribution (SDDC), through the SDDC global e-mailbox sddc.ops.ffw@us.army.mil and the Principal Assistant... Commander, MSC, through the Contracts and Business Management Directorate, MSC; or (B) The...

  9. SU-E-J-247: Time Evolution of Radiation-Induced Lung Injury After Stereotactic Proton Therapy

    International Nuclear Information System (INIS)

    Purpose: Quantitative metrics to assess patient-specific radiation-induced lung injury have the potential to guide individualization of therapy and be early indicators of recurrence. Here we investigate computed tomography (CT) density changes in normal lung after stereotactic Proton Therapy. Methods: Participants in a phase-I clinical trial for stereotactic body radiation therapy (SBRT) with protons are analyzed on a rolling basis. The dataset includes 9 patients with 34 CT images to date. Follow-up images are registered to the planning CT using deformable image registration and the change in CT density is correlated to the dose to examine the time-evolution of Hounsfield Unit (HU) changes after large doses of proton radiation. Results: The lung density observed on the follow-up images increases significantly with dose for all dose levels above 5 Gy(RBE) (p<0.001) for 8/9 patients. The change per unit dose [HU/Gy] varies significantly among the patients, from 0.1 (for the one patient without significant correlation) to 5.7 ΔHU/Gy(RBE). The current population average of ΔHU/Gy(RBE) is 2.1, i.e. a 1 Gy(RBE) increase in dose leads on average to a 2.1 HU increase in CT density. The slope of the dose-response curve is constant for all timepoints investigated (from 3–24+ months). Additionally a pronounced non-linearity in the dose response curve is noted for long follow-up times (>18 months). Conclusion: CT density changes have a robust correlation with proton dose, quantitatively similar to photon dose, and may allow estimation of a patient’s intrinsic radiosensitivity after proton therapy. The stability of the correlation with time however diverges from what is known about CT response after photon irradiation. This could have important implications for clinical decision-making during proton therapy for lung cancer, especially for scheduling of follow-up CT/PET imaging and diagnosis of recurrence

  10. 78 FR 46315 - Foreign-Trade Zone (FTZ) 247-Erie, Pennsylvania, Notification of Proposed Production Activity, GE...

    Science.gov (United States)

    2013-07-31

    ...; engine cab assemblies; floor assemblies; frame assemblies; gutter assemblies; handrails; heat shield...; socket head screws; fasteners; nuts; plates; weld nuts; locknuts; washers; retaining rings; pins; shafts...; inverter sockets; connection strips; connector kits; copper bars; junction boxes; terminal...

  11. 78 FR 42451 - Listing of Color Additives Exempt From Certification; Reactive Blue 246 and Reactive Blue 247...

    Science.gov (United States)

    2013-07-16

    ... HUMAN SERVICES Food and Drug Administration 21 CFR Part 73 Listing of Color Additives Exempt From... color additive regulations in Sec. Sec. 73.3100 and 73.3106 (21 CFR 73.3100 and 73.3106), respectively... Blue 246), as color additives in contact lenses. We also corrected the nomenclature for Reactive...

  12. 17 CFR 247.701 - Exemption from the definition of “broker” for certain institutional referrals.

    Science.gov (United States)

    2010-04-01

    ... customer to the broker or dealer for investment banking services. (3) Investment banking services includes... the broker or dealer for investment banking services provided to the customer. (e) Inflation... by the rules of any self-regulatory organization; (B) Predominantly engaged in banking...

  13. 49 CFR 40.247 - What procedures does the BAT or STT follow after a screening test result?

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 1 2010-10-01 2010-10-01 false What procedures does the BAT or STT follow after a... What procedures does the BAT or STT follow after a screening test result? (a) If the test result is an alcohol concentration of less than 0.02, as the BAT or STT, you must do the following: (1) Sign and...

  14. Beverage consumption habits “24/7” among British adults: association with total water intake and energy intake

    OpenAIRE

    Gibson Sigrid; Shirreffs Susan M

    2013-01-01

    Abstract Background Various recommendations exist for total water intake (TWI), yet it is seldom reported in dietary surveys. Few studies have examined how real-life consumption patterns, including beverage type, variety and timing relate to TWI and energy intake (EI). Methods We analysed weighed dietary records from the National Diet and Nutrition Survey of 1724 British adults aged 19–64 years (2000/2001) to investigate beverage consumption patterns over 24 hrs and 7 days and associations wi...

  15. Book Buzz: Online 24/7: Virutal Reading Clubs and What We've Learned About Them

    Directory of Open Access Journals (Sweden)

    Catherine AuYeung

    2007-09-01

    Full Text Available This presentation, originally given at the Ontario Library Association 2007 SuperConference, was based on our experience at Toronto Public Library in developing the online book club site, Book Buzz. We have described our actual experience and what we have learned from it that may be useful for other start-ups. The presentation has been adapted here for a reading audience.Taking part in the presentation were a manager, an electronic services specialist, and a moderator - all librarians. We covered the project’s planning stages, the design phase, and, lastly, what is involved in the day-to-day running of the book club.

  16. Book Buzz: Online 24/7: Virutal Reading Clubs and What We've Learned About Them

    OpenAIRE

    Catherine AuYeung; Sheila Dalton; Sandra Gornall

    2007-01-01

    This presentation, originally given at the Ontario Library Association 2007 SuperConference, was based on our experience at Toronto Public Library in developing the online book club site, Book Buzz. We have described our actual experience and what we have learned from it that may be useful for other start-ups. The presentation has been adapted here for a reading audience.Taking part in the presentation were a manager, an electronic services specialist, and a moderator - all librarians. We cov...

  17. SU-E-J-247: Time Evolution of Radiation-Induced Lung Injury After Stereotactic Proton Therapy

    Energy Technology Data Exchange (ETDEWEB)

    Grassberger, C; Sharp, G; Fintelmann, F; Paganetti, H; Willers, H [Massachusetts General Hospital, Boston, MA (United States)

    2015-06-15

    Purpose: Quantitative metrics to assess patient-specific radiation-induced lung injury have the potential to guide individualization of therapy and be early indicators of recurrence. Here we investigate computed tomography (CT) density changes in normal lung after stereotactic Proton Therapy. Methods: Participants in a phase-I clinical trial for stereotactic body radiation therapy (SBRT) with protons are analyzed on a rolling basis. The dataset includes 9 patients with 34 CT images to date. Follow-up images are registered to the planning CT using deformable image registration and the change in CT density is correlated to the dose to examine the time-evolution of Hounsfield Unit (HU) changes after large doses of proton radiation. Results: The lung density observed on the follow-up images increases significantly with dose for all dose levels above 5 Gy(RBE) (p<0.001) for 8/9 patients. The change per unit dose [HU/Gy] varies significantly among the patients, from 0.1 (for the one patient without significant correlation) to 5.7 ΔHU/Gy(RBE). The current population average of ΔHU/Gy(RBE) is 2.1, i.e. a 1 Gy(RBE) increase in dose leads on average to a 2.1 HU increase in CT density. The slope of the dose-response curve is constant for all timepoints investigated (from 3–24+ months). Additionally a pronounced non-linearity in the dose response curve is noted for long follow-up times (>18 months). Conclusion: CT density changes have a robust correlation with proton dose, quantitatively similar to photon dose, and may allow estimation of a patient’s intrinsic radiosensitivity after proton therapy. The stability of the correlation with time however diverges from what is known about CT response after photon irradiation. This could have important implications for clinical decision-making during proton therapy for lung cancer, especially for scheduling of follow-up CT/PET imaging and diagnosis of recurrence.

  18. 17 CFR 247.721 - Defined terms relating to the trust and fiduciary activities exception from the definition of...

    Science.gov (United States)

    2010-04-01

    ... investment guidelines or restrictions; (iii) A fee based on a percentage of assets under management... shareholder accounts; (C) Based on a percentage of assets under management for any of the following services... section if paid based on a percentage of assets under management; (iv) A flat or capped per...

  19. 17 CFR 247.775 - Exemption from the definition of “broker” for banks effecting certain excepted or exempted...

    Science.gov (United States)

    2010-04-01

    .... (2) Interdealer quotation system has the same meaning as in 17 CFR 240.15c2-11. (3) Insurance company... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Exemption from the definition of âbrokerâ for banks effecting certain excepted or exempted transactions in investment...

  20. 17 CFR 247.776 - Exemption from the definition of “broker” for banks effecting certain excepted or exempted...

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Exemption from the definition of âbrokerâ for banks effecting certain excepted or exempted transactions in a company's securities... AND EXCHANGE COMMISSION (CONTINUED) REGULATION R-EXEMPTIONS AND DEFINITIONS RELATED TO THE...

  1. Synthesis of new heterocyclic compounds using 2-(4,7-dichloro-3,3-dimethyl-indolin-2-ylidenemalonaldehyde

    Directory of Open Access Journals (Sweden)

    Razieh Mohammadnejad Aghdam

    2013-01-01

    Full Text Available 1-(2,5-Dichlorophenylhydrazine was converted via Fischer synthesis with isopropylmethylketone into 4,7-dichloro-2,3,3-trimethyl-3H-indole. Exposure of the indolenine to the vilsmeier reagent produced amino methylene malondialdehyde which reacted with hydrazine, arylhydrazine, urea, cyanoacetamide and thiourea to give pyrazols, pyrimidones and thiopyrimidone, respectively.

  2. Review of RBE and OER values for Cf-neutrons

    International Nuclear Information System (INIS)

    Californium-252, an isotope emitting neutrons, gamma photons and alpha particles, is being investigated for its practical use in intracavitary and interstitial brachytherapy. A review of published RBE and OER values for californium neutrons as a function of dose rate for a variety of biological endpoints is given. (Auth.)

  3. 47 CFR 15.247 - Operation within the bands 902-928 MHz, 2400-2483.5 MHz, and 5725-5850 MHz.

    Science.gov (United States)

    2010-10-01

    .... In addition, a system employing short transmission bursts must comply with the definition of a... specified in this section. (h) The incorporation of intelligence within a frequency hopping spread...

  4. A 24.7-kDa copper-containing oxidase, secreted by Thermobifida fusca, significantly increasing the xylanase/cellulase-catalyzed hydrolysis of sugarcane bagasse.

    Science.gov (United States)

    Chen, Cheng-Yu; Hsieh, Zhi-Shen; Cheepudom, Jatuporn; Yang, Chao-Hsun; Meng, Menghsiao

    2013-10-01

    Thermobifida fusca is a moderately thermophilic soil bacterium belonging to Actinobacteria. It has been known for its capability to degrade plant cell wall polymers except lignin and pectin. To know whether it can produce enzymes to facilitate lignin degradation, the extracellular proteins bound to sugarcane bagasse were harvested and identified by liquid chromatography tandem mass spectrometry. Among the identified proteins, a putative copper-containing polyphenol oxidase of 241 amino acids, encoded by the locus Tfu_1114, was thought to presumably play a role in lignin degradation. This protein (Tfu1114) was thus expressed in E. coli and characterized. Similarly to common laccases, Tfu1114 is able to catalyze the oxidation reaction of phenolic and nonphenolic lignin related compounds such as 2,6-dimethoxyphenol and veratryl alcohol. More interestingly, it can significantly enhance the enzymatic hydrolysis of bagasse by xylanase and cellulase. Tfu1114 is stable against heat, with a half-life of 4.7 h at 90 °C, and organic solvents. It is sensitive to ethylenediaminetetraacetic acid and reducing agents but resistant to sodium azide, a potent inhibitor of laccases. Atomic absorption spectroscopy indicated that the ratio of copper to the protein monomer is 1, instead of 4, a feature of classical laccases. All these data suggest that Tfu1114 is a novel oxidase with laccase-like activity, potentially useful in biotechnology application. PMID:23377789

  5. The results of sentinel lymph node imaging and biopsy with a novel lymphoscintigraphy agent 99Tcm-Rituximab in 247 breast cancer patients

    International Nuclear Information System (INIS)

    Objective: The feasibility, reliability and influence factors of sentinel lymph node (SLN) imaging and biopsy with a new imaging agent 99Tcm-Rituximab were investigated in 467 breast cancer patients. Methods: The SLN imaging was taken after peritumoral and subdermal injection of 99Tcm-Rituximab guided by ultrasound. Based on the image, the SLN were identified by a gamma probe and removed, the resected SLN were examined pathologically with both HE and immunohistochemical staining. Results: The success rate of SLN imaging was 99.14% (463/467). A total 837 SLN (1.79 per case) were visualized, which located in axilla, internal mammary, subraclavicular and breast region. The success rate of SLN biopsy (SLNB) was 99.57% (465/467), a total 1182 SLN (2.53 per case) were identified. Pathological examination showed that there were 131 patients with 194 metastatic axillary SLN; one case of micrometastases was confirmed by immunohistochemical staining, whose result of HE staining was negative. The following factors, such as age, image time, biopsy history, pathologic type and clinical stage, had no effect on the results of SLN imaging and SLNB. But the SLN metastasis rates were different in patients with different pathologic type and clinical stage(χ2=14.134, 29.184, all P99Tcm-Rituximab showed potential in both SLN imaging and identification in breast cancer patients. (authors)

  6. "I'm on it 24/7 at the moment": A qualitative examination of multi-screen viewing behaviours among UK 10-11 year olds

    Directory of Open Access Journals (Sweden)

    Cillero Itziar

    2011-08-01

    Full Text Available Abstract Background Screen-viewing has been associated with increased body mass, increased risk of metabolic syndrome and lower psychological well-being among children and adolescents. There is a shortage of information about the nature of contemporary screen-viewing amongst children especially given the rapid advances in screen-viewing equipment technology and their widespread availability. Anecdotal evidence suggests that large numbers of children embrace the multi-functionality of current devices to engage in multiple forms of screen-viewing at the same time. In this paper we used qualitative methods to assess the nature and extent of multiple forms of screen-viewing in UK children. Methods Focus groups were conducted with 10-11 year old children (n = 63 who were recruited from five primary schools in Bristol, UK. Topics included the types of screen-viewing in which the participants engaged; whether the participants ever engaged in more than one form of screen-viewing at any time and if so the nature of this multiple viewing; reasons for engaging in multi-screen-viewing; the room within the house where multi-screen-viewing took place and the reasons for selecting that room. All focus groups were transcribed verbatim, anonymised and thematically analysed. Results Multi-screen viewing was a common behaviour. Although multi-screen viewing often involved watching TV, TV viewing was often the background behaviour with attention focussed towards a laptop, handheld device or smart-phone. There were three main reasons for engaging in multi-screen viewing: 1 tempering impatience that was associated with a programme loading; 2 multi-screen facilitated filtering out unwanted content such as advertisements; and 3 multi-screen viewing was perceived to be enjoyable. Multi-screen viewing occurred either in the child's bedroom or in the main living area of the home. There was considerable variability in the level and timing of viewing and this appeared to be a function of whether the participants attended after-school clubs. Conclusions UK children regularly engage in two or more forms of screen-viewing at the same time. There are currently no means of assessing multi-screen viewing nor any interventions that specifically focus on reducing multi-screen viewing. To reduce children's overall screen-viewing we need to understand and then develop approaches to reduce multi-screen viewing among children.

  7. "I'm on it 24/7 at the moment" : A qualitative examination of multi-screen viewing behaviours among UK 10-11 year olds

    OpenAIRE

    Cillero Itziar; Gorely Trish; Sebire Simon J; Jago Russell; Biddle Stuart JH

    2011-01-01

    Abstract Background Screen-viewing has been associated with increased body mass, increased risk of metabolic syndrome and lower psychological well-being among children and adolescents. There is a shortage of information about the nature of contemporary screen-viewing amongst children especially given the rapid advances in screen-viewing equipment technology and their widespread availability. Anecdotal evidence suggests that large numbers of children embrace the multi-functionality of current ...

  8. (2012 30 Windsor Y B Access Just 247 SO LONG AS YOU HAVE YOUR HEALTH: HEALTH CARE DISTRIBUTION IN CANADA AND PROCEDURALIST HUMAN RIGHTS

    Directory of Open Access Journals (Sweden)

    Alana Klein

    2015-05-01

    Full Text Available Health resource distribution in Canada has been criticized for being opaque and increasingly inequitable, with its disproportionate emphasis on curative over preventive care. Yet there has been relatively little scrutiny of priority-setting in publicly funded health care in Canada from bodies monitoring the international human right to health. Recently, however, domestic health governance on the one hand, and international health and human rights on the other, have converged around the promotion of evidence-based policy, accountability, transparency and participation as drivers of more equitable distribution of health care resources. This paper tracks the paths toward this convergence. The emphasis in health policy was largely driven by cost containment and service integration concerns, while democratic and institutional concerns around socio-economic rights protection are at the root of the health and human rights shift toward proceduralist approaches. This shared emphasis nonetheless opens new terrains of struggle for human rights approaches to health care distribution in Canada, around (i managing indeterminacy in social determinants of health; (ii addressing power imbalances that shape how health information is produced, communicated, and acted upon and (iii the role of fundamental normative values that limit substantive policy around health. La distribution des ressources en santé au Canada a été critiquée en raison de son caractère opaque et de plus en plus inéquitable, et de l’importance disproportionnée accordée aux soins curatifs par rapport aux mesures préventives. De plus, relativement peu d’études concernant les priorités établies en matière de services de santé publics au Canada ont été faites par des organismes de contrôle du droit, reconnu dans des instruments internationaux, de tout être humain à la santé. Cela dit, récemment, la gouvernance nationale de la santé, d’une part, et le droit à la santé et les droits de la personne au niveau international, d’autre part, ont convergé et mis l’accent sur la nécessité de promouvoir des politiques fondées sur des données probantes, la responsabilisation, la transparence et la participation, facteurs qui sont aptes à assurer une distribution plus équitable des ressources en santé. Le document suit le cheminement vers cette convergence. Les politiques en matière de santé étaient largement fondées sur des préoccupations liées à la limitation des coûts et à l’intégration des services, alors que les préoccupations démocratiques et institutionnelles à l’égard de la protection des droits socio-économiques sont à l’origine du virage du droit à la santé et des droits de la personne vers des approches procéduralistes. Ces priorités communes ouvrent néanmoins la porte à de nouvelles luttes visant des approches axées sur les droits de la personne en ce qui a trait à la distribution des services de santé au Canada, luttes qui impliqueront les actions suivantes : (i gérer l’indétermination dans les déterminants sociaux de la santé; (ii corriger les déséquilibres de pouvoir qui déterminent la façon dont l’information en matière de santé est produite et communiquée et les réactions qu’elle entraîne, et (iii éclaircir le rôle des valeurs normatives fondamentales qui limitent les politiques de fond en matière de santé.

  9. Development of Abrasion-Resistant Coating for Solar Reflective Films. Cooperative Research and Development Final Report, CRADA Number CRD-07-247

    Energy Technology Data Exchange (ETDEWEB)

    Gray, Matthew [National Renewable Energy Lab. (NREL), Golden, CO (United States)

    2015-10-01

    The purpose of this CRADA is to develop an abrasion-resistant coating, suitable for use on polymeric-based reflective films (e.g., the ReflecTech reflective film), that allows for improved scratch resistance and enables the use of aggressive cleaning techniques (e.g., direct contact methods like brushing) without damaging the specular reflectance properties of the reflective film.

  10. Unveiling stomata 24/7: can we use carbonyl sulfide (COS) and oxygen isotopes (18O) to constrain estimates of nocturnal transpiration across different evolutionary plant forms?

    Science.gov (United States)

    Gimeno, Teresa E.; Ogee, Jerome; Bosc, Alexander; Genty, Bernard; Wohl, Steven; Wingate, Lisa

    2015-04-01

    Numerous studies have reported a continued flux of water through plants at night, suggesting that stomata are not fully closed. Growing evidence indicates that this nocturnal flux of transpiration might constitute an important fraction of total ecosystem water use in certain environments. However, because evaporative demand is usually low at night, nocturnal transpiration fluxes are generally an order of magnitude lower than rates measured during the day and perilously close to the measurement error of traditional gas-exchange porometers. Thus estimating rates of stomatal conductance in the dark (gnight) precisely poses a significant methodological challenge. As a result, we lack accurate field estimates of gnight and how it responds to different atmospheric drivers, indicating the need for a different measurement approach. In this presentation we propose a novel method to obtain detectable and robust estimates of gnight. We will demonstrate using mechanistic theory how independent tracers including the oxygen isotope composition of CO2 (δ18O) and carbonyl sulfide (COS) can be combined to obtain robust estimates of gnight. This is because COS and CO18O exchange within leaves are controlled by the light insensitive enzyme carbonic anhydrase. Thus, if plant stomata are open in the dark we will continue to observe COS and CO18O exchange. Using our theoretical model we will demonstrate that the exchange of these tracers can now be measured using advances in laser spectrometry techniques at a precision high enough to determine robust estimates of gnight. We will also present our novel experimental approach designed to measure simultaneously the exchange of CO18O and COS alongside the conventional technique that relies on measuring the total water flux from leaves in the dark. Using our theoretical approach we will additionally explore the feasibility of our proposed experimental design to detect variations in gnight during drought stress and across a variety of plant types that have evolved diverse strategies to control water loss from leaf tissues.

  11. Child Abuse Prevention and Treatment Act, 1974. Public Law 93-247 (S. 1191): Questions and Answers, Analysis, and Text of the Act.

    Science.gov (United States)

    Congress of the U.S., Washington, DC. Senate Committee on Labor and Public Welfare.

    This booklet contains questions and answers concerning the Child Abuse Prevention and Treatment Act, an analysis of the Act by the Congressional Research Service, and a copy of the actual text. The question and answer section provides information about the rationale for the Act, the amount of money available for its implementation, as well as its…

  12. Campylobacter-like organisms and Candida in peptic ulcers and similar lesions of the upper gastrointestinal tract: a study of 247 cases.

    OpenAIRE

    Kalogeropoulos, N K; Whitehead, R.

    1988-01-01

    Campylobacter-like organisms were detected by light microscopy in association with 57 of 102 (56%) of gastric ulcers, all the gastric erosions associated with gastritis, three of five (60%) of gastric erosions without gastritis, five of 13 (39%) of mild superficial gastritis and two of 36 (6%) of normal gastric mucosa. They were also seen in four of 20 (20%) of duodenal ulcers, but not in duodenal erosions with duodenitis or normal duodenal biopsy specimens. They were seen in association with...

  13. 17 CFR 247.740 - Defined terms relating to the sweep accounts exception from the definition of “broker.”

    Science.gov (United States)

    2010-04-01

    ... sales load has the same meaning as in 17 CFR 270.6c-10. (b) Money market fund means an open-end company... securities for sales or sales promotion expenses, for personal service, or for the maintenance of shareholder... investment company's securities for sales or sales promotion expenses, for personal service, or for...

  14. Measuring Gender (In)Equality: Introducing the Gender, Institutions and Development Data Base (GID). OECD Development Centre Working Paper No. 247

    Science.gov (United States)

    Jutting, Johannes P.; Morrisson, Christian; Dayton-Johnson, Jeff; Drechsler, Denis

    2006-01-01

    Efforts to establish, test and analyse hypotheses regarding cross-country variations in women's economic status are hampered by the lack of a readily accessible and easily used information resource on the various dimensions of gender inequality. Addressing this gap, this paper introduces the Gender, Institutions and Development data base (GID)…

  15. Improvement activities to soil stabilization near Bolivia-Brazil gas pipeline crossing through an embankment over a corrugated drainage pipe, at Km 247 in Mato Grosso do Sul, Brazil; Melhorias para estabilidade do gasoduto Bolivia-Brasil em cruzamento de aterro sobre tubo de drenagem tipo ARMCO, no km 247 em Mato Grosso do Sul

    Energy Technology Data Exchange (ETDEWEB)

    Jorge, Kemal Vieira [TBG - Transportadora Brasileira Gasoduto Bolivia Brasil S.A., Rio de Janeiro, RJ (Brazil); Costa, Cesar Augusto [TBG - Transportadora Brasileira Gasoduto Bolivia Brasil S.A., Campo Grande, MS (Brazil). Gerencia Regional Centro Oeste (CRGO)

    2005-07-01

    A hundred and seventy kilometers from Campo Grande city, on Mato Grosso do Sul State, the Brasil-Bolivia Gas Pipeline crosses a 8,5 meters high landfill, over a drainage systems made of a 2,8 meters of diameter corrugated pipe. This drainage pipe was installed to allow the drainage of the valley, and the landfill above it was built so the Gas pipeline could cross easier the 80 meters deep and 30 degree vertices valley. This paper illustrates the work tasks and solutions taken to monitor and guarantee the integrity of the drainage and landfill structures, as well as the integrity of the Gas Pipeline. Some of the work tasks illustrated are the investigation of the support conditions of the Gas Pipeline, the analysis of a drainage system under the pipeline, on a rocky soil, the analysis of the stability of the landfill, the construction of a gravity retaining walls and the monitoring of the deformations on the drainage pipe. (author)

  16. Exigência de cálcio para codornas japonesas (coturnix coturnix japonica em postura - DOI: 10.4025/actascianimsci.v29i1.247 Calcium requirement for japanese quails (Coturnix coturnix japonica in the laying phase - DOI: 10.4025/actascianimsci.v29i1.247

    Directory of Open Access Journals (Sweden)

    Jocelyn Santiago Brandão

    2007-11-01

    Full Text Available Realizou-se este experimento com o objetivo de determinar as exigências de cálcio de codornas japonesas em postura. Foram utilizadas 105 codornas, distribuídas em sete tratamentos, com três repetições. Os tratamentos consistiram em uma ração basal suplementada com calcário calcítico para alcançar sete níveis de cálcio (2,95; 3,10; 3,25; 3,40; 3,55; 3,70 e 3,85%. As variáveis avaliadas foram: consumo de ração (CR, produção de ovos (PD, massa de ovos (MO, conversão por massa de ovos (CMO, conversão por dúzia de ovos (CDO, peso do ovo (PO, peso e percentagem de gema, albúmem e casca e gravidade específica. O CR e CMO não foram influenciados pelos níveis de cálcio na dieta. A PD, MO e CDO sofreram efeito quadrático dos níveis de cálcio, sendo os valores máximos para estas variáveis estimados com os níveis de 3,45; 3,51 e 3,34% de cálcio. O PO aumentou linearmente com os níveis de cálcio na dieta. Foi verificado efeito quadrático dos níveis de cálcio sobre o peso e percentagem do albúmem e gema e gravidade específica. Recomendase para codornas japonesas o nível de 3,51% de cálcio da ração para a otimização dos índices de desempenho sem afetar negativamente a qualidade interna e externa dos ovos.This trial was performed to determine the requirements of calcium for Japanese quails during the laying period. A hundred and five quails were distributed in seven treatments and three repetitions. The treatments consisted of a basal diet supplemented with limestone in order to produce seven calcium levels (2.95; 3.10; 3.25; 3.40; 3.55; 3.70 and 3.85%. The following variables were evaluated: feed intake (CR, egg production (PD, egg mass (MO, conversion per egg mass (CMO, conversion per egg dozen (CDO, egg weight (PO, the weights and percentages of yolk, albumen and shell, and specific gravity. Calcium levels in the diet had no effect on CR and CMO. On the other hand, there was quadratic effect on PD, MO and CDO, and the maximum levels for these variables were estimated with calcium levels of 3.45; 3.51 and 3.34%, respectively. PO increased linearly with calcium levels in the diet. A quadratic effect of calcium levels was seen on the specific gravity and on weight and percentage of albumen and yolk. Calcium levels of 3.51% are recommended for Japanese quails during the laying period in order to optimize performance indexes without affecting negatively the internal and external egg quality.

