WorldWideScience

Sample records for californium 247

  1. Californium-252 progress, report No. 7, April 1971

    Energy Technology Data Exchange (ETDEWEB)

    1971-12-31

    This report contains discusses of the following topics on Californium-252: First sales of californium-252; encapsulation services discussed; three new participants in market evaluation program; summer training programs to use californium; Californium-252 shipping casks available; Californium-252 questions and answers, radiotherapy; neutron radiography; natural resources exploration; nuclear safeguards; process control; dosimetry; neutron radiography; neutron shielding; and nuclear safeguards.

  2. Historical review of californium-252 discovery and development

    Science.gov (United States)

    Stoddard, D. H.

    This paper discusses the discovery and history of californium 252. This isotope may be synthesized by irradiating plutonium 239, plutonium 242, americium 243, or curium 244 with neutrons in a nuclear reactor. Various experiments and inventions involving (252)Cf conducted at the Savannah River Plant are discussed. The evolution of radiotherapy using californium 252 is reviewed.

  3. Californium-252: a remarkable versatile radioisotope

    Energy Technology Data Exchange (ETDEWEB)

    Osborne-Lee, I.W.; Alexander, C.W.

    1995-10-10

    A product of the nuclear age, Californium-252 ({sup 252}Cf) has found many applications in medicine, scientific research, industry, and nuclear science education. Californium-252 is unique as a neutron source in that it provides a highly concentrated flux and extremely reliable neutron spectrum from a very small assembly. During the past 40 years, {sup 252}Cf has been applied with great success to cancer therapy, neutron radiography of objects ranging from flowers to entire aircraft, startup sources for nuclear reactors, fission activation for quality analysis of all commercial nuclear fuel, and many other beneficial uses, some of which are now ready for further growth. Californium-252 is produced in the High Flux Isotope Reactor (HFIR) and processed in the Radiochemical Engineering Development Center (REDC), both of which are located at the Oak Ridge National Laboratory (ORNL) in Oak Ridge, Tennessee. The REDC/HFIR facility is virtually the sole supplier of {sup 252}Cf in the western world and is the major supplier worldwide. Extensive exploitation of this product was made possible through the {sup 252}Cf Market Evaluation Program, sponsored by the United States Department of Energy (DOE) [then the Atomic Energy Commission (AEC) and later the Energy Research and Development Administration (ERDA)]. This program included training series, demonstration centers, seminars, and a liberal loan policy for fabricated sources. The Market Evaluation Program was instituted, in part, to determine if large-quantity production capability was required at the Savannah River Laboratory (SRL). Because of the nature of the product and the means by which it is produced, {sup 252}Cf can be produced only in government-owned facilities. It is evident at this time that the Oak Ridge research facility can meet present and projected near-term requirements. The production, shipment, and sales history of {sup 252}Cf from ORNL is summarized herein.

  4. Production, Distribution, and Applications of Californium-252 Neutron Sources

    Energy Technology Data Exchange (ETDEWEB)

    Balo, P.A.; Knauer, J.B.; Martin, R.C.

    1999-10-03

    The radioisotope {sup 252}Cf is routinely encapsulated into compact, portable, intense neutron sources with a 2.6-year half-life. A source the size of a person's little finger can emit up to 10{sup 11} neutrons/s. Californium-252 is used commercially as a reliable, cost-effective neutron source for prompt gamma neutron activation analysis (PGNAA) of coal, cement, and minerals, as well as for detection and identification of explosives, laud mines, and unexploded military ordnance. Other uses are neutron radiography, nuclear waste assays, reactor start-up sources, calibration standards, and cancer therapy. The inherent safety of source encapsulations is demonstrated by 30 years of experience and by U.S. Bureau of Mines tests of source survivability during explosions. The production and distribution center for the U. S Department of Energy (DOE) Californium Program is the Radiochemical Engineering Development Center (REDC) at Oak Ridge National Laboratory (ORNL). DOE sells The radioisotope {sup 252}Cf is routinely encapsulated into compact, portable, intense neutron sources with a 2.6- year half-life. A source the size of a person's little finger can emit up to 10 neutrons/s. Californium-252 is used commercially as a reliable, cost-effective neutron source for prompt gamma neutron activation analysis (PGNAA) of coal, cement, and minerals, as well as for detection and identification of explosives, laud mines, and unexploded military ordnance. Other uses are neutron radiography, nuclear waste assays, reactor start-up sources, calibration standards, and cancer therapy. The inherent safety of source encapsulations is demonstrated by 30 years of experience and by U.S. Bureau of Mines tests of source survivability during explosions. The production and distribution center for the U. S Department of Energy (DOE) Californium Program is the Radiochemical Engineering Development Center (REDC) at Oak Ridge National Laboratory(ORNL). DOE sells {sup 252}Cf to commercial

  5. Unusual structure, bonding and properties in a californium borate

    Energy Technology Data Exchange (ETDEWEB)

    Polinski, Matthew J.; Garner, Edward B.; Maurice, Rémi; Planas, Nora; Stritzinger, Jared T.; Parker, T. Gannon; Cross, Justin N.; Green, Thomas D.; Alekseev, Evgeny V.; Van Cleve, Shelley M.; Depmeier, Wulf; Gagliardi, Laura; Shatruk, Michael; Knappenberger, Kenneth L.; Liu, Guokui; Skanthakumar, S.; Soderholm, Lynda; Dixon, David A.; Albrecht-Schmitt, Thomas E.

    2014-03-23

    The participation of the valence orbitals of actinides in bonding has been debated for decades. Recent experimental and computational investigations demonstrated the involvement of 6p, 6d and/or 5f orbitals in bonding. However, structural and spectroscopic data, as well as theory, indicate a decrease in covalency across the actinide series, and the evidence points to highly ionic, lanthanide-like bonding for late actinides. Here we show that chemical differentiation between californium and lanthanides can be achieved by using ligands that are both highly polarizable and substantially rearrange on complexation. A ligand that suits both of these desired properties is polyborate. We demonstrate that the 5f, 6d and 7p orbitals are all involved in bonding in a Cf(III) borate, and that large crystal-field effects are present. Synthetic, structural and spectroscopic data are complemented by quantum mechanical calculations to support these observations.

  6. Biomedical neutron research at the Californium User Facility for neutron science

    Energy Technology Data Exchange (ETDEWEB)

    Martin, R.C. [Oak Ridge National Lab., TN (United States); Byrne, T.E. [Roane State Community College, Harriman, TN (United States); Miller, L.F. [Univ. of Tennessee, Knoxville, TN (United States)

    1997-04-01

    The Californium User Facility for Neutron Science has been established at Oak Ridge National Laboratory (ORNL). The Californium User Facility (CUF) is a part of the larger Californium Facility, which fabricates and stores compact {sup 252}Cf neutron sources for worldwide distribution. The CUF can provide a cost-effective option for research with {sup 252}Cf sources. Three projects at the CUF that demonstrate the versatility of {sup 252}Cf for biological and biomedical neutron-based research are described: future establishment of a {sup 252}Cf-based neutron activation analysis system, ongoing work to produce miniature high-intensity, remotely afterloaded {sup 252}Cf sources for tumor therapy, and a recent experiment that irradiated living human lung cancer cells impregnated with experimental boron compounds to test their effectiveness for boron neutron capture therapy.

  7. Nuclear Data Sheets for A = 247

    Energy Technology Data Exchange (ETDEWEB)

    Nesaraja, C.D.

    2015-03-15

    Available information pertaining to the nuclear structure of all nuclei with mass numbers A=247 is presented. Various decay and reaction data are evaluated and compared. Adopted data, levels, spin, parity and configuration assignments are given. When there are insufficient data, expected values from systematics of nuclear properties or/and theoretical calculations are quoted. Unexpected or discrepant experimental results are also noted. A summary and compilation of the discovery of various isotopes in this mass region is given in 2013Fr02 ({sup 247}Pu, {sup 247}Am, {sup 247}Cm, {sup 243}Bk, {sup 247}Cf), 2011Me01 ({sup 247}Es), and 2013Th02 ({sup 247}Fm, {sup 247}Md)

  8. 7 CFR 247.27 - Financial management.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Financial management. 247.27 Section 247.27... AGRICULTURE CHILD NUTRITION PROGRAMS COMMODITY SUPPLEMENTAL FOOD PROGRAM § 247.27 Financial management. (a) What are the Federal requirements for State and local agencies with regard to financial management...

  9. 7 CFR 247.19 - Dual participation.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Dual participation. 247.19 Section 247.19 Agriculture... CHILD NUTRITION PROGRAMS COMMODITY SUPPLEMENTAL FOOD PROGRAM § 247.19 Dual participation. (a) What must State and local agencies do to prevent and detect dual participation? The State agency must work with...

  10. 48 CFR 252.247-7018 - Subcontracting.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Subcontracting. 252.247... Clauses 252.247-7018 Subcontracting. As prescribed in 247.270-3(m), use the following clause: Subcontracting (DEC 1991) The Contractor shall not subcontract without the prior written approval of the...

  11. 7 CFR 247.18 - Nutrition education.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Nutrition education. 247.18 Section 247.18 Agriculture... CHILD NUTRITION PROGRAMS COMMODITY SUPPLEMENTAL FOOD PROGRAM § 247.18 Nutrition education. (a) What are the State agency's responsibilities in ensuring that nutrition education is provided? The State agency...

  12. 46 CFR 169.247 - Firefighting equipment.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Firefighting equipment. 169.247 Section 169.247 Shipping... Inspection and Certification Inspections § 169.247 Firefighting equipment. (a) At each inspection for... equipment is inspected to ensure it is in suitable condition. Tests may be necessary to determine the...

  13. 37 CFR 2.47 - Supplemental Register.

    Science.gov (United States)

    2010-07-01

    ... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Supplemental Register. 2.47 Section 2.47 Patents, Trademarks, and Copyrights UNITED STATES PATENT AND TRADEMARK OFFICE, DEPARTMENT OF COMMERCE RULES OF PRACTICE IN TRADEMARK CASES The Written Application § 2.47 Supplemental Register. (a) In...

  14. 7 CFR 247.34 - Management reviews.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Management reviews. 247.34 Section 247.34 Agriculture... CHILD NUTRITION PROGRAMS COMMODITY SUPPLEMENTAL FOOD PROGRAM § 247.34 Management reviews. (a) What must... agency must establish a management review system to ensure that local agencies, subdistributing agencies...

  15. 32 CFR 247.5 - Responsibilities.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false Responsibilities. 247.5 Section 247.5 National... DEPARTMENT OF DEFENSE NEWSPAPERS, MAGAZINES AND CIVILIAN ENTERPRISE PUBLICATIONS § 247.5 Responsibilities. (a... Commands shall: (1) Publish Combatant Command newspapers, if authorized. In discharging this responsibility...

  16. ISA 247: trans-ISA 247, trans-R 1524, ISA(TX)247, ISAtx 247, ISATx247, LX 211, LX211, R 1524, R-1524.

    Science.gov (United States)

    2007-01-01

    Isotechnika is developing the immunosuppressive drug ISA 247, a calcineurin inhibitor that is undergoing clinical development for the treatment of psoriasis (phase III) and prevention of organ rejection after transplantation (phase II). Preclinical development for uveitis is also underway. Other autoimmune disease indications that could be explored include arthritis, type I diabetes and Crohn's disease. ISA 247 was being co-developed as R 1524 by Isotechnika and Roche. However, Roche is no longer involved in the development of this compound. Based on analysis of previously collected data, the trans-ISA 247 isomer was found to be more bioavailable and it is expected that this isomer can be administered at a lower dose compared with the previous formulation that consisted of an equivalent mixture of the two geometric isomers (cis and trans). Preclinical observations indicate that ISA 247 has the potential to be more potent and less toxic than other marketed immunosuppressants in its class used for the prevention of transplant rejection. Experiments to date suggest that ISA 247 is about three times as potent as ciclosporin, while genotoxicity studies in animals have shown that the compound has a significantly reduced tendency to cause renal toxicity. The combination of reduced toxicity and improved potency would give ISA 247 a therapeutic benefit over existing calcineurin-based treatments. Isotechnika and Roche entered into a co-development and commercialisation agreement in April 2002, with Roche gaining the exclusive worldwide marketing rights for ISA 247; Isotechnika received milestone payments of $US4 million and $CAN21.9 million in September 2002 and May 2003, respectively. The agreement was restructured in April 2004, under which Isotechnika will now solely manage and fund the clinical development of trans-ISA 247. Upon successful completion of these trials, Isotechnika will conduct at its own expense a phase IIb study in renal transplantation and phase III

  17. Apparatus for the measurement of total body nitrogen using prompt neutron activation analysis with californium-252.

    Science.gov (United States)

    Mackie, A; Hannan, W J; Smith, M A; Tothill, P

    1988-01-01

    Details of clinical apparatus designed for the measurement of total body nitrogen (as an indicator of body protein), suitable for the critically ill, intensive-care patient are presented. Californium-252 radio-isotopic neutron sources are used, enabling a nitrogen measurement by prompt neutron activation analysis to be made in 40 min with a precision of +/- 3.2% for a whole body dose equivalent of 0.145 mSv. The advantages of Californium-252 over alternative neutron sources are discussed. A comparison between two irradiation/detection geometries is made, leading to an explanation of the geometry adopted for the apparatus. The choice of construction and shielding materials to reduce the count rate at the detectors and consequently to reduce the pile-up contribution to the nitrogen background is discussed. Salient features of the gamma ray spectroscopy system to reduce spectral distortion from pulse pile-up are presented.

  18. Safety Analysis Report for Packaging (SARP) of the Oak Ridge National Laboratory TRU Californium Shipping Container

    Energy Technology Data Exchange (ETDEWEB)

    Box, W.D.; Shappert, L.B.; Seagren, R.D.; Klima, B.B.; Jurgensen, M.C.; Hammond, C.R.; Watson, C.D.

    1980-01-01

    An analytical evaluation of the Oak Ridge National Laboratory TRU Californium Shipping Container was made in order to demonstrate its compliance with the regulations governing off-site shipment of packages that contain radioactive material. The evaluation encompassed five primary categories: structural integrity, thermal resistance, radiation shielding, nuclear criticality safety, and quality assurance. The results of this evaluation demonstrate that the container complies with the applicable regulations.

  19. 40 CFR 247.13 - Transportation products.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Transportation products. 247.13 Section 247.13 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES... Transportation products. (a) Traffic barricades and traffic cones used in controlling or restricting vehicular...

  20. 24 CFR 247.4 - Termination notice.

    Science.gov (United States)

    2010-04-01

    ... in rent shall in all cases be governed by 24 CFR parts 245, 246 and other applicable HUD regulations... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Termination notice. 247.4 Section 247.4 Housing and Urban Development Regulations Relating to Housing and Urban Development (Continued...

  1. 7 CFR 947.247 - Assessment rate.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 8 2010-01-01 2010-01-01 false Assessment rate. 947.247 Section 947.247 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Marketing Agreements and Orders; Fruits, Vegetables, Nuts), DEPARTMENT OF AGRICULTURE IRISH POTATOES GROWN IN MODOC AND SISKIYOU COUNTIES, CALIF., AND IN ALL...

  2. 27 CFR 19.247 - General.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false General. 19.247 Section 19.247 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE... impairing the efficiency of such bond. Executors, administrators, assignees, receivers, trustees, or other...

  3. Erythroderma: analysis of 247 cases

    Directory of Open Access Journals (Sweden)

    Cidia Vasconcellos

    1995-06-01

    Full Text Available The profile of 247 patients with erythroderma during a 23 year period from January, 1962 through March, 1985, with a follow-up period ranging from 1 to 26 years were analysed. The patients presented with diffuse erythema, scaling and pruritus of more than 2 months' duration, and the age ranged from 16 to 60 years. Psoriasis was the most frequent underlying disease with an estimated frequency of 44.9%, the reaction to the use of drugs appeared in 7.3% of total cases and association with reticulosis showed a frequency of 4.1%. The cause of the erythroderma could not be determined in 29.2% of the cases. Sex differences in terms of underlying diseases were not observed. One or more skin biopsies along with the clinical findings were diagnostic or suggestive of the underlying disease in 63.6% of the cases. Repeated skin biopsies are recommended as the best method for etiologic diagnosis of erythroderma. At P=0.05 significance level, masculine/feminine ratio of 2 : 1 was found. The question arises wether causal agent of erythroderma may not be somehow related to different exposure by sex to environmental antigens.

  4. Dicty_cDB: SLJ247 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLJ247 (Link to dictyBase) - - - Contig-U12195-1 SLJ247Z (Link... to Original site) - - SLJ247Z 293 - - - - Show SLJ247 Library SL (Link to library) Clone ID SLJ247 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLJ2-B/SLJ247Q.Seq.d/ Representative seq. ID SLJ24...7Z (Link to Original site) Representative DNA sequence >SLJ247 (SLJ247Q) /CSM/SL/SLJ2-B/SLJ247Q.Seq.d/ XXXXX...nificant alignments: (bits) Value SLJ247 (SLJ247Q) /CSM/SL/SLJ2-B/SLJ247Q.Seq.d/ 109 2e-23 SLG565 (SLG565Q)

  5. 24 CFR 247.2 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... CERTAIN SUBSIDIZED AND HUD-OWNED PROJECTS Subsidized Projects § 247.2 Definitions. Drug-related criminal activity means the illegal manufacture, sale, distribution, use or possession with the intent to manufacture, sell, distribute, or use, of a controlled substance as defined in section 102 of the Controlled...

  6. 7 CFR 247.9 - Eligibility requirements.

    Science.gov (United States)

    2010-01-01

    ... Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS COMMODITY SUPPLEMENTAL FOOD PROGRAM § 247.9 Eligibility requirements. (a... termination of pregnancy; or (6) Elderly persons, i.e., persons at least 60 years of age. (b) What are the...

  7. 7 CFR 247.16 - Certification period.

    Science.gov (United States)

    2010-01-01

    ... Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS COMMODITY SUPPLEMENTAL FOOD PROGRAM § 247.16 Certification period. (a... six weeks post-partum. (2) Elderly persons. For elderly persons, the State agency must establish...

  8. 48 CFR 247.301-70 - Definition.

    Science.gov (United States)

    2010-10-01

    ..., DEPARTMENT OF DEFENSE CONTRACT MANAGEMENT TRANSPORTATION Transportation in Supply Contracts 247.301-70 Definition. “Integrated logistics managers” or “third-party logistics providers” means providers of multiple logistics services. Some examples of logistics services are the management of transportation, demand...

  9. 48 CFR 952.247-70 - Foreign travel.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Foreign travel. 952.247-70 Section 952.247-70 Federal Acquisition Regulations System DEPARTMENT OF ENERGY CLAUSES AND FORMS SOLICITATION PROVISIONS AND CONTRACT CLAUSES Text of Provisions and Clauses 952.247-70 Foreign travel. As prescribed in 947.7002, insert the following...

  10. 43 CFR 2.47 - Records subject to Privacy Act.

    Science.gov (United States)

    2010-10-01

    ... 43 Public Lands: Interior 1 2010-10-01 2010-10-01 false Records subject to Privacy Act. 2.47 Section 2.47 Public Lands: Interior Office of the Secretary of the Interior RECORDS AND TESTIMONY; FREEDOM OF INFORMATION ACT Privacy Act § 2.47 Records subject to Privacy Act. The Privacy Act applies to all...

  11. Dicty_cDB: SFK247 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SF (Link to library) SFK247 (Link to dictyBase) - - - Contig-U03710-1 SFK247F (Link to Original site)...SFK247F 102 - - - - - - Show SFK247 Library SF (Link to library) Clone ID SFK247 (Link to dictyBase)...exiguum WGS library Go... 46 0.22 1 ( DU979309 ) KBrH065O10R KBrH (HindIII) BAC library Brassica r.....25 2 ( DU122111 ) KBrH114F15F Brassica rapa BAC library KBrH Brassi... 34 0.29 2 ( CW988577 ) KBrH015K09R

  12. The Dusty Disc of NGC 247

    Science.gov (United States)

    2011-03-01

    This image of NGC 247, taken by the Wide Field Imager on the MPG/ESO 2.2-metre telescope at ESO's La Silla Observatory in Chile, reveals the fine details of this highly inclined spiral galaxy and its rich backdrop. Astronomers say this highly tilted orientation, when viewed from Earth, explains why the distance to this prominent galaxy was previously overestimated. The spiral galaxy NGC 247 is one of the closest spiral galaxies of the southern sky. In this new view from the Wide Field Imager on the MPG/ESO 2.2-metre telescope in Chile large numbers of the galaxy's component stars are clearly resolved and many glowing pink clouds of hydrogen, marking regions of active star formation, can be made out in the loose and ragged spiral arms. NGC 247 is part of the Sculptor Group, a collection of galaxies associated with the Sculptor Galaxy (NGC 253, also shown in eso0902 and eso1025). This is the nearest group of galaxies to our Local Group, which includes the Milky Way, but putting a precise value on such celestial distances is inherently difficult. To measure the distance from the Earth to a nearby galaxy, astronomers have to rely on a type of variable star called a Cepheid to act as a distance marker. Cepheids are very luminous stars, whose brightness varies at regular intervals. The time taken for the star to brighten and fade can be plugged into a simple mathematical relation that gives its intrinsic brightness. When compared with the measured brightness this gives the distance. However, this method isn't foolproof, as astronomers think this period-luminosity relationship depends on the composition of the Cepheid. Another problem arises from the fact that some of the light from a Cepheid may be absorbed by dust en route to Earth, making it appear fainter, and therefore further away than it really is. This is a particular problem for NGC 247 with its highly inclined orientation, as the line of sight to the Cepheids passes through the galaxy's dusty disc. However, a

  13. 25 CFR 247.7 - Can I build a structure?

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Can I build a structure? 247.7 Section 247.7 Indians... FISHING ACCESS SITES § 247.7 Can I build a structure? (a) You may not build any structures at the sites... drying shed where space is available. You must remove any temporary drying shed you build. (e) If you...

  14. Creep Behaviour of Modified Mar-247 Superalloy

    Directory of Open Access Journals (Sweden)

    Cieśla M.

    2016-06-01

    Full Text Available The paper presents the results of analysis of creep behaviour in short term creep tests of cast MAR-247 nickel-based superalloy samples made using various modification techniques and heat treatment. The accelerated creep tests were performed under temperature of 982 °C and the axial stresses of σ = 150 MPa (variant I and 200 MPa (variant II. The creep behaviour was analysed based on: creep durability (creep rupture life, steady-state creep rate and morphological parameters of macro- and microstructure. It was observed that the grain size determines the creep durability in case of test conditions used in variant I, durability of coarse-grained samples was significantly higher.

  15. Application of TSH bioindicator for studying the biological efficiency of neutrons from californium-252 source

    Energy Technology Data Exchange (ETDEWEB)

    Cebulska-Wasilewska, A.; Rekas, K. [Institute of Nuclear Physics, Cracow (Poland); Kim, J.K. [Korea Atomic Energy Research Inst., Taejon (Korea, Republic of)

    1997-12-31

    The effectiveness of neutrons from a Californium-252 source in the induction of various abnormalities in the Tradescantia clone 4430 stamen hair cells (TSH-assay) was studied. The special attention was paid to check whether any enhancement in effects caused by process of boron neutron capture is visible in the cells enriched with boron ions. Two chemicals (borax and BSH) were applied to introduce boron-10 ions into cells. Inflorescence, normal or pretreated with chemicals containing boron, were irradiated in the air with neutrons from a Cf-252 source at KAERI, Taejon, Korea. To estimate the relative biological effectiveness (RBE) in the induction of gene mutations of the neutron beam under the study, Tradescantia inflorescences, without any chemical pretreatment, were irradiated with various doses of X-rays. The ranges of radiation doses used were 0-0.1 Gy in neutrons and 0-0.5 Gy in X-rays. After the time needed to complete the postirradiation repair Tradescantia cuttings were transferred to Cracow, where screening of gene and lethal; mutations, cell cycle alterations in somatic cells have been done, and dose response relationships were figured. The maximal RBE values were estimated in the range of 4.6-6.8. Alterations of RBE value were observed; from 6.8 to 7.8 in the case of plants pretreated with 240 ppm of B-10 from borax, and 4.6 to 6.1 in the case of 400 ppm of B-10 from BSH. Results showed a slight, although statistically insignificant increase in biological efficacy of radiation from the Cf-252 source in samples pretreated with boron containing chemicals. (author)

  16. 40 CFR 247.10 - Paper and paper products.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Paper and paper products. 247.10... COMPREHENSIVE PROCUREMENT GUIDELINE FOR PRODUCTS CONTAINING RECOVERED MATERIALS Item Designations § 247.10 Paper and paper products. Paper and paper products, excluding building and construction paper grades. ...

  17. Formation and characterization of Y: 247 film through spray pyrolysis ...

    Indian Academy of Sciences (India)

    The synthesis of high temperature superconducting films of Y:247 (c ∼ K) have been successfully achieved. The difficulty in synthesis owing to narrow range of stability of Y:247 has been taken care of through several quenching modes, e.g. quenching of the films synthesized at ∼ 850°C, in air or in liquid nitrogen.

  18. 40 CFR 98.247 - Records that must be retained.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 20 2010-07-01 2010-07-01 false Records that must be retained. 98.247... (CONTINUED) MANDATORY GREENHOUSE GAS REPORTING Petrochemical Production § 98.247 Records that must be retained. In addition to the recordkeeping requirements in § 98.3(g), you must retain the records specified...

  19. 7 CFR 247.12 - Rights and responsibilities.

    Science.gov (United States)

    2010-01-01

    ... AGRICULTURE CHILD NUTRITION PROGRAMS COMMODITY SUPPLEMENTAL FOOD PROGRAM § 247.12 Rights and responsibilities... § 247.33(a); (2) The local agency will make nutrition education available to all adult participants, and to parents or caretakers of infant and child participants, and will encourage them to participate...

  20. 48 CFR 3452.247-70 - Foreign travel.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 7 2010-10-01 2010-10-01 false Foreign travel. 3452.247... 3452.247-70 Foreign travel. As prescribed in 3447.7000, insert the following clause in all solicitations and resultant cost-reimbursement contracts: Foreign Travel (AUG 1987) Foreign travel shall not be...

  1. 40 CFR 247.14 - Park and recreation products.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Park and recreation products. 247.14 Section 247.14 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES... and recreation products. (a) Playground surfaces and running tracks containing recovered rubber or...

  2. Study of the shielding for spontaneous fission sources of Californium-252; Estudio de blindaje para fuentes de fision espontanea de Californio-252

    Energy Technology Data Exchange (ETDEWEB)

    Davila R, I

    1991-06-15

    A shielding study is made to attenuate, until maximum permissible levels, the neutrons radiation and photons emitted by spontaneous fission coming from a source of Californium-252. The compound package by a database (Library DLC-23) and the ANISNW code is used, in it version for personal computer. (Author)

  3. 7 CFR 58.247 - Insect and rodent control program.

    Science.gov (United States)

    2010-01-01

    ....247 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Standards, Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE (CONTINUED) REGULATIONS AND STANDARDS UNDER THE AGRICULTURAL MARKETING ACT OF 1946 AND THE EGG PRODUCTS INSPECTION ACT...

  4. 7 CFR 247.11 - Applicants exceed caseload levels.

    Science.gov (United States)

    2010-01-01

    ....11 Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS COMMODITY SUPPLEMENTAL FOOD PROGRAM § 247.11 Applicants... ages 4 and 5; (4) Postpartum women; and (5) Elderly persons. ...