  17. A new shipping container for an intense neutron emitter

    International Nuclear Information System (INIS)

    Californium-252 is an intense neutron emitter (2.34 x 1012 n/s·g) used in medicine, research, and industry. The western world's sole source of this rare radioisotope is the Californium Facility at Oak Ridge National Laboratory's Radiochemical Engineering Development Center (REDC). A project has been initiated at the REDC to design a new Type B Californium Shipping Container. This effort is essential for future transportation of californium to meet the needs of users all over the world. The shipping container must meet all requirements for transport by motor freight, air, vessel, and rail, both domestic and foreign. There are unique problems in the design, fabrication, and licensing of a new Type B shipping container that will accommodate up to 60 milligrams of californium-252. One of the first challenges in the design phase of the project is the selection of a material to shield the high neutron flux. The more stringent safety precautions of today's world impel us to consider more exotic materials for such a purpose. The candidate materials must be examined not just for their neutron shielding properties, but also in conjunction with other properties such as thermal and structural requirements to withstand the hypothetical accident conditions. The design and building of such a container is a formidable task requiring much planning. The licensing process, with the complex, interactive federal codes, is a special challenge and may be the biggest on the project in terms of time and money

  18. Application of Cf for the quantitative measurement of nuclear reactor fuel materials

    International Nuclear Information System (INIS)

    Sensitive and rapid measurements of the quantity and geometric distribution of nuclear reactor fuel materials can be made using neutrons from californium. The neutron-induced fission rate in these materials may be measured by detection of either prompt radiations from fission or delayed radiations from radioactive fission products. A number of californium-based instruments are presently in use by the nuclear industry for purposes of process control, quality control, nuclear materials safeguards, and environmentl assessment. An Automated Fuel Rod Scanner (AFRS) is used for high-speed measurement of the uniformity of loading and total fissile content of reactor fuel rods. The fuel rods are moved first through an irradiator containing about 1 mg of californium, and subsequently through high-efficiency detectors for the measurement of fission-product gamma-rays. Multiple detectors on each of two irradiation channels are used to reduce the californium source strength requirement. The fuel loading of each 15-mm-long pellet is tested to +-10% on 100% of the plant throughput. By summing the response over length, the total fissile material content of the fuel rod is measured to better than 0.5%. An on-line computer for data processing allows the instrument to measure about 150 rods per hour with a single operator. The same activation concept is used with a 25-μg californium source in a Small Sample Assay System (SSAS) which measures the fissile content of fuel pellet sized samples with a precision of 0.5%

  19. Erratum to "Effect of the time-dependent coupling on a superconducting qubit-field system under decoherence: Entanglement and Wehrl entropy" [Ann. Physics 361 (2015) 247-258

    Science.gov (United States)

    Abdel-Khalek, S.; Berrada, K.; Eleuch, H.

    2016-09-01

    The dynamics of a superconducting (SC) qubit interacting with a field under decoherence with and without time-dependent coupling effect is analyzed. Quantum features like the collapse-revivals for the dynamics of population inversion, sudden birth and sudden death of entanglement, and statistical properties are investigated under the phase damping effect. Analytic results for certain parametric conditions are obtained. We analyze the influence of decoherence on the negativity and Wehrl entropy for different values of the physical parameters. We also explore an interesting relation between the SC-field entanglement and Wehrl entropy behavior during the time evolution. We show that the amount of SC-field entanglement can be enhanced as the field tends to be more classical. The studied model of SC-field system with the time-dependent coupling has high practical importance due to their experimental accessibility which may open new perspectives in different tasks of quantum formation processing.

  20. Missense mutations in PBP2A Affecting ceftaroline susceptibility detected in epidemic hospital-acquired methicillin-resistant Staphylococcus aureus clonotypes ST228 and ST247 in Western Switzerland archived since 1998

    OpenAIRE

    Kelley, William; Jousselin, Ambre; Barras, Christine; Lelong, Emmanuelle; Renzoni, Adriana Maria

    2015-01-01

    The development and maintenance of an arsenal of antibiotics is a major health care challenge. Ceftaroline is a new cephalosporin with activity against methicillin-resistant Staphylococcus aureus (MRSA); however, no reports concerning MRSA ceftaroline susceptibility have been reported in Switzerland. We tested the in vitro activity of ceftaroline against an archived set of 60 MRSA strains from the University Hospital of Geneva collected from 1994 to 2003. Our results surprisingly revealed cef...

  1. Multibeam collection for TN247: Multibeam data collected aboard Thomas G. Thompson from 2010-03-11 to 2010-04-17, departing from Punta Arenas, Chile and returning to Seattle, WA

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set is part of a larger set of data called the Multibeam Bathymetry Database (MBBDB) where other similar data can be found at...

  2. Magnetic measurements of the transuranium elements. Progress report, January 1, 1984-December 31, 1984

    International Nuclear Information System (INIS)

    Measurements of the magnetic properties of dhcp californium-249 metal indicated the presence of three regions of differing magnetic character. Additional measurements are also reported. Magnetic moments and valence states of terbium in TbF3, BaTbO3, and TbO18 are discussed. Progress on high-field operation of the micro-magnetic susceptometer is reported

  3. Application of PGNAA to preincineration assay of combustible waste for chlorine

    Energy Technology Data Exchange (ETDEWEB)

    Gehrke, R.J.; Pawelko, R.J.; Greenwood, R.C. [Idaho National Engineering Lab., Idaho Falls, ID (United States)

    1995-12-31

    A prompt gamma neutron activation analysis method is being developed for on-stream pre-incineration assay of low level radioactive combustible waste for it`s chlorine content. The assay system consists of three californium 252 sources and a germanium or scintillation gamma-ray spectrometer.

  4. Discovery of Isotopes of the Transuranium Elements with 93 <= Z <= 98

    CERN Document Server

    Fry, C

    2012-01-01

    One hundred and five isotopes of the transuranium elements neptunium, plutonium, americium, curium, berkelium and californium have so far been observed; the discovery of these isotopes is discussed. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  5. Source storage and transfer cask: Users Guide

    International Nuclear Information System (INIS)

    The storage and shield cask for the dual californium source is designed to shield and transport up to 3.7 mg (2 Ci) of 252Cf. the cask meets Department of Transportation (DOT) license requirements for Type A materials (DOT-7A). The cask is designed to transfer sources to and from the Flourinel and Fuel Storage (FAST) facility delayed-neutron interrogator. Californium sources placed in the cask must be encapsulated in the SR-CF-100 package and attached to Teleflex cables. The cask contains two source locations. Each location contains a gear box that allows a Teleflex cable to be remotely moved by a hand crank into and out of the cask. This transfer procedure permits sources to be easily removed and inserted into the delayed-neutron interrogator and reduces personnel radiation exposure during transfer. The radiation dose rate with the maximum allowable quantity of californium (3.7 mg) in the cask is 30 mR/h at the surface and less than 2 mR/h 1 m from the cask surface. This manual contains information about the cask, californium sources, describes the method to ship the cask, and how to insert and remove sources from the cask. 28 figs

  6. Characterization of berkelium(III) dipicolinate and borate compounds in solution and the solid state.

    Science.gov (United States)

    Silver, Mark A; Cary, Samantha K; Johnson, Jason A; Baumbach, Ryan E; Arico, Alexandra A; Luckey, Morgan; Urban, Matthew; Wang, Jamie C; Polinski, Matthew J; Chemey, Alexander; Liu, Guokui; Chen, Kuan-Wen; Van Cleve, Shelley M; Marsh, Matthew L; Eaton, Teresa M; van de Burgt, Lambertus J; Gray, Ashley L; Hobart, David E; Hanson, Kenneth; Maron, Laurent; Gendron, Frédéric; Autschbach, Jochen; Speldrich, Manfred; Kögerler, Paul; Yang, Ping; Braley, Jenifer; Albrecht-Schmitt, Thomas E

    2016-08-26

    Berkelium is positioned at a crucial location in the actinide series between the inherently stable half-filled 5f(7) configuration of curium and the abrupt transition in chemical behavior created by the onset of a metastable divalent state that starts at californium. However, the mere 320-day half-life of berkelium's only available isotope, (249)Bk, has hindered in-depth studies of the element's coordination chemistry. Herein, we report the synthesis and detailed solid-state and solution-phase characterization of a berkelium coordination complex, Bk(III)tris(dipicolinate), as well as a chemically distinct Bk(III) borate material for comparison. We demonstrate that berkelium's complexation is analogous to that of californium. However, from a range of spectroscopic techniques and quantum mechanical calculations, it is clear that spin-orbit coupling contributes significantly to berkelium's multiconfigurational ground state. PMID:27563098

  7. Measurement of the energy spectra of fission fragments using nuclear track detectors and digital image processing

    International Nuclear Information System (INIS)

    Energy spectra of fission fragments were determined using a Nuclear Track Methodology (NTM) supported by digital image analysis and numerical data processing using a standard personal computer. The analysis of a californium (252Cf) spectrum with this approach shows improvement compared with the values reported previously using the standard procedure, in terms of resolution and accuracy. This new method adds full automation to the technical advantages and cost effectiveness of an NTM.

  8. Neutron multiplicities for the transplutonium nuclides

    International Nuclear Information System (INIS)

    This paper continues, with respect to the transplutonium nuclides, earlier efforts to collate and evaluate data from the scientific literature on the prompt neutron multiplicity distribution from fission and its first moment = ΣnuPnu. The isotopes considered here for which P/sub nu/ and or data (or both) were found in the literature are of americium (Am), curium (Cm), berkelium (Bk), californium (Cf), einsteinium (Es), fermium (Fm), and nobelium (No)

  9. Study of heavy particle decay from superheavy elements by SK model

    International Nuclear Information System (INIS)

    Heavy nuclei usually decay by alpha decay or spontaneous fission. These two decay modes are generally the most probable competing processes. Another less probable decay process is cluster radioactivity in which nuclei from carbon to silicon are emitted from Radium to Californium leading to the most stable daughter nucleus, lead. This work reports such a study using the cubic plus Yukawa plus exponential model of Shanmugam and Kamalaharan (SK)

  10. Properties of neutron sources

    International Nuclear Information System (INIS)

    The Conference presentations were divided into sessions devoted to the following topics: white neutron sources, primarily pulsed (6 papers); fast neutron fields (5 papers); Californium-252 prompt fission neutron spectra (14 papers); monoenergetic sources and filtered beams (11 papers); 14 MeV neutron sources (10 papers); selected special application (one paper); and a general interest session (4 papers). Individual abstracts were prepared separately for the papers

  11. Antonio Maria Baggio (ed.), Adriana Cossedu, Paolo Giusta, Rodrigo Mardones Z. y Antonio Márquez Prieto, Caino e i suoi fratelli. Il fondamento relazionale nella politica e nel diritto, Città Nuova, Roma, 2012, 247 págs.

    OpenAIRE

    María Salas Porras

    2013-01-01

    Los estudios recogidos en este volumen intentan reinterpretar los fundamentos de la Política y del Derecho, enmarcados en el horizonte relacional que la fraternidad les abre. Desde esta perspectiva, la fraternidad asume una relevancia política y jurídica en la medida en que se la entienda sustancialmente ligada a la libertad y a la igualdad. Cada una de las tres categorías, en la medida en que sean consideradas conjuntamente, llegan a adquirir su propio significado a través de la relación con...

  12. Antonio Maria Baggio (ed., Adriana Cossedu, Paolo Giusta, Rodrigo Mardones Z. y Antonio Márquez Prieto, Caino e i suoi fratelli. Il fondamento relazionale nella politica e nel diritto, Città Nuova, Roma, 2012, 247 págs.

    Directory of Open Access Journals (Sweden)

    María Salas Porras

    2013-03-01

    Full Text Available Los estudios recogidos en este volumen intentan reinterpretar los fundamentos de la Política y del Derecho, enmarcados en el horizonte relacional que la fraternidad les abre. Desde esta perspectiva, la fraternidad asume una relevancia política y jurídica en la medida en que se la entienda sustancialmente ligada a la libertad y a la igualdad. Cada una de las tres categorías, en la medida en que sean consideradas conjuntamente, llegan a adquirir su propio significado a través de la relación con las otras. El redescubrimiento de la fraternidad significa por tanto volver a proponer el "tríptico" entero, para recuperar, a través del mismo, el proyecto humanísitico de la modernidad, y liberarnos del destino del conflicto radical al que nuestro tiempo parece condenado: Caín no sólo ha matado a su hermano, sino que también ha fundado la primera ciudad, es decir, el lugar donde la violencia se ve confinada por el gobierno y por las leyes. Abrir el Derecho al horizonte de la fraternidad significa, hoy, llevar la racionalidad jurídica más allá de la mera racionalidad técnica; permitir renovar la relación jurídica, volver a encontrar sus fundamentos humanísticos, redescubriendo una justicia que reconcilia y reconstruye, fortificando el vínculo social. Considerar la fraternidad una categoría política significa poder emitir juicios políticos, capaces de producir un pensamiento político a través de la óptica de la fraternidad; se abandonan así las lógicas de la ideología, para intentar construir una forma de pensamiento en disposición de pasar, de una idea intuitiva de fraternidad, a una definición que la haga operativa, "operacionalizable". Es una tarea que no corresponde hoy a una sola disciplina, sino que interesa a todo el conjunto de los ya numerosos estudiosos que se han enrolado en este frente, interactuando entre sí de manera interdisiciplinar y abriendo un camino en el cual resulte posible, a todos los que han abrazado un humanismo y un ideal político, encontrar las mejores razones de su esperanza.

  13. ‘A dialogue about the art of portraiture’ Originally published as ‘Gespräch von der Bildniskunst’, Österreichische Rundschau, Volume 6, 1906, 502—516, and republished: Julius Schlosser, Präludien Vorträge und Aufsätze, Berlin: Bard 1927, 227—247. Translated with an introduction by Karl Johns

    OpenAIRE

    Julius Schlosser

    2011-01-01

    In an unusually popular and readable dialogue form, Schlosser alludes to the classical education he takes for granted in any reader approaching his favourite ‘thorny’ questions from aesthetics and history. These involve the problems of naturalism, impressionism, portrait likeness, psychology of perception and numerous others being bandied around academic circles at the turn of the century. It is of further interest in directly referring critically to his recently deceased friend (Alois Riegl)...

  14. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFC247 (Link to dictyBase) - - - Contig-U16444-1 VFC247P (Link... to Original site) VFC247F 353 VFC247Z 590 VFC247P 943 - - Show VFC247 Library VF (Link to library) Clone ID VFC247 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16444-1 Original site URL http://dict...ences producing significant alignments: (bits) Value N AC116978 |AC116978.1 Dicty...ostelium discoideum chromosome 2 map 4846697-4874480 strain AX4, *** SEQUENCING IN PROGRESS ***. 1049 0.0 3 AC117076 |AC117076.2 Dict

  15. Neutron nondestructive essay of the plutonium metal parts

    International Nuclear Information System (INIS)

    Based on the principle of neutron multiplicity and data unfolding mathematics, this paper developed the software which can execute the neutron multiplicity analysis, neutron attenuation analysis, parameter calibration, Pu mass solution with the neutron pulse sequence acquisition method. The measurement system consisted of detector,nuclear electronic apparatus, pulsed sequence acquisition and analysis software was tested and calibrated by californium source. Three mental plutonium components with different mass were used for experimental assay and validation, which showed that the assay bias was within 15% against the nominal value of the samples. (authors)

  16. Physical-chemical studies of transuranium elements. Progress report, April 1, 1982-March 31, 1983

    International Nuclear Information System (INIS)

    Progress is reported on the following topics: electrochemical and spectroscopic studies of less-stable higher oxidation states of transuranium elements in complexing aqueous media; spectroscopic and electrochemical studies of selected lanthanides and actinides in molten dimethyl sulfone; spectroelectronchemical studies of the Ce(IV)/Ce(III) couple in aqueous carbonate solutions; characterization of actinide orthophosphates by Raman and absorption spectrophotometries and by x-ray diffraction; relativistic multiple scattering calculations on transuranium element compounds; Raman spectroscopic studies of natural minerals containing the uranyl ion; and solution calorimetry of californium metal

  17. Composition containing transuranic elements for use in the homeopathic treatment of aids

    Energy Technology Data Exchange (ETDEWEB)

    Lustig, D.

    1996-04-18

    A homeopathic remedy consisting of a composition containing one or more transuranic elements, particularly plutonium, for preventing and treating acquired immunodeficiency syndrome (AIDS) in humans, as well as seropositivity for human immunodeficiency virus (HIV). Said composition is characterized in that it uses any chemical or isotopic form of one or more transuranic elements (neptunium, plutonium, americium, curium, berkelium, californium or einsteinium), particularly plutonium, said form being diluted and dynamized according to conventional homeopathic methods, particularly the so-called Hahnemann and Korsakov methods, and provided preferably but not exclusively in the form of lactose and/or saccharose globules or granules impregnated with the active principle of said composition. (author).

  18. TOWARD AN IMPROVED UNDERSTANDING OF STRUCTURE AND MAGNETISM IN NEPTUNIUM AND PLUTONIUM PHOSPHONATES AND SULFONATES

    Energy Technology Data Exchange (ETDEWEB)

    Albrecht-Schmitt, Thomas

    2012-03-01

    This grant supported the exploratory synthesis of new actinide materials with all of the actinides from thorium to californium with the exceptions of protactinium and berkelium. We developed detailed structure-property relationships that allowed for the identification of novel materials with selective ion-exchange, selective oxidation, and long-range magnetic ordering. We found novel bonding motifs and identified periodic trends across the actinide series. We identified structural building units that would lead to desired structural features and novel topologies. We also characterized many different spectroscopic trends across the actinide series. The grant support the preparation of approximately 1200 new compounds all of which were structurally characterized.

  19. NONDESTRUCTIVE IDENTIFICATION OF CHEMICAL WARFARE AGENTS AND EXPLOSIVES BY NEUTRON GENERATOR-DRIVEN PGNAA

    Energy Technology Data Exchange (ETDEWEB)

    T. R. Twomey; A. J. Caffrey; D. L. Chichester

    2007-02-01

    Prompt gamma-ray neutron activation analysis (PGNAA) is now a proven method for the identification of chemical warfare agents and explosives in military projectiles and storage containers. Idaho National Laboratory is developing a next-generation PGNAA instrument based on the new Ortec Detective mechanically-cooled HPGe detector and a neutron generator. In this paper we review PGNAA analysis of suspect chemical warfare munitions, and we discuss the advantages and disadvantages of replacing the californium-252 radioisotopic neutron source with a compact accelerator neutron generator.

  20. Detection of rare earth elements in Powder River Basin sub-bituminous coal ash using laser-induced breakdown spectroscopy (LIBS)

    Energy Technology Data Exchange (ETDEWEB)

    Tran, Phuoc [National Energy Technology Lab. (NETL), Pittsburgh, PA, (United State; Mcintyre, Dustin [National Energy Technology Lab. (NETL), Pittsburgh, PA, (United State

    2015-10-01

    We reported our preliminary results on the use of laser-induced breakdown spectroscopy to analyze the rare earth elements contained in ash samples from Powder River Basin sub-bituminous coal (PRB-coal). We have identified many elements in the lanthanide series (cerium, europium, holmium, lanthanum, lutetium, praseodymium, promethium, samarium, terbium, ytterbium) and some elements in the actinide series (actinium, thorium, uranium, plutonium, berkelium, californium) in the ash samples. In addition, various metals were also seen to present in the ash samples

  1. Composition containing transuranic elements for use in the homeopathic treatment of aids

    International Nuclear Information System (INIS)

    A homeopathic remedy consisting of a composition containing one or more transuranic elements, particularly plutonium, for preventing and treating acquired immunodeficiency syndrome (AIDS) in humans, as well as seropositivity for human immunodeficiency virus (HIV). Said composition is characterized in that it uses any chemical or isotopic form of one or more transuranic elements (neptunium, plutonium, americium, curium, berkelium, californium or einsteinium), particularly plutonium, said form being diluted and dynamized according to conventional homeopathic methods, particularly the so-called Hahnemann and Korsakov methods, and provided preferably but not exclusively in the form of lactose and/or saccharose globules or granules impregnated with the active principle of said composition. (author)

  2. NONDESTRUCTIVE IDENTIFICATION OF CHEMICAL WARFARE AGENTS AND EXPLOSIVES BY NEUTRON GENERATOR-DRIVEN PGNAA

    International Nuclear Information System (INIS)

    Prompt gamma-ray neutron activation analysis (PGNAA) is now a proven method for the identification of chemical warfare agents and explosives in military projectiles and storage containers. Idaho National Laboratory is developing a next-generation PGNAA instrument based on the new Ortec Detective mechanically-cooled HPGe detector and a neutron generator. In this paper we review PGNAA analysis of suspect chemical warfare munitions, and we discuss the advantages and disadvantages of replacing the californium-252 radioisotopic neutron source with a compact accelerator neutron generator

  3. Use of trioctylphosphine oxide for transplutonium element extraction and purification

    International Nuclear Information System (INIS)

    Investigated was extraction of tri-valent curium, berkelium, californium, einsteinium as well as cerium and europium with trioctylphosphin oxide from lactic acid solutions, containing DTPA and aluminium nitrate depending on the aluminium nitrate and TOPO concentrations and nitric acid solutions of variable concentration as well. Under optimum conditions of extraction chromatography of berkelium studied was the distribution of cobalt, nickel, chromium, iron, aluminium, titanium, zirconium and niobium ions, and the coefficients of berkelium purification from cations investigated were determined. The effect of weight quantities of cation impurities on extraction chromatographic yield of berkelium has been investigated. Examples of practice application of the extraction chromatography with the use of TOPO are given

  4. PROCEEDINGS OF THE SYMPOSIUM COMMEMORATING THE 25th ANNIVERSARY OF ELEMENTS 97 and 98 HELD ON JAN. 20, 1975

    Energy Technology Data Exchange (ETDEWEB)

    Seaborg, Glenn T.; Street Jr., Kenneth; Thompson, Stanley G.; Ghiorso, Albert

    1976-07-01

    This volume includes the talks given on January 20, 1975, at a symposium in Berkeley on the occasion of the celebration of the 25th anniversary of the discovery of berkelium and californium. Talks were given at this symposium by the four people involved in the discovery of these elements and by a number of people who have made significant contributions in the intervening years to the investigation of their nuclear and chemical properties. The papers are being published here, without editing, in the form in which they were submitted by the authors in the months following the anniversary symposium, and they reflect rather faithfully the remarks made on that occasion.

  5. Neutron crosstalk between liquid scintillators

    Energy Technology Data Exchange (ETDEWEB)

    Verbeke, J. M. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Prasad, M. K. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Snyderman, N. J. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

    2015-05-01

    We propose a method to quantify the fractions of neutrons scattering between liquid scintillators. Using a spontaneous fission source, this method can be utilized to quickly characterize an array of liquid scintillators in terms of crosstalk. The point model theory due to Feynman is corrected to account for these multiple scatterings. Using spectral information measured by the liquid scintillators, fractions of multiple scattering can be estimated, and mass reconstruction of fissile materials under investigation can be improved. Monte Carlo simulations of mono-energetic neutron sources were performed to estimate neutron crosstalk. A californium source in an array of liquid scintillators was modeled to illustrate the improvement of the mass reconstruction.

  6. Study by thermochromatography of fluorides of transuranium elements

    International Nuclear Information System (INIS)

    Thermochromatography was made suitable for fluoride study. So, an investigation of actinide tetrafluorides was accomplished from uranium to californium. Pentavalent and hexavalent fluorospecies of uranium, neptunium, plutonium and ruthenium were studied. Some new compounds have been identified in gaseous phase, whose: PuF5, PuOF3 and PaOF3. Furthermore, some presomptions as for the existence in gaseous phase of EsF4 and of an heptavalent fluorospecies of plutonium have been established. An important analogy between plutonium and ruthenium behaviour with fluorine have been shown, these results could explain the difficulties encountered in the fluoride-volatility processes

  7. Method for measuring multiple scattering corrections between liquid scintillators

    Science.gov (United States)

    Verbeke, J. M.; Glenn, A. M.; Keefer, G. J.; Wurtz, R. E.

    2016-07-01

    A time-of-flight method is proposed to experimentally quantify the fractions of neutrons scattering between scintillators. An array of scintillators is characterized in terms of crosstalk with this method by measuring a californium source, for different neutron energy thresholds. The spectral information recorded by the scintillators can be used to estimate the fractions of neutrons multiple scattering. With the help of a correction to Feynman's point model theory to account for multiple scattering, these fractions can in turn improve the mass reconstruction of fissile materials under investigation.

  8. 24 CFR 886.128 - Termination of tenancy.

    Science.gov (United States)

    2010-04-01

    ... violence, dating violence, or stalking is involved or claimed to be involved, the provisions of 24 CFR part... this title (24 CFR part 247) applies to the termination of tenancy and eviction of a family assisted... citizenship or eligible immigration status, the procedures of 24 CFR parts 247 and 5 shall apply. For...

  9. 78 FR 52562 - Outer Continental Shelf (OCS), Gulf of Mexico (GOM), Oil and Gas Lease Sales, Central Planning...

    Science.gov (United States)

    2013-08-23

    ... Bureau of Ocean Energy Management Outer Continental Shelf (OCS), Gulf of Mexico (GOM), Oil and Gas Lease Sales, Central Planning Area (CPA) Lease Sales 235, 241, and 247 AGENCY: Bureau of Ocean Energy... EIS for proposed Central Planning Area (CPA) Lease Sales 235, 241 and 247 in the Gulf of Mexico...

  10. 48 CFR 52.213-4 - Terms and Conditions-Simplified Acquisitions (Other Than Commercial Items)

    Science.gov (United States)

    2010-10-01

    ... information.) (xii) 52.247-64, Preference for Privately Owned U.S.-Flag Commercial Vessels (FEB 2006) (46 U.S... provide for the provision, the service, or the sale of food in the United States.) (iv) 52.247-29, F.o.b... Federal Register citations affecting 52.213-4, see the List of CFR Sections Affected, which appears in...

  11. 77 FR 3742 - India Infrastructure Business Development Mission-Clarification and Amendment

    Science.gov (United States)

    2012-01-25

    ... Mission, 76 FR, No. 247, December 23, 2011, to amend the Notice to revise the dates of the application... Infrastructure Business Development Mission, 76 FR, No. 247, December 23, 2011, is amended to read as follows... International Trade Administration India Infrastructure Business Development Mission--Clarification...

  12. 76 FR 49787 - Rural Water Supply Program Approved Appraisal Reports; Availability

    Science.gov (United States)

    2011-08-11

    ... North, Billings, MT 59101, (406) 247-7300 Douglas County Rural Water Project Appraisal Report, Bureau of... System Appraisal Report, Bureau of Reclamation, Montana Area Office, 2900 Fourth Avenue North, Billings, MT 59101, (406) 247-7300 Southern Black Hills Regional Water System Appraisal Report, Bureau...

  13. Cultural Economy, Capitalism and the Logic of the Public Sphere

    DEFF Research Database (Denmark)

    Schwarzkopf, Stefan

    2015-01-01

    Review essay: Promotional Cultures: The Rise and Spread of Advertising, Public Relations, Marketing and Branding/ by Aeron Davis. (Polity, 2013, ISBN 978-0-7456-3983-3, 247 + xi pp.......Review essay: Promotional Cultures: The Rise and Spread of Advertising, Public Relations, Marketing and Branding/ by Aeron Davis. (Polity, 2013, ISBN 978-0-7456-3983-3, 247 + xi pp....

  14. Retinitis Pigmentosa Mutations in Bad Response to Refrigeration 2 (Brr2) Impair ATPase and Helicase Activity.

    Science.gov (United States)

    Ledoux, Sarah; Guthrie, Christine

    2016-06-01

    Brr2 is an RNA-dependent ATPase required to unwind the U4/U6 snRNA duplex during spliceosome assembly. Mutations within the ratchet helix of the Brr2 RNA binding channel result in a form of degenerative human blindness known as retinitis pigmentosa (RP). The biochemical consequences of these mutations on Brr2's RNA binding, helicase, and ATPase activity have not yet been characterized. Therefore, we identified the largest construct of Brr2 that is soluble in vitro, which truncates the first 247 amino acids of the N terminus (Δ247-Brr2), to characterize the effects of the RP mutations on Brr2 activity. The Δ247-Brr2 RP mutants exhibit a gradient of severity of weakened RNA binding, reduced helicase activity, and reduced ATPase activity compared with wild type Δ247-Brr2. The globular C-terminal Jab1/Mpn1-like domain of Prp8 increases the ability of Δ247-Brr2 to bind the U4/U6 snRNA duplex at high pH and increases Δ247-Brr2's RNA-dependent ATPase activity and the extent of RNA unwinding. However, this domain of Prp8 does not differentially affect the Δ247-Brr2 RP mutants compared with the wild type Δ247-Brr2. When stimulated by Prp8, wild type Δ247-Brr2 is able to unwind long stable duplexes in vitro, and even the RP mutants capable of binding RNA with tight affinity are incapable of fully unwinding short duplex RNAs. Our data suggest that the RP mutations within the ratchet helix impair Brr2 translocation through RNA helices. PMID:27072132

  15. Dicty_cDB: Contig-U04879-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available length 5062330 Start point 2616612 End point 2616050 Strand (PLUS/MINUS) MINUS Nu...ig-U04879-1Q.Seq.d Length = 562 Score = 490 bits (247), Expect = e-139 Identities = 247/247 (100%) Strand = ...||| Sbjct: 346 ccaacaa 352 Score = 289 bits (146), Expect = 2e-78 Identities = 146/146 (100%) Strand = Plus ...||||||||||||||| Sbjct: 537 aatagagcaaacaagtgtaatgataa 562 Score = 30.2 bits (15), Expect = 2.4 Identities = 15/15 (100%) Strand... = 521 Score = 42.1 bits (21), Expect = 6e-04 Identities = 21/21 (100%) Strand = Plus / Plus Query: 332 taat

  16. Achados Ultra-Sonográficos em Pacientes com Ameaça de Abortamento no Primeiro Trimestre da Gestação Ultrasound Findings in First-trimester Threatened Abortion

    Directory of Open Access Journals (Sweden)

    Luiz Carlos Watanabe

    2000-06-01

    Full Text Available Objetivo: avaliar os achados ultra-sonográficos nas gestantes com ameaça de abortamento no primeiro trimestre da gestação. Métodos: exames de ultra-som obstétrico transabdominal e transvaginal foram realizados nas pacientes com sangramento vaginal e teste de gravidez positivo. Foram incluídas as gestantes entre 6 a 14 semanas de gestação pela data da última menstruação ou pelo exame ultra-sonográfico, que apresentavam colo do útero impérvio ao exame clínico. Foram excluídas as gestações múltiplas ou aquelas que realizaram tentativa de abortamento por meio de drogas ou manipulação. Resultados: em 132 dos 247 casos (53.4% foi diagnosticada gestação viável e em 46.6% (115/247, gestação inviável. Abortamento incompleto foi identificado em 19% (47/247, abortamento completo em 8,5% (21/247, abortamento retido em 7,7% (19/247, gestação anembrionada em 6,1% (15/247, gestação ectópica em 4,5% (11/247 e mola hidatiforme em 0,8% (2/247. Conclusão: aproximadamente metade (46,6% das gestações com ameaça de abortamento no primeiro trimestre apresentaram diagnóstico de inviabilidade da gestação. O exame ultra-sonográfico pode ajudar a definir esta condição e a conduta obstétrica.Objective: to evaluate ultrasound findings in pregnant women with threatened abortion in the first trimester of pregnancy. Methods: transabdominal and transvaginal ultrasound scans were performed in patients with vaginal bleeding with previous positive pregnancy test. Patients with 6-14-week gestation (by the last menstrual period or ultrasound scan, with closed cervix on clinical evaluation were included. Multiple pregnancies and those patients who have tried abortion by using abortive drugs or manipulation were excluded. Results: in 132 of 247 (53.4% the pregnancy was viable and in 46.6% (115/247 the pregnancy was nonviable. Incomplete miscarriage was found in 19% (47/247, complete miscarriage in 8.5% (21/247, missed abortion in 7.7% (19/247

  17. Taxonomy and distribution of benthic foraminifera from the sediments of Palk Strait, Tamil Nadu, east coast of India

    Digital Repository Service at National Institute of Oceanography (India)

    Gandhi, S.; Rajamanickam, G.V.; Nigam, R.

    Institute Nacional de Investigacion de las Ciencias Naturates. ?Bernardino Rivadavia> (Sea Geologicas), 3 : 247-300. Brady, II.B. 1879. Notes on some Retieularian Rhizopoda of the 'Challenger' expedition. Part II. Additions to the knowledge of porcellanous...

  18. Nitrogen oxide air pollution: atmospheric chemistry. 1964-1978 (citations from the NTIS data base). Report for 1964-78

    Energy Technology Data Exchange (ETDEWEB)

    Cavagnaro, D.M.

    1980-10-01

    Research reports on photochemical air pollution models, smog chemistry and reactivity, and SSt exhaust effects are cited in the bibliography. Auroral and upper atmospheric in chemistry, and photochemistry of naturally occurring nitrogen oxides are excluded. (Contains 247 citations)

  19. 77 FR 46948 - The Commerce Control List

    Science.gov (United States)

    2012-08-07

    ... rate sensors, having any of the following see List of Items Controlled) and specially designed... refer to dynamic or servo stability.) (IEEE STD 528-2001 paragraph 2.247) * * * * * BILLING CODE...

  20. Ilmus väärt artiklikogumik / Arvo Tering

    Index Scriptorium Estoniae

    Tering, Arvo, 1949-

    2008-01-01

    Arvustus: Ajalookirjutaja aeg = Aetas historicum / Eesti Rahvusraamatukogu ; koost. Piret Lotman. - Tallinn, 2008. - 247 lk. - (Eesti Rahvusraamatukogu toimetised. A, Raamat ja aeg, 1736-6984 ; nr. 1) ; (Eesti Rahvusraamatukogu toimetised ; 11)

  1. Gclust Server: 154498 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available 154498 SCE_YMR247W-A Cluster Sequences - 47 Identified by expression profiling and mass spectrometry...annotation Identified by expression profiling and mass spectrometry Number of Seq

  2. Data of evolutionary structure change: 1BFVH-1QLRB [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1BFVH-1QLRB 1BFV 1QLR H B QVQLQESGGGLVNLGGSMTLSCVASGFTFNTYYMSWVRQ...--------------------------------VSS---------------------------- EVQLQQWGAGLLKPSETLSLTCAVYGGSFSD...Y CA 247 1QLR B... 1QLRB CARPPHDTSGHY EEE 1 1QLR B 1QLRB

  3. Drug: D00247 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available 247.gif Diuretic Therapeutic category: 2139 ATC code: C03CA02 Loop diuretics Na-K-Cl cotransporter 1 inhibit...A:9376] map07017 Sulfonamide derivatives - diuretics map07233 Ion transporter inh

  4. Pediatric Palliative Care: A Personal Story

    Medline Plus

    Full Text Available ... count__/__total__ Find out why Close Pediatric Palliative Care: A Personal Story NINRnews Subscribe Subscribed Unsubscribe 247 ... and her family. The story demonstrates how palliative care can positively influence a patient's and family's experience ...

  5. Rheumatic heart disease

    Institute of Scientific and Technical Information of China (English)

    1992-01-01

    920657 The relationship between atrialnatriuretic factor and hemodynamics inrheumatic mitral stenosis. XU Zhimin(须志敏), et al. Dept Cardiol, Affil Hosp, Shand-ong Med Univ, Jinan. 25000 Chin Cir J1992; 7(3): 247-250.

  6. 75 FR 81365 - Call for Information: Information on Inputs to Emission Equations Under the Mandatory Reporting...

    Science.gov (United States)

    2010-12-27

    ... information pertaining to reporting of inputs to emission equations under the Mandatory Greenhouse Gas... Mandatory Reporting of Greenhouse Gases Rule; Proposed Rule #0;#0;Federal Register / Vol. 75 , No. 247... EPA's greenhouse gas reporting rule Web site at...

  7. SALINITY, WATER TEMPERATURE, FLUORESCENCE, PHOTOSYNTHETIC ACTIVE RADIATION (PAR) and other profile data collected in the Gulf of Alaska on the ALPHA HELIX cruises HX242, HX244 and others as part of the NEP project from 2001-04-18 to 2003-08-11 (NODC Accession 0115255)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NODC Accession 0115255 includes profile, biological and physical data collected aboard the ALPHA HELIX during cruises HX242, HX244, HX247, HX271 and HX275 in the...

  8. Cypripediquinone A, a new phenanthraquinone from Cypripedium macranthum (Orchidaceae)

    Institute of Scientific and Technical Information of China (English)

    2000-01-01

    A new phenanthraquinone, cypripediquinone A, was isolated from the rhizome of Cypripedium macranthum ( Orchidaceae ) and its structure was established as 2,4,7-trimethoxy-9, 10- phenanthraquinone mainly by spectroscopic analysis.

  9. Proceedings of the Second Environmental Physics Conference (EPC-2006)

    International Nuclear Information System (INIS)

    The publication has been set up as proceedings of the environmental physics conference. the conference consistes of atmospere and climate; the ecosystem; radiation and radioactivity; activity review; environmental issues. This conference consistes of 247p., figs., tabs., refs

  10. 78 FR 49756 - Notification of a Cooperative Agreement Award to the World Health Organization

    Science.gov (United States)

    2013-08-15

    ... the Public Health Service Act, (42 U.S.C. 241 and 247d-7e). Estimated Amount of Award: $290,000 USD... chicken pox, may cause clinical diagnostic confusion. Over the past 10 years, clinical virology...

  11. 78 FR 49757 - Notification of an Expansion to the Cooperative Agreement Award to the World Health Organization

    Science.gov (United States)

    2013-08-15

    ...: Sections 301 and 319L of the Public Health Service Act, (42 U.S.C. 241 and 247d-7e) Estimated Amount of..., such as chicken pox, may cause clinical diagnostic confusion. Over the past 10 years, clinical...

  12. Drug: D01953 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available sts Therapeutic category of drugs in Japan [BR:br08301] 2 Agents affecting individual organs 24 Hormones 247...monal Agents, Stimulant/Replacement/Modifying (Sex Hormones/Modifiers) Estrogens

  13. Drug: D00105 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available 8301] 2 Agents affecting individual organs 24 Hormones 247 Estrogen and progesterone preparations 2473 Estra...(JAN/USP/INN) USP drug classification [BR:br08302] Hormonal Agents, Stimulant/Replacement/Modifying (Sex Hormones

  14. Drug: D00189 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available ng individual organs 24 Hormones 247 Estrogen and progesterone preparations 2479 Others D00189 Pregnanediol ...e as: C05484 Therapeutic category: 2479 Therapeutic category of drugs in Japan [BR:br08301] 2 Agents affecti

  15. Design, synthesis and characterization of bioinspired nanomaterials for engineering and biomedicine

    OpenAIRE

    Ceylan, Hakan

    2014-01-01

    Ankara : The Materials Science and Nanotechnology Program and the Graduate School of Engineering and Science of Bilkent University, 2014. Thesis (Ph. D.) -- Bilkent University, 2014. Includes bibliographical references leaves 227-247. Ceylan, Hakan Ph. D.

  16. Towards a methodology for educational modelling: a case in educational assessment

    OpenAIRE

    Giesbers, Bas; Van Bruggen, Jan; Hermans, Henry; Joosten-ten Brinke, Desirée; Burgers, Jan; Koper, Rob; Latour, Ignace

    2005-01-01

    Giesbers, B., van Bruggen, J., Hermans, H., Joosten-ten Brinke, D., Burgers, J., Koper, R., & Latour, I. (2007). Towards a methodology for educational modelling: a case in educational assessment. Educational Technology & Society, 10 (1), 237-247.

  17. 48 CFR 1652.000 - Applicable clauses.

    Science.gov (United States)

    2010-10-01

    ...-5Covenant Against Contingent Fees. 52.203-7Anti-Kickback Procedures. 52.203-12Limitation on Payments to... Items and Commercial Components. 52.246-25Limitation of Liability—Services. 52.247-63Preference for...

  18. Report on progress of researches by common utilization of JAERI nuclear facilities, for fiscal 1992

    International Nuclear Information System (INIS)

    The results of the joint researches by utilizing the facilities of JAERI in 1992 fiscal year were summarized. The number of research themes in 1992 was 247 cases. In this book, 166 reports are collected. (J.P.N.)

  19. CHLOROPHYLL A, growth rate and graze rate (or grazing rate) site samples data collected in the Gulf of Alaska on the ALPHA HELIX cruises HX242, HX244 and others as part of the NEP project from 2001-04-18 to 2003-08-10 (NODC Accession 0114241)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NODC Accession 0114241 includes site samples and biological data collected aboard the ALPHA HELIX during cruises HX242, HX244, HX247, HX271 and HX275 in the Gulf of...

  20. К вопросу об объекте нарушения правил обращения экологически опасных веществ и отходов (ст. 247 УК)

    OpenAIRE

    ИВАНЦОВА НАТАЛЬЯ ВЛАДИМИРОВНА; ТОЛСТОВ П.В.

    2015-01-01

    Статья посвящена вопросам определения понятия и сущности объекта нарушения правил обращения экологически опасных веществ и отходов, а также места этого посягательства в системе экологических преступлений. В ходе исследования автор приходит к выводу о том, что данное преступление является однообъектным и его непосредственным объектом выступают отношения в сфере экологической безопасности, обеспечивающие соблюдение порядка обращения экологически опасных веществ и отходов....

  1. Alpha1a-Adrenoceptor Genetic Variant Triggers Vascular Smooth Muscle Cell Hyperproliferation and Agonist Induced Hypertrophy via EGFR Transactivation Pathway.

    Directory of Open Access Journals (Sweden)

    Irina Gradinaru

    Full Text Available α1a Adrenergic receptors (α1aARs are the predominant AR subtype in human vascular smooth muscle cells (SMCs. α1aARs in resistance vessels are crucial in the control of blood pressure, yet the impact of naturally occurring human α1aAR genetic variants in cardiovascular disorders remains poorly understood. To this end, we present novel findings demonstrating that 3D cultures of vascular SMCs expressing human α1aAR-247R (247R genetic variant demonstrate significantly increased SMC contractility compared with cells expressing the α1aAR-WT (WT receptor. Stable expression of 247R genetic variant also triggers MMP/EGFR-transactivation dependent serum- and agonist-independent (constitutive hyperproliferation and agonist-dependent hypertrophy of SMCs. Agonist stimulation reduces contractility Using pathway-specific inhibitors we determined that the observed hyperproliferation of 247R-expressing cells is triggered via β-arrestin1/Src/MMP-2/EGFR/ERK-dependent mechanism. MMP-2-specific siRNA inhibited 247R-triggered hyperproliferation indicating MMP-2 involvement in 247R-triggered hyperproliferation in SMCs. β-arrestin1-specific shRNA also inhibited 247R-triggered hyperproliferation but did not affect hypertrophy in 247R-expressing SMCs, indicating that agonist-dependent hypertrophy is independent of β-arrestin1. Our data reveal that in different cardiovascular cells the same human receptor genetic variant can activate alternative modulators of the same signaling pathway. Thus, our findings in SMCs demonstrate that depending on the type of cells expressing the same receptor (or receptor variant, different target-specific inhibitors could be used to modulate aberrant hyperproliferative or hypertrophic pathways in order to restore normal phenotype.

  2. Circulating cell-free DNA and its integrity as a prognostic marker for breast cancer

    OpenAIRE

    Iqbal, Sobuhi; Vishnubhatla, Sreenivas; Raina, Vinod; Sharma, Surabhi; Gogia, Ajay; Suryanarayana S.V. Deo; Mathur, Sandeep; Shukla, Nutan Kumar

    2015-01-01

    The aim of our study was to look for alternative predictive biomarkers for breast cancer management in limited resource setup. A comprehensive analysis of circulating cell-free DNA (CCFD) in serum at baseline was performed to assess its prognostic potential. Quantitative polymerase chain reaction (qPCR) of ALU sequences using ALU115 and ALU247 primers was carried out in patients (N: baseline 148, postoperative 47) and 51 healthy controls. Mean serum DNA integrity, levels of ALU 247 and levels...

  3. Robotics and remote systems applications

    International Nuclear Information System (INIS)

    This article is a review of numerous remote inspection techniques in use at the Savannah River (and other) facilities. These include: (1) reactor tank inspection robot, (2) californium waste removal robot, (3) fuel rod lubrication robot, (4) cesium source manipulation robot, (5) tank 13 survey and decontamination robots, (6) hot gang valve corridor decontamination and junction box removal robots, (7) lead removal from deionizer vessels robot, (8) HB line cleanup robot, (9) remote operation of a front end loader at WIPP, (10) remote overhead video extendible robot, (11) semi-intelligent mobile observing navigator, (12) remote camera systems in the SRS canyons, (13) cameras and borescope for the DWPF, (14) Hanford waste tank camera system, (15) in-tank precipitation camera system, (16) F-area retention basin pipe crawler, (17) waste tank wall crawler and annulus camera, (18) duct inspection, and (19) deionizer resin sampling

  4. Preparation of actinide targets by electrodeposition

    Science.gov (United States)

    Trautmann, N.; Folger, H.

    1989-10-01

    Actinide targets with varying thicknesses on different substrates have been prepared by electrodeposition either from aqueous solutions or from solutions of their nitrates in isopropyl alcohol. With these techniques the actinides can be deposited almost quantitatively on various backing materials within 15 to 30 min. Targets of thorium, uranium, neptunium, plutonium, americium, curium and californium with areal densities from almost carrier-free up to 1.4 mg/cm 2 on thin beryllium, carbon, titanium, tantalum and platinum foils have been prepared. In most cases, prior to the deposition, the actinides had to be purified chemically and for some of them, due to the limited amount of material available, recycling procedures were required. Applications of actinide targets in heavy-ion reactions are briefly discussed.

  5. An atomic beam source for actinide elements: concept and realization

    International Nuclear Information System (INIS)

    For ultratrace analysis of actinide elements and studies of their atomic properties with resonance ionization mass spectroscopy (RIMS), efficient and stable sources of actinide atomic beams are required. The thermodynamics and kinetics of the evaporation of actinide elements and oxides from a variety of metals were considered, including diffusion, desorption, and associative desorption. On this basis various sandwich-type filaments were studied. The most promising system was found to consist of tantalum as the backing material, an electrolytically deposited actinide hydroxide as the source of the element, and a titanium covering layer for its reduction to the metal. Such sandwich sources were experimentally proven to be well suited for the production of atomic beams of plutonium, curium, berkelium and californium at relatively low operating temperatures and with high and reproducible yields. (orig.)

  6. Environmental assessment of the thermal neutron activation explosive detection system for concourse use at US airports

    International Nuclear Information System (INIS)

    This document is an environmental assessment of a system designed to detect the presence of explosives in checked airline baggage or cargo. The system is meant to be installed at the concourse or lobby ticketing areas of US commercial airports and uses a sealed radioactive source of californium-252 to irradiate baggage items. The major impact of the use of this system arises from direct exposure of the public to scattered or leakage radiation from the source and to induced radioactivity in baggage items. Under normal operation and the most likely accident scenarios, the environmental impacts that would be created by the proposed licensing action would not be significant. 44 refs., 19 figs., 18 tabs

  7. Experimental survey of the potential energy surfaces associated with fission

    International Nuclear Information System (INIS)

    Progress in the experimental determination of the properties of the potential energy surface associated with fission is reviewed. The importance of nuclear symmetry effects on the calculation of fission widths is demonstrated. Evidence is presented for the fragmentation of the mass-asymmetric second barrier in the thorium region and the axial asymmetric first barrier in the californium region. Detailed analyses of experimental data suggest the presence of two parallel second barriers; the normal mass-asymmetric, axial-symmetric barrier and a slightly higher mass-symmetric, axial-asymmetric barrier. Experimental barrier parameters are determined systematically and compared with calculations from various theoretical models. Techniques for expanding fission probability measurements to higher energies are discussed. (author)

  8. Populations of selected microbial and fungal species growing on the surface of rape seeds following treatment with desiccants or plant growth regulators.