  5. Simulation and design of an electron beam ion source charge breeder for the californium rare isotope breeder upgrade

    Directory of Open Access Journals (Sweden)

    Clayton Dickerson

    2013-02-01

    Full Text Available An electron beam ion source (EBIS will be constructed and used to charge breed ions from the californium rare isotope breeder upgrade (CARIBU for postacceleration into the Argonne tandem linear accelerator system (ATLAS. Simulations of the EBIS charge breeder performance and the related ion transport systems are reported. Propagation of the electron beam through the EBIS was verified, and the anticipated incident power density within the electron collector was identified. The full normalized acceptance of the charge breeder with a 2 A electron beam, 0.024π  mm mrad for nominal operating parameters, was determined by simulating ion injection into the EBIS. The optics of the ion transport lines were carefully optimized to achieve well-matched ion injection, to minimize emittance growth of the injected and extracted ion beams, and to enable adequate testing of the charge bred ions prior to installation in ATLAS.

  6. Extraction of Trivalent Actinides and Lanthanides from Californium Campaign Rework Solution Using TODGA-based Solvent Extraction System

    Energy Technology Data Exchange (ETDEWEB)

    Benker, Dennis [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Delmau, Laetitia Helene [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Dryman, Joshua Cory [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States)

    2017-07-01

    This report presents the studies carried out to demonstrate the possibility of quantitatively extracting trivalent actinides and lanthanides from highly acidic solutions using a neutral ligand-based solvent extraction system. These studies stemmed from the perceived advantage of such systems over cationexchange- based solvent extraction systems that require an extensive feed adjustment to make a low-acid feed. The targeted feed solutions are highly acidic aqueous phases obtained after the dissolution of curium targets during a californium (Cf) campaign. Results obtained with actual Cf campaign solutions, but highly diluted to be manageable in a glove box, are presented, followed by results of tests run in the hot cells with Cf campaign rework solutions. It was demonstrated that a solvent extraction system based on the tetraoctyl diglycolamide molecule is capable of quantitatively extracting trivalent actinides from highly acidic solutions. This system was validated using actual feeds from a Cf campaign.

  7. Beyond Californium-A Neutron Generator Alternative for Dosimetry and Instrument Calibration in the U.S.

    Science.gov (United States)

    Piper, Roman K; Mozhayev, Andrey V; Murphy, Mark K; Thompson, Alan K

    2017-09-01

    Evaluations of neutron survey instruments, area monitors, and personal dosimeters rely on reference neutron radiations, which have evolved from the heavy reliance on (α,n) sources to a shared reliance on (α,n) and the spontaneous fission neutrons of californium-252 (Cf). Capable of producing high dose equivalent rates from an almost point source geometry, the characteristics of Cf are generally more favorable when compared to the use of (α,n) and (γ,n) sources or reactor-produced reference neutron radiations. Californium-252 is typically used in two standardized configurations: unmoderated, to yield a fission energy spectrum; or with the capsule placed within a heavy-water moderating sphere to produce a softened spectrum that is generally considered more appropriate for evaluating devices used in nuclear power plant work environments. The U.S. Department of Energy Cf Loan/Lease Program, a longtime origin of affordable Cf sources for research, testing and calibration, was terminated in 2009. Since then, high-activity sources have become increasingly cost-prohibitive for laboratories that formerly benefited from that program. Neutron generators, based on the D-T and D-D fusion reactions, have become economically competitive with Cf and are recognized internationally as important calibration and test standards. Researchers from the National Institute of Standards and Technology and the Pacific Northwest National Laboratory are jointly considering the practicality and technical challenges of implementing neutron generators as calibration standards in the U.S. This article reviews the characteristics of isotope-based neutron sources, possible isotope alternatives to Cf, and the rationale behind the increasing favor of electronically generated neutron options. The evaluation of a D-T system at PNNL has revealed characteristics that must be considered in adapting generators to the task of calibration and testing where accurate determination of a dosimetric quantity is

  8. Californium-252 Brachytherapy Combined With External-Beam Radiotherapy for Cervical Cancer: Long-Term Treatment Results

    Energy Technology Data Exchange (ETDEWEB)

    Lei Xin; Qian Chengyuan; Qing Yi; Zhao Kewei; Yang Zhengzhou; Dai Nan; Zhong Zhaoyang; Tang Cheng; Li Zheng; Gu Xianqing; Zhou Qian; Feng Yan; Xiong Yanli; Shan Jinlu [Cancer Center, Research Institute of Surgery and Daping Hospital, Third Military Medical University, Chongqing (China); Wang Dong, E-mail: dongwang64@hotmail.com [Cancer Center, Research Institute of Surgery and Daping Hospital, Third Military Medical University, Chongqing (China)

    2011-12-01

    Purpose: To observe, by retrospective analysis, the curative effects and complications due to californium-252 ({sup 252}Cf) neutron intracavitary brachytherapy (ICBT) combined with external-beam radiotherapy (EBRT) in the treatment of cervical cancer. Methods and Materials: From February 1999 to December 2007, 696 patients with cervical cancer (Stages IB to IIIB) were treated with {sup 252}Cf-ICBT in combination of EBRT. Of all, 31 patients were at Stage IB, 104 at IIA, 363 at IIB, 64 at IIIA, and 134 at IIIB. Californium-252 ICBT was delivered at 7-12 Gy per insertion per week, with a total dose of 29-45 Gy to reference point A in three to five insertions. The whole pelvic cavity was treated with 8-MV X-ray external irradiation at 2 Gy per fraction, four times per week. After 16-38 Gy of external irradiation, the center of the whole pelvic field was blocked with a 4-cm-wide lead shield, with a total external irradiation dose of 44-56 Gy. The total treatment course was 5 to 6 weeks. Results: Overall survival rate at 3 and 5 years for all patients was 76.0% and 64.9%, respectively. Disease-free 3- and 5-year survival rates of patients were 71.2% and 58.4%, respectively. Late complications included vaginal contracture and adhesion, radiation proctitis, radiation cystitis, and inflammatory bowel, which accounted for 5.8%, 7.1%, 6.2%, and 4.9%, respectively. Univariate analysis results showed significant correlation of stage, age, histopathologic grade, and lymph node status with overall survival. Cox multiple regression analysis showed that the independent variables were stage, histopathologic grade, tumor size, and lymphatic metastasis in all patients. Conclusion: Results of this series suggest that the combined use of {sup 252}Cf-ICBT with EBRT is an effective method for treatment of cervical cancer.

  9. 7 CFR 247.37 - Civil rights requirements.

    Science.gov (United States)

    2010-01-01

    ... Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS COMMODITY SUPPLEMENTAL FOOD PROGRAM § 247.37 Civil rights requirements... racial/ethnic participation data and public notification of nondiscrimination policy. State and local...

  10. 47 CFR 24.247 - Triggering a reimbursement obligation.

    Science.gov (United States)

    2010-10-01

    ... to the band. The percent required by new entrants to pay shall be calculated based upon the amount of... Section 24.247 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) COMMON CARRIER SERVICES... apply the following test to determine if a PCS entity preparing to initiate operations must pay a PCS...

  11. Formation and characterization of Y : 247 film through spray ...

    Indian Academy of Sciences (India)

    Unknown

    the as processed film, Y2Ba4Cu7O14+x, exhibit nearly correct cationic stoichiometry of 2 : 4 : 7; also narrow re- gions (< 50 Å) of minority Y : 124 phase and stacking faults capable of working as flux pinning sites have been invariably found to be present. In addition to Y : 247, Ag admixed films have also been investigated.

  12. CDC 24/7: Saving Lives, Protecting People

    Centers for Disease Control (CDC) Podcasts

    2012-06-04

    24/7, CDC provides health information, responds to public health emergencies and natural disasters, and monitors disease.  Created: 6/4/2012 by Office of the Associate Director of Communciation (OADC).   Date Released: 6/4/2012.

  13. 7 CFR 247.29 - Reports and recordkeeping.

    Science.gov (United States)

    2010-01-01

    ... Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS COMMODITY SUPPLEMENTAL FOOD PROGRAM § 247.29 Reports and recordkeeping... agencies to provide data collected in the program to aid in the evaluation of the effect of program...

  14. Phenotype abnormality: 247 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 247 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u1ria224u753i delayed in orga...n named seedling during process named 0 seed germination stage ... seedling ... delayed ... 0 seed germination stage ...

  15. Long-term effects of an intracavitary treatment with californium-252 on normal tissue. [Swine, /sup 226/Ra

    Energy Technology Data Exchange (ETDEWEB)

    Sullivan, M.F.; Beamer, J.L.; Mahony, T.D.; Cross, F.T.; Lund, J.E.; Endres, G.W.R.

    1976-01-01

    About one hundred fifty swine were exposed to either radium-226 or californium-252 sources in the uterine cervix to determine an RBE for both acute and long-term effects. That value for early changes in the tissues at risk in the treatment of cervical cancer was between 6.2 and 6.8. The incidence of complications increased with time after exposure, especially among animals treated with /sup 252/Cf. Analysis of rectal injury showed that ulceration occurred frequently within a year postexposure at doses between 1600 and 2400 rad calculated at 2 cm lateral to the source midline. Fat necrosis and smooth muscle atrophy, resulting in a local rectal stricture, were delayed changes observed in some animals. The lower ureter was the site for a greater frequency of complications than the GI tract. Ureteral stricture often occurred at doses of 1200 rad from /sup 252/Cf and 7000 rad from /sup 226/Ra. Observation of delayed effects in the uterine-cervix in animals held up to 4 years postexposure indicate that the RBE for /sup 252/Cf may be increased to a value as high as 18, while repair may have even decreased it to about 5.6 in the rectum. Fifty swine are still being observed for long-term effects after doses above 800 rad from /sup 252/Cf and 5000 rad from /sup 226/Ra.

  16. Ab initio full-potential study of mechanical properties and magnetic phase stability of californium monopnictides (CfN and CfP)

    Energy Technology Data Exchange (ETDEWEB)

    Amari, S., E-mail: siham_amari@yahoo.fr [Faculté des Sciences de la Nature et de la Vie, Université Hassiba Benbouali, Chlef, 02000 (Algeria); Bouhafs, B. [Laboratoire de Modélisation et Simulation en Sciences des Matériaux, Université Djillali Liabès de Sidi Bel-Abbés, Sidi Bel-Abbés, 22000 (Algeria)

    2016-09-15

    Based on the first-principles methods, the structural, elastic, electronic, properties and magnetic ordering of californium monopnictides CfX (X = P) have been studied using the full-potential augmented plane wave plus local orbitals (FP-L/APW + lo) method within the framework of density functional theory (DFT). The electronic exchange correlation energy is described by generalized gradient approximation GGA and GGA+U (U is the Hubbard correction). The GGA+U method is applied to the rare-earth 5f states. We have calculated the lattice parameters, bulk modulii and the first pressure derivatives of the bulk modulii. The elastic properties of the studied compounds are only investigated in the most stable calculated phase. In order to gain further information, we have calculated Young’s modulus, shear modulus, anisotropy factor and Kleinman parameter by the aid of the calculated elastic constants. The results mainly show that californium monopnictides CfX (X = P) have an antiferromagnetic spin ordering. Density of states (DOS) and charge densities for both compounds are also computed in the NaCl (B1) structure.

  17. 24/7 pediatric radiology attending coverage: times are changing

    Energy Technology Data Exchange (ETDEWEB)

    Donaldson, James S. [Feinberg School of Medicine at Northwestern University, Department of Medical Imaging, Ann and Robert H. Lurie Children' s Hospital of Chicago, IL (United States); Thakrar, Kiran H. [University of Chicago Pritzker School of Medicine, Body Imaging, NorthShore University HealthSystem, Chicago, IL (United States)

    2017-06-15

    The job of the pediatric radiologist long ago ceased to be an 8-to-5 role. Many practices have adopted evening shifts of in-house attending radiologists to cover the busy evening activity. With the ever-increasing role of imaging in clinical decisions and patient management, there is a need - if not a demand - to further extend attending pediatric radiology coverage. In this article, we discuss the needs and justification for extending pediatric radiology coverage at a tertiary-care children's hospital. We also describe the approach we took toward implementing 24/7 attending in-house coverage of pediatric radiology. (orig.)

  18. Low-Dose-Rate Californium-252 Neutron Intracavitary Afterloading Radiotherapy Combined With Conformal Radiotherapy for Treatment of Cervical Cancer

    Energy Technology Data Exchange (ETDEWEB)

    Zhang Min [Department of Oncology, Armed Police Hospital of Hangzhou, Hangzhou, Zhejiang Province (China); Xu Hongde [Cancer Center, Armed Police Hospital of Hangzhou, Hangzhou, Zhejiang Province (China); Pan Songdan; Lin Shan; Yue Jianhua [Department of Oncology, Armed Police Hospital of Hangzhou, Hangzhou, Zhejiang Province (China); Liu Jianren, E-mail: liujianren0571@hotmail.com [Second Affiliated Hospital, School of Medicine, Zhejiang University, Hangzhou, Zhejiang Province (China)

    2012-07-01

    Purpose: To study the efficacy of low-dose-rate californium-252 ({sup 252}Cf) neutron intracavitary afterloading radiotherapy (RT) combined with external pelvic RT for treatment of cervical cancer. Methods and Materials: The records of 96 patients treated for cervical cancer from 2006 to 2010 were retrospectively reviewed. For patients with tumors {<=}4 cm in diameter, external beam radiation was performed (1.8 Gy/day, five times/week) until the dose reached 20 Gy, and then {sup 252}Cf neutron intracavitary afterloading RT (once/week) was begun, and the frequency of external beam radiation was changed to four times/week. For patients with tumors >4 cm, {sup 252}Cf RT was performed one to two times before whole-pelvis external beam radiation. The tumor-eliminating dose was determined by using the depth limit of 5 mm below the mucosa as the reference point. In all patients, the total dose of the external beam radiation ranged from 46.8 to 50 Gy. For {sup 252}Cf RT, the dose delivered to point A was 6 Gy/fraction, once per week, for a total of seven times, and the total dose was 42 Gy. Results: The mean {+-} SD patient age was 54.7 {+-} 13.7 years. Six patients had disease assessed at stage IB, 13 patients had stage IIA, 49 patients had stage IIB, 3 patients had stage IIIA, 24 patients had stage IIIB, and 1 patient had stage IVA. All patients obtained complete tumor regression (CR). The mean {+-} SD time to CR was 23.5 {+-} 3.4 days. Vaginal bleeding was fully controlled in 80 patients within 1 to 8 days. The mean {+-} SD follow-up period was 27.6 {+-} 12.7 months (range, 6-48 months). Five patients died due to recurrence or metastasis. The 3-year survival and disease-free recurrence rates were 89.6% and 87.5 %, respectively. Nine patients experienced mild radiation proctitis, and 4 patients developed radiocystitis. Conclusions: Low-dose-rate {sup 252}Cf neutron RT combined with external pelvic RT is effective for treating cervical cancer, with a low incidence of

  19. A psychiatric study of 247 liver transplantation candidates.

    Science.gov (United States)

    Trzepacz, P T; Brenner, R; Van Thiel, D H

    1989-01-01

    This study prospectively evaluated 247 consecutive liver transplantation candidates for the presence of psychiatric disorders. While one-half did not meet DSM-III criteria for a psychiatric diagnosis, 18.6% had delirium, 19.8% had an adjustment disorder, 9% had alcohol abuse or dependence, 4.5% had major depression, and 2% had other drug abuse or dependence. Delirious subjects were significantly more likely to have a lower serum albumin, lower Mini-Mental State exam scores, higher Trailmaking Test scores (both A and B), and more dysrhythmia on electroencephalogram (EEG). In addition, while both delirious and nondelirious subjects were judged to have high levels of overall stress, those with delirium had significantly poorer adaptive functioning and lower occupational, family, and social scale ratings. Thus, while all liver transplant candidates are under substantial psychosocial stress and require psychosocial support, those identified as being delirious require particular attention because of their numerous cognitive, medical, and psychosocial problems.

  20. 42 CFR 137.247 - What is the effective date of a retrocession?

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 1 2010-10-01 2010-10-01 false What is the effective date of a retrocession? 137.247 Section 137.247 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES INDIAN HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES TRIBAL SELF-GOVERNANCE Retrocession § 137...

  1. 48 CFR 52.247-64 - Preference for Privately Owned U.S.-Flag Commercial Vessels.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Preference for Privately Owned U.S.-Flag Commercial Vessels. 52.247-64 Section 52.247-64 Federal Acquisition Regulations System... carriers, dry cargo liners, and tankers). Such transportation shall be accomplished when any equipment...

  2. 48 CFR 52.247-47 - Evaluation-F.o.b. Origin.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Evaluation-F.o.b. Origin. 52.247-47 Section 52.247-47 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION..., pipeline, barge, or ocean tanker, modify the provision accordingly. Evaluation—F.o.b. Origin (JUN 2003) (a...

  3. 48 CFR 752.247-70 - Preference for privately owned U.S.-flag commercial vessels.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Preference for privately owned U.S.-flag commercial vessels. 752.247-70 Section 752.247-70 Federal Acquisition Regulations System... (computed separately for dry bulk carriers, dry cargo liners, and tankers) shall be transported in privately...

  4. 24 CFR 247.5 - Inapplicability to substantial rehabilitation or demolition.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Inapplicability to substantial rehabilitation or demolition. 247.5 Section 247.5 Housing and Urban Development Regulations Relating to Housing and Urban Development (Continued) OFFICE OF ASSISTANT SECRETARY FOR HOUSING-FEDERAL HOUSING COMMISSIONER, DEPARTMENT OF HOUSING AND URBAN...

  5. 32 CFR Appendix E to Part 247 - DoD Command Newspaper and Magazine Review System

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false DoD Command Newspaper and Magazine Review System... OF DEFENSE (CONTINUED) MISCELLANEOUS DEPARTMENT OF DEFENSE NEWSPAPERS, MAGAZINES AND CIVILIAN ENTERPRISE PUBLICATIONS Pt. 247, App. E Appendix E to Part 247—DoD Command Newspaper and Magazine Review...

  6. 17 CFR 247.772 - Exemption from the definition of “broker” for banks engaging in securities lending transactions.

    Science.gov (United States)

    2010-04-01

    ... to terminate the transaction and to recall the loaned securities on terms agreed by the parties. (c... of âbrokerâ for banks engaging in securities lending transactions. 247.772 Section 247.772 Commodity... DEFINITIONS RELATED TO THE EXCEPTIONS FOR BANKS FROM THE DEFINITION OF BROKER § 247.772 Exemption from the...

  7. Switching Investigations on a SiC MOSFET in a TO-247 Package

    OpenAIRE

    Anthon, Alexander; Hernandez Botella, Juan Carlos; Zhang, Zhe; Andersen, Michael A. E.

    2014-01-01

    This paper deals with the switching behavior of a SiC MOSFET in a TO-247 package. Based on simulations, critical parasitic inductances in the circuit layout are analyzed and their effect on the switching losses highlighted. Especially the common source inductance, a critical parameter in a TO-247 package, has a major influence on the switching energy. Crucial design guidelines for an improved double pulse test circuit are introduced which are used for practical investigations on the switching...

  8. Radiology 24/7 In-House Attending Coverage: Do Benefits Outweigh Cost?

    Science.gov (United States)

    Coleman, Stephanie; Holalkere, Nagaraj Setty; O׳Malley, Julie; Doherty, Gemma; Norbash, Alexander; Kadom, Nadja

    2016-01-01

    Many radiology practices, including academic centers, are moving to in-house 24/7 attending coverage. This could be costly and may not be easily accepted by radiology trainees and attending radiologists. In this article, we evaluated the effects of 24/7 in-house attending coverage on patient care, costs, and qualitative aspects such as trainee education. We retrospectively collected report turnaround times (TAT) and work relative value units (wRVU). We compared these parameters between the years before and after the implementation of 24/7 in-house attending coverage. The cost to provide additional attending coverage was estimated from departmental financial reports. A qualitative survey of radiology residents and faculty was performed to study perceived effects on trainee education. There were decreases in report TAT following 24/7 attending implementation: 69% reduction in computed tomography, 43% reduction in diagnostic radiography, 7% reduction in magnetic resonance imaging, and 43% reduction in ultrasound. There was an average daytime wRVU decrease of 9%, although this was compounded by a decrease in total RVUs of the 2013 calendar year. The financial investment by the institution was estimated at $850,000. Qualitative data demonstrated overall positive feedback from trainees and faculty in radiology, although loss of independence was reported as a negative effect. TAT and wRVU metrics changed with implementation of 24/7 attending coverage, although these metrics do not directly relate to patient outcomes. Additional clinical benefits may include fewer discrepancies between preliminary and final reports that may improve emergency and inpatient department workflows and liability exposure. Radiologists reported the impression that clinicians appreciated 24/7 in-house attending coverage, particularly surgical specialists. Loss of trainee independence on call was a perceived disadvantage of 24/7 attending coverage and raised a concern that residency education

  9. Association of CD247 Polymorphisms with Rheumatoid Arthritis: A Replication Study and a Meta-Analysis

    Science.gov (United States)

    Teruel, María; McKinney, Cushla; Balsa, Alejandro; Pascual-Salcedo, Dora; Rodriguez-Rodriguez, Luis; Ortiz, Ana M.; Gómez-Vaquero, Carmen; González-Gay, Miguel A.; Smith, Malcolm; Witte, Torsten; Merriman, Tony; Lie, Benedicte A.; Martin, Javier

    2013-01-01

    Given the role of CD247 in the response of the T cells, its entailment in autoimmune diseases and in order to better clarify the role of this gene in RA susceptibility, we aimed to analyze CD247 gene variants previously associated with other autoimmune diseases (rs1052237, rs2056626 and rs864537) in a large independent European Caucasian population. However, no evidence of association was found for the analyzed CD247 single-nucleotide polymorphisms (SNPs) with RA and with the presence/absence of anti-cyclic citrullinated polypeptide. We performed a meta-analysis including previously published GWAS data from the rs864537 variant, revealing an overall genome-wide significant association between this CD247 SNP and RA with anti-CCP (OR = 0.90, CI 95% = 0.87–0.93, Poverall = 2.1×10−10). Our results show for first time a GWAS-level association between this CD247 polymorphism and RA risk. PMID:23861880

  10. Association of CD247 polymorphisms with rheumatoid arthritis: a replication study and a meta-analysis.

    Directory of Open Access Journals (Sweden)

    María Teruel

    Full Text Available Given the role of CD247 in the response of the T cells, its entailment in autoimmune diseases and in order to better clarify the role of this gene in RA susceptibility, we aimed to analyze CD247 gene variants previously associated with other autoimmune diseases (rs1052237, rs2056626 and rs864537 in a large independent European Caucasian population. However, no evidence of association was found for the analyzed CD247 single-nucleotide polymorphisms (SNPs with RA and with the presence/absence of anti-cyclic citrullinated polypeptide. We performed a meta-analysis including previously published GWAS data from the rs864537 variant, revealing an overall genome-wide significant association between this CD247 SNP and RA with anti-CCP (OR = 0.90, CI 95% = 0.87-0.93, Poverall = 2.1×10(-10. Our results show for first time a GWAS-level association between this CD247 polymorphism and RA risk.

  11. Californium-252 neutron intracavity brachytherapy alone for T1N0 low-lying rectal adenocarcinoma: A definitive anal sphincter-preserving radiotherapy

    Science.gov (United States)

    Xiong, Yanli; Shan, Jinlu; Liu, Jia; Zhao, Kewei; Chen, Shu; Xu, Wenjing; Zhou, Qian; Yang, Mei; Lei, Xin

    2017-01-01

    This study evaluated the 4-year results of 32 patients with T1N0 low-lying rectal adenocarcinoma treated solely with californium-252 (Cf-252) neutron intracavity brachytherapy (ICBT). Patients were solicited into the study from January 2008 to June 2011. All the patients had refused surgery or surgery was contraindicated. The patients were treated with Cf-252 neutron ICBT using a novel 3.5-cm diameter off-axis 4-channel intrarectal applicator designed by the authors. The dose reference point was defined on the mucosa surface, with a total dose of 55–62 Gy-eq/4 f (13–16 Gy-eq/f/wk). All the patients completed the radiotherapy in accordance with our protocol. The rectal lesions regressed completely, and the acute rectal toxicity was mild (≤G2). The 4-year local control, overall survival, disease-free survival, and late complication (≥G2) rates were 96.9%, 90.6%, 87.5% and 15.6%, respectively. No severe late complication (≥G3) occurred. The mean follow-up was 56.1 ± 16.0 months. At the end of last follow-up, 29 patients remained alive. The mean survival time was 82.1 ± 2.7 months. Cf-252 neutron ICBT administered as the sole treatment (without surgery) for patients with T1N0 low-lying rectal adenocarcinoma is effective with acceptable late complications. Our study and method offers a definitive anal sphincter-preserving radiotherapy for T1N0 low-lying rectal adenocarcinoma patients. PMID:28094790

  12. Isolation and Characterization of a Bacteriocin-Like Substance Produced by Geobacillus toebii Strain HBB-247.

    Science.gov (United States)

    Başbülbül Özdemir, Gamze; Biyik, Haci Halil

    2012-03-01

    A total of 201 thermophilic bacteria isolated from various thermal spring, mud and soil were tested for their antibacterial activity. Among the mostly active isolates, Geobacillus toebii HBB-247 was further examined. Bacteriocin-like inhibitory substance (BLIS) produced by strain HBB-247 was found to be stable up to 60°C, sensitive to proteolytic enzymes and effective against Enterococcus faecalis, Listeria sp., E. avium, Clostridium pasteurianum, Cellulomonas fimi and some thermophilic strains isolated and identified in this study. As a result of Tricine-SDS-PAGE molecular weight of BLIS was estimated about 38 kDa. Production studies showed that G. toebii HBB-247 starts to produce antibacterial substance at early logarithmic phase of growth and maximum production was detected at the end of the logarithmic phase.

  13. Switching Investigations on a SiC MOSFET in a TO-247 Package

    DEFF Research Database (Denmark)

    Anthon, Alexander; Hernandez Botella, Juan Carlos; Zhang, Zhe

    2014-01-01

    This paper deals with the switching behavior of a SiC MOSFET in a TO-247 package. Based on simulations, critical parasitic inductances in the circuit layout are analyzed and their effect on the switching losses highlighted. Especially the common source inductance, a critical parameter in a TO-247...... package, has a major influence on the switching energy. Crucial design guidelines for an improved double pulse test circuit are introduced which are used for practical investigations on the switching behavior. Switching energies of a SiC MOSFET in a TO-247 package is measured depending on varying gate...... resistance and loop inductances. With total switching energy of 340.24 μJ, the SiC MOSFET has more than six times lower switching losses than a regular Si IGBT. Implementing the SiC switches in a 3 kW T-Type inverter topology, efficiency improvements of 0.8 % are achieved and maximum efficiency of 97...

  14. BVVS’er Marlin de Swart en Snap Fitness 24/7 (interview)

    NARCIS (Netherlands)

    Jan de Leeuw

    2016-01-01

    Interview met BVVS’er Marlin de Swart die sinds enkele maanden werkzaam is bij Snap Fitness 24/7, een nieuw franchiseconcept in de fitnesswereld. Marlin studeerde in 2004 af bij SPECO. Ze deed haar afstudeerstage bij BVO Willem II. Vanaf 2008 werkte ze bij Optisport en nu dus in de fitnesswereld.

  15. 48 CFR 52.247-11 - Net Weight-Household Goods or Office Furniture.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Net Weight-Household Goods... Provisions and Clauses 52.247-11 Net Weight—Household Goods or Office Furniture. As prescribed in 47.207-4(b... movements of Government employees' household goods or relocations of Government offices are involved: Net...

  16. Serving culturally diverse learners in the 24/7 management classroom

    NARCIS (Netherlands)

    van de Bunt-Kokhuis, S.G.M.; Weir, D.

    2013-01-01

    Purpose: The purpose of this paper is to highlight how future teaching in business schools will probably take place in an online (here called 24/7) classroom, where culturally diverse e-learners around the globe meet. Technologies such as iPhone, iPad and a variety of social media, to mention but a

  17. Page 1 The Genus Quercus in the Korewa Deposits of Kashmir 247 ...

    Indian Academy of Sciences (India)

    The Genus Quercus in the Korewa Deposits of Kashmir 247 in the Central Almora division at an altitude of 9,500 ft., it occurs with. Betula alnoides, Pyrus lanata, Quercus dilatata, Acer Caesium, Abies Pindrow,. Meliosma dilleniaefolia, Pyrus foliolosus, Rhododendron arboreum, Betula utilis, Rosa macrophylla, Salix elegans ...

  18. 49 CFR 173.247 - Bulk packaging for certain elevated temperature materials.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 2 2010-10-01 2010-10-01 false Bulk packaging for certain elevated temperature... Than Class 1 and Class 7 § 173.247 Bulk packaging for certain elevated temperature materials. When... constructed of carbon steel which is in elevated temperature material service is excepted from § 178.345-7(d...

  19. 7 CFR 247.13 - Provisions for non-English or limited-English speakers.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Provisions for non-English or limited-English speakers... § 247.13 Provisions for non-English or limited-English speakers. (a) What must State and local agencies do to ensure that non-English or limited-English speaking persons are aware of their rights and...

  20. Page 1 Buli. Mater. Sci., Vol. 20, No. 2, April 1997, pp. 247-257. (C ...

    Indian Academy of Sciences (India)

    2, April 1997, pp. 247-257. (C) Printed in India. Synthesis of spodumene and spodumene-zirconia composite powders using aqueous sol-gel method. N N GHOSH and P PRAMANK*. Department of Chemistry, Indian Institute of Technology, Kharagpur 721302, India. MS received 5 October 1996; revised 6 January 1997.

  1. 48 CFR 247.372 - DD Form 1654, Evaluation of Transportation Cost Factors.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false DD Form 1654, Evaluation... Transportation in Supply Contracts 247.372 DD Form 1654, Evaluation of Transportation Cost Factors. Contracting personnel may use the DD Form 1654 to furnish information to the transportation office for development of...

  2. 48 CFR 247.370 - DD Form 1384, Transportation Control and Movement Document.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false DD Form 1384... Transportation in Supply Contracts 247.370 DD Form 1384, Transportation Control and Movement Document. The transportation office of the shipping activity prepares the DD Form 1384 to accompany all shipments made through...

  3. 48 CFR 247.371 - DD Form 1653, Transportation Data for Solicitations.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false DD Form 1653... Supply Contracts 247.371 DD Form 1653, Transportation Data for Solicitations. The transportation specialist prepares the DD Form 1653 to accompany requirements for the acquisition of supplies. The completed...

  4. 48 CFR 52.247-40 - Ex Dock, Pier, or Warehouse, Port of Importation.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Ex Dock, Pier, or... Provisions and Clauses 52.247-40 Ex Dock, Pier, or Warehouse, Port of Importation. As prescribed in 47.303-12(c), insert the following clause in solicitations and contracts when the delivery term is ex dock...

  5. 5 CFR 531.247 - Maximum payable rate rule for GM employees.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Maximum payable rate rule for GM... REGULATIONS PAY UNDER THE GENERAL SCHEDULE Determining Rate of Basic Pay Special Rules for Gm Employees § 531.247 Maximum payable rate rule for GM employees. (a) A rate received by a GM employee may qualify as a...

  6. Prevalence of Plasmodium vivax VK210 and VK247 subtype in Myanmar

    Directory of Open Access Journals (Sweden)

    Kang Yoon-Joong

    2010-07-01

    Full Text Available Abstract Background Plasmodium vivax is divided into two subtypes, a dominant form, VK210 and a variant form, VK247. This division is dependent on the amino acid composition of the circumsporozoite (CS protein. In this study, the prevalence of the VK247 variant form of P. vivax was investigated in Myanmar. Methods The existence of malaria parasites in blood samples was determined by microscopic examination, polymerase chain reaction (PCR and DNA hybridization assays. To test for antibodies against P. vivax and Plasmodium falciparum in blood samples, an indirect immunofluorescence antibody test (IFAT was performed using asexual blood antigens. An enzyme-linked immunosorbent assay with synthetic VK210 and VK247 antigens was carried out to discriminate between the P. vivax subtypes. Results By thick smear examination, 73 (n = 100 patients were single infected with P. vivax, one with P. falciparum and 13 with both species. By thin smear, 53 patients were single infected with P. vivax, eight with only P. falciparum and 16 with both. Most of the collected blood samples were shown to be P. vivax positive (n = 95 by PCR. All cases that were positive for P. falciparum by PCR (n = 43 were also positive for P. vivax. However, 52 cases were single infected with P. vivax. IFAT showed antibody titres from 1:32 to 1:4,096. Additionally, using specific antibodies for VK210 and VK247, ELISA showed that 12 patients had antibodies for only the VK210 subtype, 4 patients had only VK247 subtype antibodies and 21 patients had antibodies for both subtypes. Using a DNA hybridization test, 47 patients were infected with the VK210 type, one patient was infected with VK247 and 23 patients were infected with both subtypes. Conclusions The proportion of the VK247 subtype in Myanmar was 43.1% (n = 25 among 58 positive cases by serodiagnosis and 25.6% (n = 24 among 94 positive cases by genetic diagnosis. In both diagnostic methods, the infection status of malaria patients is

  7. 48 CFR 52.247-23 - Contractor Liability for Loss of and/or Damage to Household Goods.

    Science.gov (United States)

    2010-10-01

    ... Loss of and/or Damage to Household Goods. 52.247-23 Section 52.247-23 Federal Acquisition Regulations... Household Goods. As prescribed in 47.207-7(e), insert the following clause: Contractor Liability for Loss of and/or Damage to Household Goods (JAN 1991) (a) Except when loss and/or damage arise out of causes...

  8. 17 CFR 247.700 - Defined terms relating to the networking exception from the definition of “broker.”

    Science.gov (United States)

    2010-04-01

    ... networking exception from the definition of âbroker.â 247.700 Section 247.700 Commodity and Securities... networking exception from the definition of “broker.” When used with respect to the Third Party Brokerage Arrangements (“Networking”) Exception from the definition of the term “broker” in section 3(a)(4)(B)(i) of the...

  9. 24 CFR 203.439 - Mortgages on Hawaiian home lands insured pursuant to section 247 of the National Housing Act.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Mortgages on Hawaiian home lands... Mortgages on Hawaiian home lands insured pursuant to section 247 of the National Housing Act. (a) Exemptions... mortgages insured pursuant to section 247 of the National Housing Act on leaseholds of Hawaiian home lands...

  10. 17 CFR 247.721 - Defined terms relating to the trust and fiduciary activities exception from the definition of...

    Science.gov (United States)

    2010-04-01

    ... percentage for each trust or fiduciary account of the bank is greater than 50 percent. (2) The relationship... percentage for a trust or fiduciary account shall be (i) Equal to the relationship compensation attributable... trust and fiduciary activities exception from the definition of âbroker.â 247.721 Section 247.721...

  11. 17 CFR 247.722 - Exemption allowing banks to calculate trust and fiduciary compensation on a bank-wide basis.

    Science.gov (United States)

    2010-04-01

    ... for the bank's trust and fiduciary business is at least 70 percent. (b) Aggregate relationship-total... to the relationship compensation attributable to the bank's trust and fiduciary business as a whole... calculate trust and fiduciary compensation on a bank-wide basis. 247.722 Section 247.722 Commodity and...

  12. Microstructural studies of carbides in MAR-M247 nickel-based superalloy

    Science.gov (United States)

    Szczotok, A.; Rodak, K.

    2012-05-01

    Carbides play an important role in the strengthening of microstructures of nickel-based superalloys. Grain boundary carbides prevent or retard grain-boundary sliding and make the grain boundary stronger. Carbides can also tie up certain elements that would otherwise promote phase instability during service. Various types of carbides are possible in the microstructure of nickel-based superalloys, depending on the superalloy composition and processing. In this paper, scanning electron and scanning transmission electron microscopy studies of carbides occurring in the microstructure of polycrystalline MAR-M247 nickel-based superalloy were carried out. In the present work, MC and M23C6 carbides in the MAR-M247 microstructure were examined.

  13. 48 CFR 3052.247-71 - F.o.b. origin only.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 7 2010-10-01 2010-10-01 false F.o.b. origin only. 3052... CLAUSES Text of Provisions and Clauses 3052.247-71 F.o.b. origin only. As prescribed in (HSAR) 48 CFR 3047.305-70(b), insert the following provision: F.O.B. Origin Only (DEC 2003) Offers are invited on the...

  14. 24/7 Registered Nurse Staffing Coverage in Saskatchewan Nursing Homes and Acute Hospital Use.

    Science.gov (United States)

    McGregor, Margaret J; Murphy, Janice M; Poss, Jeffrey W; McGrail, Kimberlyn M; Kuramoto, Lisa; Huang, Huei-Chung; Bryan, Stirling

    2015-12-01

    RÉSUMÉ La législation, dans de nombreuses juridictions, nécessite les établissements des soins de longue durée (SLD) d'avoir une infirmière en service 24 heures par jour, 7 jours par semaine. Bien que la recherche considérable existe sur l'intensité SLD de la dotation en personnel infirmier, il n'existe pas de la recherche empirique relative à cette exigence. Notre étude rétrospectif d'observation a comparé des installations en Saskatchewan avec 24/7 RN couverture aux établissements offrant moins de couverture, complétées par divers modèles de dotation des postes de nuit. Les ratios de risque associés à moins de 24/7 couverture RN complété de la dotation infirmière autorisé de nuit, ajusté pour l'intensité de dotation en personnel infirmier et d'autres facteurs de confusion potentiels, étaient de 1,17, IC 95% [0,91, 1,50] et 1.00, IC à 95% [0,72, 1,39], et avec moins de couverture 24/7 RN complété avec soin par aides personnels de nuit, les ratios de risque étaient de 1,46, IC 95% [1,11, 1,91] et 1,11, IC 95% [0,78, 1,58], pour les patients hospitalisés et de visites aux services d'urgence, respectivement. Ces résultats suggèrent que l'utilisation des soins de courte durée peut être influencée négativement par l'absence de la couverture 24/7 RN.

  15. Variants of the Plasmodium vivax circumsporozoite protein (VK210 and VK247 in Colombian isolates

    Directory of Open Access Journals (Sweden)

    JM González

    2001-07-01

    Full Text Available Phenotypic diversity has been described in the central repeated region of the circumsporozoite protein (CSP from Plasmodium vivax. Two sequences VK210 (common and VK247 (variant have been found widely distributed in P. vivax isolates from several malaria endemic areas around the world. A third protein variant called P. vivax-like showing a sequence similar to the simian parasite P. simio-ovale has also been described. Here, using an immunofluorescent test and specific monoclonal antibodies, we assessed the presence of two of these protein variants (VK210 and VK247 in laboratory produced sporozoite. Both sequences were found in parasite isolates coming from different geographic regions of Colombia. Interestingly, sporozoites carrying the VK247 sequence were more frequently produced in Anopheles albimanus than sporozoites with the VK210 sequence. This difference in sporozoites production was statistically significant (p <0.05, Kruskal-Wallis; not correlation was found with parameters as the total number of parasites or gametocytes in blood from human donors used to feed mosquitoes. Previous studies in the same region have shown a higher prevalence of anti-VK210 antibodies which in theory may suggest their role in blocking the development of sporozoites carrying the CSP VK210 sequence.

  16. Californium-252 Program Equipment Evaluation

    Energy Technology Data Exchange (ETDEWEB)

    Chattin, Fred Rhea [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Wilson, Kenton [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Ezold, Julie G. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States)

    2017-12-01

    To successfully continue the 252Cf production and meet the needs of the customers, a comprehensive evaluation of the Building 7920 processing equipment was requested to identify equipment critical to the operational continuity of the program.

  17. Pro/Con debate: should 24/7 in-house intensivist coverage be implemented?

    Science.gov (United States)

    Arabi, Yaseen

    2008-01-01

    You are appointed director of a new large multi-discipline intensive care unit in an academic center. The hospital is affiliated with a medical school and as such there will be an adequate number of medical students, residents, and fellows (specializing in critical care) rotating through the unit. The unit will be a 'closed' (intensivist-led) model. In setting up the call schedule for the intensivists, you need to decide whether the mandate will be for the intensivists to provide 24/7 in-house coverage as opposed to off-hour coverage from home. You wonder about the sustainability of each model.

  18. High temperature creep properties of directionally solidified CM-247LC Ni-based superalloy

    Energy Technology Data Exchange (ETDEWEB)

    Chiou, Mau-Sheng [Department of Materials Science and Engineering, I-Shou University, Kaohsiung 840, Taiwan (China); Jian, Sheng-Rui, E-mail: srjian@gmail.com [Department of Materials Science and Engineering, I-Shou University, Kaohsiung 840, Taiwan (China); Yeh, An-Chou [Department of Materials Science and Engineering, National Tsing Hua University, Hsinchu 300, Taiwan (China); Kuo, Chen-Ming [Department of Mechanical and Automation Engineering, I-Shou University, Kaohsiung 840, Taiwan (China); Juang, Jenh-Yih [Department of Electrophysics, National Chiao Tung University, Hsinchu 300, Taiwan (China)

    2016-02-08

    This study explores the effects of cooling rate after solution heat treatment on the high temperature/low stress (982 °C/200 MPa) creep properties of CM-247LC Nickel base superalloy. Cooling rate was controlled by blowing argon gas, air cooling, and furnace cooling, which, in turn, gave rise to corresponding cooling rates (from 1260 °C to 800 °C) of 18.7, 7.4, and 0.19 °C/s, respectively. The results indicated that higher cooling rate from the solution heat treatment temperature led to finer γ′ precipitates and much improved tertiary creep as well as rupture life time in high-temperature creep test. The microstructural analyses using both scanning electron microscopy (SEM) and transmission electron microscopy (TEM) revealed that finer γ′ precipitates and narrower γ channel width could result in denser rafting structure which might have hindered the climb of dislocations across the precipitates rafts.

  19. Sickness unto Death in the Age of 24/7: Wolfgang Herrndorf's Arbeit und Struktur

    Directory of Open Access Journals (Sweden)

    Lilla Balint

    2016-01-01

    Full Text Available How does one die in the digital age? In exploring this question, this article juxtaposes Jonathan Crary’s critique of the contemporary and Wolfgang Herrndorf’s Arbeit und Struktur —a blog in which the German author documented his three-year battle against brain cancer. The digital age, Crary argues in 24/7 , not only enables but forces its natives to ceaselessly engage in work. From the vantage point of terminal illness, however, the digital administration of the self appears not as a strategy of disempowerment but as a life-sustaining practice that allows for the continuous production of the self under precarious bodily conditions. Drawing on the temporality of the digital—its immediacy—the article also examines the poetics of Herrndorf’s blog as illness narrative.

  20. Manganese determination om minerals by activation analysis, using the californium-252 as a neutron source; Determinacao de manganes em minerios, por analise por ativacao, usando californio-252 como fonte de neutrons

    Energy Technology Data Exchange (ETDEWEB)

    Cardoso, Antonio

    1976-07-01

    Neutron Activation Analysis, using a Californium-252 neutron source, has been applied for the determination of manganese in ores such as pyrolusite, rodonite (manganese silicate)' and blending used in dry-batteries The favorable nuclear properties of manganese, such as high thermal neutron cross-section for the reaction {sup 55}Mn (n.gamma){sup 56} Mn, high concentration of manganese in the matrix and short half - life of {sup 56}Mn, are an ideal combination for non-destructive analysis of manganese in ores. Samples and standards of manganese dioxide were irradiated for about 20 minutes, followed by a 4 to 15 minutes decay and counted in a single channel pulse-height discrimination using a NaI(Tl) scintillation detector. Counting time was equal to 10 minutes. The interference of nuclear reactions {sup 56}Fe(n,p){sup 56}Mn and {sup 59} Co (n, {alpha}){sup 56} were studied, as well as problems in connection with neutron shadowing during irradiation, gamma-rays attenuation during counting and influence of granulometry of samples. One sample,was also analysed by wet-chemical method (sodium bismuthate) in order to compare results. As a whole, i t was shown that the analytical method of neutron activation for manganese in ores and blending, is a method simple, rapid and with good precision and accuracy. (author)

  1. Design of a homogeneous subcritical nuclear reactor based on thorium with a source of californium 252; Diseno de un reactor nuclear subcritico homogeneo a base de Torio con una fuente de Californio 252

    Energy Technology Data Exchange (ETDEWEB)

    Delgado H, C. E.; Vega C, H. R. [Universidad Autonoma de Zacatecas, Unidad Academica de Estudios Nucleares, Cipres No. 10, Fracc. La Penuela, 98068 Zacatecas, Zac. (Mexico); Sajo B, L., E-mail: ce_delgado89@hotmail.com [Universidad Simon Bolivar, Laboratorio de Fisica Nuclear, Apdo. 89000, 1080A Caracas (Venezuela, Bolivarian Republic of)

    2015-10-15

    Full text: One of the energy alternatives to fossil fuels which do not produce greenhouse gases is the nuclear energy. One of the drawbacks of this alternative is the generation of radioactive wastes of long half-life and its relation to the generation of nuclear materials to produce weapons of mass destruction. An option to these drawbacks of nuclear energy is to use Thorium as part of the nuclear fuel which it becomes in U{sup 233} when capturing neutrons, that is a fissile material. In this paper Monte Carlo methods were used to design a homogeneous subcritical reactor based on thorium. As neutron reflector graphite was used. The reactor core is homogeneous and is formed of 70% light water as moderator, 12% of enriched uranium UO{sub 2}(NO{sub 3}){sub 4} and 18% of thorium Th(NO{sub 3}){sub 4} as fuel. To start the nuclear fission chain reaction an isotopic source of californium 252 was used with an intensity of 4.6 x 10{sup 7} s{sup -1}. In the design the value of the effective multiplication factor, whose value turned out k{sub eff} <1 was calculated. Also, the neutron spectra at different distances from the source and the total fluence were calculated, as well as the values of the ambient dose equivalent in the periphery of the reactor. (Author)

  2. Structural and functional insights into thermostable and organic solvent stable variant Pro247-Ser of Bacillus lipase.

    Science.gov (United States)

    Chopra, Nisha; Kumar, Arbind; Kaur, Jagdeep

    2017-10-31

    Thermostability of enzymes is an important issue in protein engineering and has been studied in detail. Still there is no hard and fast rule to define the conditions which will provide thermal stability. Understanding the various factors and mechanism responsible for thermal stability will add on new insights into our present knowledge in this area. Pro247-Ser variant was constructed based on homology modelling and rational design. It exhibited 60 fold increase in thermal stability at 60°C and+0.7M shift in C1/2 value for urea denaturation as compared to WT. Variant displayed noticeable tolerance to organic solvents. With decrease in Km, catalytic efficiency of Pro247-Ser variant was increased by 12 fold. The activity and stability assay including circular dichroism and fluorescence spectroscopy favoured increased thermal performance of variant. Hydrolytic activity of variant was found to be high in comparison to control for all p-nitrophenol esters investigated. The immobilized variant enzyme demonstrated nearly two fold enhanced conversion of methyl oleate than WT enzyme. The additional molecular interactions of variant residue might contribute to increased thermostability of lipase. The homology modeling predicted formation of additional hydrogen bonds between Ser247/O-Thr251/OG1 as well as Ser247/O-Glu250/N. Copyright © 2017 Elsevier B.V. All rights reserved.

  3. Phosphorylation of HOX11/TLX1 on Threonine-247 during mitosis modulates expression of cyclin B1

    Directory of Open Access Journals (Sweden)

    Chesney Alden

    2010-09-01

    Full Text Available Abstract Background The HOX11/TLX1 (hereafter referred to as HOX11 homeobox gene was originally identified at a t(10;14(q24;q11 translocation breakpoint, a chromosomal abnormality observed in 5-7% of T cell acute lymphoblastic leukemias (T-ALLs. We previously reported a predisposition to aberrant spindle assembly checkpoint arrest and heightened incidences of chromosome missegregation in HOX11-overexpressing B lymphocytes following exposure to spindle poisons. The purpose of the current study was to evaluate cell cycle specific expression of HOX11. Results Cell cycle specific expression studies revealed a phosphorylated form of HOX11 detectable only in the mitotic fraction of cells after treatment with inhibitors to arrest cells at different stages of the cell cycle. Mutational analyses revealed phosphorylation on threonine-247 (Thr247, a conserved amino acid that defines the HOX11 gene family and is integral for the association with DNA binding elements. The effect of HOX11 phosphorylation on its ability to modulate expression of the downstream target, cyclin B1, was tested. A HOX11 mutant in which Thr247 was substituted with glutamic acid (HOX11 T247E, thereby mimicking a constitutively phosphorylated HOX11 isoform, was unable to bind the cyclin B1 promoter or enhance levels of the cyclin B1 protein. Expression of the wildtype HOX11 was associated with accelerated progression through the G2/M phase of the cell cycle, impaired synchronization in prometaphase and reduced apoptosis whereas expression of the HOX11 T247E mutant restored cell cycle kinetics, the spindle checkpoint and apoptosis. Conclusions Our results demonstrate that the transcriptional activity of HOX11 is regulated by phosphorylation of Thr247 in a cell cycle-specific manner and that this phosphorylation modulates the expression of the target gene, cyclin B1. Since it is likely that Thr247 phosphorylation regulates DNA binding activity to multiple HOX11 target sequences, it is

  4. a 24/7 High Resolution Storm Surge, Inundation and Circulation Forecasting System for Florida Coast

    Science.gov (United States)

    Paramygin, V.; Davis, J. R.; Sheng, Y.

    2012-12-01

    A 24/7 forecasting system for Florida is needed because of the high risk of tropical storm surge-induced coastal inundation and damage, and the need to support operational management of water resources, utility infrastructures, and fishery resources. With the anticipated climate change impacts, including sea level rise, coastal areas are facing the challenges of increasing inundation risk and increasing population. Accurate 24/7 forecasting of water level, inundation, and circulation will significantly enhance the sustainability of coastal communities and environments. Supported by the Southeast Coastal Ocean Observing Regional Association (SECOORA) through NOAA IOOS, a 24/7 high-resolution forecasting system for storm surge, coastal inundation, and baroclinic circulation is being developed for Florida using CH3D Storm Surge Modeling System (CH3D-SSMS). CH3D-SSMS is based on the CH3D hydrodynamic model coupled to a coastal wave model SWAN and basin scale surge and wave models. CH3D-SSMS has been verified with surge, wave, and circulation data from several recent hurricanes in the U.S.: Isabel (2003); Charley, Dennis and Ivan (2004); Katrina and Wilma (2005); Ike and Fay (2008); and Irene (2011), as well as typhoons in the Pacific: Fanapi (2010) and Nanmadol (2011). The effects of tropical cyclones on flow and salinity distribution in estuarine and coastal waters has been simulated for Apalachicola Bay as well as Guana-Tolomato-Matanzas Estuary using CH3D-SSMS. The system successfully reproduced different physical phenomena including large waves during Ivan that damaged I-10 Bridges, a large alongshore wave and coastal flooding during Wilma, salinity drop during Fay, and flooding in Taiwan as a result of combined surge and rain effect during Fanapi. The system uses 4 domains that cover entire Florida coastline: West, which covers the Florida panhandle and Tampa Bay; Southwest spans from Florida Keys to Charlotte Harbor; Southeast, covering Biscayne Bay and Miami and

  5. 48 CFR 52.247-22 - Contractor Liability for Loss of and/or Damage to Freight Other Than Household Goods.

    Science.gov (United States)

    2010-10-01

    ... Loss of and/or Damage to Freight Other Than Household Goods. 52.247-22 Section 52.247-22 Federal.../or Damage to Freight Other Than Household Goods. As prescribed in 47.207-7(d), insert the following clause in solicitations and contracts for the transportation of freight other than household goods...

  6. 32 CFR Appendix C to Part 247 - Mailing of DoD Newspapers, Magazines, CE Guides, and Installation Maps; Sales and Distribution of...

    Science.gov (United States)

    2010-07-01

    ..., and Installation Maps; Sales and Distribution of Non-DoD Publications C Appendix C to Part 247... Appendix C to Part 247—Mailing of DoD Newspapers, Magazines, CE Guides, and Installation Maps; Sales and... installation maps to incoming DoD personnel and their families to orient them to their new command...

  7. Large Scale Outflow from a Radio Loud AGN in Merging Galaxies at Redshift 2.47

    Science.gov (United States)

    Shih, Hsin-Yi; Stockton, Alan

    2015-08-01

    We detected a system of extended ionized gas cloud, approximately 40 kpc wide, while studying a compact group of galaxies surrounding a powerful radio source at z = 2.47. The most plausible source of these ionized gas, and also the radio emission, is a pair of merging galaxies greater than 70 kpc away from the tip of the detected extended gas cloud. Optical spectra of the merging pair itself shows strong UV lines with very broad line profiles of FWHM ~ 1700 km/s, which may represent a high velocity outflow driven by nuclear superbubbles that are commonly found in low redshift mergers. Thus, we have one merger with two distinct outflow systems: the extended ionized gas cloud, and the high velocity gas close to the host. This raises the question of the power source and the timing of the two outflows. The extended outflow is likely carried to such large distance by the radio jets, while the high velocity outflow close to the nucleus can be driven by the AGN radiation. The two outflows may be from a single episode of feedback, or two separate episodes triggered by different mechanism. Given that this is a stage 3 merger, where the two galaxies' nucleii share a common envelope, the kinematics and extent of the outflows from this system may shed some light on when the AGN feedback is triggered and the interplay between the different possible feedback mechanisms in the merger process.

  8. Study on Application of Grey Prediction Model in Superalloy MAR-247 Machining

    Directory of Open Access Journals (Sweden)

    Chen Shao-Hsien

    2015-01-01

    Full Text Available Superalloy MAR-247 is mainly applied in the space industry and die industry. With its characteristics of mechanical property, fatigue resistance, and high temperature corrosion resistance, therefore, it is mainly applied in machine parts of high temperature and corrosion resistance, such as turbine blades and rotor of the aeroengine and turbine assembly in the nuclear power plant. However, considering that its properties of high strength, low thermal conductivity, being difficult to soften, and work hardening may reduce the life of cutting-tool and weaken the surface accuracy, the study provided minimizing experiment occurring during milling process for superalloy material. As a statistical approach used to analyse experiment data, this study used GM(1,1 in the grey prediction model to conduct simulation and then predict and analyze its characteristics based on the experimental data, focusing on the tool life and surface accuracy. Moreover, with the superalloy machining parameters of the current effective application improved grey prediction model, it can decrease the errors, extend the tool life, and improve the prediction precision of surface accuracy.

  9. The 24/7 approach to promoting optimal welfare for captive wild animals.

    Science.gov (United States)

    Brando, Sabrina; Buchanan-Smith, Hannah M

    2017-11-04

    We have an ethical responsibility to provide captive animals with environments that allow them to experience good welfare. Husbandry activities are often scheduled for the convenience of care staff working within the constraints of the facility, rather than considering the biological and psychological requirements of the animals themselves. The animal welfare 24/7 across the lifespan concept provides a holistic framework to map features of the animal's life cycle, taking into account their natural history, in relation to variations in the captive environment, across day and night, weekdays, weekends, and seasons. In order for animals to have the opportunity to thrive, we argue the need to consider their lifetime experience, integrated into the environments we provide, and with their perspective in mind. Here, we propose a welfare assessment tool based upon 14 criteria, to allow care staff to determine if their animals' welfare needs are met. We conclude that animal habitat management will be enhanced with the use of integrated technologies that provide the animals with more opportunities to engineer their own environments, providing them with complexity, choice and control. Copyright © 2017 Elsevier B.V. All rights reserved.