    Science.gov (United States)

    Frac, Magdalena; Jezierska-Tys, Stefania; Tys, Jerzy

    2010-01-01

    The aim of this study was to determine the effects of desiccants and plant growth regulators on selected microbial species affecting rape seeds, with special emphasis on the growth of fungi and identification of the genus and species composition. The experimental material in the study was seeds of winter rape cv. Californium that were collected from the field during combine harvest. The chemical agents applied, both desiccants and growth regulators, generally decreased the populations of bacteria occurring on the surface of rape seeds. The responses of fungi depended upon the type of agent applied and were manifested as either stimulation or inhibition of the growth of the fungal species. The fungi isolated from the surface of rape seeds were characteristic of those found in the field environment (Cladosporium and Penicillium) and typical for those present on the surface of rape seeds (Alternaria).

  9. Effects of 252Cf neutrons, transmitted through an iron block on human lymphocyte chromosome

    International Nuclear Information System (INIS)

    Chromosome aberration of human peripheral blood lymphocytes exposed to californium-252 (252Cf) neutrons transmitted through a 15 cm thick iron block was analysed. The spectrum of the filtered neutrons ranged from 0.1 to 2MeV with a peak at 0.7 MeV, simulating the Hiroshima atomic bomb neutron spectrum as shown in the Dosimetry System 1986 (DS86). Chromosome aberration frequencies after exposure to filtered and unfiltered 252Cf radiation were compared. Acentric ring chromosomes were significantly increased (p 0.1). The relative biological effectiveness (RBE) of the neutrons with respect to the formation of dicentrics and centric rings was 10.9 and 12.3 in the filtered and unfiltered conditions respectively, but the difference was not statistically significant. These results provide useful information for the re-evaluation of the biological effect of the Hiroshima atomic bomb radiations. (Author)

  10. Reliability of semiconductor and gas-filled diodes for over-voltage protection exposed to ionizing radiation

    Directory of Open Access Journals (Sweden)

    Stanković Koviljka

    2009-01-01

    Full Text Available The wide-spread use of semiconductor and gas-filled diodes for non-linear over-voltage protection results in a variety of possible working conditions. It is therefore essential to have a thorough insight into their reliability in exploitation environments which imply exposure to ionizing radiation. The aim of this paper is to investigate the influence of irradiation on over-voltage diode characteristics by exposing the diodes to californium-252 combined neutron/gamma radiation field. The irradiation of semiconductor over-voltage diodes causes severe degradation of their protection characteristics. On the other hand, gas-filled over-voltage diodes exhibit a temporal improvement of performance. The results are presented with the accompanying theoretical interpretations of the observed changes in over-voltage diode behaviour, based on the interaction of radiation with materials constituting the diodes.

  11. Potential nuclear safeguards applications for neutron generators

    International Nuclear Information System (INIS)

    Many nuclear safeguards inspection instruments use neutron sources to interrogate the fissile material (commonly 235U and 239Pu) to be measured. The neutron sources currently used in these instruments are isotopics such as Californium-252, Americium-Lithium, etc. It is becoming increasingly more difficult to transport isotopic sources from one measurement location to another. This represents a significant problem for the International Atomic Energy Agency (IAEA) safeguards inspectors because they must take their safeguards instruments with them to each nuclear installation to make an independent measurement. Purpose of this paper is to review the possibility of replacing isotopic neutron sources now used in IAEA safeguards instruments with electric neutron sources such as deuterium-tritium (D-T, 14-MeV neutrons) or deuterium-deuterium (D-D, 2-MeV neutrons). The potential for neutron generators to interrogate spent-light water reactor fuel assemblies in storage pools is also reviewed

  12. Off-line commissioning of EBIS and plans for its integration into ATLAS and CARIBU.

    Science.gov (United States)

    Ostroumov, P N; Barcikowski, A; Dickerson, C A; Mustapha, B; Perry, A; Sharamentov, S I; Vondrasek, R C; Zinkann, G

    2016-02-01

    An Electron Beam Ion Source Charge Breeder (EBIS-CB) has been developed at Argonne to breed radioactive beams from the CAlifornium Rare Isotope Breeder Upgrade (CARIBU) facility at Argonne Tandem Linac Accelerator System (ATLAS). The EBIS-CB will replace the existing ECR charge breeder to increase the intensity and significantly improve the purity of reaccelerated radioactive ion beams. The CARIBU EBIS-CB has been successfully commissioned offline with an external singly charged cesium ion source. The performance of the EBIS fully meets the specifications to breed rare isotope beams delivered from CARIBU. The EBIS is being relocated and integrated into ATLAS and CARIBU. A long electrostatic beam transport system including two 180° bends in the vertical plane has been designed. The commissioning of the EBIS and the beam transport system in their permanent location will start at the end of this year. PMID:26932059

  13. Measurements of the neutron capture cross sections and incineration potentials of minor-actinides in high thermal neutron fluxes: Impact on the transmutation of nuclear wastes

    International Nuclear Information System (INIS)

    This thesis comes within the framework of minor-actinide nuclear transmutation studies. First of all, we have evaluated the impact of minor actinide nuclear data uncertainties within the cases of 241Am and 237Np incineration in three different reactor spectra: EFR (fast), GT-MHR (epithermal) and HI-HWR (thermal). The nuclear parameters which give the highest uncertainties were thus highlighted. As a result of fact, we have tried to reduce data uncertainties, in the thermal energy region, for one part of them through experimental campaigns in the moderated high intensity neutron fluxes of ILL reactor (Grenoble). These measurements were focused onto the incineration and transmutation of the americium-241, the curium-244 and the californium-249 isotopes. Finally, the values of 12 different cross sections and the 241Am isomeric branching ratio were precisely measured at thermal energy point. (author)

  14. Environmental assessment of the thermal neutron activation explosive detection system for concourse use at US airports

    Energy Technology Data Exchange (ETDEWEB)

    Jones, C.G.

    1990-08-01

    This document is an environmental assessment of a system designed to detect the presence of explosives in checked airline baggage or cargo. The system is meant to be installed at the concourse or lobby ticketing areas of US commercial airports and uses a sealed radioactive source of californium-252 to irradiate baggage items. The major impact of the use of this system arises from direct exposure of the public to scattered or leakage radiation from the source and to induced radioactivity in baggage items. Under normal operation and the most likely accident scenarios, the environmental impacts that would be created by the proposed licensing action would not be significant. 44 refs., 19 figs., 18 tabs.

  15. Triton and alpha-particle contribution from LiF converter for neutron dosimeter

    CERN Document Server

    Camacho, M E; Balcazar, M

    1999-01-01

    A personnel neutron dosimeter prototype based on chemical and electrochemical etched CR-39 detector, combined with LiF converter, has been calibrated using an ICRP-like phantom, under a heavy-water moderated Californium source neutron spectra; A conversion factor of 1.052+-126 spots cm sup - sup 2 mSv sup - sup 1 was obtained. The sealing properties of the detector holder showed a ten-fold reduction in radon background when it was tested in a high radon atmosphere. A convenient mechanical shock resistance was achieved in LiF converters by sintering to 11 tons pressure LiF powder at 650 deg. C, during one hour.

  16. Nuclear fission and the transuranium elements

    Energy Technology Data Exchange (ETDEWEB)

    Seaborg, G.T.

    1989-02-01

    Many of the transuranium elements are produced and isolated in large quantities through the use of neutrons furnished by nuclear fission reactions: plutonium (atomic number 94) in ton quantities; neptunium (93), americium (95), and curium (96) in kilogram quantities; berkelium (97) in 100 milligram quantities; californium (98) in gram quantities; and einsteinium (99) in milligram quantities. Transuranium isotopes have found many practical applications---as nuclear fuel for the large-scale generation of electricity, as compact, long-lived power sources for use in space exploration, as means for diagnosis and treatment in the medical area, and as tools in numerous industrial processes. Of particular interest is the unusual chemistry and impact of these heaviest elements on the periodic table. This account will feature these aspects. 9 refs., 5 figs.

  17. Measurements of the neutron capture cross sections and incineration potentials of minor-actinides in high thermal neutron fluxes: Impact on the transmutation of nuclear wastes; Mesures des sections efficaces de capture et potentiels d'incineration des actinides mineurs dans les hauts flux de neutrons: Impact sur la transmutation des dechets

    Energy Technology Data Exchange (ETDEWEB)

    Bringer, O

    2007-10-15

    This thesis comes within the framework of minor-actinide nuclear transmutation studies. First of all, we have evaluated the impact of minor actinide nuclear data uncertainties within the cases of {sup 241}Am and {sup 237}Np incineration in three different reactor spectra: EFR (fast), GT-MHR (epithermal) and HI-HWR (thermal). The nuclear parameters which give the highest uncertainties were thus highlighted. As a result of fact, we have tried to reduce data uncertainties, in the thermal energy region, for one part of them through experimental campaigns in the moderated high intensity neutron fluxes of ILL reactor (Grenoble). These measurements were focused onto the incineration and transmutation of the americium-241, the curium-244 and the californium-249 isotopes. Finally, the values of 12 different cross sections and the {sup 241}Am isomeric branching ratio were precisely measured at thermal energy point. (author)

  18. Study of reproducibility of measurements with the spectrometer of Bonner multispheres

    Energy Technology Data Exchange (ETDEWEB)

    Azevedo, G.A.; Pereira, W.W.; Patrao, K.C.S.; Fonseca, E.S., E-mail: geisadeazevedo@gmail.com, E-mail: walsan@ird.gov.br, E-mail: karla@ird.gov.br, E-mail: evaldo@ird.gov.br [Instituto de Radionprotecao e Dosimetria (IRD/CNEN-RJ), Rio de Janeiro, RJ (Brazil)

    2013-07-01

    This work aims to study the metrological behavior of the Bonner Multisphere Spectrometer (BMS) of the LN / LNMRI / IRD - Laboratorio Metrologia de Neutrons / Laboratorio Nacional de Metrologia e Radiacao Ionizante / Instituto de Radioprotecao e Dosimetria, for measurements in repeatability and reproducibility conditions. Initially, a simulation was done by applying the Monte Carlo method, using the MCNP code and respecting the ISO 8529-1 (2001), using the sources of Californium ({sup 252} Cf), Americium-Beryllium ({sup 241} AmBe) and californium in heavy water (Cf + D{sub 2}O), all located at a distance of 100 cm from the neutron detector ({sup 6}Li (Eu) - crystal scintillator). In this program, the counting of neutrons that are captured by the detector was made. The source is located in the center of a sphere of radius 300 cm. Analyzes the impact of these neutrons in a point of the sphere wall, which in this case acted as a neutron detector and from there, it is estimated the number of neutrons that collide in the whole sphere. The purpose is to obtain the neutron count for different energy bands in a solid field of neutrons, since they have a spectrum ranging from a low to a high energy that can also vary within a particular environment. Wishes to obtain new fields with different sources and moderators materials to be used as new reference fields. Measurements are being conducted for these fields, with the aim of analyzing the variability conditions of the measurement (repeatability and reproducibility) in LEN - Laboratorio de Espectrometria de Neutrons of the LN/LMNRI/IRD. Thus, the spectrometer will be used to improve both the knowledge of the spectrum as the standard of neutrons of the lab, proving that a spectrometry is essential for correct measurement.

  19. Improvement of Soil Carbon Determination using laser-induced breakdown spectroscopy

    Science.gov (United States)

    Moon, S. J.

    2014-12-01

    The increase of atmospheric greenhouse gases such as CO2 has caused noticeable climate change. Since increased CO2 may contribute to carbon storage in terrestrial ecosystems through the CO2 cycle between the atmosphere and vegetation, it is necessary to improve methods for measuring C in soil. In this study, we determined the total carbon concentrations of soils using a laser-induced breakdown spectroscopy (LIBS). The LIBS is a minimally destructive measurement technique that uses an ultra-short laser pulse to create plasma on the sample surface via the process of laser ablation. Compared with the traditional C measurements methods techniques such as wet oxidation and dry combustion, LIBS is known as a potentially elegant and promising solution for measuring C in soils. Although previous studies suggested the advantages of LIBS for measuring the C in soils, there are still challenging obstacles to be solved in measuring C. Previous studies have shown that the C in soil can be detected at wavelengths of 193.03 and 247.86 nm. The C line at 247.86 nm shows strong interference with Fe lines at 247.86 nm and 247.95 nm due to overlapping or self-absorption. To dismiss the problem of measuring the C line at 247.86 nm, the C line at 193.03 nm has been used to observe C emission. The C line at 193.03 nm can be quantified without interference from other elements, however, the ratio of Al line (198.90 nm) and Si line (212.40 nm) were used as standardizing factors to develop a significant calibration curve for soils. Although the wavelengths of both 193.03 and 247.86 nm presented the potential to measure C in soils, there has still been a lack of studies comparing the accuracy and effectiveness between the 193.03- and 247.8-nm C lines to analyze soil samples with different chemical and textural characteristics. In this study, we conducted extensive measurements of the C lines at 193.03 and 247.86 nm using LIBS to evaluate the C concentrations of Korean soils with different

  20. Analysis of the contribution of the hinge region of human neutrophil collagenase (HNC, MMP-8) to stability and collagenolytic activity by alanine scanning mutagenesis.

    Science.gov (United States)

    Knäuper, V; Docherty, A J; Smith, B; Tschesche, H; Murphy, G

    1997-03-17

    Analysis of the hinge region of neutrophil collagenase by alanine scanning mutagenesis revealed that this sequence motif has a pronounced effect on the stability and collagenolytic activity of the active enzyme. The mutagenesis of the amino acid residues in the P1' position of the two autoproteolytically cleaved peptide bonds (Leu243 and Ile248) to Ala showed that the mutant enzymes were more resistant to autoproteolysis. However, these mutants were not completely stable and autoproteolysis occurred mainly at the Ala239-Ile240 peptide bond and the half-life of the active enzyme was increased by 50%. In contrast, mutagenesis of Pro247 --> Ala (P1 of the minor cleavage site Pro247-Ile248) lead to increased susceptibility of the enzyme to autoproteolysis. However, when the other P1 position Gly242 was altered to Ala no effect on stability was observed. The analysis of the ability of the mutant active enzymes to hydrolyse 14C-type I collagen was assessed and our results demonstrate that the hinge sequence motif of neutrophil collagenase is important for collagenolytic activity. The alteration of the Gly242-Leu-Ser-Ser-Asn-Pro-Ile-Gln-Pro247 sequence motif to Gly242-Ala-Ala-Ala-Ala-Pro-Ala-Ala-Pro247 showed that the collagenolytic activity was reduced by 68.4%. In addition, mutagenesis of the downstream sequence motif Pro247-Thr-Gly-Pro-Ser-Thr-Pro-Lys-Pro258 to Pro247-Ala-Ala-Pro-Ala-Ala-Pro-Ala-Pro258 had an even more marked effect on the collagenolytic activity, which was reduced by 87.4%. When the Pro residues in the hinge motif (Pro247, Pro250, Pro253 and Pro256) were altered to Ala the collagenolytic activity dropped to 1.5% of the value observed for wild-type enzyme.

  1. Percutaneous vertebroplasty - the role of osseous phlebography; Die perkutane Vertebroplastie - Rolle der ossaeren Phlebographie

    Energy Technology Data Exchange (ETDEWEB)

    Hierholzer, J.; Fuchs, H.; Westphalen, K.; Venz, S. [Diagnostische und Interventionelle Radiologie, Klinikum Ernst-von-Bergmann gGmbH, Potsdam (Germany); Pappert, D. [Klinik fuer Anaesthesiologie und Intensivtherapie, Klinikum Ernst-von-Bergmann gGmbH, Potsdam (Germany); Depriester, C. [Clinique DuBois, Lille (France)

    2005-03-01

    Purpose: To evaluate the usefulness of osseous phlebography preceding percutaneous vertebroplasty. Materials and Methods: Seventy-five patients with painful osteoporotic (57) or malignant (18) vertebral fractures were treated by percutaneous vertebroplasty under fluoroscopic control. Prior to cement injection, osseous phlebography was performed, with 247 phlebographic studies included in the retrospective correlation with radiographic and CT images. Clinical results were assessed by standardized questionnaire. Results: In 69/75 (92%) patients, pain and mobility improved and medication needed for pain control decreased significantly after vertebroplasty. Two clinically apparent complications occurred. The results of osseous phlebography prompted correction of the needle position in 34/247 (14%) of the procedures and cancellation of the cement injection in 19/247 (8%). No complications occurred related to osseous phlebography. CT was superior to conventional radiography in detecting extra-osseous cement leakage (106/247 by CT vs. 63/247 by conventional radiography). The cement leakage was asymptomatic in 104/106 (98%) cases for the duration of follow-up. Discussion: Osseous phlebography prior to percutaneous vertebroplasty had a significant impact on the procedure in our retrospective study and was able to predict the cement distribution in the majority of cases. However, phlebography was unable to foresee and therefore prevent 2 clinically relevant complications. Complications related to phlebography did not occur. (orig.)

  2. Origin of uranium isotope variations in early solar nebula condensates

    CERN Document Server

    Tissot, Francois L H; Grossman, Lawrence

    2016-01-01

    High temperature condensates found in meteorites display uranium isotopic variations (235U/238U) that complicate dating of the formation of the Solar System and whose origin remains mysterious. It is possible that these variations are due to decay of the short-lived radionuclide 247Cm (t1/2=15.6 Myr) into 235U but they could also be due to uranium kinetic isotopic fractionation during condensation. We report uranium isotope measurements of meteoritic refractory inclusions that reveal excesses of 235U reaching ~+6 % relative to average solar system composition, which can only be due to decay of 247Cm. This allows us to constrain the 247Cm/235U ratio at Solar System formation to (1.1 +- 0.3) x 10-4. This value provides new clues on the universality of nucleosynthetic r-process of rapid neutron capture.

  3. Single crystal growth of YBa2Cu4O8 and Y2Ba4Cu7O15 under high oxygen pressure

    International Nuclear Information System (INIS)

    In this paper, the authors investigate the crystal growth of YBa2Cu4O8 (124) and Y2Ba4Cu7O15 (247) in Al2O3 crucibles at an oxygen partial pressure of 10 MPa employing an O2-HIP apparatus in a mixed gas environment of Ar-20% O2. Various melts compositions, rich in Ba and Cu, are explored to optimize crystal growth of 124. Large 124 single crystals up to a size of 1 x 0.5 x 0.05 mm3 are obtained from compositions with about 65 ∼ 67% CuO. 247 crystals having a maximum size of 3 x 1.5 x 0.05 mm3 are grown from the same composition of melts. 124 crystals exhibit superconductivity at 75K. 247 crystals show Tc of 20K

  4. Origin of uranium isotope variations in early solar nebula condensates.

    Science.gov (United States)

    Tissot, François L H; Dauphas, Nicolas; Grossman, Lawrence

    2016-03-01

    High-temperature condensates found in meteorites display uranium isotopic variations ((235)U/(238)U), which complicate dating the solar system's formation and whose origin remains mysterious. It is possible that these variations are due to the decay of the short-lived radionuclide (247)Cm (t 1/2 = 15.6 My) into (235)U, but they could also be due to uranium kinetic isotopic fractionation during condensation. We report uranium isotope measurements of meteoritic refractory inclusions that reveal excesses of (235)U reaching ~+6% relative to average solar system composition, which can only be due to the decay of (247)Cm. This allows us to constrain the (247)Cm/(235)U ratio at solar system formation to (1.1 ± 0.3) × 10(-4). This value provides new clues on the universality of the nucleosynthetic r-process of rapid neutron capture.

  5. Origin of uranium isotope variations in early solar nebula condensates.

    Science.gov (United States)

    Tissot, François L H; Dauphas, Nicolas; Grossman, Lawrence

    2016-03-01

    High-temperature condensates found in meteorites display uranium isotopic variations ((235)U/(238)U), which complicate dating the solar system's formation and whose origin remains mysterious. It is possible that these variations are due to the decay of the short-lived radionuclide (247)Cm (t 1/2 = 15.6 My) into (235)U, but they could also be due to uranium kinetic isotopic fractionation during condensation. We report uranium isotope measurements of meteoritic refractory inclusions that reveal excesses of (235)U reaching ~+6% relative to average solar system composition, which can only be due to the decay of (247)Cm. This allows us to constrain the (247)Cm/(235)U ratio at solar system formation to (1.1 ± 0.3) × 10(-4). This value provides new clues on the universality of the nucleosynthetic r-process of rapid neutron capture. PMID:26973874

  6. Drug: D08343 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D08343 Drug Pethidine (INN); Meperidine; Pethidine DBL (TN) C15H21NO2 247.1572 247.3327 D08343.gif Opioi...d analgesic Same as: C07128 ATC code: N02AB02 Synthesis opioid mu-opioid receptor agoni...st [HSA:4988] [KO:K04215] hsa04080(4988) Neuroactive ligand-receptor interaction map07028 Antipsychotics map07039 Opioi...d analgesics map07224 Opioid receptor agonists/antagonists Anatomical ...Therapeutic Chemical (ATC) classification [BR:br08303] N NERVOUS SYSTEM N02 ANALGESICS N02A OPIOIDS N02AB Ph

  7. Cell Persistence of Allogeneic Keratinocytes and Fibroblasts Applied in a Fibrin Matrix to Acute, Full Thickness Wounds

    OpenAIRE

    Dickerson, Jaime E; Planz, John V.; Reece, Barry T.; Weedon, Kathy A.; Kirkpatrick, Sandy D.; Slade, Herbert B

    2012-01-01

    HP802-247 is a living cell suspension of cultured allogeneic growth-arrested human male keratinocytes and fibroblasts (1:9 ratio), intended for spray application to chronic wounds. In this study, a small wound was created on the arms of 28 healthy female volunteers (3-mm punch), followed by a single application of HP802-247. At each subsequent week for 8 weeks, a punch excision of the wounds was performed on a cohort of three subjects. Excised specimens were analyzed for allogeneic fibroblast...

  8. Drug: D08100 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D08100 Drug Ketobemidone (INN) C15H21NO2 247.1572 247.3327 D08100.gif Opioid Analge... NERVOUS SYSTEM N02 ANALGESICS N02A OPIOIDS N02AB Phenylpiperidine derivatives N02AB01 Ketobemidone D08100 K...04 2905 2906] [KO:K05208 K05209 K05210 K05211 K05212] Ketobemidone [ATC:N02AB01] D08100 Ketobemidone (INN) C...AS: 469-79-4 PubChem: 96024790 LigandBox: D08100 NIKKAJI: J5.929C ATOM 18 1 C1z C

  9. 12-core x 3-mode Dense Space Division Multiplexed Transmission over 40 km Employing Multi-carrier Signals with Parallel MIMO Equalization

    DEFF Research Database (Denmark)

    Mizuno, T.; Kobayashi, T.; Takara, H.;

    2014-01-01

    We demonstrate dense SDM transmission of 20-WDM multi-carrier PDM-32QAM signals over a 40-km 12-core x 3-mode fiber with 247.9-b/s/Hz spectral efficiency. Parallel MIMO equalization enables 21-ns DMD compensation with 61 TDE taps per subcarrier.......We demonstrate dense SDM transmission of 20-WDM multi-carrier PDM-32QAM signals over a 40-km 12-core x 3-mode fiber with 247.9-b/s/Hz spectral efficiency. Parallel MIMO equalization enables 21-ns DMD compensation with 61 TDE taps per subcarrier....

  10. Mothers’ non-standard working and childcare-related challenges : A comparison between lone and coupled mothers

    OpenAIRE

    Moilanen, Sanna; May, Vanessa; Räikkönen, Eija; Sevón, Eija; Laakso, Marja-Leena

    2016-01-01

    Purpose – The purpose of this paper is to particularly focus on lone-mother families, comparing the childcare-related challenges experienced by working lone mothers and coupled mothers in three European countries in the context of a 24/7 economy and non-standard working hours (e.g. evening, night and weekend work). Design/methodology/approach – This study utilises survey data from Finnish, Dutch and British working mothers (n=1,106) collected as part of the “Families 24/7” research ...

  11. Carbon isotope systematics of individual hydrocarbons in hydrothermal petroleum from Escanaba Trough, Northeastern Pacific Ocean

    Science.gov (United States)

    Simoneit, B.R.T.; Schoell, M.; Kvenvolden, K.A.

    1997-01-01

    We submitted individual aliphatic and polycyclic aromatic hydrocarbons in samples of hydrothermal petroleum from Escanaba trough to compound specific isotope analysis to trace their origins. The carbon isotope compositions of the alkanes and polycyclic aromatic hydrocarbons (means -27.5 and -24.7%, respectively) reflect a primarily terrestrial organic matter source.We submitted individual aliphatic and polycyclic aromatic hydrocarbons in samples of hydrothermal petroleum from Escanaba Trough to compound specific isotope analysis to trace their origins. The carbon isotope compositions of the alkanes and polycyclic aromatic hydrocarbons (means -27.5 and -24.7 per mill, respectively) reflect a primarily terrestrial organic matter source.