  10. Creep-Fatigue Cracking Near the Welded Interface in Friction Welding Dissimilar Superalloys INCONEL 718 and MAR-M247

    Science.gov (United States)

    Tra, Tran Hung; Okazaki, Masakazu

    2017-08-01

    A forged INCONEL 718 and a cast MAR-M247 alloy were joined by a friction welding process. The creep-fatigue strength of this joint was investigated. The life of the joint was significantly shorter than that of the base alloys. The joint failed near the interface of the INCONEL 718 side, although the life of INCONEL 718 was longer than that of MAR-M247. To understand this behavior, the stress field in the welding was numerically analyzed using a visco-elastic model. The results suggested that triaxiality in the stress state could be promoted near the welded interface and lead to an acceleration of creep-fatigue crack nucleation.

  11. LCF- and LCF/HCF-behaviour of the superalloy MAR-M247LC

    Energy Technology Data Exchange (ETDEWEB)

    Gelmedin, Domnin; Lang, Karl-Heinz [Karlsruhe Institute of Technology (KIT), Karlsruhe (Germany). Inst. fuer Werkstoffkunde I

    2010-07-01

    The fatigue behaviour of the Nickel-base superalloy Mar-M247LC was investigated at 650 C in air environment under total strain control. Pure low cycle fatigue (LCF) loading, pure high cycle fatigue (HCF) loading and superimposed LCF/HCF loading were realised. In LCF tests with a strain ratio of zero and a hold time of 60 seconds the cyclic deformation and the lifetime behaviour was investigated. The dependence of the fatigue limit on the mean strain was estimated in HCF tests at a frequency of 60 Hz using an ultimate number of cycles of ten million. Finally the influence of superimposed HCF and LCF loadings was examined. At high total strain ranges of the HCF loading the lifetime of the superalloy as reduced about more than one magnitude compared to the lifetime under pure LCF loading. With decreasing HCF loadings the reduction of the lifetime decreases. This life time reduction can be explained by the interaction of the LCF and the superimposed HCF loading. Crack initiation and first crack propagation is predominantly induced by the LCF loading. After reaching an adequate long fatigue crack length the superimposed HCF loading contributes considerably to the crack growth. This contribution can be determined evaluating the distance between the LCF marking lines which form on the fracture surface. The higher the superimposed HCF loading was the longer the distance between the LCF marking lines and the lower the crack length were when first LCF marking lines could be recognized. On the basis of this cognition the life time under superimposed LCF/HCF loading was modelled using a model basing on fracture mechanics. (orig.)

  12. 48 CFR 52.247-45 - F.o.b. Origin and/or F.o.b. Destination Evaluation.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false F.o.b. Origin and/or F.o.b... Clauses 52.247-45 F.o.b. Origin and/or F.o.b. Destination Evaluation. As prescribed in 47.305-2(b), insert the following provision in solicitations when offers are solicited on the basis of both f.o.b. origin...

  13. 17 CFR 247.701 - Exemption from the definition of “broker” for certain institutional referrals.

    Science.gov (United States)

    2010-04-01

    ... THE EXCEPTIONS FOR BANKS FROM THE DEFINITION OF BROKER § 247.701 Exemption from the definition of “broker” for certain institutional referrals. (a) General. A bank that meets the requirements for the exception from the definition of “broker” under section 3(a)(4)(B)(i) of the Act (15 U.S.C. 78c(a)(4)(B)(i...

  14. P247 and p523: two in vivo-expressed megalocytivirus proteins that induce protective immunity and are essential to viral infection.

    Directory of Open Access Journals (Sweden)

    Jian Zhang

    Full Text Available Megalocytivirus is a DNA virus with a broad host range among teleost fish. Although the complete genome sequences of a number of megalocytivirus isolates have been reported, the functions of most of the genes of this virus are unknown. In this study, we selected two megalocytivirus immunogens, P247 and P523, which were expressed during host infection and, when in the form of DNA vaccines (pCN247 and pCN523 respectively, elicited strong protectivity against lethal megalocytivirus challenge in a turbot (Scophthalmus maximus model. Compared to control fish, fish vaccinated with pCN247 and pCN523 exhibited drastically reduced viral loads in tissues and high levels of survival rates. Immune response analysis showed that pCN247 and pCN523 (i induced production of specific serum antibodies, (ii caused generation of cytotoxic immune cells and specific memory immune cells that responded to secondary antigen stimulation, and (iii upregulated the expression of genes involved in innate and adaptive immunity. To examine the potential role of P247 and P523 in viral infection, the expression of P247 and P523 was knocked down by siRNA. Subsequent in vivo infection study showed that P247 and P523 knockdown significantly impaired viral replication. Furthermore, whole-genome transcriptome analysis revealed that P247 and P523 knockdown altered the expression profiles of 26 and 41 viral genes, respectively, putatively participating in diverse aspects of viral infection. Taken together, these results indicate that P247 and P523 induce protective immunity in teleost and play fundamental roles essential to viral replication. These observations provide the first evidence that suggests a likely link between the protectivity of viral immunogens and their biological significance in viral replication.

  15. Characterization of street rabies virus variants with an additional N-glycan at position 247 in the glycoprotein.

    Science.gov (United States)

    Yamada, Kentaro; Noguchi, Kazuko; Nishizono, Akira

    2014-02-01

    Most street rabies virus glycoproteins (G proteins) possess two N-glycosylation sites, at Asn(37) and Asn(319), whereas an additional N-glycosylation site is present in several fixed (laboratory-adapted) rabies virus strains at Asn(247), which suggests that the N-glycosylation addition may be a marker of fixed viruses. In this study, we successfully cloned two street virus strain 1088 variants, N5B#15 and N5B#10-28, in which the G proteins had an additional N-glycan at position 247, and we examined whether these variants were characterized by cell culture adaptation and attenuation after intramuscular inoculation as fixed viruses. N5B#15 had four mutations, i.e., S148P and D247N in the G protein, and T137A and N2046S in the large (L) protein. N5B#10-28 had an additional mutation in the G protein, R196I. Compared with the parental 1088 virus, both variants exhibited highly efficient replication in mouse neuroblastoma-derived NA cells and reduced pathogenicity in adult mice when inoculated intramuscularly, but not intracerebrally. However, this attenuation was not attributable to the induction of strong immune responses.

  16. Performance Characteristics of Automotive Engines in the United States : First Series - Report No. 12 - 1975 Perkins Diesel 247 CID (4.0 Liters)

    Science.gov (United States)

    1978-04-01

    Experimental data were obtained in dynamometer tests of a 1975 Perkins 247-CID diesel engine to determine fuel consumption and emissions (hydrocarbon, carbon monoxide, oxides of nitrogen) at steady-state engine-operating modes. The objective of the p...

  17. Association of 24/7 In-House Intensive Care Unit Attending Physician Coverage With Outcomes in Children Undergoing Heart Operations.

    Science.gov (United States)

    Gupta, Punkaj; Rettiganti, Mallikarjuna; Jeffries, Howard E; Brundage, Nancy; Markovitz, Barry P; Scanlon, Matthew C; Simsic, Janet M

    2016-12-01

    Multicenter data regarding the around-the-clock (24/7) presence of an in-house critical care attending physician with outcomes in children undergoing cardiac operations are limited. Patients younger than 18 years of age who underwent operations (with or without cardiopulmonary bypass [CPB]) for congenital heart disease at 1 of the participating intensive care units (ICUs) in the Virtual PICU Systems (VPS, LLC) database were included (2009-2014). The study population was divided into 2 groups: the 24/7 group (14,737 patients; 32 hospitals), and the No 24/7 group (10,422 patients; 22 hospitals). Propensity-score matching was performed to match patients 1:1 in the 24/7 group and in the No 24/7 group. Overall, 25,159 patients from 54 hospitals qualified for inclusion. By propensity matching, 9,072 patients (4,536 patient pairs) from 51 hospitals were matched 1:1 in the 2 groups. After matching, mortality at ICU discharge was lower among the patients treated in hospitals with 24/7 coverage (24/7 versus No 24/7, 2.8% versus 4.0%; p = 0.002). The use of extracorporeal membrane oxygenation (ECMO), the incidence of cardiac arrest, extubation within 48 hours after operation, the rate of reintubation, and the duration of arterial line and central venous line use after operation were significantly improved in the 24/7 group. When stratified by surgical complexity, survival benefits of 24/7 coverage persisted among patients undergoing both high-complexity and low-complexity operations. The presence of 24-hour in-ICU attending physician coverage in children undergoing cardiac operations is associated with improved outcomes, including ICU mortality. It is possible that 24-hour in-ICU attending physician coverage may be a surrogate for other factors that may bias the results. Further study is warranted. Copyright © 2016 The Society of Thoracic Surgeons. Published by Elsevier Inc. All rights reserved.

  18. Development of a logic model to support a network approach in delivering 24/7 children's palliative care: part one.

    Science.gov (United States)

    Maynard, Linda; Lynn, Deborah

    2016-04-02

    This research aimed to develop and evaluate a 24/7 symptom-management service for children with life-limiting conditions and a model for palliative care nursing. A combination of audit and qualitative and quantitative evaluation. A consultant nurse-led service (n=5 clinical nurse specialists) provided care and support to children and their families, which spanned a range of settings (home, hospital, hospice) supported by a managed clinical network of consultant paediatricians (n=4) with postgraduate expertise in palliative care. A pluralistic evaluation was conducted where the predefined service standards were audited and the predetermined service objectives were evaluated using daily diary data from the nursing team (micro), qualitative and quantitative survey data of stakeholders using the service (mezzo) and family assessment of children's palliative care (CPC) standards across the CPC network (macro).

  19. High cycle fatigue behavior of the IN718/M247 hybrid element fabricated by friction welding at elevated temperatures

    Directory of Open Access Journals (Sweden)

    Tran Hung Tra

    2016-12-01

    Full Text Available A hybrid element has been fabricated by friction welding, joining two superalloys Inconel 718 and Mar-M247. The high cycle fatigue behavior of this welded element was investigated at 500 °C and 700 °C. The fabrication could obtain excellent fatigue strength in which the fracture is located in the base metal Mar-M247 side and takes place outside the welded zone. The behavior of the joint under loadings is discussed through a simulation by the numerical finite element method.

  20. Development of the 24/7 Nurse Practitioner Model on the Inpatient Pediatric General Surgery Service at a Large Tertiary Care Children's Hospital and Associated Outcomes.

    Science.gov (United States)

    Rejtar, Marketa; Ranstrom, Lee; Allcox, Christina

    Nurse practitioners (NPs) have been providing high-quality and safe patient care for a few decades, and evidence showing the extent of their impact is emerging. This article describes the implementation of a 24/7 NP patient care model on an inpatient pediatric general surgery service in a tertiary free-standing Children's Hospital in the Northeastern United States. The literature shows that there is limited evidence regarding NP models of care and their effect on patient outcomes. In response to policy changes leading to reduction of resident work hours and a more acute and complex inpatient pediatric general surgery patient population, our existing NP model evolved into a 24/7 NP Model in June 2011. The results from two quality improvement projects showed positive registered nurse and attending surgeon staff satisfaction with the 24/7 NP Model of care and a decreased trend of unplanned intensive care unit patient transfers after the 24/7 NP Model implementation. These findings further support the evidence in the literature that NPs provide safe and quality patient care. Copyright © 2016 National Association of Pediatric Nurse Practitioners. Published by Elsevier Inc. All rights reserved.

  1. SlamZ: Slide activity on the Hikurangi margin, New Zealand - First results of the RV Sonne expedition SO247

    Science.gov (United States)

    Huhn, Katrin; Kukowski, Nina; Freudenthal, Tim; Crutchley, Gareth; Goepel, Andreas; Henrys, Stuart; Kasten, Sabine; Kaul, Norbert; Kuhlmann, Jannis; Mountjoy, Joshu; Orpin, Alan; Pape, Thomas; Schwarze, Cornelius; Totsche, Kai-Uwe; Torres, Marta; Villinger, Heiner

    2017-04-01

    Submarine landslides are important geologic hazards. Although they have been the focus of research for decades, there is still a clear lack in knowledge with respect to the interplay between tectonic movements, slope architecture and sediment physical properties of slope strata, as well as gas hydrate dissociation as controlling factors of slope stability or respectively slope failure processes. The main scientific goal of the Sonne expedition SO247 undertaken in spring 2016 was to gain a better understanding of the factors controlling slope destabilization, especially the interaction of tectonic steepening and gas hydrate transformation, at different tectonic settings along the Hikurangi subduction zone east of New Zealand's North Island. This active continental margin is characterized by various potential triggers for slope failure, e.g. (I) a wide range of tectonic movements which are associated with high seismicity, numerous active faults, sediment uplift and slope over-steepening, and (II) large gas hydrate deposits whose current upper stability limit in some places correlates with the breakoff points of slides. The target areas of SO247 were the frontal accretionary ridge at Rock Garden and the Tuaheni landslide complex (TLC) further north offshore Gisborne. Bathymetric as well as high-resolution seismic reflection and Parasound data were used to select suitable position for 53 gravity cores with a total length of 150 m which were recovered along systematic transects from the undisturbed slope sections to the slid masses in both working areas. In addition, six long sediment cores (three in both working areas) with a total length of approx. 470 m were drilled utilizing the MARUM Bremen drill rig MeBo200. These include a 105 m long continuous sediment core (core recovery > 95%) from an undisturbed slope section in the vicinity of the Tuaheni slide complex. This core represented the first long (i.e. longer than 50 m) sediment record from the Hikurangi margin

  2. Effects of the Hot Isostatic Pressing Process on Crack Healing of the Laser Repair-Welded CM247LC Superalloy

    Directory of Open Access Journals (Sweden)

    Keng-Tu Hsu

    2016-10-01

    Full Text Available This study investigated the effects of the hot isostatic pressing process on the crack healing, microstructure, and mechanical properties of the laser repair-welded CM247LC precipitation-hardened superalloy. To ensure the strength of the repair-welded area, this study used the direct re-melting approach, and simulated the repair welding with the filler addition, which has a chemical composition matching that of the base superalloy. As expected, different types of cracks, including the solidification crack in the weld fusion zone and various types of liquidation cracks in the heat-affected zone, were observed. Through a proper hot isostatic pressing healing process, all cracks in the weld fusion zone and the heat-affected zone of the repair-welded pieces were healed. At the same time, some nano- and micro-sized carbides tended to form discontinuously along the healed crack trace. A micro-hardness test was conducted in the repair-welded area, and the results were similar to that of the as-cast material.

  3. Microstructure of selective laser melted CM247LC nickel-based superalloy and its evolution through heat treatment

    Energy Technology Data Exchange (ETDEWEB)

    Divya, V.D., E-mail: dv272@cam.ac.uk [Department of Materials Science and Metallurgy, University of Cambridge, 27 Charles Babbage Road, Cambridge CB3 0FS (United Kingdom); Muñoz-Moreno, R.; Messé, O.M.D.M.; Barnard, J.S. [Department of Materials Science and Metallurgy, University of Cambridge, 27 Charles Babbage Road, Cambridge CB3 0FS (United Kingdom); Baker, S.; Illston, T. [Materials Solutions, Unit 8, Great Western Business Park, McKenzie Way, Worcester WR4 9GN (United Kingdom); Stone, H.J. [Department of Materials Science and Metallurgy, University of Cambridge, 27 Charles Babbage Road, Cambridge CB3 0FS (United Kingdom)

    2016-04-15

    The selective laser melting of high temperature alloys is of great interest to the aerospace industry as it offers the prospect of producing more complex geometries than can be achieved with other manufacturing methods. In this study, the microstructure of the nickel-based superalloy, CM247LC, has been characterised following selective laser melting and after a post deposition heat treatment below the γ′ solvus temperature. In the as-deposited state, scanning electron microscopy with electron backscatter diffraction revealed a fine, cellular microstructure with preferential alignment of 〈001〉 along the build direction. A high dislocation density was seen at the periphery of the cells, indicating substantial localised deformation of the material. Fine primary MC carbides were also observed in the inter-cellular regions. High-resolution transmission electron microscopy identified the occurrence of very fine γ′ precipitates, approximately 5 nm in diameter, dispersed within the gamma phase. After heat treatment, the elongated cell colonies were observed to partially coalesce, accompanied by a decrease in dislocation density, producing columnar grains along the build direction. Cuboidal γ′ precipitates approximately 500 nm in diameter were observed to form in the recrystallised grains, accompanied by larger γ′ precipitates on the grain boundaries.

  4. Genomic characterization of the uncultured Bacteroidales family S24-7 inhabiting the guts of homeothermic animals.

    Science.gov (United States)

    Ormerod, Kate L; Wood, David L A; Lachner, Nancy; Gellatly, Shaan L; Daly, Joshua N; Parsons, Jeremy D; Dal'Molin, Cristiana G O; Palfreyman, Robin W; Nielsen, Lars K; Cooper, Matthew A; Morrison, Mark; Hansbro, Philip M; Hugenholtz, Philip

    2016-07-07

    Our view of host-associated microbiota remains incomplete due to the presence of as yet uncultured constituents. The Bacteroidales family S24-7 is a prominent example of one of these groups. Marker gene surveys indicate that members of this family are highly localized to the gastrointestinal tracts of homeothermic animals and are increasingly being recognized as a numerically predominant member of the gut microbiota; however, little is known about the nature of their interactions with the host. Here, we provide the first whole genome exploration of this family, for which we propose the name "Candidatus Homeothermaceae," using 30 population genomes extracted from fecal samples of four different animal hosts: human, mouse, koala, and guinea pig. We infer the core metabolism of "Ca. Homeothermaceae" to be that of fermentative or nanaerobic bacteria, resembling that of related Bacteroidales families. In addition, we describe three trophic guilds within the family, plant glycan (hemicellulose and pectin), host glycan, and α-glucan, each broadly defined by increased abundance of enzymes involved in the degradation of particular carbohydrates. "Ca. Homeothermaceae" representatives constitute a substantial component of the murine gut microbiota, as well as being present within the human gut, and this study provides important first insights into the nature of their residency. The presence of trophic guilds within the family indicates the potential for niche partitioning and specific roles for each guild in gut health and dysbiosis.

  5. Grainex Mar-M 247 Turbine Disk Life Study for NASA's High Temperature High Speed Turbine Seal Test Facility

    Science.gov (United States)

    Delgado, Irebert R.

    2015-01-01

    An experimental and analytical fatigue life study was performed on the Grainex Mar-M 247 disk used in NASA s Turbine Seal Test Facility. To preclude fatigue cracks from growing to critical size in the NASA disk bolt holes due to cyclic loading at severe test conditions, a retirement-for-cause methodology was adopted to detect and monitor cracks within the bolt holes using eddy-current inspection. For the NASA disk material that was tested, the fatigue strain-life to crack initiation at a total strain of 0.5 percent, a minimum to maximum strain ratio of 0, and a bolt hole temperature of 649 C was calculated to be 665 cycles using -99.95 percent prediction intervals. The fatigue crack propagation life was calculated to be 367 cycles after implementing a safety factor of 2 on life. Thus, the NASA disk bolt hole total life or retirement life was determined to be 1032 cycles at a crack depth of 0.501 mm. An initial NASA disk bolt hole inspection at 665 cycles is suggested with 50 cycle inspection intervals thereafter to monitor fatigue crack growth.

  6. Towards low-friction and wear-resistant plasma sintering dies via plasma surface co-alloying CM247 nickel alloy with V/Ag and N

    Directory of Open Access Journals (Sweden)

    Zhang Zhenxue

    2015-01-01

    Full Text Available Nickel based superalloys have good oxidation and creep resistance and hence they can function under high mechanical stress and high temperatures. However, their undesirable tribological behaviour is the major technical barrier to the challenging high-temperature, lubricant-free plasma sintering tool application. In this study, nickel based CM247 superalloy surfaces were co-alloyed using innovative active screen plasma technology with both interstitial element (e.g. N and substitutional alloying elements (e.g. V and Ag to provide a synergy effect to enhance its tribological properties. The tribological behaviour of the plasma co-alloyed CM247 superalloy surfaces were fully evaluated using reciprocal and pin-on-disc tribometers at temperatures from room temperature to 600 ∘C. The experimental results demonstrate that the co-alloyed surface with N, Ag and V can effectively lower the friction coefficient, which is expected to help demoulding during lubricant-free plasma sintering.

  7. Radiometallurgical examination of 1.47 enriched I&E fuel elements for PT-IP-247-A

    Energy Technology Data Exchange (ETDEWEB)

    Teats, R.

    1960-07-19

    Under the conditions of PT-IP-247-A, four columns of self-supported and four columns of rib-supported I&E 1.47% enriched fuel elements were irradiated to determine their relative performance under severe operating conditions. Four of the self-supported and two of the rib-supported control elements were received for nation. The two rib-supported control pieces, which were classified as ``near failures`` had received average exposures of 353 and 359 MWD/T at average specific power levels of 91 and 108 KW/ft before they were discharged because of other ruptured pieces in the tubes. The nominal specified canned fuel dimensions of the rib supported elements was 1.445 in. OD, .310 in bore, and 7.640 in. long. The first two self-supported elements were selected for examination on the basis of high weight losses sustained during irradiation, and the second two were selected to determine the effect of specific power levels on the AlSi bonding. The average specific power levels of the four self-supported elements varied from 79 to 110 KW/ft and the exposure varied from 845 MWD/T to 949 MWD/T. The nominal canned dimensions of the self-supported elements, which were made oversize to attain high annular coolant temperatures with respect to the interior coolant channel, were 1.460 in. OD, .375 in. bore, and 7.640 in. long. The eight bridge rail supports were spot welded on and gave an effective rib outside diameter of 1.600 in. All of the components were X-8001 aluminum alloy.

  8. Retrospective analysis of hepatitis B virus chronic infection in 247 patients: clinical stages, response to treatment and poor prognostic factors

    Directory of Open Access Journals (Sweden)

    Marlone Cunha-Silva

    Full Text Available Abstract Background: Chronic hepatitis B is a major cause of cirrhosis, and the natural history of the disease has several clinical stages that should be thoroughly understood for the implementation of proper treatment. Nonetheless, curing the disease with antiviral treatment remains a challenge. Aims: To describe the clinical course, response to treatment, and poor prognostic factors in 247 hepatitis B virus chronic infection patients treated in a tertiary hospital in Brazil. Methods: This was a retrospective and observational study, by analyzing the medical records of HBV infected patients between January 2000 and January 2015. Results: Most patients were male (67.2% and 74.1% were HBeAg negative. Approximately 41% had cirrhosis and 8.5% were hepatitis C virus coinfected. The viral load was negative after two years on lamivudine, entecavir and tenofovir in 86%, 90.6%, and 92.9% of the patients, respectively. The five-year resistance rates for lamivudine, adefovir, entecavir, and tenofovir were 57.5%, 51.8%, 1.9%, and 0%, respectively. The overall seroconversion rates were 31.2% for HBeAg and 9.4% for HBsAg. Hepatocellular carcinoma was diagnosed in 9.7% of patients, liver transplantation was performed in 9.7%, and overall mortality was 10.5%. Elevations of serum alanine aminotransferase (p = 0.0059 and viral load (p < 0.0001 were associated with progression to liver cirrhosis. High viral load was associated with progression to hepatocellular carcinoma (p < 0.0001. Significant risk factors associated with death were elevated alanine aminotransferase (p = 0.0039, liver cirrhosis (p < 0.0001, high viral load (p = 0.007, and hepatocellular carcinoma (p = 0.0008. HBeAg positive status was not associated with worse outcomes, and treatment may have been largely responsible. Conclusions: Elevations of viral load and serum alanine aminotransferase may select patients with worse prognosis, especially progression to cirrhosis and hepatocellular carcinoma

  9. 24/7 Neurocritical Care Nurse Practitioner Coverage Reduced Door-to-Needle Time in Stroke Patients Treated with Tissue Plasminogen Activator.

    Science.gov (United States)

    Moran, Jennifer L; Nakagawa, Kazuma; Asai, Susan M; Koenig, Matthew A

    2016-05-01

    Stroke centers with limited on-site neurovascular physician coverage may experience delays in acute stroke treatment. We sought to assess the impact of providing 24/7 neurocritical care acute care nurse practitioner (ACNP) "stroke code" first responder coverage on treatment delays in acute stroke patients who received tissue plasminogen activator (tPA). Consecutive acute ischemic stroke patients treated with intravenous tPA at a primary stroke center on Oahu between 2009 and 2014were retrospectively studied. 24/7 ACNP stroke code coverage (intervention) was introduced on July 1, 2011. The tPA utilization, door-to-needle (DTN) time, imaging-to-needle (ITN) time, and independent ambulation at hospital discharge were compared between the preintervention period (24 months) and the postintervention period (33 months). We studied 166 stroke code patients who were treated with intravenous tPA, 44 of whom were treated during the preintervention period and 122 of whom were treated during the postintervention period. After the intervention, the median DTN time was reduced from 53 minutes (interquartile range [IQR] 45-73) to 45 minutes (IQR 35-58) (P = .001), and the median ITN time was reduced from 36 minutes (IQR 28-64) to 21 minutes (IQR 16-31) (P < .0001). Compliance with the 60-minute target DTN improved from 61.4% (27 of 44 patients) in the preintervention period to 81.2% (99 of 122 patients) in the postintervention period (P = .004). The tPA treatment rates were similar between the preintervention and postintervention periods (P = .60). Addition of 24/7 on-site neurocritical care ACNP first responder coverage for acute stroke code significantly reduced the DTN time among acute stroke patients treated with tPA. Copyright © 2016 National Stroke Association. Published by Elsevier Inc. All rights reserved.

  10. Spatially conserved regulatory elements identified within human and mouse Cd247 gene using high-throughput sequencing data from the ENCODE project

    DEFF Research Database (Denmark)

    Pundhir, Sachin; Hannibal, Tine Dahlbæk; Bang-Berthelsen, Claus Heiner

    2014-01-01

    , supported by histone marks and ChIP-seq data, that specifically have features of an enhancer and a promoter, respectively. We also identified a putative long non-coding RNA from the characteristically long first intron of the Cd247 gene. The long non-coding RNA annotation is supported by manual annotations...... from the GENCODE project in human and our expression quantification analysis performed in NOD and B6 mice using qRT-PCR. Furthermore, 17 of the 23 SNPs already known to be implicated with T1D were observed within the long non-coding RNA region in mouse. The spatially conserved regulatory elements...

  11. Determining the impact of 24/7 phone support on hospital readmissions after aortic valve replacement surgery (the AVRre study): study protocol for a randomised controlled trial.

    Science.gov (United States)

    Lie, Irene; Danielsen, Stein Ove; Tønnessen, Theis; Solheim, Svein; Leegaard, Marit; Sandvik, Leiv; Wisløff, Torbjørn; Vangen, Jonny; Røsstad, Tor Henning; Moons, Philip

    2017-05-30

    Patients undergoing surgical aortic valve replacement (sAVR) have high rates of 30-day readmissions. They also report a low health-related quality of life (HRQOL) and elevated anxiety and depression. The aim of the AVRre study is to determine the efficacy and cost of a 24/7 phone-support intervention in reducing post-discharge readmissions after sAVR. The nature of the support is to help patients better understand and self-manage non-urgent symptoms at home. AVRre is a prospective, randomised controlled study comprising 30 days of continuous phone-support intervention and then intermittent follow-up for the first 12 months. Phone call data from and to patients are evaluated qualitatively; thus, the study has a mixed-method design. Two hundred and eighty-six patients, aged >18 years, scheduled for a sAVR - singly or in combination with another procedure - are recruited from locations in southeast Norway. Patients are randomly assigned to the intervention group, who are purposively phone-called individually 2 and 9 days after discharge and offered on-demand 24/7 (around-the-clock) telephone support for 30 days post-discharge. The primary outcome variable is the number of 30-day hospital readmissions. Secondary outcomes are anxiety and depression symptoms, as measured by the Hospital Anxiety and Depression Scale, HRQOL and quality-adjusted life years, measured by the EuroQol (EQ-5D). Intervention and hospital readmission (diagnosis-related groups (DRGs)/length of stay) for the first year after initial discharge from hospital are used for a cost-utility analysis. Standard parametric and non-parametric tests are used for evaluations over time. Analysis of covariance is used to control for possible differences at baseline. Narratives from phone calls are transcribed verbatim and analysed using systematic text condensation. A complex 'around-the-clock' intervention within a university hospital-based setting could be an effective strategy to reduce the high

  12. Methyl-3,4-dihydroxybenzoate and 9-10-dihydrophenanthrene-2,4,7-triol two phenolic compounds from Dioscorea alata L. and their antioxidant activity

    Science.gov (United States)

    Aminah, N. S.; Yulvia, A.; Tanjung, M.

    2017-09-01

    Two phenolic compounds namely: methyl-3,4-dihydroxybenzoate (1) and 9,10-dihydrophenanthrene-2,4,7-triol (2) had been isolated for the first time from the tuber of Dioscorea alata L. The extraction of two compounds were done by maceration method using methanol as solvent, followed by partition with n-hexane and ethyl acetate. The ethyl acetate extract was separated and purified using various chromatographic techniques yielded pure compounds. The structure of isolated compounds were determined based on spectroscopic data, including UV-Vis, 1D and 2D NMR spectra. Compounds (1), (2) and ascorbic acid as a comparator were evaluated for their antioxidant properties against DPPH, showing their IC50 were 9,41 ± 0,08; 23,52 ± 0,05; and 10,95 ± 0,08 ppm, respectively.

  13. Val/Leu247 and Trp/Ser316 polymorphisms in beta 2 glycoprotein I and their association with thrombosis in unselected Chilean patients.

    Science.gov (United States)

    Palomo, Iván; Pereira, Jaime; Alarcón, Marcelo; Vásquez, Marcela; Pinochet, Carmen; Poblete, Fernando; Mendez, Evelyn; Sandoval, Jeannette; Vidal, Rolando; Pierangeli, Silvia

    2007-03-01

    It is known that polymorphisms of beta (2)-glycoprotein I (beta (2)GPI) in exon 7 affect interaction between the phospholipid binding site and the antibodies, and that other polymorphisms in exon 8 increase the generation of antibodies. In this study, we analyzed genetic polymorphisms of beta (2)GPI in unselected Chilean patients to determine the prevalence of beta (2)GPI polymorphisms in the phospholipid domain in patients with venous and arterial thrombosis and the clinical correlation with thromboembolic complications. This study comprised 149 patients with venous and arterial thrombosis (62 with venous thrombosis and 87 with arterial thrombosis) and 160 healthy controls with no previous history of thrombosis. Polymorphisms of exons 7 and 8 of beta (2)GPI, which encode for its fifth domain, were determined by PCR-RFLP. The presence of aPL or anti-beta (2)GPI in the patients was detected by ELISA. Anti-beta (2)GPI were present in 8/149 patients (5.4%); of these, five had aCL antibodies of low titer. The allele containing Val/Leu(247) and Trp/Ser(316) was significantly more frequent in patients with thrombosis than in the control group (OR=3.1, CI 1.6-6.0, p=0.0003; OR=2.9, CI 1.1-8.6, p=0.027, respectively). These polymorphisms did not correlate with aPL or anti-beta (2)GPI but significant differences were observed with venous thrombosis (p=<0.0001) and arterial thrombosis (p=0.026). In conclusion, the beta (2)GPI polymorphisms Val/Leu(247) and Trp/Ser(316) are not related to the presence of anti-beta (2)GPI antibodies in unselected Chilean patients with venous and arterial thrombosis, but they are significantly associated with venous and arterial thrombosis.

  14. Frequency of MEFV gene mutations in Hatay province, Mediterranean region of Turkey and report of a novel missense mutation (I247V).

    Science.gov (United States)

    Gunesacar, Ramazan; Celik, Muhammet Murat; Arica, Vefik; Elmacioglu, Sibel; Ozturk, Oktay Hasan

    2014-08-10

    In the present study, 1000 patients with clinical suspicion of FMF were retrospectively reviewed to determine the spectrum of MEFV gene mutations by using DNA sequence analysis between September, 2008 and April, 2012. Sixteen different mutations and 55 different genotypes were detected in 618 of 1000 patients. Among 16 different mutations, R202Q (21.35%) was the most frequently observed mutation; followed by E148Q (8.85%), M694V (7.95%), M680I (2.40%), V726A (1.85%), M694I (0.95%), A744S (0.80%), R761H (0.55%), P283L (0.35%), K695R (0.20%), E230K (0.15%), L110P (0.10%), I247V (0.05%), G196W (0.05%) and G304R (0.05%). In the present study, a novel missense mutation (I247V) and a silent variant (G150G) were identified in the MEFV gene. On the other hand, P238L, G632A and G304R mutations are the first cases reported from Turkey. Our results indicated that MEFV mutations are highly heterogeneous in our study population as in other regions of Turkey and mutation screening techniques such as PCR-RFLP, amplification refractory mutation system or reverse hybridization do not adequately detect uncommon or novel mutations. Therefore, it was proven that sequence analysis of the MEFV gene could be useful for detection of rare or unknown mutations. Copyright © 2014 Elsevier B.V. All rights reserved.

  15. The multifaceted effects of agmatine on functional recovery after spinal cord injury through Modulations of BMP-2/4/7 expressions in neurons and glial cells.

    Directory of Open Access Journals (Sweden)

    Yu Mi Park

    Full Text Available Presently, few treatments for spinal cord injury (SCI are available and none have facilitated neural regeneration and/or significant functional improvement. Agmatine (Agm, a guanidinium compound formed from decarboxylation of L-arginine by arginine decarboxylase, is a neurotransmitter/neuromodulator and been reported to exert neuroprotective effects in central nervous system injury models including SCI. The purpose of this study was to demonstrate the multifaceted effects of Agm on functional recovery and remyelinating events following SCI. Compression SCI in mice was produced by placing a 15 g/mm(2 weight for 1 min at thoracic vertebra (Th 9 segment. Mice that received an intraperitoneal (i.p. injection of Agm (100 mg/kg/day within 1 hour after SCI until 35 days showed improvement in locomotor recovery and bladder function. Emphasis was made on the analysis of remyelination events, neuronal cell preservation and ablation of glial scar area following SCI. Agm treatment significantly inhibited the demyelination events, neuronal loss and glial scar around the lesion site. In light of recent findings that expressions of bone morphogenetic proteins (BMPs are modulated in the neuronal and glial cell population after SCI, we hypothesized whether Agm could modulate BMP- 2/4/7 expressions in neurons, astrocytes, oligodendrocytes and play key role in promoting the neuronal and glial cell survival in the injured spinal cord. The results from computer assisted stereological toolbox analysis (CAST demonstrate that Agm treatment dramatically increased BMP- 2/7 expressions in neurons and oligodendrocytes. On the other hand, BMP- 4 expressions were significantly decreased in astrocytes and oligodendrocytes around the lesion site. Together, our results reveal that Agm treatment improved neurological and histological outcomes, induced oligodendrogenesis, protected neurons, and decreased glial scar formation through modulating the BMP- 2/4/7 expressions following

  16. The effect of tantalum on the structure/properties of two polycrystalline nickel-base superalloys: B-1900 + Hf MAR-M247. M.S. Thesis, Final Report

    Science.gov (United States)

    Janowski, G. M.

    1985-01-01

    The microstructure, phase compositions, and phase fractions were studied in conventionally cast B-1900 + Hf and both conventionally cast and directionally solidified MAR-M247 as a function of tantalum concentration. The hot tensile and creep rupture properties of the solutionized and aged MAR-M247-type alloys were also determined as a function of tantalum level. The effects of tantalum on the microstructure and phase compositions of B-1900 + Hf and MAR-M247 (conventionally cast and directionally solidified) were found to be very similar. The addition of tantalum to the as cast and heat treated alloys was shown to cause the partial replacement of the Hf in the MC carbides by Ta, although the degree of replacement was decreased by the solutionizing and aging heat treatment. The gamma prime and minor phase fractions (primarily MC type carbides) both increased approximately linearly with tantalum concentration. The gamma prime phase compositions were relatively insensitive to tantalum variations with the exception of the tantalum and/or hafnium levels. Bulk tantalum additions increased the tantalum, chromium, and cobalt levels of the gamma phase in both alloy series. The increase in the concentrations of the latter two elements in the gamma phase was a result of the decrease in the gamma phase fraction with increasing bulk tantalum concentration and constant gamma/gamma prime partitioning ratio. Tantalum additions increased the yield stress and ultimate tensile strength of the directionally solidified MAR-M247 type alloys and had no significant effect on ductility.

  17. Structural Benchmark Creep Testing for Microcast MarM-247 Advanced Stirling Convertor E2 Heater Head Test Article SN18

    Science.gov (United States)

    Krause, David L.; Brewer, Ethan J.; Pawlik, Ralph

    2013-01-01

    This report provides test methodology details and qualitative results for the first structural benchmark creep test of an Advanced Stirling Convertor (ASC) heater head of ASC-E2 design heritage. The test article was recovered from a flight-like Microcast MarM-247 heater head specimen previously used in helium permeability testing. The test article was utilized for benchmark creep test rig preparation, wall thickness and diametral laser scan hardware metrological developments, and induction heater custom coil experiments. In addition, a benchmark creep test was performed, terminated after one week when through-thickness cracks propagated at thermocouple weld locations. Following this, it was used to develop a unique temperature measurement methodology using contact thermocouples, thereby enabling future benchmark testing to be performed without the use of conventional welded thermocouples, proven problematic for the alloy. This report includes an overview of heater head structural benchmark creep testing, the origin of this particular test article, test configuration developments accomplished using the test article, creep predictions for its benchmark creep test, qualitative structural benchmark creep test results, and a short summary.

  18. Identification of Critical Operation Conditions of Industrial Gearboxes by 24/7 Monitoring of Oil Quality, Oil Aging, and Additive Consumption

    Science.gov (United States)

    Mauntz, M.; Peuser, J.

    2017-05-01

    The demand for wind energy grows at exponential rates. At the same time improving reliability, reduced operation and maintenance costs are the key priorities in wind tur-bine maintenance strategies [1]. This paper provides information about a novel online oil condition monitoring system to give a solution to the mentioned priorities. The presented sensor system enables damage prevention of the wind turbine gear-box by an advanced warning time of critical operation conditions and an enhanced oil exchange interval realized by a precise measurement of the electrical conductivity, the relative permittivity and the oil temperature. A new parameter, the WearSens® Index (WSi) is introduced. The mathematical model of the WSi combines all measured values and its gradients in one single parameter for a comprehensive monitoring to prevent wind turbines from damage. Furthermore, the WSi enables a long-term prognosis on the next oil change by 24/7 server data logging. Corrective procedures and/or maintenance can be carried out before actual damage occurs. First WSi results of an onshore wind turbine installation compared to traditional vibration monitoring are shown.

  19. Hydra—The National Earthquake Information Center’s 24/7 seismic monitoring, analysis, catalog production, quality analysis, and special studies tool suite

    Science.gov (United States)

    Patton, John M.; Guy, Michelle R.; Benz, Harley M.; Buland, Raymond P.; Erickson, Brian K.; Kragness, David S.

    2016-08-18

    This report provides an overview of the capabilities and design of Hydra, the global seismic monitoring and analysis system used for earthquake response and catalog production at the U.S. Geological Survey National Earthquake Information Center (NEIC). Hydra supports the NEIC’s worldwide earthquake monitoring mission in areas such as seismic event detection, seismic data insertion and storage, seismic data processing and analysis, and seismic data output.The Hydra system automatically identifies seismic phase arrival times and detects the occurrence of earthquakes in near-real time. The system integrates and inserts parametric and waveform seismic data into discrete events in a database for analysis. Hydra computes seismic event parameters, including locations, multiple magnitudes, moment tensors, and depth estimates. Hydra supports the NEIC’s 24/7 analyst staff with a suite of seismic analysis graphical user interfaces.In addition to the NEIC’s monitoring needs, the system supports the processing of aftershock and temporary deployment data, and supports the NEIC’s quality assurance procedures. The Hydra system continues to be developed to expand its seismic analysis and monitoring capabilities.

  20. 247 - 250_Tijjani_saponins

    African Journals Online (AJOL)

    pc

    and ground into powder using a porcelain pestle. It was then sealed in a polyethene stored in a dessicator prior to evaluation. Extraction of saponins. The powdered stem-bark (1kg) of the plant exhaustively extracted using petroleum spirit in a Soxhlet extractor. This was to remove the l and other pigments available in the ...

  1. Automated absolute activation analysis with californium-252 sources

    Energy Technology Data Exchange (ETDEWEB)

    MacMurdo, K.W.; Bowman, W.W.

    1978-09-01

    A 100-mg /sup 252/Cf neutron activation analysis facility is used routinely at the Savannah River Laboratory for multielement analysis of many solid and liquid samples. An absolute analysis technique converts counting data directly to elemental concentration without the use of classical comparative standards and flux monitors. With the totally automated pneumatic sample transfer system, cyclic irradiation-decay-count regimes can be pre-selected for up to 40 samples, and samples can be analyzed with the facility unattended. An automatic data control system starts and stops a high-resolution gamma-ray spectrometer and/or a delayed-neutron detector; the system also stores data and controls output modes. Gamma ray data are reduced by three main programs in the IBM 360/195 computer: the 4096-channel spectrum and pertinent experimental timing, counting, and sample data are stored on magnetic tape; the spectrum is then reduced to a list of significant photopeak energies, integrated areas, and their associated statistical errors; and the third program assigns gamma ray photopeaks to the appropriate neutron activation product(s) by comparing photopeak energies to tabulated gamma ray energies. Photopeak areas are then converted to elemental concentration by using experimental timing and sample data, calculated elemental neutron capture rates, absolute detector efficiencies, and absolute spectroscopic decay data. Calculational procedures have been developed so that fissile material can be analyzed by cyclic neutron activation and delayed-neutron counting procedures. These calculations are based on a 6 half-life group model of delayed neutron emission; calculations include corrections for delayed neutron interference from /sup 17/O. Detection sensitivities of < or = 400 ppB for natural uranium and 8 ppB (< or = 0.5 (nCi/g)) for /sup 239/Pu were demonstrated with 15-g samples at a throughput of up to 140 per day. Over 40 elements can be detected at the sub-ppM level.

  2. Metastable charge-transfer state of californium(iii) compounds.

    Science.gov (United States)

    Liu, Guokui; Cary, Samantha K; Albrecht-Schmitt, Thomas E

    2015-06-28

    Among a series of anomalous physical and chemical properties of Cf(iii) compounds revealed by recent investigations, the present work addresses the characteristics of the optical spectra of An(HDPA)3·H2O (An = Am, Cm, and Cf), especially the broadband photoluminescence from Cf(HDPA)3·H2O induced by ligand-to-metal charge transfer (CT). As a result of strong ion-ligand interactions and the relative ease of reducing Cf(iii) to Cf(ii), a CT transition occurs at low energy (transfer state undergoes radiative and non-radiative relaxations. Broadening of the CT transition arises from strong vibronic coupling and hole-charge interactions in the valence band. The non-radiative relaxation of the metastable CT state results from a competition between phonon-relaxation and thermal tunneling that populates the excited states of Cf(iii).

  3. Biological, chemical and other data collected aboard the THOMAS G. THOMPSON during cruise TN247 in the Coastal Waters of SE Alaska, North Pacific Ocean and South Pacific Ocean from 2010-03-11 to 2010-04-27 (NODC Accession 0104408)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NODC accession 0104408 includes biological, chemical, optical, physical and underway data collected aboard the THOMAS G. THOMPSON during cruise TN247 in the Coastal...

  4. A 1550-nm all-optical VCSEL-to-VCSEL wavelength conversion of a 8.5-Gb/s data signal and transmission over a 24.7-km fibre

    Science.gov (United States)

    Boiyo, D. Kiboi; Isoe, G. M.; Gamatham, R. R. G.; Leitch, A. W. R.; Gibbon, T. B.

    2016-02-01

    For the first time, we demonstrate, VCSEL-to-VCSEL wavelength conversion within the low attenuation 1550 nm window, including transmission over fibre and bit error rate (BER) performance characterization. We experimentally demonstrate a low injection power optical wavelength conversion by injecting an optical beam from a signal carrier master vertical cavity surface-emitting laser (VCSEL) into the side-mode of the slave VCSEL. This technique solves the challenge of wavelength collisions and also provides wavelength re-use in typical wavelength division multiplexed (WDM) systems. This paper, for the first time, uses two 1550 nm VCSELs with tunability range of 3 nm for a 5-9.8 mA bias current. The master VCSEL is modulated with a non-return-to-zero (NRZ) pseudo-random binary sequence (PRBS_27-1) 8.5 Gb/s data. A data conversion penalty of 1.1 dB is realized when a 15 dBm injection beam is used. The transmission performance of the converted wavelength from the slave VCSEL is evaluated using BER measurement at a 10-9 threshold. A 0.5 dB transmission penalty of the converted wavelength data is realized in an 8.5 Gb/s transmission over 24.7 km. This work is vital for optical fibre systems that may require wavelength switching for transmission of data signals.

  5. 32 CFR 247.3 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... availability of command, installation, or community services; local geography; historical background; and other...; morale, welfare, and recreation news and announcements; photography; line art; and installation and local..., for a specified time, the Government may elect to acquire additional supplies or services called for...

  6. 40 CFR 247.12 - Construction products.

    Science.gov (United States)

    2010-07-01

    ... Construction products. (a) Building insulation products, including the following items: (1) Loose-fill insulation, including but not limited to cellulose fiber, mineral fibers (fiberglass and rock wool... (fiberglass and rock wool); (3) Board (sheathing, roof decking, wall panel) insulation, including but not...

  7. 40 CFR 247.3 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... expanded perlite and fibers formed into rigid, flat, rectangular units with a suitable sizing material... catalyst to produce a polyisocyanurate chemical structure; Polystyrene insulation means an organic foam...

  8. 40 CFR 247.15 - Landscaping products.

    Science.gov (United States)

    2010-07-01

    ... hydroseeding and as an over-spray for straw mulch in landscaping, erosion control, and soil reclamation. (b) Compost made from recovered organic materials. (c) Garden and soaker hoses containing recovered plastic or rubber. (d) Lawn and garden edging containing recovered plastic or rubber. (e) Plastic lumber landscaping...

  9. Publications | Page 247 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    This paper presents a summary of the progress in financial inclusion in Conditional cash transfer programs (CCTPS) in Latin America and the Caribbean (LAC), the supply of financial services in CCTPS, and assessments of the process of inclusion in the formal banking and financial systems. Some... Feasibility study report ...

  10. 40 CFR 247.17 - Miscellaneous products.

    Science.gov (United States)

    2010-07-01

    ... Miscellaneous products. (a) Pallets containing recovered wood, plastic, or paperboard. (b) Sorbents containing... containing recovered steel, plastic, or paper. (d) Awards and plaques containing recovered glass, wood, paper...

  11. May 2003 EAST AFRICAN MEDICAL JOURNAL 247

    African Journals Online (AJOL)

    2003-05-01

    May 1, 2003 ... known as Shifara or Shalchaa'a in Ethiopia. Moringa stenopetala is widely cultivated in Southern Ethiopia especially in Gamu~Gofa, Sidama, Konso and the adjoining provinces. ... mature seeds of the Morigaceae family are used as foodstuff and ... Flours obtained from the raw and cooked M. stenopetala ...

  12. 32 CFR 247.6 - Procedures.

    Science.gov (United States)

    2010-07-01

    ... the missions of the Department of Defense. (4) DoD editors of publications covered under this part... as letters to the editor columns. This alerts the commander to the emotional status and state of DoD... authorizing their representatives to negotiate a contract with a CE publisher. (3) DoD newspapers are mission...

  13. 7 CFR 247.21 - Caseload assignment.

    Science.gov (United States)

    2010-01-01

    ..., infants, and children, and the elderly. Requests by State agencies to increase service to women, infants, and children receive priority over requests to increase service to the elderly. Eligibility for and... participation of women, infants, and children, and the elderly in the State, in the previous fiscal year; (B...

  14. 7 CFR 247.1 - Definitions.

    Science.gov (United States)

    2010-01-01

    .... Certification means the use of procedures to determine an applicant's eligibility for the program. Certification... definitions that apply to the Commodity Supplemental Food Program (CSFP). Applicant means any person who.... Breastfeeding women means women up to one year postpartum who are breastfeeding their infants. Caseload means...

  15. Reference: 247 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available ssociated with suppression of FHL expression in fhy1-3 cannot be accounted for by a critical role for FHY1-F... abundances of FHY1 and FHL in WT plants account for the differences in the severity of fhy1 and fhl mutatio

  16. Publications | Page 247 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    IDRC works with developing-country researchers and institutions to build local capacity through funding, knowledge sharing, and training. Through books, articles, research publications, and studies, we aim to widen the impact of our investment and advance development research. We share the results of our funded ...

  17. 32 CFR 247.4 - Policy.

    Science.gov (United States)

    2010-07-01

    ... with (DoD Component or subordinate level).” (2) “The appearance of advertising in this publication... products or services advertised.” (3) “Everything advertised in this publication shall be made available for purchase, use, or patronage without regard to race, color, religion, sex, national origin, age...

  18. Safety and Efficacy of Single-Stage versus 2-Stage Spinal Fusion via Posterior Instrumentation and Anterior Thoracoscopy: A Retrospective Matched-Pair Cohort Study with 247 Consecutive Patients.

    Science.gov (United States)

    Viezens, Lennart; Reer, Phillip; Strahl, Andre; Weiser, Lukas; Schroeder, Malte; Beyerlein, Joerg; Schaefer, Christian

    2018-01-01

    Posterior-anterior spondylodesis is often used to stabilize the spine in various pathologies. The anterior procedure is often performed via thoracoscopy. It is unclear whether the anterior procedure should be performed immediately after posterior instrumentation or after the patient has convalesced. This retrospective study compared perioperative safety and morbidity in 1-stage versus 2-stage posterior-anterior fusion surgery with a thoracoscopic anterior approach. All consecutive patients who underwent surgery for posterior-anterior spinal stabilization from 2006 to 2013 were included. American Society of Anesthesiologists score, preoperative and postoperative laboratory values, operation duration, blood loss, intensive care unit stay, pain, postoperative hospital stay, perioperative complications, and preoperative and postoperative Eastern Cooperative Oncology Group and Frankel scores were assessed. A subset of the cohort was selected by propensity score matching to eliminate possible selection bias. There were 247 patients who underwent 1-stage (n = 104) or 2-stage (n = 143) stabilization with thoracoscopic fusion. Spinal pathologies were fracture, malignancy, pyogenic spondylodiscitis, degenerative spinal disorders, and failed previous surgery. One-stage and 2-stage procedures were similar in terms of preoperative, surgical, and postoperative variables, including complication rates, except that the 1-stage procedure was associated with greater pain 2 days after surgery and shorter hospital stay. The propensity score-matched cohort of 64 pairs yielded similar results with only 1-stage patients showing elevated visual analog scale score on postoperative day 2 (3.8 vs. 2.4, P = 0.043). One-stage stabilization was as safe as 2-stage stabilization and associated with shorter hospitalization. Greater pain after the 1-stage procedure, which resolved 30 days after surgery, reflects the fact that 2-stage patients already had pain relief when they underwent

  19. Neutron Protection Factor Determination and Validation for a Vehicle Surrogate Using a Californium Fission Source

    Science.gov (United States)

    2017-06-01

    a 4 mm x 4 mm (0.157" x 0.157") LiI(Eu) crystal with 96% enrichment of lithium -6. The crystal is connected to a photomultiplier tube (PMT) which...32 Figure 17. Lithium -6 Iodide, Europium Doped Scintillation Detector. Source: [27...Alamos National Laboratory LiI(Eu) Lithium Iodide Europium Doped LLD Low Level Discriminator LLNL Lawrence Livermore National Laboratory MASH Monte

  20. 48 CFR 247.301-71 - Evaluation factor or subfactor.

    Science.gov (United States)

    2010-10-01

    ... suppliers, third-party logistics providers, and integrated logistics managers that commit to using carriers... REGULATIONS SYSTEM, DEPARTMENT OF DEFENSE CONTRACT MANAGEMENT TRANSPORTATION Transportation in Supply...

  1. Dicty_cDB: SFG247 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available sl56c07.y1 Gm-c1027 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1027-5317 5' similar to TR:Q9ZS06...st59b09.y1 Gm-c1053 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1053-857 5' similar to TR:Q9ZS06...saj01e10.y1 Gm-c1065 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1065-9068 5' similar to TR:Q9ZS06...sc57c05.y1 Gm-c1016 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1016-513 5' similar to TR:O13792

  2. Dicty_cDB: VHD247 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available iens, clone IMAGE:5139212, mRNA, partial cds. 40 0.32 2 DQ030683 |DQ030683.1 Homo sapiens HC440 gene, VIRT...UAL TRANSCRIPT, partial sequence, genomic survey sequence. 40 0.48 2 BC104994 |BC10

  3. 7 CFR 2.47 - Administrator, Rural Utilities Service.

    Science.gov (United States)

    2010-01-01

    ... and safety standards and wage and labor standards applicable to covered work; and emergency... of exposure to significant risk to human health; (iv) Section 104(j) of the Act (42 U.S.C. 9604(j...) Clean Air Act, as amended (42 U.S.C. 7401 et seq.); (v) Noise Control Act of 1972, as amended (42 U.S.C...

  4. Dicty_cDB: VFJ247 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available PERKYSVWIGSILASLSTFQQIGFQKKNMRIXSIN Translated Amino Acid sequence (All Frames) Frame A: *iwffldn*ncirfii*cr...ERKYSVWIGSILASLSTFQQIGFQKKNMRIXSIN Frame C: nlvffr*lkly*vynimsivsinkyinafkpntqmcikllcryg*nileln*mvqlcvkl vll

  5. 14 CFR 135.247 - Pilot qualifications: Recent experience.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Pilot qualifications: Recent experience... TRANSPORTATION (CONTINUED) AIR CARRIERS AND OPERATORS FOR COMPENSATION OR HIRE: CERTIFICATION AND OPERATIONS OPERATING REQUIREMENTS: COMMUTER AND ON DEMAND OPERATIONS AND RULES GOVERNING PERSONS ON BOARD SUCH AIRCRAFT...

  6. 247 REVIEW ARTICLE BOOK TITLE: ORAL TRADITION AS ...

    African Journals Online (AJOL)

    Department of History and International Relations, ... African historical reconstruction in particular has been made popular by this brilliant study to the .... Tradition in memory are only distinguished from other more recent information by the conviction that they stemmed from previous generations, just as memory itself is only ...