  12. New Antioxidative Secondary Metabolites from the Fruits of a Beibu Gulf Mangrove, Avicennia marina

    Directory of Open Access Journals (Sweden)

    Cheng-Hai Gao

    2014-07-01

    Full Text Available Further chemical investigation of the fruits of the mangrove, Avicennia marina, afforded three new phenylethyl glycosides, marinoids J–L (1–3, and a new cinnamoyl glycoside, marinoid M (4. The structures of isolates were elucidated on the basis of extensive spectroscopic analysis and by comparison of the data with those of related secondary metabolites. The antioxidant activity of the isolates was evaluated using the cellular antioxidant assay (CAA, and compounds 1–4 showed antioxidant activities, with EC50 values ranging from 23.0 ± 0.71 μM to 247.8 ± 2.47 μM.

  13. TET2 mutations in secondary acute myeloid leukemias: a French retrospective study

    OpenAIRE

    Kosmider, Olivier; Delabesse, Eric; Mas, Véronique Mansat-De; Cornillet-Lefebvre, Pascale; Blanchet, Odile; Delmer, Alain; Recher, Christian; Raynaud, Sophie; Bouscary, Didier; Viguié, Franck; Lacombe, Catherine; Bernard, Olivier A.; Ifrah, Norbert; Dreyfus, François; Fontenay, Michaëla

    2011-01-01

    Ten-eleven translocation 2 (TET2) mutations have been involved in myeloid malignancies. This retrospective study aims at evaluating the frequency and impact of TET2 mutations in 247 secondary acute myeloid leukemia cases referred to as myelodysplasia-related changes (n=201) or therapy-related (n=46) leukemias. Mutation of at least one copy of the TET2 gene was detected in 49 of 247 (19.8%) patients who presented with older age, higher hemoglobin level, higher neutrophil and monocyte counts, a...

  14. 脑胶质瘤患者血清及脑脊液中游离DNA的检测%Diagnostic value of the content and integrity of free DNA in patients with glioma

    Institute of Scientific and Technical Information of China (English)

    陈建; 施炜; 吕成林; 夏亮; 戚青; 景蓉蓉; 鞠少卿

    2012-01-01

    目的 检测不同级别脑胶质瘤患者血清及脑脊液中游离DNA的含量及完整性,探讨其对脑胶质瘤的诊断及预后判断的意义.方法 术前采集70例脑胶质瘤患者和22例健康对照的外周血;其中30例胶质瘤患者同时采集脑脊液.通过实时荧光定量聚合酶链反应( RT-qPCR)方法检测血清及脑脊液中游离DNA短串联重复序列(ALU)的长片段(247 bp)与短片段(115 bp)的含量以及DNA完整性.结果 血清中ALU-247 bp与115 bp含量以及游离DNA完整性在胶质瘤组与对照组间差异无统计学意义(P>0.05).脑脊液中游离DNA ALU-247 bp与115 bp含量均较非肿瘤对照组高,DNA完整性(ALU-247/ALU-115 bp)较对照组也显著增高.ROC曲线分析ALU-247 bp,ALU-115 bp含量与DNA完整性的AUC分别为0.775、0.875和0.912.结论 胶质瘤患者术前脑脊液中游离DNA ALU-247 bp、ALU-115 bp的含量以及DNA完整性对胶质瘤的术前诊断具有一定价值.%Objective To detect the content of free DNA and the DNA integrity in serum and cerebrospinal fluid (CSF) from glioma patients in order to assess their diagnostic value for the glioma.Methods Serum samples were obtained from 70 patients with glioma and 22 healthy volunteers as controls,and CSF samples from 20 patients with glioma and 8 nonneoplastic controls with hydrocephalus or arachnoid cyst.Free DNA concentration and integrity were detected by using real-time quantitative polymerase chain reaction (RT-qPCR) before operation.With 2 primers sets amplifying short and long free DNA fragments ( ALU115 and ALU247 ),free DNA integrity was determined by ratio of the concentration of ALU247 over ALU115 (ALU 247/115).Results The concentration of serum ALU had no significant differences between glioma patients and healthy controls.ALU115 and ALU247 contents,and free DNA integrity in CSF were significantly higher in glioma patients than in the controls ( all P<0.05 ).Area under curve of ROC curve analysis for the CSF

  15. The Development of Neutron Radiography and Tomography on a SLOWPOKE-2 Reactor

    Science.gov (United States)

    Bennett, L. G. I.; Lewis, W. J.; Hungler, P. C.

    Development of neutron radiography at the Royal Military College of Canada (RMC) started by trying to interest the Royal Canadian Air Force (RCAF) in this new non-destructive testing (NDT) technique. A Californium-252 based device was ordered and then installed at RMC for development of applicable techniques for aircraft by the first author. A second and transportable device was then designed, modified and used in trials at RCAF Bases and other locations for one year. This activity was the only foreign loan of the U.S. Californium Loan Program. Around this time, SLOWPOKE-2 reactors were being installed at four Canadian universities, while a new science and engineering building was being built at RMC. A reactor pool was incorporated and efforts to procure a reactor succeeded a decade later with a SLOWPOKE-2 reactor being installed at RMC. The only modification by the vendor for RMC was a thermal column replacing an irradiation site inside the reactor container for a later installation of a neutron beam tube (NBT). Development of a working NBT took several years, starting with the second author. A demonstration of the actual worth of neutron radiography took place with a CF-18 Hornet aircraft being neutron and X-radiographed at McClellan Air Force Base, Sacramento, CA. This inspection was followed by one of the rudders that had indications of water ingress being radiographed successfully at RMC just after the NBT became functional. The next step was to develop a neutron radioscopy system (NRS), initially employing film and then digital imaging, and is in use today for all flight control surfaces (FCS). With the third author, a technique capable of removing water from affected FCS was developed at RMC. Heating equipment and a vacuum system were utilized to carefully remove the water. This technique was proven using a sequence of near real time neutron images obtained during the drying process. The results of the drying process were correlated with a relative humidity

  16. Marijuana

    Science.gov (United States)

    ... J Drug Policy . 2015;26(2):135-142. doi:10.1016/j.drugpo.2014.07.011. Panlilio LV, Zanettini ... Alcohol Depend . 2008;92(1-3):239-247. doi:10.1016/j.drugalcdep.2007.08.005. This publication is ...

  17. Data of evolutionary structure change: 1YLJA-3BLMA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1YLJA-3BLMA 1YLJ 3BLM A A QTSAVQQKLAALEKSSGGRLGVALIDTADNTQVLYRGDE... 194 LEU CA 258 LEU CA 327 ASN CA 247 3BLM... A 3BLMA LLEQVPYNKL... CA 338 THR CA 465 THR CA 490 3BLM... A 3BLMA KSGQ

  18. Contrasts and Similarities in Attitudes toward Death of Health Care Providers.

    Science.gov (United States)

    Clair, Jeffrey Michael; Hashimoto, Shige

    Although death and the circumstances surrounding it are inevitable for all people, open discussions of this subject are considered morbid and thus taboo. The fear of death, however, greatly affects the care administered to dying patients in a health care setting by professionals, family, and friends. A mail survey was administered to 247

  19. Teachers' Job Characteristics and Motivation.

    Science.gov (United States)

    Barnabe, Clermont; Burns, Mildred

    1994-01-01

    To test the Job Characteristics Model of Motivation, 247 Quebec teachers completed the Job Diagnostic Survey. Results demonstrated the utility of the model and the instrument for the teaching profession. Psychological states influenced the relationship between job characteristics and motivation/satisfaction outcomes. (SK)

  20. 48 CFR 3447.7000 - Foreign travel clause.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 7 2010-10-01 2010-10-01 false Foreign travel clause... REGULATION CONTRACT MANAGEMENT TRANSPORTATION Foreign Travel 3447.7000 Foreign travel clause. The contracting officer shall insert the clause in 3452.247-70, Foreign Travel, in all solicitations and resultant...

  1. 25 CFR 700.245 - Time limits on processing of initial requests.

    Science.gov (United States)

    2010-04-01

    ... public holidays) after receipt of a request. This determination shall be communicated immediately to the..., but in no case may the time limit be extended for more than ten (10) working days: (1) The need to... of the running of the twenty (20) working-day appeal period set out in § 700.247. If a...

  2. Understanding Elementary Astronomy by Making Drawing-Based Models

    Science.gov (United States)

    van Joolingen, W. R.; Aukes, Annika V.; Gijlers, H.; Bollen, L.

    2015-01-01

    Modeling is an important approach in the teaching and learning of science. In this study, we attempt to bring modeling within the reach of young children by creating the SimSketch modeling system, which is based on freehand drawings that can be turned into simulations. This system was used by 247 children (ages ranging from 7 to 15) to create a…

  3. The Contribution of the Library to the Reputation of a University

    Science.gov (United States)

    Weiner, Sharon

    2009-01-01

    This paper explores the relationship between a peer-assessed reputation rating for each of the 247 doctoral universities and cross-institutional performance indicators for universities and their libraries. Using multiple regression, the variable of library expenditures, was the only consistently significant one using combinations of variables.…

  4. Utilfredsstillende langtidsresultater efter konservativ behandling af patellofemoralt smertesyndrom

    DEFF Research Database (Denmark)

    Rathleff, Michael Skovdal; Rasmussen, Sten; Olesen, Jens Lykkegaard

    2012-01-01

    This review overviews the long-term prognosis of conservatively treated patients with patellofemoral pain syndrome (PFPS). Median values of the 16 included studies show that 29% of soldiers, 27.8% of sports active and 24,7% of the general public will become pain free after they are diagnosed...

  5. The Modes of Communication Used by Children with Cochlear Implants and the Role of Sign in Their Lives

    Science.gov (United States)

    Hyde, Merv; Punch, Renee

    2011-01-01

    In a mixed-methods study, which included surveys of 247 parents and 151 teachers, the researchers investigated the modes of communication used by children with cochlear implants and the role of signed communication in the children's lives. Findings indicated that 15%-20% of the children in the parent surveys and approximately 30% of the children…

  6. Deme accounts and the meaning of hosios money in fifth-century Athens

    NARCIS (Netherlands)

    Blok, J.H.

    2010-01-01

    Comparing the accounts of the deme Ikarion (IG I3 253) with those of Rhamnous (IG I3 247 bis and 253; IRhamnous 181 and 182) and Plotheia (IG I3 258), this article argues that the adjective hosios applied to a fund in Ikarion indicates that this money was dêmosios and to be used in a way pleasing to

  7. 7 CFR 2902.22 - Fertilizers.

    Science.gov (United States)

    2010-01-01

    ... Procurement Guideline, 40 CFR 247.15. EPA provides recovered materials content recommendations for fertilizers... 7 Agriculture 15 2010-01-01 2010-01-01 false Fertilizers. 2902.22 Section 2902.22 Agriculture... Fertilizers. (a) Definition. Products formulated or processed to provide nutrients for plant growth...

  8. Attachment, Autonomy, and Emotional Reliance: A Multilevel Model

    Science.gov (United States)

    Lynch, Martin F.

    2013-01-01

    This article reports a test of a multilevel model investigating how attachment security and autonomy contribute to emotional reliance, or the willingness to seek interpersonal support. Participants ("N" = 247) completed online measures of attachment, autonomy, emotional reliance, and vitality with respect to several everyday…

  9. The Relationships between Shyness and Unsociability and Peer Difficulties: The Moderating Role of Insecure Attachment

    Science.gov (United States)

    Chen, Bin-Bin; Santo, Jonathan Bruce

    2016-01-01

    The main purpose of the study was to examine the moderating role of the insecure mother-child attachment in the relations between social withdraw and peer difficulties. Participants were 487 urban children (247 boys, 240 girls) in elementary schools in Shanghai, the People's Republic of China. Data on attachment-relevant coping styles in insecure…

  10. The DNA methylome of human peripheral blood mononuclear cells

    DEFF Research Database (Denmark)

    Li, Yingrui; Zhu, Jingde; Tian, Geng;

    2010-01-01

    DNA methylation plays an important role in biological processes in human health and disease. Recent technological advances allow unbiased whole-genome DNA methylation (methylome) analysis to be carried out on human cells. Using whole-genome bisulfite sequencing at 24.7-fold coverage (12.3-fold per...

  11. Reactivity of Alkyldibenzothiophenes Using Theoretical Descriptors

    Directory of Open Access Journals (Sweden)

    Jose Luis Rivera

    2014-01-01

    Full Text Available Theoretical calculations of the reactivity of dibenzothiophene and its methyl, dimethyl, and trimethyl derivatives show that local reactivity descriptors reproduce their experimental desulfurization reactivity trend if the first desulfurization step involves directly the sulfur atom, which only occurs if the sulfur atom is blocked at most by one methyl group. In the series of molecules {4,7-dimethyldibenzothiophene, x,4,7-trimethyldibenzothiophene (x=1,2,3}, the most reactive molecule is 2,4,7-trimethyldibenzothiophene, and local descriptors show that the reactivity is linked to the activity of the sulfur atom, which is higher in 2,4,7-trimethyldibenzothiophene due to the position of the third methyl substitute, located in the para position with respect to the carbon bonded to the sulfur atom. The electrostatic potential of 2,4,7-trimethyldibenzothiophene shows one effective adsorption site, while 1,4,7-trimethyldibenzothiophene and 3,4,7-trimethyldibenzothiophene have more sites, contributing to the higher reactivity of 2,4,7-trimethyldibenzothiophene. The index of reactivity of other descriptors was evaluated and the effect of the position of the methyl substituents on adsorption parameters, as the dipole moment and the atomic charges were also studied.

  12. Examining Gender with General Creativity and Preferences for Creative Persons in College Students within the Sciences and the Arts

    Science.gov (United States)

    Charyton, Christine; Basham, Kimberly M.; Elliott, John O.

    2008-01-01

    The purpose of the research was to investigate gender similarities and differences in general creativity constructs with their preferences for creative persons. Data were collected from 247 participants (87 engineering, 24 psychology students with a psychology major, 51 psychology students with a major other than psychology, 30 English, and 55…

  13. 49 CFR 174.86 - Maximum allowable operating speed.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 2 2010-10-01 2010-10-01 false Maximum allowable operating speed. 174.86 Section... operating speed. (a) For molten metals and molten glass shipped in packagings other than those prescribed in § 173.247 of this subchapter, the maximum allowable operating speed may not exceed 24 km/hour (15...

  14. The Role of Individualism-Collectivism in the Individual Creative Process

    Science.gov (United States)

    Yao, Xiang; Wang, Shuhong; Dang, Junhua; Wang, Lei

    2012-01-01

    This study is among the first to examine how individuals' cultural value orientations impact 2 separate stages of creativity: idea generation and idea implementation. A total of 247 Chinese employees completed questionnaires including individualism-collectivism culture orientation and their idea generation behavior. Supervisor ratings of idea…

  15. 78 FR 6056 - Designation of Payor as Agent To Perform Acts Required of an Employer

    Science.gov (United States)

    2013-01-29

    ... Federal Register on January 13, 2010, (75 FR 1735-01). Pursuant to section 3504 and the regulations, the.... United States, 419 U.S. 43, 95 S. Ct. 247, 42 L. Ed. 2d 212 (1974); In re Armadillo Corp., 410 F....

  16. Microstress evolution during in situ loading of a superalloy containing high volume fraction of {gamma}{sup '} phase

    Energy Technology Data Exchange (ETDEWEB)

    Ma, S.; Rangaswamy, P.; Majumdar, B.S

    2003-03-03

    Pulsed neutron diffraction under in situ mechanical loading was used to monitor microstrain evolution in individual phases of a polycrystalline {gamma}/{gamma}{sup '} superalloy, CM 247 LC. The load partitioning and yielding of differently oriented grains and phases were evaluated. The critical resolved shear stresses of individual phases were obtained and are compared with dislocation models.

  17. Prevalence and diversity of Campylobacter jejuni in pig herds on farms with and without cattle or poultry

    DEFF Research Database (Denmark)

    Boes, J.; Nersting, L.; Nielsen, Eva;

    2005-01-01

    The prevalence and diversity of Campylobacter jejuni was investigated in pig herds on farms with and without cattle or poultry production. A bacteriological screening of pig cecal samples from 247 finisher herds was carried out at the slaughterhouse. Subsequently, a follow-up study was conducted ...

  18. Work Design, Role Conflict, and Role Ambiguity: The Case of Elementary and Secondary Schools.

    Science.gov (United States)

    Bacharach, Samuel B.; And Others

    1990-01-01

    Work design outcomes (role conflict, role ambiguity, stress symptomatology, turnover, and militancy) were assessed in New York State. Out of 3,200 mailed surveys, 2,247 teacher questionnaires were returned and analyzed. Managerial and educational policy implications of the findings for elementary school and secondary schools are discussed. (SLD)

  19. "You Cannot Talk with All of the Strangers in a Pub": A Longitudinal Case Study of International Postgraduate Students' Social Ties at a British University

    Science.gov (United States)

    Schartner, Alina

    2015-01-01

    The formation of social ties is a major factor in the international student experience (Ramsay et al. in High Educ 54(2):247-265, 2007), influencing student wellbeing and adjustment to the new academic and sociocultural environment (Ward et al. in The psychology of culture shock. Routledge, Hove, 2001). Although a significant body of research in…

  20. Evaluating Career Success of African American Males: It's What You Know and Who You Are that Matters

    Science.gov (United States)

    Johnson, C. Douglas; Eby, Lillian T.

    2011-01-01

    The objectives of the present study were to identify the factors related to career success of college educated, African American men and to explore the relative importance of human capital, social capital, individual differences, and demographic attributes in predicting career success. Using a sample of 247 African American males, we found some…

  1. Genetic variants of the human dipeptide transporter PEPT1

    DEFF Research Database (Denmark)

    Anderle, Pascale; Nielsen, Carsten Uhd; Pinsonneault, Julia;

    2006-01-01

    We tested whether genetic polymorphisms affect activity of the dipeptide transporter PEPT1, which mediates bioavailability of peptidomimetic drugs. All 23 exons and adjoining intronic sections of PEPT1 (SLC15A1) were sequenced in 247 individuals of various ethnic origins (Coriell collection). Of ...

  2. Ethnic Microaggressions and the Depressive and Somatic Symptoms of Latino and Asian American Adolescents

    Science.gov (United States)

    Huynh, Virginia W.

    2012-01-01

    Ethnic microaggressions are a form of everyday, interpersonal discrimination that are ambiguous and difficult to recognize as discrimination. This study examined the frequency and impact of microaggressions among Latino (n = 247) and Asian American (n = 113) adolescents (M[subscript age] = 17.18, SD = 0.75; 57% girls). Latino adolescents reported…

  3. The Teaching of the Code of Ethics and Standard Practices for Texas Educator Preparation Programs

    Science.gov (United States)

    Davenport, Marvin; Thompson, J. Ray; Templeton, Nathan R.

    2015-01-01

    The purpose of this descriptive quantitative research study was to answer three basic informational questions: (1) To what extent ethics training, as stipulated in Texas Administrative Code Chapter 247, was included in the EPP curriculum; (2) To what extent Texas public universities with approved EPP programs provided faculty opportunities for…

  4. The Role of Biographical Characteristics in Preservice Classroom Teachers' School Physical Activity Promotion Attitudes

    Science.gov (United States)

    Webster, Collin A.; Monsma, Eva; Erwin, Heather E.

    2010-01-01

    Recommendations for increasing children's daily physical activity (PA) call on classroom teachers to assume an activist role at school. This study examined relationships among preservice classroom teachers' (PCT; n = 247) biographical characteristics, perceptions and attitudes regarding school PA promotion (SPAP). Results indicated participants…

  5. Antibiotic susceptibility profiles of oral pathogens

    NARCIS (Netherlands)

    Veloo, A. C. M.; Seme, K.; Raangs, E.; Rurenga, P.; Singadji, Z.; Wekema-Mulder, G.; van Winkelhoff, A. J.

    2012-01-01

    Periodontitis is a bacterial disease that can be treated with systemic antibiotics. The aim of this study was to establish the antibiotic susceptibility profiles of five periodontal pathogens to six commonly used antibiotics in periodontics. A total of 247 periodontal bacterial isolates were tested

  6. 24 CFR 982.310 - Owner termination of tenancy.

    Science.gov (United States)

    2010-04-01

    ... with fair housing and equal opportunity provisions of 24 CFR 5.105, and with the provisions for protection of victims of domestic violence, dating violence, and stalking in 24 CFR part 5, subpart L... applicable. 24 CFR part 247 (concerning evictions from certain subsidized and HUD-owned projects) does...

  7. Self-help treatment for insomnia through television and book: A randomized trial.

    NARCIS (Netherlands)

    Straten, van A.; Cuijpers, P.; Smit, H.F.E.; Spermon, M.; Verbeek, I.

    2009-01-01

    Abstract Objective Recently, a Dutch educational broadcasting company developed a 6 week self-help course for insomnia, which consists of a book and television programmes. In this study we examined its effects. Methods 247 subjects with sleep problems were recruited through the media and randomized

  8. Industrial Maintenance, Volume II-B. Post Secondary Curriculum Guide.

    Science.gov (United States)

    Butler, Raymond H.; And Others

    This volume is the third of four volumes that comprise a curriculum guide for a postsecondary industrial maintenance program. It contains part of section 3 of the guide which contains the unit guides for 10 of the 12 duties included in the course. Each of the 247 tasks included in these 10 duties is presented on a separate page and contains the…

  9. 48 CFR 47.104-2 - Fixed-price contracts.

    Science.gov (United States)

    2010-10-01

    ... contractor shall use a commercial bill of lading and be reimbursed for the direct and actual transportation cost as a separate item in the invoice. The clause at 52.247-1, Commercial Bill of Lading Notations, will ensure that the Government in this type of arrangement obtains the benefit of 49 U.S.C. 10721...

  10. Peer Relations of Bullies, Bully-Victims, and Victims: The Two Social Worlds of Bullying in Second-Grade Classrooms

    Science.gov (United States)

    Farmer, Thomas W.; Petrin, Robert A.; Robertson, Dylan L.; Fraser, Mark W.; Hall, Cristin M.; Day, Steven H.; Dadisman, Kimberly

    2010-01-01

    This study examined the social relations of bullies, victims, and bully-victims in second-grade classrooms. Bully-victims are identified as both bullies and victims. The sample consisted of 537 ethnically diverse second-grade students (247 boys, 290 girls) from 37 classrooms across 11 participating schools. Bullies, bully-victims, and victims…

  11. 75 FR 49938 - Proposed Collection; Comment Request; NIH NCI Central Institutional Review Board (CIRB...

    Science.gov (United States)

    2010-08-16

    ... Review (FR) 1450 1 10/60 (.17 hour)......... 247 Acceptance Form (Attachment 2L). Participants Study... requested to serve as a reviewer for a study. CIRB helpdesk surveys measure satisfaction of helpdesk users and is conducted occasionally or each time the person contacts the helpdesk. Frequency of...

  12. The Properties of Large Amplitude Whistler Mode Waves in the Magnetosphere: Propagation and Relationship with Geomagnetic Activity

    Science.gov (United States)

    Wilson, L. B., III; Cattell, C. A.; Kellogg, P. J.; Wygant, J. R.; Goetz, K.; Breneman, A.; Kersten, K.

    2011-01-01

    Wepresent resultsof a studyof the characteristicsof very large amplitude whistler mode waves inside the terrestrial magnetosphere at radial distances of less than 15 RE using waveform capture data from the Wind spacecraft. We observed 247 whistler mode waves with at least one electric field component (105/247 had !80 mV/m peak!to!peak amplitudes) and 66 whistler mode waves with at least one search coil magnetic field component (38/66 had !0.8 nT peak!to!peak amplitudes). Wave vectors determined from events with three magnetic field components indicate that 30/46 propagate within 20 of the ambient magnetic field, though some are more oblique (up to "50 ). No relationship was observed between wave normal angle and GSM latitude. 162/247 of the large amplitude whistler mode waves were observed during magnetically active periods (AE > 200 nT). 217 out of 247 total whistler mode waves examined were observed inside the radiation belts. We present a waveform capture with the largest whistler wave magnetic field amplitude (^8 nT peak!to!peak) ever reported in the radiation belts. The estimated Poynting flux magnitude associated with this wave is ^300 mW/m2, roughly four orders of magnitude above estimates from previous satellite measurements. Such large Poynting flux values are consistent with rapid energization of electrons.

  13. 75 FR 76022 - Agency Information Collection Activities: Cost Submission

    Science.gov (United States)

    2010-12-07

    ... published in the Federal Register (75 FR 57284) on September 20, 2010, allowing for a 60-day comment period... SECURITY Customs and Border Protection Agency Information Collection Activities: Cost Submission AGENCY: U... approval in accordance with the Paperwork Reduction Act: Cost Submission (CBP Form 247). This is a...

  14. Calculating foraging area using gloal navigation satellite system (GNSS) technology

    Science.gov (United States)

    Adjusting stocking rate to changing forage conditions is a critical part of pro-active range management. In general stocking rate approaches tend to assume more optimal landscape use patterns than will actually occur. Today we can monitor spatio-temporal landscape use on a 24/7 basis using animals...

  15. File list: Pol.Epd.50.RNA_polymerase_II.AllCell [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Pol.Epd.50.RNA_polymerase_II.AllCell hg19 RNA polymerase RNA polymerase II Epidermi...247,SRX080162,SRX807622 http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/Pol.Epd.50.RNA_polymerase_II.AllCell.bed ...

  16. Introduction to the special section: Designing a better user experience for self-service systems

    NARCIS (Netherlands)

    Geest, van der T.M.; Ramey, J.; Rosenbaum, S.; Velsen, van L.S.

    2013-01-01

    June 2013 issue of IEEE Transactions on Professional Communication features a special section on 'Designing a Better User Experience for Self-Service Systems'. Self-service systems offers the users the benefit of 24/7 access to an ever-growing range of services and perhaps also a strong sense of aut

  17. 7 CFR 2003.22 - Functional organization of RUS.

    Science.gov (United States)

    2010-01-01

    ... Administrator. According to 7 CFR 2.47, the Administrator has responsibility for managing and administering the... 7 Agriculture 15 2010-01-01 2010-01-01 false Functional organization of RUS. 2003.22 Section 2003... Area § 2003.22 Functional organization of RUS. (a) General. The Secretary established RUS pursuant...

  18. Mobile Learning: At the Tipping Point

    Science.gov (United States)

    Franklin, Teresa

    2011-01-01

    Mobile technologies are interfacing with all aspects of our lives including Web 2.0 tools and applications, immersive virtual world environments, and online environments to present educational opportunities for 24/7 learning at the learner's discretion. Mobile devices are allowing educators to build new community learning ecosystems for and by…

  19. 75 FR 11154 - Marseilles Land and Water Company; Notice of Application Ready for Environmental Analysis and...

    Science.gov (United States)

    2010-03-10

    ... Energy Regulatory Commission Marseilles Land and Water Company; Notice of Application Ready for...-13351-000. c. Date filed: December 30, 2008. d. Applicant: Marseilles Land and Water Company. e. Name of... President, Marseilles Land & Water Company, 4132 S. Rainbow Blvd., 247, Las Vegas, NV 89103, (702)...

  20. 75 FR 142 - Marseilles Land and Water Company; Notice Soliciting Scoping Comments

    Science.gov (United States)

    2010-01-04

    ... Energy Regulatory Commission Marseilles Land and Water Company; Notice Soliciting Scoping Comments... No.: P-13351-000. c. Date filed: December 30, 2008. d. Applicant: Marseilles Land and Water Company... and Vice President, Marseilles Land & Water Company, 4132 S. Rainbow Blvd., 247, Las Vegas, NV...

  1. Gclust Server: 141414 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available 141414 NpunA_pNPAF087 Cluster Sequences - 247 - 1 1.00e-99 0.0 0.0 4.0 0.0 0.0 0.0 Show 141414... Cluster ID 141414 Sequence ID NpunA_pNPAF087 Link to cluster sequences Cluster Sequences Link to

  2. Different for Girls? An Exploration of the Impact of "Playing for Success."

    Science.gov (United States)

    Sharp, Caroline; Kendall, Lesley; Schagen, Ian

    2003-01-01

    A program providing study support to underachieving youth using British football as a motivator was evaluated by comparing 1,247 participants and 244 controls. The program helped raise achievement and seemed equally effective for males and females. There was no evidence that the sports emphasis marginalized girls or ethnic minorities. (Contains 25…

  3. Dicty_cDB: CFG349 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available its) Value N AF305060 |AF305060.1 Dictyostelium discoideum Wiscott-Aldrich syndrome protein (wasA) gene, com...060_1( AF305060 |pid:none) Dictyostelium discoideum Wiscott-A... 247 4e-64 DQ985464_1( DQ985464 |pid:none) S

  4. Multimodal Surveillance: Behavior analysis for recognizing stress and aggression

    NARCIS (Netherlands)

    Lefter, I.

    2014-01-01

    Nowadays, camera systems are installed in military areas as well as in public spaces like schools, shopping malls, airports, and football stadiums. Human operators are monitoring the screens, looking for any signs of unwanted behavior and negative incidents. The task requires working personnel 24/7.

  5. Incidence of inguinal hernia in children with congenital cerebral palsy

    DEFF Research Database (Denmark)

    Reimers, J I; Latocha, J E

    1990-01-01

    The incidence of inguinal hernia among 247 children with cerebral palsy was ascertained. During the first year of life, 20 of the 153 boys developed hernia, as did one of the 94 girls. Among boys with birthweights of 1000 to 2000g the incidence was 31 per cent, which is twice the rate for normal...

  6. Sleep Disturbances and Glucose Homeostasis

    NARCIS (Netherlands)

    Barf, R. Paulien; Scheurink, Anton J.W.

    2011-01-01

    Sleep disturbances, induced by either lifestyle, shift work or sleeping disorders, have become more prevalent in our 24/7 Western society. Sleep disturbances are associated with impaired health including metabolic diseases such as obesity and type 2 diabetes. The question remains whether there is a

  7. Health and Quality of Life in Northern Plains Indians

    Science.gov (United States)

    Quality of life and standard of living are consistently depicted as indigent among American Indian and Alaska Native (AI/AN) populations. American Indians (AI) are among the most heterogeneous and impoverished ethnic groups in the U.S.,have the highest per capita suicide rate at 247% of the national...

  8. Gender Differences in Academic Self-Efficacy: A Meta-Analysis

    Science.gov (United States)

    Huang, Chiungjung

    2013-01-01

    A meta-analysis of 187 studies containing 247 independent studies (N = 68,429) on gender differences in academic self-efficacy identified an overall effect size of 0.08, with a small difference favoring males. Moderator analysis demonstrated that content domain was a significant moderator in explaining effect size variation. Females displayed…

  9. 24 CFR 886.127 - Lease requirements.

    Science.gov (United States)

    2010-04-01

    ... the tenancy for “other good cause” under 24 CFR 247.3(a)(3), unless the termination is based on family... 24 Housing and Urban Development 4 2010-04-01 2010-04-01 false Lease requirements. 886.127 Section... for Projects With HUD-Insured and HUD-Held Mortgages § 886.127 Lease requirements. (a) Term of...

  10. 24 CFR 886.327 - Lease requirements.

    Science.gov (United States)

    2010-04-01

    ... tenancy for “other good cause” under 24 CFR 247.3(a)(3), unless the termination is based on family... 24 Housing and Urban Development 4 2010-04-01 2010-04-01 false Lease requirements. 886.327 Section... Program for the Disposition of HUD-Owned Projects § 886.327 Lease requirements. (a) Term of lease. (1)...

  11. Determinant of Mobile Devices Acceptance for Learning among Students in Developing Country

    Science.gov (United States)

    Tajudeen, Shittu Ahmed; Basha, Madarsha Kamal; Michael, Fakomogbon O.; Mukthar, Alhaji Liman

    2013-01-01

    This study was conducted to understand the determinant of mobile devices for learning among students in the developing world. A sample of 247 undergraduate students from Malaysia and Nigeria were involved in the study. An adapted but modified survey instrument was used to gather the data of the study. The variable of the study are perceived…

  12. 32 CFR 246.1 - Purpose.

    Science.gov (United States)

    2010-07-01

    ... establish and maintain a S&S board of directors to address S&S business operations in their Unified Commands. ... STRIPES (S&S) NEWSPAPER AND BUSINESS OPERATIONS § 246.1 Purpose. This part: (a) Establishes policy... Commands consistent with 32 CFR part 372. (b) Supersedes policies and procedures in 32 CFR part 247...

  13. Propuesta de implantación de ITIL en GXI S.A.

    OpenAIRE

    Aguilar, Marc; García, Eduardo; Navarro, Javier; Sàmper Marbà, Joel

    2006-01-01

    Implantamos un sistema de gestion de redes y servicios de una empresa de seguros. Tras analizar la situacion de la empresa, nuestro departamento especifica un servicio de help desk, gestion de incidencias estructurada en 4 niveles con servicio 24/7, gestion de problemas y gestion de cambios; todo ello basado en ITIL.

  14. Date Violence and Date Rape among Adolescents: Associations with Disordered Eating Behaviors and Psychological Health.

    Science.gov (United States)

    Ackard, Diann M.; Neumark-Sztainer, Dianne

    2002-01-01

    A study assessed prevalence of date violence and rape in 81,247 adolescents. Approximately 9% of girls and 6% of boys had experienced date violence or rape. Date violence and rape was associated with higher rates of disordered eating behaviors and suicidal thoughts and attempts, and lower emotional well-being and self-esteem. (Contains…

  15. Phenotypic and genetic variation in two North American arctic charr (Salvelinus alpinus) stocks cultured in recirculating aquaculture systems

    Science.gov (United States)

    Arctic charr were obtained as eggs from two North American sources, an eastern (Fraser River, Canada) and a western (Bristol Bay, Alaska) stock. Fish from each family (n=38) were pit tagged at approximately 12 months post-hatch (eastern mean+SE=247+/-13g, western mean+SE=220+/-g) and stocked commun...

  16. Network Monitoring with Zabbix

    OpenAIRE

    Shokhin, Anatolii

    2015-01-01

    Network monitoring became an essential part of any network size. It brings monitoring of network components 24/7. This provides clarity and transparency of network infrastructure and performance. With on time alert notification, network administrator may start failure troubleshooting immediately. As a result, end users may not even notice the issue.

  17. 7 CFR 2902.17 - Plastic insulating foam for residential and commercial construction.

    Science.gov (United States)

    2010-01-01

    ... Comprehensive Procurement Guideline, 40 CFR 247.12. EPA provides recovered materials content recommendations for... 7 Agriculture 15 2010-01-01 2010-01-01 false Plastic insulating foam for residential and... BIOBASED PRODUCTS FOR FEDERAL PROCUREMENT Designated Items § 2902.17 Plastic insulating foam...

  18. Predictors of Science Subject Discipline Identities: A Statistical Analysis

    Science.gov (United States)

    Nieswandt, Martina; Barrett, Sarah E.; McEneaney, Elizabeth H.

    2013-01-01

    This quantitative study (n = 247) explores whether preservice science teachers express science-specific identities that reflect multiple areas of their beliefs (e.g., purpose for science teaching, inclusion of science-technology-society-environment issues into science teaching, and nature of science) as well as other individual characteristics…

  19. Fluorinated Polyurethanes, Synthesis and Properties.

    Science.gov (United States)

    Smirnova, Olga; Glazkov, Alexey; Yarosh, Alexander; Sakharov, Alexey

    2016-01-01

    Fluorinated polyurethanes with a glass transition temperature as low as -139 °C and a decomposition onset temperature of 247-330 °C were prepared by a reaction of fluorinated alcohols with aromatic and cycloaliphatic diisocyanates in solution or melt. PMID:27420039

  20. What to Do about Being Overwhelmed: Graduate Students, Stress and University Services

    Science.gov (United States)

    Oswalt, Sara B.; Riddock, Christina C.

    2007-01-01

    Few studies have examined graduate students and stress. At a large, Southeastern university, 223 graduate students completed a survey about factors contributing their stress, current coping strategies and related university services. A majority felt stressed (48.9%) or very stressed (24.7%). There were significant differences in coping strategies…

  1. Discovery of a transient U-band dropout in a Lyman break survey : A tidally disrupted star at z=3.3?

    NARCIS (Netherlands)

    Stern, D; van Dokkum, PG; Nugent, P; Sand, DJ; Ellis, RS; Sullivan, M; Bloom, JS; Frail, DA; Kneib, JP; Koopmans, LVE; Treu, T

    2004-01-01

    We report the discovery of a transient source in the central regions of galaxy cluster A267. The object, which we call "PALS-1,'' was found in a survey aimed at identifying highly magnified Lyman break galaxies in the fields of intervening rich clusters. At discovery, the source had U(n)>24.7 (2 sig

  2. 38 CFR 21.3333 - Rates.

    Science.gov (United States)

    2010-07-01

    ... $860.00 If costs for tuition and fees average in excess of $268.00 per month, rate may be increased by... charges Special restorative training $788.00 If costs for tuition and fees average in excess of $247.00... Monthly rate Accelerated charges Special restorative training $803.00 If costs for tuition and...

  3. The Relation between Different Facets of Creativity and the Dark Side of Personality

    Science.gov (United States)

    Dahmen-Wassenberg, Phoebe; Kämmerle, Monika; Unterrainer, Human-Friedrich; Fink, Andreas

    2016-01-01

    This study examined the relation between different facets of creativity and personality, focusing on the dark side of personality. In a sample of 247 students, psychometric measures for the assessment of the dark triad of personality (subclinical narcissism, Machiavellianism, subclinical psychopathy), personality organization (structural deficit:…

  4. 76 FR 61279 - Defense Federal Acquisition Regulation Supplement; Defense Cargo Riding Gang Member (DFARS Case...

    Science.gov (United States)

    2011-10-04

    ... published an interim rule at 75 FR 65437 on October 25, 2010, to implement section 3504 of the National..., 247, and 252, which was published at 75 FR 65437 on October 25, 2010, is adopted as a final rule with... Acquisition Regulation Supplement; Defense Cargo Riding Gang Member (DFARS Case 2007-D002) AGENCY:...

  5. Unrecognized circulation of SAT 1 foot-and-mouth disease virus in cattle herds around Queen Elizabeth National Park in Uganda

    DEFF Research Database (Denmark)

    Dhikusooka, Moses Tefula; Ayebazibwe, Chrisostom; Namatovu, Alice;

    2016-01-01

    understand the epidemiology of FMD at the livestock-wildlife-interface, samples were collected from young, unvaccinated cattle from 24 pastoral herds that closely interact with wildlife around Queen Elizabeth National Park in Uganda, and analysed for evidence of FMDV infection. In total, 37 (15 %) of 247...

  6. Innovative collection development for e-books at the TU Delft Library

    NARCIS (Netherlands)

    Brinkman Dzwig, Z.E.

    2013-01-01

    Thanks to new technologies libraries worldwide go digital and are accessible 24/7 from remote locations. The innovation is even more visible in traditional library tasks such as collection development and acquisitions. Those tasks are undergoing rapid transformation as well. One of the reasons is t

  7. Thought-Experiments about Gravity in the History of Science and in Research into Children's Thinking

    Science.gov (United States)

    Blown, E. J.; Bryce, T. G. K.

    2013-01-01

    This article examines the main strands of thinking about gravity through the ages and the continuity of thought-experiments, from the early Greeks, through medieval times, to Galileo, Newton and Einstein. The key ideas are used to contextualise an empirical study of 247 children's ideas about falling objects carried out in China and New Zealand,…

  8. EST Table: FS914333 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available FS914333 E_FL_fufe_31P15_F_0 10/09/28 83 %/247 aa ref|NP_001040506.1| bmp-2 protein... [Bombyx mori] gb|ABF60228.1| bmp-2 [Bombyx mori] 10/09/12 low homology 10/08/29 n.h 10/09/10 42 %/150 aa AG

  9. EST Table: FS918053 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available FS918053 E_FL_fufe_43C23_F_0 10/09/28 83 %/247 aa ref|NP_001040506.1| bmp-2 protein... [Bombyx mori] gb|ABF60228.1| bmp-2 [Bombyx mori] 10/09/12 low homology 10/08/29 n.h 10/09/10 42 %/150 aa AG

  10. Drug: D01426 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available 0627 247.2715 D01426.gif Antiprotozoal [DS:H00812] Therapeutic category: 2529 6419 ATC code: J01XD02 P01AB02...P/INN) 6 Agents against pathologic organisms and parasites 64 Parasitics (systemic) 641 Antiprotozoans 6419 ...nidazole (JP16/USP/INN) Antiinfectives [BR:br08307] Antiparasitics Agents against Amebiasis and other antiprotozoa

  11. Disease: H00142 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available I: a 10-year follow-up study. J Neurol Sci 247:65-9 (2006) PMID:19568825 Caciotti A, Di Rocco M, Filocamo M...u RK, Ro LS, Chang HS First report of two Taiwanese siblings with sialidosis type

  12. The use of the psychological contract to explain self-perceived employability

    NARCIS (Netherlands)

    Sok, J.; Blomme, R.J.; Tromp, D.M.

    2013-01-01

    This study examines the relationship between the psychological contract and self-perceived employability (intra-organizational mobility intentions, employee development and perceived labor market opportunities). A survey was completed by 247 alumni of the Hotelschool The Hague, a hotel management sc

  13. Written on the Writer's Face: Facial Width-to-Height Ratio among Nominees and Laureates of the Nobel Prize in Literature

    Science.gov (United States)

    Lebuda, Izabela; Karwowski, Maciej

    2016-01-01

    This study examined the relationship between facial width-to-height ratio (fWHR), an established marker of testosterone level and dominance, and eminent writers' achievement. The fWHR of laureates (N = 39) and nominees (N = 247) of the Nobel Prize in Literature 1901-1950 was measured together with historiometric data. It was demonstrated that…

  14. 40 CFR 63.775 - Reporting requirements.

    Science.gov (United States)

    2010-07-01

    ... requirements specified in 40 CFR 61.247, except that the Periodic Reports shall be submitted on the schedule... 40 Protection of Environment 10 2010-07-01 2010-07-01 false Reporting requirements. 63.775 Section 63.775 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS...

  15. Meta-Analysis of Correlations Among Usability Measures

    DEFF Research Database (Denmark)

    Hornbæk, Kasper Anders Søren; Effie Lai Chong, Law

    2007-01-01

    are generally low: effectiveness measures (e.g., errors) and efficiency measures (e.g., time) has a correlation of .247 ± .059 (Pearson's product-moment correlation with 95% confidence interval), efficiency and satisfaction (e.g., preference) one of .196 ± .064, and effectiveness and satisfaction one of .164...

  16. 7 CFR 2902.28 - Stationary equipment hydraulic fluids.

    Science.gov (United States)

    2010-01-01

    ... designation can be found in the Comprehensive Procurement Guideline, 40 CFR 247.11. EPA provides recovered... 7 Agriculture 15 2010-01-01 2010-01-01 false Stationary equipment hydraulic fluids. 2902.28... PROCUREMENT Designated Items § 2902.28 Stationary equipment hydraulic fluids. (a) Definition....

  17. 7 CFR 2902.10 - Mobile equipment hydraulic fluids.

    Science.gov (United States)

    2010-01-01

    ... Comprehensive Procurement Guideline, 40 CFR 247.11. ... 7 Agriculture 15 2010-01-01 2010-01-01 false Mobile equipment hydraulic fluids. 2902.10 Section... PROCUREMENT Designated Items § 2902.10 Mobile equipment hydraulic fluids. (a) Definition. Hydraulic...

  18. Speciallægen er ikke i front på de danske akutafdelinger (The use of consultants in the Emergency Department)

    DEFF Research Database (Denmark)

    Mackenhauer, Julie; Møller, Marianne Cecilie Markvard; Fjældstad, Alexander;

    2013-01-01

    are not staffed by consultants 24/7, 51% report difficulties in recruiting qualified personnel and 33% report problems connected to retaining them. 71% believe that a specialty in emergency medicine could help solve these problems. Danish EDs do not comply with the visions of the reorganisation plan....

  19. 50 CFR 216.3 - Definitions.

    Science.gov (United States)

    2010-10-01

    ... to the labeling requirements of 50 CFR part 247 and that only contain fish harvested by vessels of... vessel operator's or vessel owner's control that could not be avoided by the exercise of due care. FSA... enrolled in the Metlaktla Indian Community), Eskimo, or Aleut blood or combination thereof. The...

  20. 7 CFR 2902.27 - Films.

    Science.gov (United States)

    2010-01-01

    ... Comprehensive Procurement Guideline, 40 CFR 247.16. EPA provides recovered materials content recommendations for... 7 Agriculture 15 2010-01-01 2010-01-01 false Films. 2902.27 Section 2902.27 Agriculture... Films. (a) Definition. (1) Products that are used in packaging, wrappings, linings, and other...

  1. 7 CFR 2902.21 - Disposable containers.

    Science.gov (United States)

    2010-01-01

    ... Guideline, 40 CFR 247.10. EPA provides recovered materials content recommendations for paper and paper... 7 Agriculture 15 2010-01-01 2010-01-01 false Disposable containers. 2902.21 Section 2902.21... Items § 2902.21 Disposable containers. (a) Definition. Products designed to be used for...

  2. Carbon isotope systematics of individual hydrocarbons in hydrothermal petroleum from Escanaba Trough, northeastern Pacific Ocean.

    Science.gov (United States)

    Simoneit, B R; Schoell, M; Kvenvolden, K A

    1997-01-01

    We submitted individual aliphatic and polycyclic aromatic hydrocarbons in samples of hydrothermal petroleum from Escanaba Trough to compound specific isotope analysis to trace their origins. The carbon isotope compositions of the alkanes and polycyclic aromatic hydrocarbons (means -27.5 and -24.7%, respectively) reflect a primarily terrestrial organic matter source. PMID:11541391

  3. Perceptions of Retirement Affect Career Commitment: The Mediating Role of Retirement System Satisfaction for Two Teacher Age Groups

    Science.gov (United States)

    Smith, Justin L.; Conley, Sharon; You, Sukkyung

    2015-01-01

    This study investigated a sample of California elementary, intermediate, and high school employed teachers (N = 247) to assess the effects of retirement perceptions on career commitment among teachers who are in different age groupings. Using path analysis, the influence of five retirement perceptions variables was examined: concerns about…

  4. Cyber Worlds: New Playgrounds for Bullying

    Science.gov (United States)

    Mark, Lauren; Ratliffe, Katherine T.

    2011-01-01

    The experiences of 247 middle school children around cyberbullying were examined through in-class questionnaires. Their use of different media, their experiences with cyberbullying, and the relationships among school type, gender, and grade level were analyzed. Of the students in this sample 33% of female and 20% of male students reported being a…

  5. NATIONAL CHILD ABUSE AND NEGLECT DATA SYSTEM (NCANDS)

    Science.gov (United States)

    NCANDS collects data on child maltreatment from the States. It was developed in response to the Child Abuse Prevention and Treatment Act (Public Law 93-247), as amended, which called for the creation of a coordinated national data collection and analysis program, both universal a...

  6. Lost in transition: Media innovations in the Netherlands

    NARCIS (Netherlands)

    M.C. van Kerkhoven

    2016-01-01

    Original news production is a costly business. News production that lives up to a high quality standard has become even costlier. Due to a new attitude of both news consumers and advertisers - people living in the media, with its 24/7 online free news environments, rather than with the media - most

  7. Ubiquitous Versus One-to-One

    Science.gov (United States)

    McAnear, Anita

    2006-01-01

    When we planned the editorial calendar with the topic ubiquitous computing, we were thinking of ubiquitous computing as the one-to-one ratio of computers to students and teachers and 24/7 access to electronic resources. At the time, we were aware that ubiquitous computing in the computer science field had more to do with wearable computers. Our…

  8. Physical activity energy expenditure and sarcopenia in black South African urban women

    NARCIS (Netherlands)

    Kruger, Herculina S.; Havemann-Nel, Lize; Ravyse, Chrisna; Moss, Sarah J.; Tieland, Michael

    2016-01-01

    Background: Black women are believed to be genetically less predisposed to age-related sarcopenia. The objective of this study was to investigate lifestyle factors associated with sarcopenia in black South African (SA) urban women. Methods: In a cross-sectional study, 247 women (mean age 57 y) we

  9. Corganiser: a web-based software tool for planning time-sensitive sampling of whole rounds during scientific drilling

    DEFF Research Database (Denmark)

    Marshall, Ian

    2014-01-01

    with a wide range of core and section configurations and can thus be used in future drilling projects. Corganiser is written in the Python programming language and is implemented both as a graphical web interface and command-line interface. It can be accessed online at http://130.226.247.137/....

  10. Fluorinated Polyurethanes, Synthesis and Properties

    Directory of Open Access Journals (Sweden)

    Olga Smirnova

    2016-07-01

    Full Text Available Fluorinated polyurethanes with a glass transition temperature as low as −139 °C and a decomposition onset temperature of 247–330 °C were prepared by a reaction of fluorinated alcohols with aromatic and cycloaliphatic diisocyanates in solution or melt.

  11. Fluorinated Polyurethanes, Synthesis and Properties.

    Science.gov (United States)

    Smirnova, Olga; Glazkov, Alexey; Yarosh, Alexander; Sakharov, Alexey

    2016-07-12

    Fluorinated polyurethanes with a glass transition temperature as low as -139 °C and a decomposition onset temperature of 247-330 °C were prepared by a reaction of fluorinated alcohols with aromatic and cycloaliphatic diisocyanates in solution or melt.

  12. Team Sports Achievement and Self-Esteem Development among Urban Adolescent Girls

    Science.gov (United States)

    Pedersen, Sara; Seidman, Edward

    2004-01-01

    In this study we investigate the contribution of achievement in team sports to adolescent girls' self-esteem development. Adolescent girls (N = 247) from racially and ethnically diverse backgrounds were surveyed as part of a larger study investigating the development of poor urban youth. Participants responded to items tapping global self-esteem,…

  13. Math-Gender Stereotypes in Elementary School Children

    Science.gov (United States)

    Cvencek, Dario; Meltzoff, Andrew N.; Greenwald, Anthony G.