  7. Maintaining Mission Critical Systems in a 247 Environment

    CERN Document Server

    Curtis, Peter M

    2011-01-01

    "This book is meant to offer Architects, Property Mangers, Facility Managers, Building Engineers, Information Technology Professionals, Data Center Personnel, Electrical & Mechanical Technicians and students in undergraduate, graduate, or continuing education programs relevant insight into the Mission Critical Environment with an emphasis on business resiliency, data center efficiency, and green power technology. Industry improvements, standards, and techniques have been incorporated into the text and address the latest issues prevalent in the Mission Critical Industry. An emphasis on green technologies and certifications is presented throughout the book. In addition, a description of the United States energy infrastructure's dependency on oil, in relation to energy security in the mission critical industry, is discussed. In conjunction with this, either a new chapter will be created on updated policies and regulations specifically related to the mission critical industry or updates to policies and regula...

  8. Case 247: Jersey Finger of the Fifth Finger.

    Science.gov (United States)

    Créteur, Viviane Marie; Durieux, Pierre François; Cuylits, Nicolas

    2017-11-01

    History A 34-year-old man without underlying medical conditions came to the emergency department for evaluation of persistent pain over the volar portion of his right fifth finger after a fall during a football match 3 days before. At physical examination, the injured finger was swollen and purple. Passive and active flexion of the proximal and distal interphalangeal joints were compromised, without interphalangeal instability. Radiography was performed in the emergency department, and the patient was released with a diagnosis of a fifth digit sprain. After the senior radiologist (V.M.C.) reviewed the radiographs, the patient was called back for assessment with ultrasonography (US) on the same day. US was performed with an Aplio 500 unit (Toshiba Medical Systems, Tokyo, Japan) using a multifrequency linear array 7.2-18.0-MHz PLT-1204BX transducer focused at the level of the flexor tendon. The patient was sitting in front of the examiner, with the hand lying palm up on the examination bed. No abnormality was observed during color Doppler US.

  9. 247 Educational Policy and Technological Development in Africa ...

    African Journals Online (AJOL)

    User

    world and domesticate his environment. With this knowledge and control, man was to derive maximum comfort in terms of his needs and living condition. However, in Nigeria, these noble objectives of science and technology are yet to be achieved. This is because the colonial masters did not lay a solid foundation for the ...

  10. Tutorial: Delivering Information to Students 24/7 with Camtasia

    Directory of Open Access Journals (Sweden)

    Kathleen Carlson

    2009-09-01

    Full Text Available This article examines the selection process for and use of Camtasia Studio software, a screen video capture program created by TechSmith. The Camtasia Studio software allows the author to create streaming videos which gives students 24 hour access on any topics including how to order books through interlibrary loan.

  11. Phenotype-gene: 247 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available during process named senescence in environment of continuous dark (no light) regimen for AT2G43400 Ishizaki...ontinuous dark (no light) regimen http://metadb.riken.jp/db/SciNetS_ria224i/cria224u1ria224u746i AT2G43400

  12. Dicty_cDB: SHI247 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ls, boron exposed, phytoremediation Malus x domestica cDNA clone ABNB001773, mRNA sequence. 78 1e-12 2 CN939...e-13 2 CN914665 |CN914665.1 030110ABNB001773HT (ABNB) Braeburn cultured fruit cel

  13. 32 CFR Appendix B to Part 247 - CE Publications

    Science.gov (United States)

    2010-07-01

    .... Management approach: NARRATIVE DISCUSSION: 1 (1 Discussions of strengths, weaknesses, and deficiencies should... challenges regarding the legality of the selection process.) Strengths Weaknesses Deficiencies Attachment 3... shall be a summary of the individual strengths and weaknesses in each proposal, along with any...

  14. Dicty_cDB: CHA247 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VIFPTAASTDAPCTSLAVLYKDNGEFDQYLYIPNNPDVVLVDPVVMVTAPPRLFSSGVGD ALATYFEARQCFQSFGNNLTNTKPSLI--- ---GIIKPGMVVTFAPAGLSTEVKSV...VIFPTAASTDAPCTSLAVLYKDNGEFDQYLYIPNNPDVVLVDPVVMVTAPPRLFSSGVGD ALATYFEARQCFQSFGNNLTNTKPSLI--- ---GIIKPGMVVTFAPAGLSTEVKSV

  15. 25 CFR 247.18 - What are the sanitation prohibitions?

    Science.gov (United States)

    2010-04-01

    ... the ground. (e) You must not place in or near the river or other water any substance that pollutes or may pollute the water. (f) If dumping stations are not available, you must transport sewage off site. ...

  16. 48 CFR 52.247-60 - Guaranteed Shipping Characteristics.

    Science.gov (United States)

    2010-10-01

    ... characteristics had been accurate. (1) To be completed by the offeror: (i) Type of container: Wood Box __, Fiber... contents__ LBS (vi) Palletized/skidded __ Yes __ No; (vii) Number of containers per pallet/skid __; (viii) Weight of empty pallet bottom/skid and sides__ LBS; (ix) Size of pallet/skid and contents __ LBS Cube...

  17. Dicty_cDB: VHM247 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ryza sativa Japonica Group genomic DNA, chromoso... 48 0.76 1 ( EE263958 ) D07_D07gf4n14_pDNRf_505927 Myzu...s persicae, line G... 48 0.76 1 ( DW014216 ) w7k20_M13F Myzus persicae, tobacco lin...eage, whole... 48 0.76 1 ( DW014077 ) w7d4_M13F Myzus persicae, tobacco lineage, whole ... 48 0.76 1 ( DT970

  18. Dicty_cDB: SSJ247 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available vhrd lkpenlllnlkktiwkllllilvlvkllakll*CKLPCGTPSYVAPEVLNATGYDREVDM WSIGVITYILLCGFPPFYGDTVPEIFEQIMEANY...vhrd lkpenlllnlkktiwkllllilvlvkllakll*CKLPCGTPSYVAPEVLNATGYDREVDM WSIGVITYILLCGFPPFYGDTVPEIFEQIMEANY

  19. 8 CFR 247.12 - Disposition of case.

    Science.gov (United States)

    2010-01-01

    ... retain his status as an immigrant and files with the district director Form I-508 and, if applicable, Form I-508F, the alien's immigrant status be adjusted to that of a nonimmigrant. The alien shall be informed of such decision and of the reasons therefor, and of his right to appeal in accordance with the...

  20. Dicty_cDB: SFJ247 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AAAGCCAAGATCCAAGATAAAGAA GGTATTCCACCAGATCAACAAAGATTAATCT sequence update 2001. 6. 1 Translated Amino Acid sequence ---m*xqxpxxxrf...kinxcr*tir rwsysf*lqyskrihspfsfkikrwyanlc*nshw*nnhfrs*rf**h*kc*sqdpr*rr ystrstkin Frame B: ---m*xqxpxxxrfppd

  1. 48 CFR 52.247-51 - Evaluation of Export Offers.

    Science.gov (United States)

    2010-10-01

    ... available sailings on U.S.-flag vessels, and other pertinent transportation factors, it determines that use... scheduled in this provision for delivery during the ice-free or navigable period as proclaimed by the...

  2. 48 CFR 452.247-72 - Packing for Domestic Shipment.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Packing for Domestic... Packing for Domestic Shipment. As prescribed in 447.305-10(b), insert the following clause: Packing for Domestic Shipment (FEB 1988) Material shall be packed for shipment in such a manner that will insure...

  3. Dicty_cDB: VHE247 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available |DY889811.1 CeleSEQ6761 Cunninghamella elegans pBluescript (EcoRI-XhoI) Cunninghamella elegans cDNA clone...|DY889772.1 CeleSEQ11980 Cunninghamella elegans pBluescript (EcoRI-XhoI) Cunninghamella elegans cDNA clone...|DY890935.1 CeleSEQ7425 Cunninghamella elegans pBluescript (EcoRI-XhoI) Cunninghamella elegans cDNA clone...|DY887441.1 CeleSEQ3766 Cunninghamella elegans pBluescript (EcoRI-XhoI) Cunninghamella elegans cDNA clone...|DY888936.1 CeleSEQ6366 Cunninghamella elegans pBluescript (EcoRI-XhoI) Cunninghamella elegans cDNA clone

  4. Teaching Children Thinking. Artificial Intelligence Memo Number 247.

    Science.gov (United States)

    Papert, Seymour

    It is possible to maintain a vision of a technologically oriented educational system which is grander than the current one in which new gadgets are used to teach the old material in a thinly disguised old way. Educational innovation, particularly when computers are included, can find better things for children to do and better ways for the child…

  5. 48 CFR 52.247-7 - Freight Excluded.

    Science.gov (United States)

    2010-10-01

    ... package carrier; shipments of unusual value, explosives and other dangerous articles, household goods... contracts for transportation or for transportation-related services when any commodities or types of...

  6. 247-IJBCS-Article-Chukwunjindu M A Iwegbue

    African Journals Online (AJOL)

    DR GATSING

    the safety of food. Heavy metals are one of a range of important type of contaminants that can be found on the surface and in the tissue of fresh vegetables .... µg.kg-1 in Piper nigrum L. The vegetables and spices examined showed elevated metal compared to maximum allowable value of. 0.05 mg.kg-1 in food.

  7. Dicty_cDB: SSF247 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available NLNGIEANINDGKISLSKLNSKIYCFNEMSHSSHDDDFLQLNNFNHHETDLSSNSIKHSK YNFITLFSYLLVXLII*lyylii*iinlkkkkkkkkkkkk Translated...NLNGIEANINDGKISLSKLNSKIYCFNEMSHSSHDDDFLQLNNFNHHETDLSSNSIKHSK YNFITLFSYLLVXLII*lyylii*iinlkkkkkkkkkkkk Homology

  8. Dicty_cDB: SHG247 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Plasmodium falciparum 3D7 cDNA clone from Sugano malaria cDNA library: XPFn3537. 34 0.002 3 dna update 2006...B71609( B71609 )hypothetical protein PFB0680w - malaria parasite (... 40 0.15 AE001362_140( AE001362 |pid:none)

  9. ED 'vending machine' sells patient meds 24/7.

    Science.gov (United States)

    2008-05-01

    A vending machine stocked with your most commonly used drugs can be a relatively inexpensive investment in patient and staff satisfaction. Rice Memorial Hospital in Willmar, MN, has installed such a machine, which includes several safeguards: * It has several internal cameras, serving as backup systems to ensure the proper drug is being dispensed to the proper patient. * The machine cannot be accessed by anyone unless they have received a magnetic swipe card from the prescribing physician. * The code is only given to a physician authorized to enter the web portal of the prescription vendor.

  10. Exon 3-deleted/full-length growth hormone receptor polymorphism genotype frequencies in Spanish short small-for-gestational-age (SGA) children and adolescents (n = 247) and in an adult control population (n = 289) show increased fl/fl in short SGA.

    Science.gov (United States)

    Audí, Laura; Esteban, Cristina; Carrascosa, Antonio; Espadero, Rosa; Pérez-Arroyo, Annalisa; Arjona, Rosa; Clemente, María; Wollmann, Hartmut; Fryklund, Linda; Parodi, Luis A

    2006-12-01

    A polymorphism in the human GH receptor gene (d3/fl-GHR) resulting in genomic deletion of exon 3 has been associated with the degree of height increase in response to GH therapy. The objective of the study was to evaluate the frequencies of d3/fl-GHR polymorphism genotypes in control and short small-for-gestational-age (SGA) populations. An adult control population with heights normally distributed (ACPNH) between -2 and +2 sd score (SDS) and a short non-GH-deficient SGA child population were selected. Thirty Spanish hospitals participated in the selection of the short non-GH-deficient SGA children in the setting of a controlled, randomized trial, and one of these hospitals selected the ACPNH. CONTROLS AND PATIENTS: Two hundred eighty-nine adult subjects of both sexes constituted the ACPNH and 247 children and adolescents of both sexes the short SGA patients. Heights and weights were recorded in the ACPNH, and auxologic and biochemical data were recorded at each hospital for the SGA patients; d3/fl-GHR genotypes were determined and data analyzed in a single hospital. In short SGA patients, d3/fl-GHR genotype frequencies were significantly different from those in ACPNH, with a higher frequency of fl/fl genotype (P or=-2 SDS, n = 60). Our data showed significant differences in the frequency distribution of the d3/fl-GHR genotypes between a normally distributed adult height population and short SGA children, with the biologically less active fl/fl genotype being almost twice as frequent in SGA patients. These data suggest that the d3/fl-GHR polymorphism might be considered among the factors that contribute to the phenotypic expression of growth.

  11. A retrospective study of californium-252 neutron brachytherapy combined with EBRT versus 3D-CRT in the treatment of esophageal squamous cell cancer.

    Science.gov (United States)

    Wang, Qifeng; Li, Tao; Lang, Jinyi; Wang, Jie; Wang, Jian; Liu, Huiming; Jia, Xitang; Liu, Bo; Wang, C-K Chris

    2015-10-24

    We conducted a retrospective analysis on 884 patients who were diagnosed with esophageal squamous cell carcinoma (ESCC) and treated with either the neutron brachytherapy in combination with external beam radiotherapy (NBT + EBRT) or 3-dimensional conformal radiation therapy (3D-CRT) to determine the differences in efficacy and morbidity between the two treatment groups. The 884 ESCC patients treated with either NBT + EBRT or 3D-CRT between 2002 and 2012 were retrospectively reviewed and analyzed. Multivariable Cox regression was used to compare oncologic outcomes of the two groups of patients in the context of other clinically relevant variables. The acute and chronic toxicities associated with the two groups were compared using Fisher exact and log-rank tests, respectively. Among the 884 patients, 545 received NBT + EBRT and 339 received 3D-CRT (i.e. EBRT-only). The age range is 39-95 years (median 66). The follow-up time range is 3-145 months (median 32). The analysis shows that the NBT + EBRT group has higher overall survival rate and local control rate than that of the 3D-CRT group. The acute toxicity effects were acceptable for both groups of patients with the NBT + EBRT group showing higher rates of leukopenia and thrombocytopenia and the 3D-CRT group showing higher rates on fistula and massive bleeding. The patients treated with NBT + EBRT showed better oncologic outcomes than those treated with 3D-CRT. The toxicity effects were acceptable for both groups with the NBT + EBRT group showing higher rates on the acute effects and the 3D-CRT group showing higher rates on the late effects.

  12. Accurate determination of Curium and Californium isotopic ratios by inductively coupled plasma quadrupole mass spectrometry (ICP-QMS) in 248Cm samples for transmutation studies

    Energy Technology Data Exchange (ETDEWEB)

    Gourgiotis, A.; Isnard, H.; Aubert, M.; Dupont, E.; AlMahamid, I.; Cassette, P.; Panebianco, S.; Letourneau, A.; Chartier, F.; Tian, G.; Rao, L.; Lukens, W.

    2011-02-01

    The French Atomic Energy Commission has carried out several experiments including the mini-INCA (INcineration of Actinides) project for the study of minor-actinide transmutation processes in high intensity thermal neutron fluxes, in view of proposing solutions to reduce the radiotoxicity of long-lived nuclear wastes. In this context, a Cm sample enriched in {sup 248}Cm ({approx}97 %) was irradiated in thermal neutron flux at the High Flux Reactor (HFR) of the Laue-Langevin Institute (ILL). This work describes a quadrupole ICP-MS (ICP-QMS) analytical procedure for precise and accurate isotopic composition determination of Cm before sample irradiation and of Cm and Cf after sample irradiation. The factors that affect the accuracy and reproducibility of isotopic ratio measurements by ICP-QMS, such as peak centre correction, detector dead time, mass bias, abundance sensitivity and hydrides formation, instrumental background, and memory blank were carefully evaluated and corrected. Uncertainties of the isotopic ratios, taking into account internal precision of isotope ratio measurements, peak tailing, and hydrides formations ranged from 0.3% to 1.3%. This uncertainties range is quite acceptable for the nuclear data to be used in transmutation studies.

  13. Radiological Characterization Technical Report on Californium-252 Sealed Source Transuranic Debris Waste for the Off-Site Source Recovery Project at Los Alamos National Laboratory

    Energy Technology Data Exchange (ETDEWEB)

    Feldman, Alexander [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2014-04-24

    This document describes the development and approach for the radiological characterization of Cf-252 sealed sources for shipment to the Waste Isolation Pilot Plant. The report combines information on the nuclear material content of each individual source (mass or activity and date of manufacture) with information and data on the radionuclide distributions within the originating nuclear material. This approach allows for complete and accurate characterization of the waste container without the need to take additional measurements. The radionuclide uncertainties, developed from acceptable knowledge (AK) information regarding the source material, are applied to the summed activities in the drum. The AK information used in the characterization of Cf-252 sealed sources has been qualified by the peer review process, which has been reviewed and accepted by the Environmental Protection Agency.

  14. 27 CFR 24.247 - Materials authorized for the treatment of distilling material.

    Science.gov (United States)

    2010-04-01

    ... Aspergillus oryzae per FDA advisory opinion dated 8/18/83 or from Rhizopus oryzae per 21 CFR 173.130 or from... fermentable carbohydrates The amylase enzyme activity shall be derived from Aspergillus niger, Aspergillus oryzae, Bacillus subtilis, or barley malt per FDA advisory opinion of 8/18/83 or from Rhizopus oryzae per...

  15. S. Afr. J. Anim. Sci. I I , 247- 254 ( I 981 ) PRACTICAL ...

    African Journals Online (AJOL)

    J. agric. Sci. Camb.,93,607. CRONJE, K.G., l9l3.Ondersoek na die invloed van verskillende drogingstegnieke op die samestelling van gedroogde groenvoer en kuilvoer. M.Sc. Tesis Universiteit van Stellenbosch-. DANLEY, M.M. & VETTER, R.L., l9l l. Changes in carbohydrate and nitrogen fractionsand digestibilityof orages:.

  16. S. Afr. J. Anim. Sci. I I , 247- 254 ( I 981 ) PRACTICAL ...

    African Journals Online (AJOL)

    through a Wiley mill with a I mm screen and stored in screw cap glass containers before being analyzed. The two-stage technique of Tilley & Terry ( 1963) with slight modifications described by Engels & van der Mer- we ( 1967) was used for the determination of in vitro digestibility. Nitrogen content was determined by means.

  17. 48 CFR 52.247-19 - Stopping in Transit for Partial Unloading.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Stopping in Transit for... origin to two or more consignees along the route between origin and last destination: Stopping in Transit... for movement from one origin to two or more consignees along the route between the origin and the last...

  18. 48 CFR 52.247-13 - Accessorial Services-Moving Contracts.

    Science.gov (United States)

    2010-10-01

    ... the goods. (b) Disassembling and reassembling of property and servicing appliances. The disassembling of property; e.g., beds and sectional bookcases, and the preparing of appliances; e.g., washers, driers, and record players, for shipment shall be performed by the Contractor. The Contractor shall...

  19. 247. Complicaciones durante la experiencia inicial en cirugía robótica

    OpenAIRE

    J.F. Valderrama Marcos; S. González González; L. Rubio Lobato; Cano Nieto, J.; Gutiérrez de Loma, J.; Pérez Villardón, B.; J.M.a Melero Tejedor

    2010-01-01

    La cirugía robótica es un instrumento incorporado a nuestra práctica quirúrgica. Sin embargo, el número de intervenciones no ha sido la esperada en un principio. Analizamos las causas de ello. Objetivo: Exponer las dificultades para la completa implantación de un programa de cirugía robótica en nuestro medio y las complicaciones observadas. Material y método: Durante los primeros 20 meses, 25 pacientes han sido propuestos como candidatos para cirugía con asistencia robótica. La edad med...

  20. Episode: Phaedrus (247c6-8 by Yorgos Kentrotis, translated and introduced by Paschalis Nikolaou

    Directory of Open Access Journals (Sweden)

    Yorgos Kentrotis

    2017-05-01

    Full Text Available Yorgos Kentrotis was born in 1958 in Laconia, the Peloponnese. Following studies in Law at Greek and German universities, he was eventually won over by literature and translation. He is currently Professor in Translation Theory at the Ionian University in Corfu. Since the early 1980s he has steadily produced translations from ancient Greek, Latin, German and Russian–of works by, among others, Plato, Cicero, Robert Musil, Pablo Neruda, Vladimir Mayakovsky and Bertolt Brecht. His essays and monographs on comparative literature, poetics and translation are widely recognized. A first collection of his poems appeared in 2006; Kentrotis has published five collections since. In 2014, he put out a collection of no less than 500 of Brecht’s poems in Greek translation, as well as a selection of epigrams from the Palatine Anthology. A similar edition of Paz’s poetry is forthcoming. Most recently in 2015, he published the long-awaited Greek translation of Giambattista Vico’s (1668–1744 La Scienza Nuova (1725.

  1. 48 CFR 3052.247-70 - F.o.b. origin information.

    Science.gov (United States)

    2010-10-01

    ... the offered shipping point has a private railroad siding, and the name of the rail carrier serving it; (c) When the offered shipping point does not have a private siding, the names and addresses of the nearest public rail siding and of the carrier serving it; and (d) The quantity of supplies to be shipped...

  2. Yeast Interacting Proteins Database: YLR223C, YOR247W [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available YLR223C IFH1 Essential protein with a highly acidic N-terminal domain; IFH1 exhibits genetic interactions...ion Essential protein with a highly acidic N-terminal domain; IFH1 exhibits genetic interactions with FHL1,

  3. 32 CFR Appendix A to Part 247 - Funded Newspapers and Magazines

    Science.gov (United States)

    2010-07-01

    ... funds and manpower may be used for distribution of Funded publications, as required. I. Advertising. Funded publications shall not carry commercial advertising. As a service, the Funded newspaper may carry... Ethics Regulation. In addition, DoD personnel whose spouse or children (or other relatives as described...

  4. Page 1 i Polycrystalline silicon and ZnO ceramic 247 under optical ...

    Indian Academy of Sciences (India)

    barrier at the GB. Following Card and Yang (1977) the minority carrier lifetime in the space charge region of n-type polysilicon denoted as tº is given by where ſpa is the barrier height, d is grain size, o is the capture cross-section, v is the thermal velocity of carrier, Ni, is the interface state density and Er, and Er, are the quasi.

  5. 76 FR 7101 - Airworthiness Directives; Hamilton Sundstrand Propellers Model 247F Propellers

    Science.gov (United States)

    2011-02-09

    ... corrosion pits in the tulip area of the blades. We are issuing this AD to prevent cracks from developing in the tulip area of the blade, which could result in separation of the blade and possible loss of... tulip area of the blades. We are issuing this AD to prevent cracks from developing in the tulip area of...

  6. 247. Complicaciones durante la experiencia inicial en cirugía robótica

    Directory of Open Access Journals (Sweden)

    J.F. Valderrama Marcos

    2010-01-01

    Conclusiones: a El número de pacientes intervenidos es muy escaso para los recursos empleados; b en nuestro medio, no obtuvimos los resultados esperados en los pacientes intervenidos de válvula mitral; c en pacientes coronarios, hemos conseguido un abordaje realmente miniinvasivo, sin complicaciones observadas durante el postoperatorio; d en otra enfermedad como los mixomas y la pericardiectomía, se ha mostrado como una herramienta eficaz, aunque el escaso volumen no permita sacar conclusiones, y e el tiempo transcurrido entre las intervenciones influye negativamente en los resultados.

  7. Flame Retardant: Cyberbullies Torment Their Victims 24/7: Here's How to Stop the Abuse

    Science.gov (United States)

    Willard, Nancy

    2006-01-01

    Cyberbullying is the use of electronic information such as e-mail and other digital age tools to bully or harass individuals. Cyberbullies post angry and vulgar messages in online "flaming" wars or hack into a peer's e-mail account to wreak havoc, assaulting the reputations and already fragile egos of their young victims. The devastating effects…

  8. 48 CFR 52.247-30 - F.o.b. Origin, Contractor's Facility.

    Science.gov (United States)

    2010-10-01

    ... carrier's conveyance; (5) Complete the Government bill of lading supplied by the ordering agency or, when a Government bill of lading is not supplied, prepare a commercial bill of lading or other transportation receipt. The bill of lading shall show— (i) A description of the shipment in terms of the...

  9. 48 CFR 52.247-32 - F.o.b. Origin, Freight Prepaid.

    Science.gov (United States)

    2010-10-01

    ... lading or other transportation receipt. The bill of lading shall show— (i) A description of the shipment... copies of the bill of lading, or other transportation receipts, as directed by the ordering agency; and... annotations requested by the ordering agency for bills of lading; e.g., “This shipment is the property of, and...

  10. 48 CFR 52.247-33 - F.o.b. Origin, With Differentials.

    Science.gov (United States)

    2010-10-01

    ...) Complete the Government bill of lading supplied by the ordering agency or, when a Government bill of lading is not supplied, prepare a commercial bill of lading or other transportation receipt. The bill of... received by carrier; and (6) Distribute the copies of the bill of lading, or other transportation receipts...

  11. 48 CFR 52.247-31 - F.o.b. Origin, Freight Allowed.

    Science.gov (United States)

    2010-10-01

    ... carrier's conveyance; (5) Complete the Government bill of lading supplied by the ordering agency, or when a Government bill of lading is not supplied, prepare a commercial bill of lading or other transportation receipt. The bill of lading shall show— (i) A description of the shipment in terms of the...

  12. 48 CFR 52.247-34 - F.o.b. Destination.

    Science.gov (United States)

    2010-10-01

    ..., prepare the shipment in conformance with carrier requirements; (2) Prepare and distribute commercial bills of lading; (3) Deliver the shipment in good order and condition to the point of delivery specified in the contract; (4) Be responsible for any loss of and/or damage to the goods occurring before receipt...

  13. 48 CFR 52.247-35 - F.o.b. Destination, Within Consignee's Premises.

    Science.gov (United States)

    2010-10-01

    ... shipment in conformance with carrier requirements; (2) Prepare and distribute commercial bills of lading... contract; (4) Be responsible for any loss of and/or damage to the goods occurring before receipt of the...

  14. 48 CFR 52.247-48 - F.o.b. Destination-Evidence of Shipment.

    Science.gov (United States)

    2010-10-01

    ... accomplished by common carrier, a signed copy of the commercial bill of lading for the supplies covered by the... the delivery document showing receipt at the destination specified in the contract. (b) The Contractor...

  15. 48 CFR 52.247-29 - F.o.b. Origin.

    Science.gov (United States)

    2010-10-01

    ... or other transportation receipt. The bill of lading shall show— (i) A description of the shipment in... bill of lading, or other transportation receipts, as directed by the ordering agency. (c) These... on or in the carrier's conveyance; (5) Complete the Government bill of lading supplied by the...

  16. Activities for Studying Megalopolis, Grade Level 4-8. Environmental Education Series, Bulletin No. 247-H.

    Science.gov (United States)

    Montgomery County Public Schools, Rockville, MD.

    This bulletin is one in a series of environmental education activity guides for grades K-12, developed and field-tested by teachers in the Montgomery County (Maryland) Public Schools. Primarily for use in the middle grades four through six, the guides are not intended to constitute complete units in themselves. They are, rather, a compilation of…

  17. Operational Research: Evaluating Multimodel Implementations for 24/7 Runtime Environments

    Science.gov (United States)

    Burkhart, J. F.; Helset, S.; Abdella, Y. S.; Lappegard, G.

    2016-12-01

    We present a new open source framework for operational hydrologic rainfall-runoff modeling. The Statkraft Hydrologic Forecasting Toolbox (Shyft) is unique from existing frameworks in that two primary goals are to provide: i) modern, professionally developed source code, and ii) a platform that is robust and ready for operational deployment. Developed jointly between Statkraft AS and The University of Oslo, the framework is currently in operation in both private and academic environments. The hydrology presently available in the distribution is simple and proven. Shyft provides a platform for distributed hydrologic modeling in a highly efficient manner. In it's current operational deployment at Statkraft, Shyft is used to provide daily 10-day forecasts for critical reservoirs. In a research setting, we have developed a novel implementation of the SNICAR model to assess the impact of aerosol deposition on snow packs. Several well known rainfall-runoff algorithms are available for use, allowing for intercomparing different approaches based on available data and the geographical environment. The well known HBV model is a default option, and other routines with more localized methods handling snow and evapotranspiration, or simplifications of catchment scale processes are included. For the latter, we have implemented the Kirchner response routine. Being developed in Norway, a variety snow-melt routines, including simplified degree day models or more advanced energy balance models, may be selected. Ensemble forecasts, multi-model implementations, and statistical post-processing routines enable a robust toolbox for investigating optimal model configurations in an operational setting. The Shyft core is written in modern templated C++ and has Python wrappers developed for easy access to module sub-routines. The code is developed such that the modules that make up a "method stack" are easy to modify and customize, allowing one to create new methods and test them rapidly. Due to the simple architecture and ease of access to the module routines, we see Shyft as an optimal choice to evaluate new hydrologic routines in an environment requiring robust, professionally developed software and welcome further community participation.

  18. : tous les projets | Page 247 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Sujet: RESEARCH CAPACITY, POLICY MAKING, Climate change, ADAPTATION TO CHANGE, WATER RESOURCES, WATER MANAGEMENT, DISASTER PREPAREDNESS, DISASTER MANAGEMENT, DISASTER PREVENTION. Région: North of Sahara, South ... Date de début : 31 mars 2011. End Date: 29 septembre ...

  19. Workflow continuity--moving beyond business continuity in a multisite 24-7 healthcare organization.

    Science.gov (United States)

    Kolowitz, Brian J; Lauro, Gonzalo Romero; Barkey, Charles; Black, Harry; Light, Karen; Deible, Christopher

    2012-12-01

    As hospitals move towards providing in-house 24 × 7 services, there is an increasing need for information systems to be available around the clock. This study investigates one organization's need for a workflow continuity solution that provides around the clock availability for information systems that do not provide highly available services. The organization investigated is a large multifacility healthcare organization that consists of 20 hospitals and more than 30 imaging centers. A case analysis approach was used to investigate the organization's efforts. The results show an overall reduction in downtimes where radiologists could not continue their normal workflow on the integrated Picture Archiving and Communications System (PACS) solution by 94 % from 2008 to 2011. The impact of unplanned downtimes was reduced by 72 % while the impact of planned downtimes was reduced by 99.66 % over the same period. Additionally more than 98 h of radiologist impact due to a PACS upgrade in 2008 was entirely eliminated in 2011 utilizing the system created by the workflow continuity approach. Workflow continuity differs from high availability and business continuity in its design process and available services. Workflow continuity only ensures that critical workflows are available when the production system is unavailable due to scheduled or unscheduled downtimes. Workflow continuity works in conjunction with business continuity and highly available system designs. The results of this investigation revealed that this approach can add significant value to organizations because impact on users is minimized if not eliminated entirely.

  20. 32 CFR Appendix D to Part 247 - AFIS Print Media Directorate

    Science.gov (United States)

    2010-07-01

    ... for word processing or desktop publishing. All other PMD publications should be requisitioned through... accepted standards of good taste will be maintained. Due to the policy-oriented nature of DEFENSE magazine...

  1. 7 CFR 247.2 - The purpose and scope of CSFP.

    Science.gov (United States)

    2010-01-01

    ... help State and local agencies meet the nutritional needs of low-income pregnant, postpartum, and breastfeeding women, infants under one year of age, children who are at least one year of age but have not... and local agencies. Food packages include such nutritious foods as infant formula and cereal, juices...

  2. Agarwal Vijay K see Varma AK 247 see Varma AK 257 Banse Karl ...

    Indian Academy of Sciences (India)

    R.Narasimhan(krishtel emaging) 1461 1996 Oct 15 13:05:22

    lation Model - An axample from Arabian Sea and equatorial Pacific. 339. Nayak S R see Prasad J S. 189 see Sarangi R K. 237. Neprochnov Yu P see Krishna K S. 17. Nijampurkar V N. Records of climatic changes and volcanic events in an ice core from Central Dronning Maud Land (East. Antarctica) during the past century.

  3. 48 CFR 252.247-7023 - Transportation of supplies by sea.

    Science.gov (United States)

    2010-10-01

    ... contingency operations, exercises, or forces deployed in humanitarian or peacekeeping operations; or (3) Are..., or forces deployed in humanitarian or peacekeeping operations (Note: This contract requires shipment... deployed in humanitarian or peacekeeping operations); or (C) Are commissary or exchange cargoes transported...

  4. S. Aft. J. Anim. Sci., 4, 247-258 (1974) INTENSIFICATION

    African Journals Online (AJOL)

    ovrr fccd cootr both por rnfuul tod por bcctrrc. Thb in- crcrrc in productivity b of ths adsr of 5fi)-7fi)t for thc rnore intcnsiw syrtcmr. Tbo condudoa is jurtified that thc profit potcntial exicb for intcnrificatior of thc ow hrrd sith tlpro im- povcd forrgo systaru. Sincc tho crpital rcqtdrcmcntl h. crctrr, attcntio'rr to mrrgiml rctums and crpial ...

  5. Testing oral proficiency: what does pronunciation tell us?DOI:10.5007/2175-8026.2011n60p247

    Directory of Open Access Journals (Sweden)

    Vanessa Borges-Almeida

    2011-10-01

    Full Text Available In this study we discuss the role of pronunciation in languagetesting and investigate two features of pronunciation of eightcandidates of the Test of Oral Proficiency in English (TEPOLIalong four bands of the test scale. Deviations in vowel segmentsand in syllable structure are analyzed. The results point to theneed for a global assessment of the candidates’ phonologicalsystems.

  6. 17 CFR 247.760 - Exemption from definition of “broker” for banks accepting orders to effect transactions in...

    Science.gov (United States)

    2010-04-01

    ... any Web site, newspaper, magazine or other periodical, radio, television, telephone or tape recording...) Advertise that the bank accepts orders for securities transactions for employee benefit plan accounts or individual retirement accounts or similar accounts, except as part of advertising the other custodial or...

  7. The approach and treatment of a unicystic Ameloblastoma in the jaw - doi:10.5020/18061230.2006.p247

    Directory of Open Access Journals (Sweden)

    Antônio Francisco Durighetto Júnior

    2012-01-01

    Full Text Available Among the complex group of odontogenic tumors, the ameloblastoma points out as the most important and common odontogenic tumor of epithelial origin. It consists mainly of a benign tumor, slow in progress and locally invasive, although it can present high rates of reincidence. The unicystic ameloblastoma is one of the tumor variants and deserves singular consideration for its peculiar characteristics. This study aimed at showing the peculiarities of this ameloblastoma variant through a case report on the care assistance of a young man committed by a jaw tumor, approaching the diagnostic methods used and the applied treatment. Based on present, we conclud that the prognostic for patients with unicystic ameloblastoma is very favorable, since the propaedeutic proceedings are well conducted by the professionals involved.

  8. 78 FR 19413 - Listing of Color Additives Exempt From Certification; Reactive Blue 246 and Reactive Blue 247...

    Science.gov (United States)

    2013-04-01

    ....regulations.gov . 1. Bar n, M., K.-H. Hellwich, M. Hess, K. Horie, et al, ``Glossary of Class Names of.... Memorandum from S. Park, Division of Petition Review, Toxicology Review Team, to M.Harry, Division of...

  9. 48 CFR 52.247-65 - F.o.b. Origin, Prepaid Freight-Small Package Shipments.

    Science.gov (United States)

    2010-10-01

    ... invoice for each shipment made. A copy of the pertinent bill of lading, shipment receipt, or freight bill... do not have a security classification shall move on prepaid commercial bills of lading or other... reasonable freight charges. (b) The Contractor shall annotate the commercial bill of lading as required by...

  10. 78 FR 46315 - Foreign-Trade Zone (FTZ) 247-Erie, Pennsylvania, Notification of Proposed Production Activity, GE...

    Science.gov (United States)

    2013-07-31

    ...; flexible conduits; connectors; elbows; reducers; plastic pipes; O-ring flanges; O-rings; seals; spacers... to: pads; sand fill assemblies; hoses; couplings; arm rest assemblies; sleeves; tube assemblies; pipe...; nozzle rings; motors; lube oil pumps; water pump assemblies; pipes; support assemblies; air foil fans...

  11. Beverage consumption habits “24/7” among British adults: association with total water intake and energy intake

    Science.gov (United States)

    2013-01-01

    Background Various recommendations exist for total water intake (TWI), yet it is seldom reported in dietary surveys. Few studies have examined how real-life consumption patterns, including beverage type, variety and timing relate to TWI and energy intake (EI). Methods We analysed weighed dietary records from the National Diet and Nutrition Survey of 1724 British adults aged 19–64 years (2000/2001) to investigate beverage consumption patterns over 24 hrs and 7 days and associations with TWI and EI. TWI was calculated from the nutrient composition of each item of food and drink and compared with reference values. Results Mean TWI was 2.53 L (SD 0.86) for men and 2.03 L (SD 0.71) for women, close to the European Food Safety Authority “adequate Intake” (AI) of 2.5 L and 2 L, respectively. However, for 33% of men and 23% of women TWI was below AI and TWI:EI ratio was Beverages accounted for 75% of TWI. Beverage variety was correlated with TWI (r 0.34) and more weakly with EI (r 0.16). Beverage consumption peaked at 0800 hrs (mainly hot beverages/ milk) and 2100 hrs (mainly alcohol). Total beverage consumption was higher at weekends, especially among men. Overall, beverages supplied 16% of EI (men 17%, women 14%), alcoholic drinks contributed 9% (men) and 5% (women), milk 5-6%, caloric soft drinks 2%, and fruit juice 1%. In multi-variable regression (adjusted for sex, age, body weight, smoking, dieting, activity level and mis-reporting), replacing 100 g of caloric beverages (milk, fruit juice, caloric soft drinks and alcohol) with 100 g non-caloric drinks (diet soft drinks, hot beverages and water) was associated with a reduction in EI of 15 kcal, or 34 kcal if food energy were unchanged. Using within-person data (deviations from 7-day mean) each 100 g change in caloric beverages was associated with 29 kcal change in EI or 35 kcal if food energy were constant. By comparison the calculated energy content of caloric drinks consumed was 47 kcal/100 g. Conclusions TWI and beverage consumption are closely related, and some individuals appeared to have low TWI. Energy from beverages may be partly compensated. A better understanding of interactions between drinking and eating habits and their impact on water and energy balance would give a firmer basis to dietary recommendations. PMID:23305461

  12. 40 CFR 174.524 - Glyphosate Oxidoreductase GOX or GOXv247 in all plants; exemption from the requirement of a...

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 23 2010-07-01 2010-07-01 false Glyphosate Oxidoreductase GOX or... of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) PESTICIDE PROGRAMS PROCEDURES AND REQUIREMENTS FOR PLANT-INCORPORATED PROTECTANTS Tolerances and Tolerance Exemptions § 174.524 Glyphosate...

  13. Teaching and Learning 24/7 Using Twitter in a University Classroom: Experiences from a Developing Country

    Science.gov (United States)

    Chawinga, Winner Dominic

    2016-01-01

    It is understood that microblogging (tweeting) which is a form of Web 2.0, has been a centre of attraction in some institutions of higher education. However, despite its hype and pomp as reported by some scholars in developed countries, integration of Twitter in a classroom environment in developing countries is just beginning to flourish. In…

  14. Beverage consumption habits “24/7” among British adults: association with total water intake and energy intake

    Directory of Open Access Journals (Sweden)

    Gibson Sigrid

    2013-01-01

    Full Text Available Abstract Background Various recommendations exist for total water intake (TWI, yet it is seldom reported in dietary surveys. Few studies have examined how real-life consumption patterns, including beverage type, variety and timing relate to TWI and energy intake (EI. Methods We analysed weighed dietary records from the National Diet and Nutrition Survey of 1724 British adults aged 19–64 years (2000/2001 to investigate beverage consumption patterns over 24 hrs and 7 days and associations with TWI and EI. TWI was calculated from the nutrient composition of each item of food and drink and compared with reference values. Results Mean TWI was 2.53 L (SD 0.86 for men and 2.03 L (SD 0.71 for women, close to the European Food Safety Authority “adequate Intake” (AI of 2.5 L and 2 L, respectively. However, for 33% of men and 23% of women TWI was below AI and TWI:EI ratio was In multi-variable regression (adjusted for sex, age, body weight, smoking, dieting, activity level and mis-reporting, replacing 100 g of caloric beverages (milk, fruit juice, caloric soft drinks and alcohol with 100 g non-caloric drinks (diet soft drinks, hot beverages and water was associated with a reduction in EI of 15 kcal, or 34 kcal if food energy were unchanged. Using within-person data (deviations from 7-day mean each 100 g change in caloric beverages was associated with 29 kcal change in EI or 35 kcal if food energy were constant. By comparison the calculated energy content of caloric drinks consumed was 47 kcal/100 g. Conclusions TWI and beverage consumption are closely related, and some individuals appeared to have low TWI. Compensation for energy from beverages may occur but is partial. A better understanding of interactions between drinking and eating habits and their impact on water and energy balance would give a firmer basis to dietary recommendations.

  15. Beverage consumption habits "24/7" among British adults: association with total water intake and energy intake.

    Science.gov (United States)

    Gibson, Sigrid; Shirreffs, Susan M

    2013-01-10

    Various recommendations exist for total water intake (TWI), yet it is seldom reported in dietary surveys. Few studies have examined how real-life consumption patterns, including beverage type, variety and timing relate to TWI and energy intake (EI). We analysed weighed dietary records from the National Diet and Nutrition Survey of 1724 British adults aged 19-64 years (2000/2001) to investigate beverage consumption patterns over 24 hrs and 7 days and associations with TWI and EI. TWI was calculated from the nutrient composition of each item of food and drink and compared with reference values. Mean TWI was 2.53 L (SD 0.86) for men and 2.03 L (SD 0.71) for women, close to the European Food Safety Authority "adequate Intake" (AI) of 2.5 L and 2 L, respectively. However, for 33% of men and 23% of women TWI was below AI and TWI:EI ratio was milk) and 2100 hrs (mainly alcohol). Total beverage consumption was higher at weekends, especially among men. Overall, beverages supplied 16% of EI (men 17%, women 14%), alcoholic drinks contributed 9% (men) and 5% (women), milk 5-6%, caloric soft drinks 2%, and fruit juice 1%.In multi-variable regression (adjusted for sex, age, body weight, smoking, dieting, activity level and mis-reporting), replacing 100 g of caloric beverages (milk, fruit juice, caloric soft drinks and alcohol) with 100 g non-caloric drinks (diet soft drinks, hot beverages and water) was associated with a reduction in EI of 15 kcal, or 34 kcal if food energy were unchanged. Using within-person data (deviations from 7-day mean) each 100 g change in caloric beverages was associated with 29 kcal change in EI or 35 kcal if food energy were constant. By comparison the calculated energy content of caloric drinks consumed was 47 kcal/100 g. TWI and beverage consumption are closely related, and some individuals appeared to have low TWI. Compensation for energy from beverages may occur but is partial. A better understanding of interactions between drinking and eating habits and their impact on water and energy balance would give a firmer basis to dietary recommendations.

  16. Book Buzz: Online 24/7: Virutal Reading Clubs and What We've Learned About Them

    Directory of Open Access Journals (Sweden)

    Catherine AuYeung

    2007-09-01

    Full Text Available This presentation, originally given at the Ontario Library Association 2007 SuperConference, was based on our experience at Toronto Public Library in developing the online book club site, Book Buzz. We have described our actual experience and what we have learned from it that may be useful for other start-ups. The presentation has been adapted here for a reading audience.Taking part in the presentation were a manager, an electronic services specialist, and a moderator - all librarians. We covered the project’s planning stages, the design phase, and, lastly, what is involved in the day-to-day running of the book club.

  17. Development of Abrasion-Resistant Coating for Solar Reflective Films. Cooperative Research and Development Final Report, CRADA Number CRD-07-247

    Energy Technology Data Exchange (ETDEWEB)

    Gray, Matthew [National Renewable Energy Lab. (NREL), Golden, CO (United States)

    2015-10-01

    The purpose of this CRADA is to develop an abrasion-resistant coating, suitable for use on polymeric-based reflective films (e.g., the ReflecTech reflective film), that allows for improved scratch resistance and enables the use of aggressive cleaning techniques (e.g., direct contact methods like brushing) without damaging the specular reflectance properties of the reflective film.

  18. (2012 30 Windsor Y B Access Just 247 SO LONG AS YOU HAVE YOUR HEALTH: HEALTH CARE DISTRIBUTION IN CANADA AND PROCEDURALIST HUMAN RIGHTS

    Directory of Open Access Journals (Sweden)

    Alana Klein

    2012-10-01

    Full Text Available Health resource distribution in Canada has been criticized for being opaque and increasingly inequitable, with its disproportionate emphasis on curative over preventive care. Yet there has been relatively little scrutiny of priority-setting in publicly funded health care in Canada from bodies monitoring the international human right to health. Recently, however, domestic health governance on the one hand, and international health and human rights on the other, have converged around the promotion of evidence-based policy, accountability, transparency and participation as drivers of more equitable distribution of health care resources. This paper tracks the paths toward this convergence. The emphasis in health policy was largely driven by cost containment and service integration concerns, while democratic and institutional concerns around socio-economic rights protection are at the root of the health and human rights shift toward proceduralist approaches. This shared emphasis nonetheless opens new terrains of struggle for human rights approaches to health care distribution in Canada, around (i managing indeterminacy in social determinants of health; (ii addressing power imbalances that shape how health information is produced, communicated, and acted upon and (iii the role of fundamental normative values that limit substantive policy around health. La distribution des ressources en santé au Canada a été critiquée en raison de son caractère opaque et de plus en plus inéquitable, et de l’importance disproportionnée accordée aux soins curatifs par rapport aux mesures préventives. De plus, relativement peu d’études concernant les priorités établies en matière de services de santé publics au Canada ont été faites par des organismes de contrôle du droit, reconnu dans des instruments internationaux, de tout être humain à la santé. Cela dit, récemment, la gouvernance nationale de la santé, d’une part, et le droit à la santé et les droits de la personne au niveau international, d’autre part, ont convergé et mis l’accent sur la nécessité de promouvoir des politiques fondées sur des données probantes, la responsabilisation, la transparence et la participation, facteurs qui sont aptes à assurer une distribution plus équitable des ressources en santé. Le document suit le cheminement vers cette convergence. Les politiques en matière de santé étaient largement fondées sur des préoccupations liées à la limitation des coûts et à l’intégration des services, alors que les préoccupations démocratiques et institutionnelles à l’égard de la protection des droits socio-économiques sont à l’origine du virage du droit à la santé et des droits de la personne vers des approches procéduralistes. Ces priorités communes ouvrent néanmoins la porte à de nouvelles luttes visant des approches axées sur les droits de la personne en ce qui a trait à la distribution des services de santé au Canada, luttes qui impliqueront les actions suivantes : (i gérer l’indétermination dans les déterminants sociaux de la santé; (ii corriger les déséquilibres de pouvoir qui déterminent la façon dont l’information en matière de santé est produite et communiquée et les réactions qu’elle entraîne, et (iii éclaircir le rôle des valeurs normatives fondamentales qui limitent les politiques de fond en matière de santé.

  19. Vuorohoito - Varhaiskasvatusta 24/7. "En ees haluu kuvitella, ettei meillä olis tätä paikkaa." Positiivinen näkökulma vuorohoitoon.

    OpenAIRE

    Hietanoro, Sannalinnea

    2017-01-01

    Tämä tutkimus käsittelee vuorohoitoa varhaiskasvatuksen päivähoitomuotona. Pyrin tässä tutkimuksessa varhaiskasvatuksen vuorohoidon ilmiöiden ymmärtämiseen positiivisen psykologian näkökulmasta. Tavoitteena on tutkia, miten vuorohoito näkyy päivähoitomuotona lastentarhanopettajan työssä, sekä miten vuorohoidossa olevien lasten vanhemmat kokevat tämän hoitomuodon merkityksen heidän perheensä arjessa. Tutkimuksessa pyritään myös selvittämään, miten lapsi kokee hoitonsa vuorohoitoyksikössä. Tark...

  20. Effect of tensile dwell on high-temperature low-cycle fatigue and fracture behaviour of cast superalloy MAR-M247

    Czech Academy of Sciences Publication Activity Database

    Šulák, Ivo; Obrtlík, Karel

    2017-01-01

    Roč. 185, NOV (2017), s. 92-100 ISSN 0013-7944. [ICMFM 2016 - International Colloquium on Mechanical Fatigue of Metals /18./. Gijón, 05.09.2016-07.09.2016] R&D Projects: GA ČR(CZ) GA15-20991S Institutional support: RVO:68081723 Keywords : Nickel-based superalloy * High-temperature low-cycle fatigue * Tensile dwell * Fatigue life * Damage mechanisms Subject RIV: JL - Materials Fatigue, Friction Mechanics Impact factor: 2.151, year: 2016

  1. SU-F-T-247: Collision Risks in a Modern Radiation Oncology Department: An Efficient Approach to Failure Modes and Effects Analysis

    Energy Technology Data Exchange (ETDEWEB)

    Schubert, L; Westerly, D; Vinogradskiy, Y; Fisher, C; Liu, A [University of Colorado Denver, Aurora, CO (United States); Aldridge, J [University of Colorado Hospital, Aurora, CO (United States)

    2016-06-15

    Purpose: Collisions between treatment equipment and patients are potentially catastrophic. Modern technology now commonly involves automated remote motion during imaging and treatment, yet a systematic assessment to identify and mitigate collision risks has yet to be performed. Failure modes and effects analysis (FMEA) is a method of risk assessment that has been increasingly used in healthcare, yet can be resource intensive. This work presents an efficient approach to FMEA to identify collision risks and implement practical interventions within a modern radiation therapy department. Methods: Potential collisions (e.g. failure modes) were assessed for all treatment and simulation rooms by teams consisting of physicists, therapists, and radiation oncologists. Failure modes were grouped into classes according to similar characteristics. A single group meeting was held to identify implementable interventions for the highest priority classes of failure modes. Results: A total of 60 unique failure modes were identified by 6 different teams of physicists, therapists, and radiation oncologists. Failure modes were grouped into four main classes: specific patient setups, automated equipment motion, manual equipment motion, and actions in QA or service mode. Two of these classes, unusual patient setups and automated machine motion, were identified as being high priority in terms severity of consequence and addressability by interventions. The two highest risk classes consisted of 33 failure modes (55% of the total). In a single one hour group meeting, 6 interventions were identified. Those interventions addressed 100% of the high risk classes of failure modes (55% of all failure modes identified). Conclusion: A class-based approach to FMEA was developed to efficiently identify collision risks and implement interventions in a modern radiation oncology department. Failure modes and interventions will be listed, and a comparison of this approach against traditional FMEA methods will be presented.

  2. André Rauch, L’amour à la lumière du crime. 1936-2007, Paris, Hachette Littérature, 2009, 247 p.

    Directory of Open Access Journals (Sweden)

    Odile Goerg

    2010-07-01

    Full Text Available Bien avant que ne se répande la vogue des études sur la masculinité, réponses en miroir à l’énoncé de Simone de Beauvoir « on ne naît pas femme, on le devient », André Rauch s’interrogeait sur ce qui fonde, détermine ou cerne le ‘premier sexe’. Sous des angles variés, et sur deux siècles environ, de la Révolution à nos jours, il poursuit ses interrogations sur le rapport homme-femme, en renouvelant constamment ses approches. Il choisit ici de traiter la question par le biais de ce qu’on appel...

  3. A Gene Encoding a DUF247 Domain Protein Cosegregates with the i>S> Self-Incompatibility Locus in Perennial Ryegrass

    DEFF Research Database (Denmark)

    Manzanares, Chloe; Barth, Susanne; Thorogood, Daniel

    2016-01-01

    The grass family (Poaceae), the fourth largest family of flowering plants, encompasses the most economically important cereal, forage, and energy crops, and exhibits a unique gametophytic self-incompatibility (SI) mechanism that is controlled by at least two multiallelic and independent loci, S a...

  4. Measuring Gender (In)Equality: Introducing the Gender, Institutions and Development Data Base (GID). OECD Development Centre Working Paper No. 247

    Science.gov (United States)

    Jutting, Johannes P.; Morrisson, Christian; Dayton-Johnson, Jeff; Drechsler, Denis

    2006-01-01

    Efforts to establish, test and analyse hypotheses regarding cross-country variations in women's economic status are hampered by the lack of a readily accessible and easily used information resource on the various dimensions of gender inequality. Addressing this gap, this paper introduces the Gender, Institutions and Development data base (GID)…

  5. "I'm on it 24/7 at the moment": A qualitative examination of multi-screen viewing behaviours among UK 10-11 year olds

    Directory of Open Access Journals (Sweden)

    Cillero Itziar

    2011-08-01

    Full Text Available Abstract Background Screen-viewing has been associated with increased body mass, increased risk of metabolic syndrome and lower psychological well-being among children and adolescents. There is a shortage of information about the nature of contemporary screen-viewing amongst children especially given the rapid advances in screen-viewing equipment technology and their widespread availability. Anecdotal evidence suggests that large numbers of children embrace the multi-functionality of current devices to engage in multiple forms of screen-viewing at the same time. In this paper we used qualitative methods to assess the nature and extent of multiple forms of screen-viewing in UK children. Methods Focus groups were conducted with 10-11 year old children (n = 63 who were recruited from five primary schools in Bristol, UK. Topics included the types of screen-viewing in which the participants engaged; whether the participants ever engaged in more than one form of screen-viewing at any time and if so the nature of this multiple viewing; reasons for engaging in multi-screen-viewing; the room within the house where multi-screen-viewing took place and the reasons for selecting that room. All focus groups were transcribed verbatim, anonymised and thematically analysed. Results Multi-screen viewing was a common behaviour. Although multi-screen viewing often involved watching TV, TV viewing was often the background behaviour with attention focussed towards a laptop, handheld device or smart-phone. There were three main reasons for engaging in multi-screen viewing: 1 tempering impatience that was associated with a programme loading; 2 multi-screen facilitated filtering out unwanted content such as advertisements; and 3 multi-screen viewing was perceived to be enjoyable. Multi-screen viewing occurred either in the child's bedroom or in the main living area of the home. There was considerable variability in the level and timing of viewing and this appeared to be a function of whether the participants attended after-school clubs. Conclusions UK children regularly engage in two or more forms of screen-viewing at the same time. There are currently no means of assessing multi-screen viewing nor any interventions that specifically focus on reducing multi-screen viewing. To reduce children's overall screen-viewing we need to understand and then develop approaches to reduce multi-screen viewing among children.

  6. 47 CFR 15.247 - Operation within the bands 902-928 MHz, 2400-2483.5 MHz, and 5725-5850 MHz.

    Science.gov (United States)

    2010-10-01

    ... operation of the hybrid system, with the frequency hopping operation turned off, shall comply with the power... bandwidth of the hopping channel, whichever is greater, provided the systems operate with an output power no... at its maximum power control level. Power must be summed across all antennas and antenna elements...