    2011-01-01

    A total of 247 American children between 6 and 10 years of age (126 girls and 121 boys) completed Implicit Association Tests and explicit self-report measures assessing the association of (a) "me" with "male" (gender identity), (b) "male" with "math" (math-gender stereotype), and (c) "me" with "math" (math self-concept). Two findings emerged.…

  14. Pain phenotype as a predictor for drug response in painful polyneuropathy A retrospective analysis of data from controlled clinical trials

    DEFF Research Database (Denmark)

    Holbech, Jakob V; Bach, Flemming W; Finnerup, Nanna B;

    2016-01-01

    better effect in patients with preserved large fiber function with a mean difference in total pain reduction 1.31 (CI: 0.15 to 2.47). No phenotype-specific effects were found for venlafaxine, escitalopram, oxcarbazepine, valproic acid, levetiracetam or St. john's wort. Thus, this post-hoc analysis of 8...

  15. Paternity testing with VNTR DNA systems. I. Matching criteria and population frequencies of the VNTR systems D2S44, D5S43, D7S21, D7S22, and D12S11 in Danes

    DEFF Research Database (Denmark)

    Morling, N; Hansen, Hanna Elsebeth

    1993-01-01

    of the putative father as an exclusion in paternity testing. This matching criterion was used for the comparisons of 1,197 DNA fragment differences in 247 pairs of children and putative fathers who had not been excluded by conventional marker systems. In all of these cases, the migration differences between...

  16. Gestational Alcohol Exposure and Other Factors Associated with Continued Teenage Drinking

    Science.gov (United States)

    Cornelius, Marie D.; Goldschmidt, Lidush; Day, Nancy L.

    2016-01-01

    Purpose: A longitudinal cohort of adolescents who initiated drinking before age 15 were studied to determine which factors distinguished between early initiators who continued to drink (persisters) from those who stopped drinking (desisters). There were 308 early initiators in the total sample (n = 917); 247 were persisters, and 61 were desisters.…

  17. Drug: D01159 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available tic category of drugs in Japan [BR:br08301] 2 Agents affecting individual organs 24 Hormones 247 Estrogen an...G03DA01] D01159 Gestonorone caproate (JAN/USAN) Antineoplastics [BR:br08308] Hormones and hormone antagonist

  18. Drug: D00554 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available an [BR:br08301] 2 Agents affecting individual organs 24 Hormones 247 Estrogen and progesterone preparations ...USP drug classification [BR:br08302] Hormonal Agents, Stimulant/Replacement/Modifying (Sex Hormones/Modifier...ntineoplastics [BR:br08308] Hormones and hormone antagonist Estrogen Ethinylestradiol [ATC:L02AA03] D00554 E

  19. Drug: D00182 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available drugs in Japan [BR:br08301] 2 Agents affecting individual organs 24 Hormones 247 Estrogen and progesterone p...P) USP drug classification [BR:br08302] Hormonal Agents, Stimulant/Replacement/Modifying (Sex Hormones/Modif

  20. The Distribution of Dropout and Turnover Rates among Urban and Suburban High Schools.

    Science.gov (United States)

    Rumberger, Russell W.; Thomas, Scott L.

    2000-01-01

    Examines the distribution of dropout and turnover rates among 247 U.S. urban and suburban high schools to study school effectiveness. Finds that dropout and turnover rates can be attributed to student background, student composition, school resources, and school processes. (Contains references.) (CMK)

  1. The Parallel Information Universe

    Science.gov (United States)

    Eisenberg, Mike

    2008-01-01

    The Web 2.0 "buzz" starts with new technologies such as virtual worlds, cell phones and handheld devices that offer 24/7 web access, tagging, social networks, and blogs and brings together various web capabilities in unique combinations. Web 2.0, however, is about much more than the technology--it is about a change in focus to participation, user…

  2. Thinking Styles and Preferred Teacher Interpersonal Behavior among Hong Kong Students

    Science.gov (United States)

    Yu, Tak-ming; Chen, Chen

    2012-01-01

    This study investigated the relationship between thinking styles and preferred teacher interpersonal behavior based on the Model for Interpersonal Teacher Behavior (MITB, Wubbels, Creton, & Hooymayers, 1985) among 247 Hong Kong secondary school female students. The Thinking Style Inventory Revised (TSI-R, Sternberg, Wagner, & Zhang, 2003) and the…

  3. Moving the Law School into the Twenty-First Century--Embedding Technology into Teaching and Learning

    Science.gov (United States)

    Steventon, Beverley; Panesar, Sukhninder; Wood, Jane

    2014-01-01

    Over the past twenty years phenomenal developments in technology have changed the nature of education. Students now have access to a vast range of resources 24/7. This instant access has created a certain expectation on the part of the student and there must now be very few, if any, courses taught in higher education where the lecturer does not…

  4. The Erd(o)s-Sós Conjecture for Graphs Whose Complements Contain No C4

    Institute of Scientific and Technical Information of China (English)

    Jian-hua Yin; Jiong-sheng Li

    2004-01-01

    Erd(o)s and Sós conjectured in 1963 (see [1], Problem 12 in 247) that every graph G on n vertices with size e(G) > 12 n(k - 1) contains every tree T of size k. In this paper, we prove the conjecture for graphs whose complements contain no cycles of length 4.

  5. 75 FR 22611 - Renewal of Agency Information Collection for Acquisition of Trust Land; Request for Comments

    Science.gov (United States)

    2010-04-29

    ... Services, 316 N. 26th Street, Billings, MT 59601; facsimile: (406) 247- 7991; e-mail: Darryl.LaCounte@bia..., Billings, MT 59601, during the hours of 9 a.m.-5 p.m., Local Time, Monday through Friday except for legal... renewal of this information collection on February 18, 2010. See 75 FR 7285. Two commenters responded...

  6. 75 FR 1616 - Post-2010 Resource Pool, Pick-Sloan Missouri Basin Program-Eastern Division

    Science.gov (United States)

    2010-01-12

    ... Administration, 2900 4th Avenue North, Billings, MT 59101-1266. FOR FURTHER INFORMATION CONTACT: John A. Pankratz... Avenue North, Billings, MT 59101-1266, telephone (406) 247-7392, e-mail pankratz@wapa.gov . SUPPLEMENTARY... with the January 2011 billing period through the December 2020 billing period. DATES: The...

  7. Underneath Hypercapitalism

    Science.gov (United States)

    Luke, Allan

    2007-01-01

    As Joel Spring's (2007/this issue) description of Singapore's Orchard Road suggests, Benetton, Zara, Nike, BMW, LG, and Microsoft dominate the visual and textual landscape where signage, advertising, packaging, labeling, and the environments of the connected underground malls and walkways merge into a wall-to-wall, 24/7 print and visual…

  8. Good agreement of conventional and gel-based direct agglutination test in immune-mediated haemolytic anaemia

    NARCIS (Netherlands)

    Piek, C.J.; Teske, E.; van Leeuwen, M.W.; Day, M.J.

    2012-01-01

    Abstract Background The aim of this study was to compare a gel-based test with the traditional direct agglutination test (DAT) for the diagnosis of immune-mediated haemolytic anaemia (IMHA). Methods Canine (n = 247) and feline (n = 74) blood samples were submitted for DAT testing to two laboratories

  9. "Something's Gotta Give:" Advanced-Degree Seeking Women's Experiences of Sexism, Role Overload, and Psychological Distress

    Science.gov (United States)

    West, Lindsey M.

    2014-01-01

    With the rise in advanced-degree seeking women and the minimal research on the dual impact of sexism and role overload, the current study aims to better understand the impact of sexism and role overload on psychological distress in a particular sample of advanced-degree seeking women. Seventy-six female medical student participants (mean age 24.7)…

  10. 78 FR 61161 - Airworthiness Directives; The Boeing Company Airplanes

    Science.gov (United States)

    2013-10-03

    ...-247-AD; Amendment 39-17602; AD 2013-19-20] RIN 2120-AA64 Airworthiness Directives; The Boeing Company... new airworthiness directive (AD) for certain The Boeing Company Model DC-10-10 and MD-10-10F airplanes... MLG and consequent damage to airplane structure, which could adversely affect the airplane's...

  11. Teachers' Level of Awareness of 21st Century Occupational Roles in Rivers State Secondary Schools

    Science.gov (United States)

    Uche, Chineze M.; Kaegon, Leesi E. S. P.; Okata, Fanny Chiemezie

    2016-01-01

    This study investigated the teachers' level of awareness of 21st century occupational roles in Rivers state secondary schools. Three research questions and three hypotheses guided the study. The population of study comprised of 247 public secondary schools and 57 private secondary schools in Port Harcourt metropolis of Rivers state which gave a…

  12. 78 FR 803 - Revisions to Electric Reliability Organization Definition of Bulk Electric System and Rules of...

    Science.gov (United States)

    2013-01-04

    ... Procedure, Notice of Proposed Rulemaking, 77 FR 39857 (July 5, 2012) 139 FERC ] 61,247 (2012) (NOPR). I... to Electric Reliability Organization Definition of Bulk Electric System and Rules of Procedure; Final...; ] DEPARTMENT OF ENERGY Federal Energy Regulatory Commission 18 CFR Part 40 Revisions to Electric...

  13. Embedding Resilience within the Tertiary Curriculum: A Feasibility Study

    Science.gov (United States)

    Stallman, Helen M.

    2011-01-01

    Mental health problems can significantly impact on the ability of university students to both meet their individual potential and contribute positively within society. This study evaluates the feasibility of embedding a strength-focused resilience-building seminar within a university curriculum. Participants were 247 students enrolled in an…

  14. Reasoning about Family Honour among Two Generations of Hindu Indian-Americans

    Science.gov (United States)

    Kay, Adam

    2012-01-01

    To investigate reasoning about family honour, 128 first generation (mean age = 27.2 years) and second generation Hindu Indian-American adults (mean age = 24.7 years) were presented hypothetical scenarios in which male or female protagonists defied common Hindu customs (e.g., arranged marriage, intra-religion marriage and premarital sexual…

  15. Designing robots with care: creating an ethical framework for the future design and implementation of care robots

    NARCIS (Netherlands)

    Wynsberghe, van A.

    2012-01-01

    This book begins by highlighting the range of positive and negative aspects associated with the initiative to design and use care robots. The positive aspects vary from; the reality that care is required 24/7 and a human caregiver cannot possibly meet such a standard, the reality that patients are a

  16. Hand Hygiene Saves Lives

    Medline Plus

    Full Text Available ... or call 1-800-CDC-INFO, 24/7. File Formats Help: How do I view different file formats (PDF, DOC, PPT, MPEG) on this site? Adobe PDF file Microsoft PowerPoint file Microsoft Word file Microsoft Excel ...

  17. AcEST: DK955242 [AcEST

    Lifescience Database Archive (English)

    Full Text Available inase 1 OS=Arabidopsis ... 158 1e-38 sp|Q94B08|GCP1_ARATH Germination-specific cysteine protease 1 OS... 157...STGGLHKEDDYPYLM---EEGICQEQKEDVER-VTI 245 Query: 528 DG 533 G Sbjct: 246 SG 247 >sp|Q94B08|GCP1_ARATH Germination

  18. EST Table: FY016706 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available FY016706 rbmov17i21 11/12/09 n.h 11/11/04 45 %/247 aa ref|XP_970998.1| PREDICTED: similar to Evolution...1094187|ref|XP_970998.1| PREDICTED: similar to Evolutionarily conserved signaling intermediate in Toll pathway, mitochondrial [Tribolium castaneum] FY016706 bmov ...

  19. 76 FR 62835 - Notice of Inventory Completion: Fort Lewis College, Durango, CO

    Science.gov (United States)

    2011-10-11

    ... Anthropology, Fort Lewis College, 1000 Rim Dr., Durango, CO 81301, telephone (970) 247-7500. SUPPLEMENTARY... these groups. However, the body of evidence does not collectively support a common Ute and Puebloan..., Department of Anthropology, Fort Lewis College, 1000 Rim Dr., Durango, CO 81301, telephone (970)...

  20. FOLLOW-UP OF ASTHMA FROM CHILDHOOD TO ADULTHOOD - INFLUENCE OF POTENTIAL CHILDHOOD RISK-FACTORS ON THE OUTCOME OF PULMONARY-FUNCTION AND BRONCHIAL RESPONSIVENESS IN ADULTHOOD

    NARCIS (Netherlands)

    ROORDA, RJ; GERRITSEN, J; VANAALDEREN, WMC; SCHOUTEN, JP; VELTMAN, JC; WEISS, ST; KNOL, K

    1994-01-01

    The outcome of asthma in 406 children, aged 8 to 12 years, was studied. Follow-up in adulthood was 86%, with a mean age of 24.7 years and a mean interval of follow-up of 14.8 years. The predictive value of gender and various childhood variables on the adult level of pulmonary function (forced expira

  1. NCI launches smoking cessation support for teens

    Science.gov (United States)

    A new effort to help teens quit smoking will use one of today’s teen’s most constant companions—the mobile phone. Developed by smoking cessation experts, SmokefreeTXT is a free text message cessation service that provides 24/7 encouragement, advice, and

  2. 76 FR 3843 - Final Guidance for Federal Departments and Agencies on the Appropriate Use of Mitigation and...

    Science.gov (United States)

    2011-01-21

    ..., Establishing, Revising and Using Categorical Exclusions, 75 FR 75628, Dec. 6, 2010. In a Federal Register... Guidance for NEPA Mitigation and Monitoring, 75 FR 8046, Feb. 23, 2010. Mitigation Planning Some commenters... (NEPA), 42 U.S.C. 4344, and Executive Order No. 11,514, 35 FR 4,247 (Mar. 5, 1970), as amended...

  3. Preservice Teachers' Internet Addiction in Terms of Gender, Internet Access, Loneliness and Life Satisfaction

    Science.gov (United States)

    Demirer, Veysel; Bozoglan, Bahadir; Sahin, Ismail

    2013-01-01

    The aim of this study is to investigate pre-service teachers' Internet addiction in terms of gender, Internet accessibility, loneliness and life satisfaction. Statistical analyses were completed on the data by the 247 preservice teachers that filled the surveys completely. According to findings, pre-service teachers' level of loneliness and…

  4. Gas dynamic lasers (a bibliography with abstracts). Report for 1964-July 1979

    Energy Technology Data Exchange (ETDEWEB)

    Carrigan, B.

    1979-08-01

    The citations cover research on kinetic and energy transfer processes, design, optics, nozzles, and performance of gas and chemical lasers relying on gas dynamic effects for lasing enhancement. Diffusion and flow studies specifically applicable to such lasers are also included. (This updated bibliography contains 247 abstracts, 11 of which are new entries to the previous edition.)

  5. 24 CFR 886.328 - Termination of tenancy.

    Science.gov (United States)

    2010-04-01

    ... this title (24 CFR part 247) applies to the termination of tenancy and eviction of a family assisted.... For cases where domestic violence, dating violence, stalking, or criminal activity directly relating to domestic violence, dating violence, or stalking is involved or claimed to be involved,...

  6. Establishing Influential Decision Making Factors for University Library Opening Hours: An Exploratory UK Regional Study

    Science.gov (United States)

    Ravenwood, Clare; Stephens, Derek; Walton, Graham

    2015-01-01

    Many factors and pressures affect decisions made in UK university libraries on opening hours especially 24/7. This article reports on a project to examine the decision-making process, influential factors, and stakeholders. A workshop for senior library managers in the East Midlands was held to gather data and share experiences. From analysis of…

  7. 7 CFR 2902.19 - Composite panels.

    Science.gov (United States)

    2010-01-01

    .... The designation can be found in the Comprehensive Procurement Guideline, 40 CFR 247.12. EPA provides... 7 Agriculture 15 2010-01-01 2010-01-01 false Composite panels. 2902.19 Section 2902.19 Agriculture... Composite panels. (a) Definitions. (1) Plastic lumber composite panels. Engineered products suitable for...

  8. Muscular disease

    Institute of Scientific and Technical Information of China (English)

    2009-01-01

    2009252 Investigation on survival motor neuron gene deletion in Chinese patients with sporadic amyotrophic lateral sclerosis.SU Zongquan(苏宗权),et al.Dept Neurol,1st Affili Hosp,Fujian Med,Fuzhou 350005.Chin J Neurol,2009;42(4):245-247.

  9. IT lessons learnt from real time dike monitoring

    NARCIS (Netherlands)

    Vonder, M.R.; Waaij, B.D. van der

    2013-01-01

    The Dutch lowlands are protected by many kilometres of dikes. Currently these dikes are visually inspected on a regular basis. During heavy weather this frequency is raised, up to 24/7 in very extreme situations. After a dike failure at the Dutch town Wilnis in 2003, the question was raised whether

  10. Kunstiakadeemia uus õppehoone kõrgub õhuliselt vana maja kohale / Ants Juske, Mari Kodres

    Index Scriptorium Estoniae

    Juske, Ants, 1956-

    2008-01-01

    Eesti Kunstiakadeemia uue hoone arhitektuurivõistlusest ja võidutööst "Art Plaza"(Taani arhitektuuribüroo Effekt). Võistlustöödest "TLN247" (II koht), "Arts Factory" (III koht), "Public Section" (ergutuspreemia) ja "Sashimi" (ergutuspreemia)

  11. Download - GETDB | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available r List) getdb_cluster.zip (56KB) Simple search and download 5 Expression image data of Drosophila GAL4 enhancer trap lines getdb_imag...es.zip (247MB) - Downlaod via FTP Joomla SEF URLs by Art

  12. Field-theoretic calculation of kinetic helicity flux

    Indian Academy of Sciences (India)

    V Avinash; Mahendra K Verma; Amar K Chandra

    2006-02-01

    In this paper we apply perturbative field-theoretic technique to helical turbulence. In the inertial range the kinetic helicity flux is found to be constant and forward. The universal constant H appearing in the spectrum of kinetic helicity was found to be 2.47.

  13. Euroclay 95. Clays and clay materials sciences. Book of abstracts

    International Nuclear Information System (INIS)

    The document contains the abstracts of the invited lecturers (18) and posters (247) presented at EUROCLAY '95. Clays and clay materials sciences. 13 items (4 from the invited lecturers and 12 from posters) have been considered within the INIS Subject Scope and indexed separately

  14. 75 FR 59329 - Reasonable Charges for Inpatient MS-DRGs and SNF Medical Services; 2011 Fiscal Year Update

    Science.gov (United States)

    2010-09-27

    ... Administration (VHA) Chief Business Office, currently at http://www1.va.gov/CBO/apps/rates/index.asp , under..., 2009 (74 FR 247). Based on the methodologies set forth in 38 CFR 17.101(b), this document provides an... Internet site of the VHA Chief Business Office, currently at...

  15. CLONING AND SEQUENCING OF THE GENE FOR A LACTOCOCCAL ENDOPEPTIDASE, AN ENZYME WITH SEQUENCE SIMILARITY TO MAMMALIAN ENKEPHALINASE

    NARCIS (Netherlands)

    Mierau, Igor; Tan, Paris S.T.; Haandrikman, Alfred J.; Kok, Jan; Leenhouts, Kees J.; Konings, Wil N.; Venema, Gerard

    1993-01-01

    The gene specifying an endopeptidase of Lactococcus lactis, named pepO, was cloned from a genomic library of L. lactis subsp. cremoris P8-247 in lambdaEMBL3 and was subsequently sequenced. pepO is probably the last gene of an operon encoding the binding-protein-dependent oligopeptide transport syste

  16. Identification of TMPRSS2 as a Susceptibility Gene for Severe 2009 Pandemic A(H1N1) Influenza and A(H7N9) Influenza

    NARCIS (Netherlands)

    Cheng, Zhongshan; Zhou, Jie; To, Kelvin Kai-Wang; Chu, Hin; Li, Cun; Wang, Dong; Yang, Dong; Zheng, Shufa; Hao, Ke; Bosse, Yohan; Obeidat, Ma'en; Brandsma, Corry-Anke; Song, You-Qiang; Chen, Yu; Zheng, Bo-Jian; Li, Lanjuan; Yuen, Kwok-Yung

    2015-01-01

    The genetic predisposition to severe A(H1N1) 2009 (A[H1N1]pdm09) influenza was evaluated in 409 patients, including 162 cases with severe infection and 247 controls with mild infection. We prioritized candidate variants based on the result of a pilot genome-wide association study and a lung expressi

  17. Do Antenatal and Postnatal Parental Psychological Distress, and Recognized Need of Help Predict Preadolescent's Psychiatric Symptoms? The Finnish Family Competence Cohort Study

    Science.gov (United States)

    Pihlakoski, Leena; Sourander, Andre; Aromaa, Minna; Ronning, John A.; Rautava, Paivi; Helenius, Hans; Sillanpaa, Matti

    2013-01-01

    In a prospective population-based study, mothers and fathers of 1,247 children reported their physical and mental health during pregnancy, after delivery, within the child's first 18 months of life, and at 12 years. Additionally, maternal health clinic nurses rated parents' well-being and perceived need for support. At age 12, child outcomes were…

  18. Vervangende toestemming tot verhuizing naar Finland

    NARCIS (Netherlands)

    A.J.M. Nuytinck (André)

    2013-01-01

    markdownabstract__Abstract__ In de onderhavige beschikking gaat de Hoge Raad in op de betekenis van het in artikel 1:247 lid 4 BW bedoelde gelijkwaardig ouderschap en op de vraag of op het uitgangspunt hiervan een uitzondering kan worden gemaakt.

  19. Improving Mathematics Learning of Kindergarten Students through Computer-Assisted Instruction

    Science.gov (United States)

    Foster, Matthew E.; Anthony, Jason L.; Clements, Doug H.; Sarama, Julie; Williams, Jeffrey M.

    2016-01-01

    This study evaluated the effects of a mathematics software program, the Building Blocks software suite, on young children's mathematics performance. Participants included 247 Kindergartners from 37 classrooms in 9 schools located in low-income communities. Children within classrooms were randomly assigned to receive 21 weeks of computer-assisted…

  20. Whole-body MRI in neurofibromatosis: incidental findings and prevalence of scoliosis

    Energy Technology Data Exchange (ETDEWEB)

    Jaremko, Jacob L.; MacMahon, Peter J.; Torriani, Martin; Bredella, Miriam A. [Massachusetts General Hospital and Harvard Medical School, Musculoskeletal Imaging and Intervention, Department of Radiology, Boston, MA (United States); Merker, Vanessa L.; Plotkin, Scott R. [Massachusetts General Hospital, Department of Neurology and Cancer Center, Boston, MA (United States); Mautner, Victor F. [University Medical Center Hamburg-Eppendorf, Department of Neurology, Hamburg (Germany)

    2012-08-15

    To demonstrate incidental findings and scoliosis on whole-body MRI (WBMRI) in patients with neurofibromatosis type 1 and 2 (NF1 and NF2, respectively), and schwannomatosis. Institutional review board approval and written informed consent were obtained for this prospective HIPAA-compliant study. A total of 247 subjects (141 with NF1, 55 with NF2, 51 with schwannomatosis; 132 women (53.5%); mean age, 41 years, range, 18-97 years) underwent WBMRI using coronal STIR (TR/TE: 4190/111 ms, TI: 150 ms) and T1-weighted images (TR/TE: 454/10 ms), 10-mm slice thickness, imaging time {proportional_to}40 min. Images were reviewed for the presence of incidental findings, outside of nerve sheath tumors. The presence of scoliosis was recorded and curve morphology was assessed and quantified. Incidental findings other than scoliosis were recorded in 104/247 (42%) patients, most often affecting the musculoskeletal system (65/247 patients, 26%). We found 16/247 (6.5%) significant incidental findings likely to affect clinical management, including avascular necrosis of bone in eight patients (five with NF2), eight insufficiency fractures, and four non-neurogenic neoplasms (Hodgkin's lymphoma, liposarcoma, dermoid cyst, large uterine myoma requiring excision). Scoliosis was seen in 50/247 patients (20%), including 8/55 with NF2 (15%) and 11/51 with schwannomatosis (22%). Incidental findings in the neurofibromatoses frequently involve the skeleton. Given the relatively high incidence of unsuspected osteonecrosis and stress fractures, close attention to the skeleton on WBMRI is advised. In addition, knowledge of common incidental findings can help clinicians prepare patients who undergo WBMRI for potential unexpected findings. (orig.)

  1. Odd-even effects in the nuclear fission

    International Nuclear Information System (INIS)

    By the adopted way it succeeded without a completely free parameter to reproduce the experimental values for the odd-even effect for all those nuclei for which data were present. These are all even-charged nuclei from thorium to californium. Partly the OE-effect was studied in spontaneous fission, partly in neutron induced fission with thermal, 1.9-, and 3.0- MeV neutrons. It was shown that the calculated values depend very strongly from the one-particle model which is assumed in order to calculate the probabilities for pairing excitations. Thereby not only the steepness plays a role with which the one-particle energies cross the Fermi edge, but also the deformation velocity, and finally the remaining time until the scission point. That means that the whole procedure depends extremely from details of the one-particle model. Different one-particle models can be excluded because they contain simply too many crossings and then the OE effect tends to O. (orig./HSI)

  2. Fast neutron tomography with real-time pulse-shape discrimination in organic scintillation detectors

    Science.gov (United States)

    Joyce, Malcolm J.; Agar, Stewart; Aspinall, Michael D.; Beaumont, Jonathan S.; Colley, Edmund; Colling, Miriam; Dykes, Joseph; Kardasopoulos, Phoevos; Mitton, Katie

    2016-10-01

    A fast neutron tomography system based on the use of real-time pulse-shape discrimination in 7 organic liquid scintillation detectors is described. The system has been tested with a californium-252 source of dose rate 163 μSv/h at 1 m and neutron emission rate of 1.5×107 per second into 4π and a maximum acquisition time of 2 h, to characterize two 100×100×100 mm3 concrete samples. The first of these was a solid sample and the second has a vertical, cylindrical void. The experimental data, supported by simulations with both Monte Carlo methods and MATLAB®, indicate that the presence of the internal cylindrical void, corners and inhomogeneities in the samples can be discerned. The potential for fast neutron assay of this type with the capability to probe hydrogenous features in large low-Z samples is discussed. Neutron tomography of bulk porous samples is achieved that combines effective penetration not possible with thermal neutrons in the absence of beam hardening.

  3. γ -soft Ba146 and the role of nonaxial shapes at N90

    Energy Technology Data Exchange (ETDEWEB)

    Mitchell, A. J.; Lister, C. J.; McCutchan, E. A.; Albers, M.; Ayangeakaa, A. D.; Bertone, P. F.; Carpenter, M. P.; Chiara, C. J.; Chowdhury, P.; Clark, J. A.; Copp, P.; David, H. M.; Deo, A. Y.; DiGiovine, B.; D' Olympia, N.; Dungan, R.; Harding, R. D.; Harker, J.; Hota, S. S.; Janssens, R. V. F.; Kondev, F. G.; Liu, S. H.; Ramayya, A. V.; Rissanen, J.; Savard, G.; Seweryniak, D.; Shearman, R.; Sonzogni, A. A.; Tabor, S. L.; Walters, W. B.; Wang, E.; Zhu, S.

    2016-01-01

    Low-spin states in the neutron-rich, N=90 nuclide Ba146 were populated following β decay of Cs146, with the goal of clarifying the development of deformation in barium isotopes through delineation of their nonyrast structures. Fission fragments of Cs146 were extracted from a 1.7-Ci Cf252 source and mass selected using the CAlifornium Rare Ion Breeder Upgrade (CARIBU) facility. Low-energy ions were deposited at the center of a box of thin β detectors, surrounded by a highly efficient high-purity Ge array. The new Ba146 decay scheme now contains 31 excited levels extending up to ~2.5 MeV excitation energy, double what was previously known. These data are compared to predictions from the interacting boson approximation (IBA) model. It appears that the abrupt shape change found at N=90 in Sm and Gd is much more gradual in Ba and Ce, due to an enhanced role of the γ degree of freedom.

  4. Use of plasma desorption time-of-flight mass spectrometry to screen for products of prohormone processing in crude tissue extracts

    International Nuclear Information System (INIS)

    Californium-252 plasma desorption mass spectrometry (252Cf PDMS) of a crude, desalted, extract of piscine endocrine pancreas provided mass information for the major biologically active peptide hormones present in this tissue. An extraction procedure compatible with 252Cf PDMS analysis was developed. In extracts of catfish pancreas, strong molecular ions were identified in the positive mode for somatostatin-14 (1638 amu), O-glycosylated somatostatin-22 (2944 amu), glucagon (3512 amu), glucagon-like peptide (3785 amu), insulin (ca. 5550 amu), and other prohormone-derived peptides. Both protonated species and sodium adducts were apparent in the mass spectrum. A number of other molecular ions were observed including somatostatin-26, 1-10 (1014 amu) and the entire portion of prosomatostatin-22 remaining after removal of somatostatin-22 (6465 amu). The data obtained by this method also resulted in the identification of the third major product of proglucagon processing in catfish pancreas, glicentin-related polypeptide. Subtractive Edman degradation analyzed by 252Cf PDMS was also used to confirm a mass assignment

  5. Nuclear Chemistry Institute, Mainz University. Annual Report 1995

    International Nuclear Information System (INIS)

    The annual report of the Institut fuer Kernchemie addresses inter alia three main research activities. The first belongs to the area of basic research, covering studies in the fields of nuclear fission, chemistry of the super-heavy elements and of heavy-ion reactions extending from the Coulomb barrier to relativistic energies, and nuclear astrophysics in connection with the ''r process''. By means of laser technology, high-precision data could be measured of the ionization energies of berkelium and californium. Studies of atomic clusters in the vacuum of an ionization trap revealed interesting aspects. The second major activity was devoted to the analysis of environmental media, applying inter alia neutron activation analysis and resonance ionization mass spectroscopy (RIMS). The third activity resulted in the development of novel processes, or the enhancement of existing processes or methods, for applications in basic research work and in environmental analytics. Another item of interest is the summarizing report on the operation of the TRIGA research reactor. (orig./SR)

  6. About possibilities of obtaining focused beams of thermal neutrons of radionuclide source

    International Nuclear Information System (INIS)

    Full text: In the last years significant progress is achieved in development of neutron focusing methods (concentrating neutrons in a given direction and a small area). In this, main attention is given to focusing of neutron beams of reactor, particularly cold neutrons and their applications. [1,2]. However, isotope sources also let obtain intensive neutron beams and solve quite important (tasks) problems (e.g. neutron capture therapy for malignant tumors) [3], and an actual problems is focusing of neutrons. We developed a device on the basis of californium source of neutrons, allowing to obtain focused (preliminarily) beam of thermal neutrons with the aid of respective choice of moderators, reflectors and geometry of their disposition. Here, fast neutrons and gamma rays in the beam are minimized. With the aid of the model we developed on the basis of Monte-Carlo method, it is possible to modify aforementioned device and dynamics of output neutrons in wide energy range and analyze ways of optimization of neutron beams of isotope sources with different neutron outputs. Device of preliminary focusing of thermal neutrons can serve as a basis for further focus of neutrons using micro- and nano-capillar systems. It is known that, capillary systems performed with certain technology can form beam of thermal neutrons increasing its density by more than two orders of magnitude and effectively divert beams up to 20o with length of system 15 cm

  7. Production of Medical Radioisotopes in the ORNL High Flux Isotope Reactor (HFIR) for Cancer Treatment and Arterial Restenosis Therapy after PTCA

    Science.gov (United States)

    Knapp, F. F. Jr.; Beets, A. L.; Mirzadeh, S.; Alexander, C. W.; Hobbs, R. L.

    1998-06-01

    The High Flux Isotope Reactor (HFIR) at the Oak Ridge National Laboratory (ORNL) represents an important resource for the production of a wide variety of medical radioisotopes. In addition to serving as a key production site for californium-252 and other transuranic elements, important examples of therapeutic radioisotopes which are currently routinely produced in the HFIR for distribution include dysprosium-166 (parent of holmium-166), rhenium-186, tin-117m and tungsten-188 (parent of rhenium-188). The nine hydraulic tube (HT) positions in the central high flux region permit the insertion and removal of targets at any time during the operating cycle and have traditionally represented a major site for production of medical radioisotopes. To increase the irradiation capabilities of the HFIR, special target holders have recently been designed and fabricated which will be installed in the six Peripheral Target Positions (PTP), which are also located in the high flux region. These positions are only accessible during reactor refueling and will be used for long-term irradiations, such as required for the production of tin-117m and tungsten-188. Each of the PTP tubes will be capable of housing a maximum of eight HT targets, thus increasing the total maximum number of HT targets from the current nine, to a total of 57. In this paper the therapeutic use of reactor-produced radioisotopes for bone pain palliation and vascular brachytherapy and the therapeutic medical radioisotope production capabilities of the ORNL HFIR are briefly discussed.

  8. Neutron activation determination of gold in technogenic raw materials with different mineral composition

    Directory of Open Access Journals (Sweden)

    Yudakov Aleksandr A.

    2015-01-01

    Full Text Available The methods used to determine the gold content in the technogenic objects of gold mining were analyzed regarding their non-homogeneity and complexity of chemical and mineral compositions. A possible application of the neutron activation analysis with the use of the californium source of neutrons for determining the content of fine-grained and extra-fine-grained gold in the technogenic objects, including the bottom-ash waste of energy providers, is considered. It was demonstrated that the chemical composition of the sample affects the neuron flux distribution in the sample, which can essentially distort the results of the neutron activation analysis. In order to eliminate possible systematic errors investigations of the effect of the sample mineral composition on the results of the gold determination using the neutron activation analysis were carried out. Namely, a large mass of rock (3-5 kg was loaded into an activation zone using four matrix types such as silicate, carbon-containing, iron-containing, and titanium magnetite. It was shown that there wereno significant difference between the dispersal of the fluxes of thermal and resonance neutrons emitted from 252Cf during activation of the gold-containing technogenic samples with different mineral compositions.

  9. On-line charge breeding using ECRIS and EBIS

    Science.gov (United States)

    Vondrasek, Richard

    2016-06-01

    The efficient and rapid production of a high-quality, pure beam of highly charged ions is at the heart of any radioactive ion beam facility. Whether an electron cyclotron resonance (ECR) ion source or an electron beam ion source (EBIS) is used to produce these highly charged ions, their operating characteristics will set the boundaries on the range of experiments which can be performed. In addition, time structure and duty cycle have to be considered when defining the operating parameters of the accelerator system as a whole. At Argonne National Laboratory (ANL), an ECR charge breeder was developed as part of the Californium Rare Ion Breeder Upgrade (CARIBU) program. The charge breeding efficiency and high charge state production of the source is at the forefront of ECR charge breeders, but its overall performance as part of the accelerator system is limited by pervasive background and relatively long breeding times. As such, an EBIS charge breeder has been developed and is running in an off-line configuration. It has already demonstrated good breeding efficiencies, shorter residence times, and reduced background and is scheduled to replace the ECR charge breeder in late 2015. The resultant change in duty cycle and time structure necessitates changes to the overall operation of the facility. The experiences with these breeders, as well as from several other facilities which already utilize an ECR or EBIS for charge breeding, help to define the operational characteristics of each technology - their strengths, their weaknesses, and the possible paths to improvement.

  10. Report on the workshop "Decay spectroscopy at CARIBU: advanced fuel cycle applications, nuclear structure and astrophysics". 14-16 April 2011, Argonne National Laboratory, USA.

    Energy Technology Data Exchange (ETDEWEB)

    Kondev, F.; Carpenter, M.P.; Chowdhury, P.; Clark, J.A.; Lister, C.J.; Nichols, A.L.; Swewryniak, D. (Nuclear Engineering Division); (Univ. of Massachusetts); (Univ. of Surrey)

    2011-10-06

    A workshop on 'Decay Spectroscopy at CARIBU: Advanced Fuel Cycle Applications, Nuclear Structure and Astrophysics' will be held at Argonne National Laboratory on April 14-16, 2011. The aim of the workshop is to discuss opportunities for decay studies at the Californium Rare Isotope Breeder Upgrade (CARIBU) of the ATLAS facility with emphasis on advanced fuel cycle (AFC) applications, nuclear structure and astrophysics research. The workshop will consist of review and contributed talks. Presentations by members of the local groups, outlining the status of relevant in-house projects and availabile equipment, will also be organized. time will also be set aside to discuss and develop working collaborations for future decay studies at CARIBU. Topics of interest include: (1) Decay data of relevance to AFC applications with emphasis on reactor decay heat; (2) Discrete high-resolution gamma-ray spectroscopy following radioactive decya and related topics; (3) Calorimetric studies of neutron-rich fission framgents using Total ABsorption Gamma-Ray Spectrometry (TAGS) technique; (4) Beta-delayed neutron emissions and related topics; and (5) Decay data needs for nuclear astrophysics.

  11. Preliminary Identification of Three New Isolates in Genus Alexandrium (Dinophyceae) from China Sea Area

    Institute of Scientific and Technical Information of China (English)

    FAN Lijing; SUI Zhenghong; MAO Yunxiang; GUO Hao

    2007-01-01

    The 5.8 S ribosomal DNA sequences (5.8S rDNA) and their flanking regions, internal transcribed spacer 1 and spacer 2(ITS1 and ITS2) of three new isolates in genus Alexandrium (Alexandrium sp. qdl, Alexandrium sp. qd2, Alexandrium sp. gz) from China were amplified, sequenced, and subjected to phylogenetic analysis. Alexandrium sp. gz and Alexandrium sp. qdl were grouped with high bootstrap values with four strains/species, i.e., A. catenella South Korea strain, A. catenella Japan strain, and two from China, Alexandrium sp. AC03 and Alexandrium sp. AN01 being proposed to be A. catenalla in a previous study. Then Alexandrium sp. gz and Alexandrium sp. qdl were identified as Alexandrium catenella. As A. catenella was isolated from Qingdao and Guangzhou sea areas, it supposedly distributed at least in these two areas and was genetically different. Alexandrium sp. qd2 differed greatly from species in Alexandrium. It clustered with Symbiodinium californium, Symbiodinium sp. Gl5 and Gymnodinium sp. Zhao 01 with 100% bootstrap value; so Alexandrium sp. qd2 affiliates to genus Symbiodinium, and is probably a free-living Symbiodinium species.

  12. Extraction studies of selected actinide ions from aqueous solutions with 4-benzoyl-2,4-dihydro-5-methyl-2-phenyl-3H-pyrazol-3-thione and tri-n-octylphosphine oxide

    Energy Technology Data Exchange (ETDEWEB)

    Hannink, N.J.; Hoffman, D.C. [Lawrence Berkeley Lab., CA (United States)]|[California Univ., Berkeley, CA (United States). Dept. of Chemistry; Smith, B.F. [Los Alamos National Lab., NM (United States)

    1991-11-01

    The first measurements of distribution coefficients (K{sub d}) for Cm(III), Bk(III), Cf(III), Es(III), and Fm(III) between aqueous perchlorate solutions and solutions of 4-benzoyl-2,4-dihydro-5-methyl-2-phenyl-3H-pyrazol-3-thione (BMPPT) and the synergist tri-n-octylphosphine oxide (TOPO) in toluene are reported. Curium-243, berkelium-250, californium-249, einsteinium-254, and fermium-253 were used in these studies. The K{sub d} for {sup 241}Am was also measured and is in agreement with previously published results. Our new results show that the K{sub d}`s decrease gradually with increasing atomic number for the actinides with a dip at Cf. In general, the K{sub d}`s for these actinides are about a factor of 5 to 10 greater than the K{sub d}`s for the homologous lanthanides at a pH of 2.9, a BMPPT concentration of 0.2 M, and a TOPO concentration of 0.04 M. The larger K{sub d}`s for the actinides are consistent with greater covalent bonding between the actinide metal ion and the sulfur bonding site in the ligand.

  13. Extraction studies of selected actinide ions from aqueous solutions with 4-benzoyl-2,4-dihydro-5-methyl-2-phenyl-3H-pyrazol-3-thione and tri-n-octylphosphine oxide

    Energy Technology Data Exchange (ETDEWEB)

    Hannink, N.J.; Hoffman, D.C. (Lawrence Berkeley Lab., CA (United States) California Univ., Berkeley, CA (United States). Dept. of Chemistry); Smith, B.F. (Los Alamos National Lab., NM (United States))

    1991-11-01

    The first measurements of distribution coefficients (K{sub d}) for Cm(III), Bk(III), Cf(III), Es(III), and Fm(III) between aqueous perchlorate solutions and solutions of 4-benzoyl-2,4-dihydro-5-methyl-2-phenyl-3H-pyrazol-3-thione (BMPPT) and the synergist tri-n-octylphosphine oxide (TOPO) in toluene are reported. Curium-243, berkelium-250, californium-249, einsteinium-254, and fermium-253 were used in these studies. The K{sub d} for {sup 241}Am was also measured and is in agreement with previously published results. Our new results show that the K{sub d}'s decrease gradually with increasing atomic number for the actinides with a dip at Cf. In general, the K{sub d}'s for these actinides are about a factor of 5 to 10 greater than the K{sub d}'s for the homologous lanthanides at a pH of 2.9, a BMPPT concentration of 0.2 M, and a TOPO concentration of 0.04 M. The larger K{sub d}'s for the actinides are consistent with greater covalent bonding between the actinide metal ion and the sulfur bonding site in the ligand.

  14. Extraction studies of selected actinide ions from aqueous solutions with 4-benzoyl-2,4-Dihydro-5-methyl-2-phenyl-3H-pyrazol-3-thione and Tri-n-octylphosphine oxide

    Energy Technology Data Exchange (ETDEWEB)

    Hannink, N.J.; Hoffman, D.C. [Lawrence Berkeley Lab., CA (United States); Smith, B.F. [Los Alamos National Lab., NM (United States)

    1992-07-01

    The first measurements of distribution coefficients (k{sub d}) for Cm(III), Bk(III), Cf(III), Es(III), and Fm(III) between aqueous perchlorate solutions and solutions of 4-benzoyl-2,4-dihydro-5-methyl-2-phenyl-3H-pyrazol-3-thione (BMPPT) and the synergist tri-n-octylphosphine oxide (TOPO) in toluene are reported. Curium-243, berkelium-250, californium-249, einsteinium-254, and fermium-253 were used in these studies. The K{sub d} for {sup 241}Am was also measured and is in agreement with previously published results. Our new results show that the K{sub d}`s decrease gradually with increasing atomic number for the actinides with a dip at Cf. In general, the K{sub d}`s for these actinides are about about a factor of 10 greater than the K{sub d}`s for the homologous lanthanides at a pH of 2.9, a BMPPT concentration of 0.2 M, and a TOPO concentration of 0.04 M. The larger K{sub d}`s for the actinides are consistent with greater covalent bonding between the actinide metal ion and the sulfur bonding site in the ligand. 9 refs., 2 figs., 1 tab.

  15. A carbon cluster ion source for mass calibration at TRIGA-TRAP

    International Nuclear Information System (INIS)

    TRIGA-TRAP is a high-precision penning trap mass spectrometer installed at the research reactor TRIGA Mainz in order to determine the masses of short-lived fission products and - in addition to that - also the masses of actinide elements ranging from uranium up to californium. In order to determine precisely the masses of the nuclides of interest, the superconducting magnet providing the strong magnetic field for the Penning trap has to be calibrated by measuring the cyclotron frequency of an ion with well-known mass, which is, if possible, an isobaric nuclide of the ion of interest. Therefore, the best possible choice for mass calibration is to use carbon clusters as mass references, as demonstrated at the ISOLTRAP facility at ISOLDE/CERN. A laser ablation ion source for the production of carbon clusters has been developed using a frequency-doubled Nd:YAG laser. The design, current status, and results of the production of carbon cluster ions, using C60 and Sigradure registered samples, as well as other ions are presented

  16. Perspectives for online analysis of raw material by pulsed neutron irradiation

    Science.gov (United States)

    Bach, Pierre; Le Tourneur, P.; Poumarede, B.

    1997-02-01

    On-line analysis by pulsed neutron irradiation is an example of an advanced technology application of nuclear techniques, concerning real problems in the cement, mineral and coal industries. The most significant of these nuclear techniques is their capability of continuous measurement without contact and without sampling, which can lead to improved control of processes and resultant large financial savings. Compared to Californium neutron sources, the use of electrical pulsed neutron generators allows to obtain a higher signal/noise ratio for a more sensitive measurement, and allows to overcome a number of safety problems concerning transportation, installation and maintenance. An experiment related to a possible new on-line raw material analyzer is described, using a pulsed neutron generator. The key factors contributing to an accurate measurement are related to a suitable generator, to a high count rate gamma ray spectroscopy electronics, and to computational tools. Calculation and results for the optimization of the neutron irradiation time diagram are reported. One of the operational characteristics of such an equipment is related to neutron flux available: it is possible to adjust it to the requested accuracy, i.e. for a high accuracy during a few hours/day and for a lower accuracy the rest of the time. This feature allows to operate the neutron tube during a longer time, and then to reduce the cost of analysis.

  17. A review of neutron scattering correction for the calibration of neutron survey meters using the shadow cone method

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Sang In; Kim, Bong Hwan; Kim, Jang Lyul; Lee, Jung Il [Health Physics Team, Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of)

    2015-12-15

    The calibration methods of neutron-measuring devices such as the neutron survey meter have advantages and disadvantages. To compare the calibration factors obtained by the shadow cone method and semi-empirical method, 10 neutron survey meters of five different types were used in this study. This experiment was performed at the Korea Atomic Energy Research Institute (KAERI; Daejeon, South Korea), and the calibration neutron fields were constructed using a {sup 252}Californium ({sup 252}Cf) neutron source, which was positioned in the center of the neutron irradiation room. The neutron spectra of the calibration neutron fields were measured by a europium-activated lithium iodide scintillator in combination with KAERI's Bonner sphere system. When the shadow cone method was used, 10 single moderator-based survey meters exhibited a smaller calibration factor by as much as 3.1 - 9.3% than that of the semi-empirical method. This finding indicates that neutron survey meters underestimated the scattered neutrons and attenuated neutrons (i.e., the total scatter corrections). This underestimation of the calibration factor was attributed to the fact that single moderator-based survey meters have an under-ambient dose equivalent response in the thermal or thermal-dominant neutron field. As a result, when the shadow cone method is used for a single moderator-based survey meter, an additional correction and the International Organization for Standardization standard 8529-2 for room-scattered neutrons should be considered.

  18. Review of the accomplishments and promise of US transplutonium research, 1940-1981

    International Nuclear Information System (INIS)

    It has been just over 40 years since the identification of plutonium by Seaborg, McMillan, Kennedy, and Wahl at the University of California, Berkeley. This discovery, and the isolation of plutonium-239 a year later by Kennedy, Seaborg, Segre, and Wahl, laid the cornerstone of one of the most exciting and productive eras of research in American history - research on the transplutonium elements. This research was to span all fields of natural science, and indeed was to have many implications and applications in the biological sciences. In this brief document, we have attempted to touch on only some of the many achievements of the US heavy element program. Many of those whose work has been at the heart of this research have contributed to this report. They have summarized some of what was scientifically important and exciting and they have suggested some of the topics of important research remaining to be done. The following topics are covered in this review: historical account; plutonium; synthesis of transplutonium isotopes; nuclear fission and stability, heavy ion reactions and nuclear structure; chemistry of the transplutonium elements; optical and magnetic properties; electronic structure and solid state properties; environmental and biological behavior of transplutonium elements; heavy element production; application of californium-252

  19. Time-of-flight mass spectrometry with desorption-ionization multiprobes (UV photons and KeV and MeV particles). Cluster atoms are used as projectiles

    International Nuclear Information System (INIS)

    A new time-of-flight mass spectrometer, Super-Depil, is used to study secondary ion emission from solid surfaces bombarded by various kinds of primary particles. Three different desorption probes were set up on this machine: a 252 californium source, providing by spontaneous fission about 1 MeV/u energy heavy ions, a 5 to 30 keV energy pulsed caesium ion gun and a pulsed nitrogen laser, which wavelength is 337 mm. A two stages electrostatic mirror was added to the spectrometer. The time spread due to the initial kinetic energy of secondary ions leaving the surface was minimized. The mass resolution is greater than 5000. The analysis of glycosidic terpenes showed the complementarity of the three probes. The study of such metastable ions, with the electrostatic mirror, showed that some fragment ions may conserve the memory of the stereochemistry of the neutral lost. Clusters ions were used as projectiles in the energy range 5-60 keV. A strong non linear enhancement was observed in the secondary ion yield from various targets

  20. Compensated bismuth-loaded plastic scintillators for neutron detection using low-energy pseudo-spectroscopy

    Science.gov (United States)

    Dumazert, Jonathan; Coulon, Romain; Bertrand, Guillaume H. V.; Normand, Stéphane; Méchin, Laurence; Hamel, Matthieu

    2016-05-01

    Gadolinium-covered modified plastic scintillators show a high potential for the deployment of cost-effective neutron detectors. Taking advantage of the low-energy photon and electron signature of thermal neutron captures in gadolinium-155 and gadolinium-157 however requires a background correction. In order to display a trustable rate, dual compensation schemes appear as an alternative to Pulse Shape Discrimination. This paper presents the application of such a compensation scheme to a two-bismuth loaded plastic scintillator system. A detection scintillator interacts with incident photon and fast neutron radiations and is covered with a gadolinium converter to become thermal neutron-sensitive as well. In the meantime, an identical compensation scintillator, covered with terbium, solely interacts with the photon and fast neutron part of incident radiations. After the acquisition and the treatment of the counting signals from both sensors, a hypothesis test determines whether the resulting count rate after subtraction falls into statistical fluctuations or provides a robust image of neutron activity. A laboratory prototype is tested under both photon and neutron radiations, allowing us to investigate the performance of the overall compensation system. The study reveals satisfactory results in terms of robustness to a cesium-137 background and in terms of sensitivity in presence of a californium-252 source.