  7. Improvement activities to soil stabilization near Bolivia-Brazil gas pipeline crossing through an embankment over a corrugated drainage pipe, at Km 247 in Mato Grosso do Sul, Brazil; Melhorias para estabilidade do gasoduto Bolivia-Brasil em cruzamento de aterro sobre tubo de drenagem tipo ARMCO, no km 247 em Mato Grosso do Sul

    Energy Technology Data Exchange (ETDEWEB)

    Jorge, Kemal Vieira [TBG - Transportadora Brasileira Gasoduto Bolivia Brasil S.A., Rio de Janeiro, RJ (Brazil); Costa, Cesar Augusto [TBG - Transportadora Brasileira Gasoduto Bolivia Brasil S.A., Campo Grande, MS (Brazil). Gerencia Regional Centro Oeste (CRGO)

    2005-07-01

    A hundred and seventy kilometers from Campo Grande city, on Mato Grosso do Sul State, the Brasil-Bolivia Gas Pipeline crosses a 8,5 meters high landfill, over a drainage systems made of a 2,8 meters of diameter corrugated pipe. This drainage pipe was installed to allow the drainage of the valley, and the landfill above it was built so the Gas pipeline could cross easier the 80 meters deep and 30 degree vertices valley. This paper illustrates the work tasks and solutions taken to monitor and guarantee the integrity of the drainage and landfill structures, as well as the integrity of the Gas Pipeline. Some of the work tasks illustrated are the investigation of the support conditions of the Gas Pipeline, the analysis of a drainage system under the pipeline, on a rocky soil, the analysis of the stability of the landfill, the construction of a gravity retaining walls and the monitoring of the deformations on the drainage pipe. (author)

  8. Work/Family Balancing and 24/7 Work Schedules: Network Analysis of Strategies in a Transport Company Cleaning Service: Concilier travail-famille et horaires 24/7: analyse réseau des stratégies au sein du service de nettoyage d'une compagnie de transport.

    Science.gov (United States)

    Lefrançois, Mélanie; Saint-Charles, Johanne; Riel, Jessica

    2017-11-01

    Whether or not official work/family balance measures exist within an organization, scheduling accommodations often go through informal channels involving colleagues and superiors and are negotiated within interpersonal relationships. This study examines the relationship dimensions of the scheduling strategies of cleaners working atypical hours in the transport sector through the lenses of ergonomic activity, network, and gender analyses. Using semi-directed interviews, observation, and network analysis, we revealed the effect of gender on relationship dynamics and the influence of these dynamics on work/family balance strategies deployed by cleaners. One of the main contributions of this study is to demonstrate the decisive effect of relationships by revealing inequalities in access to organizational social networks. Creating spaces to discuss work/family balancing and a more equitable circulation of information could contribute to reducing inequalities associated with gender, social status, and family responsibilities and support the work/family strategies developed by workers dealing with restrictive work schedules. Résumé Les accommodements du temps de travail pour la conciliation travail-famille (CTF) passent souvent par des ententes informelles qui s'inscrivent dans les relations entre collègues ou avec des gestionnaires. Notre étude, intégrant l'ergonomie et la communication dans une perspective de genre, porte sur les dimensions relationnelles des stratégies de choix d'horaire d'agentes et agents de nettoyage devant composer avec des horaires atypiques dans le secteur des transports. À partir d'entretiens semi-dirigés, d'observations et d'analyse de réseaux, nous avons pu observer l'influence des dynamiques relationnelles, notamment de genre, sur les stratégies de CTF. Un apport central de cette étude est de montrer l'effet structurant des relations en révélant notamment des inégalités dans l'accès aux ressources facilitant le choix d'horaire, mais aussi dans l'inclusion au sein du réseau de relations. L'article conclut en proposant des pistes de solutions concrètes pour la réduction de ces inégalités.

  9. Multibeam collection for TN247: Multibeam data collected aboard Thomas G. Thompson from 2010-03-11 to 2010-04-17, departing from Punta Arenas, Chile and returning to Seattle, WA

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set is part of a larger set of data called the Multibeam Bathymetry Database (MBBDB) where other similar data can be found at...

  10. Cultura corporal na pauta do jornal: notas de uma análise a partir do "Programa AN Escola"doi: 10.5007/2175-8042.2010v22n35p247

    Directory of Open Access Journals (Sweden)

    Daniel Minuzzi de Souza

    2010-01-01

    Full Text Available Este estudo objetivou apresentar elementos de uma análise de um programa de jornal escolar, em que identificamos matérias referentes aos conteúdos da cultura corporal. Para tanto, utilizamos procedimentos de análise de conteúdo para analisar o suplemento AN Escola, tendo o recorte temporal de 2004-2008. Nesse corpus identificamos a presença de conteúdos da cultura corporal em 1145 matérias que foram distribuídas em 11 categorias (Esporte, Temas transversais, Lazer, Corpo/identidade, Jogos/brincadeiras, Saúde, Estética, Circo, Dança, Lutas, e Outros. As conclusões apontam indícios de o Programa AN Escola tratar-se de mais uma estratégia de marketing institucional do que ser um programa que promove mídia-educação, apesar dessa possibilidade.

  11. Comportamiento mecánico a alta temperatura y alta velocidad de deformación de la superaleación de niquel MAR-M247DS

    OpenAIRE

    Galvez Diaz-Rubio, Francisco; Erice Echávarri, Borja; Cendón Franco, David Angel; Sanchez Galvez, Vicente

    2011-01-01

    Las súper-aleaciones de níquel tienen gran utilidad en aplicaciones estructurales en condiciones de trabajo a m uy alta temperatura. Uno de las aplicaciones más empleadas es en los alabes de turbina de aeromotores, en los que los alabes se producen por solidificación direccional, con propiedades muy variables en las direcciones longitudinal y transversal. En el presente trabajo se exponen 1 os resultados obtenidos en la investigación llevada a cabo para det erminar el comportamiento mecánico ...

  12. A Review of the Literature on Social and Emotional Learning for Students Ages 3-8: Teacher and Classroom Strategies that Contribute to Social and Emotional Learning (Part 3 of 4). REL 2017-247

    Science.gov (United States)

    O'Conner, Rosemarie; De Feyter, Jessica; Carr, Alyssa; Luo, Jia Lisa; Romm, Helen

    2017-01-01

    Social and emotional learning (SEL) is the process by which children and adults learn to understand and manage emotions, maintain positive relationships, and make responsible decisions. This is the third in a series of four related reports about what is known about SEL programs for students ages 3-8. The report series addresses four issues raised…

  13. Discovery of isotopes of the transuranium elements with 93≤Z≤98

    Energy Technology Data Exchange (ETDEWEB)

    Fry, C.; Thoennessen, M., E-mail: thoennessen@nscl.msu.edu

    2013-01-15

    One hundred and five isotopes of the transuranium elements neptunium, plutonium, americium, curium, berkelium, and californium have been observed so far; the discovery of these isotopes is described. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  14. Separation of Transplutonium Elements from Neutron Irradiated Americium-241

    National Research Council Canada - National Science Library

    UENO, Kaoru; WATANABE, Kenju; SAGAWA, Chiaki; ISHIMORI, Tomitaro

    1974-01-01

    .... The ratios of the amounts present of these isotopes were determined by mass spectrometry. It was not possible to identify 249Bk in the berkelium fraction owing to the interference from other β-ray emitting nuclides. In the californium fraction, both spontaneous fission and a-activities due to 250, 252 were observed.

  15. Neutron-Activated Gamma-Emission: Technology Review

    Science.gov (United States)

    2012-01-01

    flux sources developed for boron neutron capture therapy ( BNCT ), found to be an experimental success in cancer treatment (26). 30 Improved flux on...achievable Am americium API associated particle imaging B boron Be beryllium BNCT boron neutron capture therapy C carbon Cf californium Cl

  16. ORF Alignment: NC_004463 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available THFQ 180 ... Query: 247 FQGLLMSDDVSMNALAGSIADRTRAIFAAGCDMALHCNGNIEEMREV 293 ... FQGLLMSDDVSMNALAGSIADRTRAIFAAGCDMA...LHCNGNIEEMREV Sbjct: 241 FQGLLMSDDVSMNALAGSIADRTRAIFAAGCDMALHCNGNIEEMREV 287

  17. Solid-State Neutron Multiplicity Counting System Using Commercial Off-the-Shelf Semiconductor Detectors

    Energy Technology Data Exchange (ETDEWEB)

    Rozhdestvenskyy, S. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

    2017-08-09

    This work iterates on the first demonstration of a solid-state neutron multiplicity counting system developed at Lawrence Livermore National Laboratory by using commercial off-the-shelf detectors. The system was demonstrated to determine the mass of a californium-252 neutron source within 20% error requiring only one-hour measurement time with 20 cm2 of active detector area.

  18. Cold valleys in the radioactive decay of 248−254Cf isotopes

    Indian Academy of Sciences (India)

    Geiger–Nuttal plots of log10(T1/2) vs. Q−1/2 for 48−52Ca emitting from various californium isotopes. Acknowledgement. One of the authors (KPS) would like to thank University Grants Commis- sion, Govt. of India for the financial support under project No. MRP(S)-. 352/2005(X Plan)/KLKA 002/UGC-SWRO. References.

  19. Directed evolution of the periodic table: probing the electronic structure of late actinides.

    Science.gov (United States)

    Marsh, M L; Albrecht-Schmitt, T E

    2017-07-25

    Recent investigations of the coordination chemistry and physical properties of berkelium (Z = 97) and californium (Z = 98) have revealed fundamental differences between post-curium elements and lighter members of the actinide series. This review highlights these developments and chronicles key findings and concepts from the last half-century that have helped usher in a new understanding of the evolution of electronic structure in the periodic table.

  20. Open Source: Potential in Latin America for Radiological Weapons

    Science.gov (United States)

    2010-03-01

    terrorist group would need to acquire a radioactive isotope with a relatively short half-life. 36,37 As an aside, the IAEA verified that depleted...cns.miis.edu/npr/pdfs/123salama.pdf (accessed March 3, 2010), Useful RDD isotopes include cobalt-60, strontium-90, yttrium-90, iridium-192, cesium-137...plutonium-238, radium -226, americium-241, and californium-252. 37 Hansell and Salama, “Does intent equal capability?,” 640-641. 38 Internation Atomic

  1. Gclust Server: 3265 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available 3265 Atu_Atu3085 Cluster Sequences Related Sequences(6) 247 hydantoin Racemase 30 1...ces Cluster Sequences Link to related sequences Related Sequences(6) Sequence length 247 Representative annotation hydantoin Race

  2. Effect of power variation on wettability and optical properties of co ...

    Indian Academy of Sciences (India)

    Centre of Nanotechnology, Indian Institute of Technology Roorkee, Roorkee 247 667, India; Nano Science Laboratory, Institute Instrumentation Centre, Indian Institute of Technology Roorkee, Roorkee 247 667, India; CHAMOS Matrusanstha Department of Mechanical Engineering, Charotar University of Science and ...

  3. Antonio Maria Baggio (ed., Adriana Cossedu, Paolo Giusta, Rodrigo Mardones Z. y Antonio Márquez Prieto, Caino e i suoi fratelli. Il fondamento relazionale nella politica e nel diritto, Città Nuova, Roma, 2012, 247 págs.

    Directory of Open Access Journals (Sweden)

    María Salas Porras

    2013-03-01

    Full Text Available Los estudios recogidos en este volumen intentan reinterpretar los fundamentos de la Política y del Derecho, enmarcados en el horizonte relacional que la fraternidad les abre. Desde esta perspectiva, la fraternidad asume una relevancia política y jurídica en la medida en que se la entienda sustancialmente ligada a la libertad y a la igualdad. Cada una de las tres categorías, en la medida en que sean consideradas conjuntamente, llegan a adquirir su propio significado a través de la relación con las otras. El redescubrimiento de la fraternidad significa por tanto volver a proponer el "tríptico" entero, para recuperar, a través del mismo, el proyecto humanísitico de la modernidad, y liberarnos del destino del conflicto radical al que nuestro tiempo parece condenado: Caín no sólo ha matado a su hermano, sino que también ha fundado la primera ciudad, es decir, el lugar donde la violencia se ve confinada por el gobierno y por las leyes. Abrir el Derecho al horizonte de la fraternidad significa, hoy, llevar la racionalidad jurídica más allá de la mera racionalidad técnica; permitir renovar la relación jurídica, volver a encontrar sus fundamentos humanísticos, redescubriendo una justicia que reconcilia y reconstruye, fortificando el vínculo social. Considerar la fraternidad una categoría política significa poder emitir juicios políticos, capaces de producir un pensamiento político a través de la óptica de la fraternidad; se abandonan así las lógicas de la ideología, para intentar construir una forma de pensamiento en disposición de pasar, de una idea intuitiva de fraternidad, a una definición que la haga operativa, "operacionalizable". Es una tarea que no corresponde hoy a una sola disciplina, sino que interesa a todo el conjunto de los ya numerosos estudiosos que se han enrolado en este frente, interactuando entre sí de manera interdisiciplinar y abriendo un camino en el cual resulte posible, a todos los que han abrazado un humanismo y un ideal político, encontrar las mejores razones de su esperanza.

  4. Turning the Blues Around - One Woman's Story of Kicking Depression to Nurse the Mentally III Burnett-Thomas Irene Turning the Blues Around - One Woman's Story of Kicking Depression to Nurse the Mentally III 247pp Athena Press 9781847484123 1847484123 [Formula: see text].

    Science.gov (United States)

    2010-04-21

    Trapped in a failing marriage and experiencing postnatal depression, Irene Burnett-Thomas ended up in a psychiatric hospital - with the depressive's characteristic feelings of worthlessness and guilt. But she fought back against this near-overwhelming situation to start life afresh and develop a satisfying career in nursing.

  5. ‘A dialogue about the art of portraiture’ Originally published as ‘Gespräch von der Bildniskunst’, Österreichische Rundschau, Volume 6, 1906, 502—516, and republished: Julius Schlosser, Präludien Vorträge und Aufsätze, Berlin: Bard 1927, 227—247. Translated with an introduction by Karl Johns

    Directory of Open Access Journals (Sweden)

    Julius Schlosser

    2011-12-01

    Full Text Available In an unusually popular and readable dialogue form, Schlosser alludes to the classical education he takes for granted in any reader approaching his favourite ‘thorny’ questions from aesthetics and history. These involve the problems of naturalism, impressionism, portrait likeness, psychology of perception and numerous others being bandied around academic circles at the turn of the century. It is of further interest in directly referring critically to his recently deceased friend (Alois Riegl, and being written just at a moment in his career when Schlosser had been casting around the ideas of Ernst Brücke, Konrad Lange, even Henri Bergson, but had discovered the recent contribution of Benedetto Croce, which would colour his approach with an increasing intensity for the remainder of his life. He became what might be seen as the archetypical art historical theorist, but continues to distinguish himself from his successors by his greater consistency.

  6. GETDB: 105369 [GETDB

    Lifescience Database Archive (English)

    Full Text Available te of Genetics. FM7c Link to clone table - 1 247 Link to cluster table 247 1 Request - scattered cells - wing pouch...247 Num of clusters 1 Stock Request Request - Embryonic Expression scattered cells Larval GFP - Larval X-gal wing pouch

  7. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFC247 (Link to dictyBase) - - - Contig-U16444-1 VFC247P (Link... to Original site) VFC247F 353 VFC247Z 590 VFC247P 943 - - Show VFC247 Library VF (Link to library) Clone ID VFC247 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16444-1 Original site URL http://dict...ences producing significant alignments: (bits) Value N AC116978 |AC116978.1 Dicty...ostelium discoideum chromosome 2 map 4846697-4874480 strain AX4, *** SEQUENCING IN PROGRESS ***. 1049 0.0 3 AC117076 |AC117076.2 Dict

  8. PROCEEDINGS OF THE SYMPOSIUM COMMEMORATING THE 25th ANNIVERSARY OF ELEMENTS 97 and 98 HELD ON JAN. 20, 1975

    Energy Technology Data Exchange (ETDEWEB)

    Seaborg, Glenn T.; Street Jr., Kenneth; Thompson, Stanley G.; Ghiorso, Albert

    1976-07-01

    This volume includes the talks given on January 20, 1975, at a symposium in Berkeley on the occasion of the celebration of the 25th anniversary of the discovery of berkelium and californium. Talks were given at this symposium by the four people involved in the discovery of these elements and by a number of people who have made significant contributions in the intervening years to the investigation of their nuclear and chemical properties. The papers are being published here, without editing, in the form in which they were submitted by the authors in the months following the anniversary symposium, and they reflect rather faithfully the remarks made on that occasion.

  9. Composition containing transuranic elements for use in the homeopathic treatment of aids

    Energy Technology Data Exchange (ETDEWEB)

    Lustig, D.

    1996-04-18

    A homeopathic remedy consisting of a composition containing one or more transuranic elements, particularly plutonium, for preventing and treating acquired immunodeficiency syndrome (AIDS) in humans, as well as seropositivity for human immunodeficiency virus (HIV). Said composition is characterized in that it uses any chemical or isotopic form of one or more transuranic elements (neptunium, plutonium, americium, curium, berkelium, californium or einsteinium), particularly plutonium, said form being diluted and dynamized according to conventional homeopathic methods, particularly the so-called Hahnemann and Korsakov methods, and provided preferably but not exclusively in the form of lactose and/or saccharose globules or granules impregnated with the active principle of said composition. (author).

  10. Advanced development of the spectrum sciences Model 5005-TF, single-event test fixture

    Energy Technology Data Exchange (ETDEWEB)

    Ackermann, M.R.; Browning, J.S. (Sandia National Labs., Albuquerque, NM (USA)); Hughlock, B.W. (Boeing Aerospace and Electronics Co., Seattle, WA (USA)); Lum, G.K. (Lockheed Missiles and Space Co., Sunnyvale, CA (USA)); Tsacoyeanes, W.C. (Draper (Charles Stark) Lab., Inc., Cambridge, MA (USA)); Weeks, M.D. (Spectrum Sciences, Inc., Santa Clara, CA (USA))

    1990-09-01

    This report summarizes the advanced development of the Spectrum Sciences Model 5005-TF, Single-Event Test Fixture. The Model 5005-TF uses a Californium-252 (Cf-252) fission-fragment source to test integrated circuits and other devices for the effects of single-event phenomena. Particle identification methods commonly used in high-energy physics research and nuclear engineering have been incorporated into the Model 5005-TF for estimating the particle charge, mass, and energy parameters. All single-event phenomena observed in a device under test (DUT) are correlated with an identified fission fragment, and its linear energy transfer (LET) and range in the semiconductor material of the DUT.

  11. TOWARD AN IMPROVED UNDERSTANDING OF STRUCTURE AND MAGNETISM IN NEPTUNIUM AND PLUTONIUM PHOSPHONATES AND SULFONATES

    Energy Technology Data Exchange (ETDEWEB)

    Albrecht-Schmitt, Thomas

    2012-03-01

    This grant supported the exploratory synthesis of new actinide materials with all of the actinides from thorium to californium with the exceptions of protactinium and berkelium. We developed detailed structure-property relationships that allowed for the identification of novel materials with selective ion-exchange, selective oxidation, and long-range magnetic ordering. We found novel bonding motifs and identified periodic trends across the actinide series. We identified structural building units that would lead to desired structural features and novel topologies. We also characterized many different spectroscopic trends across the actinide series. The grant support the preparation of approximately 1200 new compounds all of which were structurally characterized.

  12. Detection of rare earth elements in Powder River Basin sub-bituminous coal ash using laser-induced breakdown spectroscopy (LIBS)

    Energy Technology Data Exchange (ETDEWEB)

    Tran, Phuoc [National Energy Technology Lab. (NETL), Pittsburgh, PA, (United State; Mcintyre, Dustin [National Energy Technology Lab. (NETL), Pittsburgh, PA, (United State

    2015-10-01

    We reported our preliminary results on the use of laser-induced breakdown spectroscopy to analyze the rare earth elements contained in ash samples from Powder River Basin sub-bituminous coal (PRB-coal). We have identified many elements in the lanthanide series (cerium, europium, holmium, lanthanum, lutetium, praseodymium, promethium, samarium, terbium, ytterbium) and some elements in the actinide series (actinium, thorium, uranium, plutonium, berkelium, californium) in the ash samples. In addition, various metals were also seen to present in the ash samples

  13. Reducing Electromagnetic Interference in a Grid Tied Single Phase Power Inverter

    Science.gov (United States)

    2016-09-01

    R parasitic 2.0  unknown L1 247.0 µH 247.0 µH L2 247.0 µH 247.0 µH Lm 25.0 µH 25.0 µH L1 + L2 950.0 µH 950.0 µH C 12.0 µF 12.0 µF R Load 133.33...naval vessel, this is definitely something that must be taken into consideration. 28 THIS PAGE INTENTIONALLY LEFT BLANK 29 IV. UPDATED MODEL

  14. About Military Sexual Trauma

    Medline Plus

    Full Text Available ... Service Connected Disability Hearings as Gateway to Pain Management - Duration: 4:11. Veterans Health Administration 247 views ... Loading... Loading... Loading... About Press Copyright Creators ...

  15. ORF Alignment: NC_003106 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ... protein [Sulfolobus tokodaii str. 7] ... Length = 247 ... Query: 2 ... IREVLRFINKSDLVIEVIDAREPD...LTRSKKLEEYALNRERKILIVLNKADLIPREILEGW 61 ... IREVLRFINKSDLVIEVIDAREPDLTRSKK...LEEYALNRERKILIVLNKADLIPREILEGW Sbjct: 1 ... IREVLRFINKSDLVIEVIDAREPDLTRSKKLEEYALNRERKILIVLNKADLIPREILEGW 60 ... Q

  16. ORF Alignment: NC_004567 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ... [Lactobacillus plantarum WCFS1] ... Length = 247 ... Query: 4 ... NEQDQTAADFVIGRHPAMAAIKSDQQINKVFIQSGLQA...DVLNDIAKIAKKRNLIVQYVPK 63 ... NEQDQTAADFVIGRHPAMAAIKSDQQINKVFIQSGLQADVLNDI...AKIAKKRNLIVQYVPK Sbjct: 1 ... NEQDQTAADFVIGRHPAMAAIKSDQQINKVFIQSGLQADVLNDIAKIAKKRNLIVQYVPK 60 ... Query: 124 TADA

  17. Cultural Economy, Capitalism and the Logic of the Public Sphere

    DEFF Research Database (Denmark)

    Schwarzkopf, Stefan

    2015-01-01

    Review essay: Promotional Cultures: The Rise and Spread of Advertising, Public Relations, Marketing and Branding/ by Aeron Davis. (Polity, 2013, ISBN 978-0-7456-3983-3, 247 + xi pp.......Review essay: Promotional Cultures: The Rise and Spread of Advertising, Public Relations, Marketing and Branding/ by Aeron Davis. (Polity, 2013, ISBN 978-0-7456-3983-3, 247 + xi pp....

  18. Drug: D07173 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D07173 Drug Ciclonicate (INN) C15H21NO2 247.1572 247.3327 D07173.gif ATC code: C04A... VASODILATORS C04A PERIPHERAL VASODILATORS C04AC Nicotinic acid and derivatives C04AC07 Ciclonicate D07173 Ciclo

  19. Molecular characterization of two positive-strand RNA viruses co-infecting a hypovirulent strain of Sclerotinia sclerotiorum.

    Science.gov (United States)

    Hu, Zijin; Wu, Songsong; Cheng, Jiasen; Fu, Yanping; Jiang, Daohong; Xie, Jiatao

    2014-09-01

    Two dsRNA segments, the replicative forms of two ssRNA viruses of SsHV2/SX247 (Sclerotinia sclerotiorum hypovirus 2) and SsDRV/SX247 (Sclerotinia sclerotiorum debilitation-associated RNA virus), were isolated from the hypovirulent strain SX247 of Sclerotinia sclerotiorum. SsDRV/SX247 has the highest similarities (81% aa identity) with the previously reported virus SsDRV/Ep-1PN. The genome of SsHV2/SX247 is 15,219bp in length with a poly-A tail, and it has only one large putative open reading frame (ORF) that encodes a polyprotein containing RNA-dependent RNA polymerase (RdRp) and viral RNA helicase domains. The RdRp domain shares amino acid similarity with that of CHV1 (23%). However, the genome organization of SsHV2/SX247 is significantly different from that of CHV1 on genomic size and ORFs. We conclude that SsDRV/SX247 is a novel strain in species SsDRV of genus Sclerodarnavirus, whereas SsHV2/SX247 is a representative member of new proposed lineage Gammahypovirus in the family Hypoviridae and confers hypovirulence in its host. Copyright © 2014 Elsevier Inc. All rights reserved.

  20. Operations Research Center. Annual Report. Jul 1, 1977 through June 30, 1978.

    Science.gov (United States)

    1978-06-30

    Carlton), Journal of Urban Economics , 4, July 1977, pp. 221-247. The market effects of alternative housing payment formulas are analyzed and... Urban Economics , 4, July 1977, pp. 221-247. PROFESSIONAL ACTIVITIES: Publications M.J. CARUSO, "Blood Donation Attitudes and Behavior," Technical

  1. Decline in snowfall in response to temperature in Satluj basin ...

    Indian Academy of Sciences (India)

    Riyaz Ahmad Mir1 2 Sanjay K Jain3 Arun K Saraf1 Ajanta Goswami4. Department of Earth Sciences, Indian Institute of Technology, Roorkee 247 667, India. Geological Survey of India, State Unit: J&K, Srinagar, 190 008, India. National Institute of Hydrology, Roorkee 247 667, India. Indian Institute of Remote Sensing, ...

  2. Browse Title Index

    African Journals Online (AJOL)

    Items 201 - 247 of 247 ... S.A James, L Bilbiss, B.Y Muhammad. Vol 2, No 4 (2007), The effects of Diethylsulphate on some quantitative traits of tomato (Lycopersicon esculentum Mill), Abstract PDF. H Aliyu, A.K Adamu. Vol 4, No 3 (2009), The future of Carbon Capture and Storage (CCS) in Nigeria, Abstract PDF. M Anastassia ...

  3. 75 FR 52872 - Radio Broadcasting Services; Blythe, CA

    Science.gov (United States)

    2010-08-30

    ... Company, Inc., substitutes FM Channel 247B for Channel 239B at Blythe, California. Channel 247B can be... Order, MB Docket No. 08-151, adopted August 12, 2010, and released August 16, 2010. The full text of... via the company's Web site, http://www.bcpiweb.com . This document does not contain proposed...

  4. Production of L-glutaminase and its optimization from a novel ...

    African Journals Online (AJOL)

    The maximum yield of enzyme production (247 U/ml) was achieved in a seawater based medium at pH 8, 37°C, 1% inoculum concentration and 2% glutamine concentration for 24 h. The medium when supplemented with carbon source, it improved the enzyme production from 247 to 321 U/ml with 1.5% maltose. Addition of ...

  5. Deprotection of oximes using urea nitrate under microwave irradiation

    Indian Academy of Sciences (India)

    Unknown

    With increasing environmental concerns, it is important that new 'environmentally friendly' reagents be developed using inexpensive and non-polluting materials. Recently .... Dictionary of organic compounds 4th edn 1965 (Lon- don: Eyre and Spottiswoode) p. 12, 23, 29, 80, 247,. 247, 322, 348, 416, 543, 569, 593, 599, 785 ...

  6. Browse Title Index

    African Journals Online (AJOL)

    Items 201 - 247 of 247 ... Frances CL Rakotsoane. Vol 19, No 1 (2006):, The Impact of the Iranian Revolution on Muslim Organizations in South Africa during the Struggle against Apartheid, Abstract. U Lehmann. Vol 17, No 1 (2004):, The Lonely Goddess: The Lack of Personal Female Relationships in the Shi'ite Religious ...

  7. Browse Title Index

    African Journals Online (AJOL)

    Items 201 - 247 of 247 ... G Philip Clarke, Neil D Burgess, Frank M Mbago, Cosmas Mligo, Barbara Mackinder, Roy E Gereau. Vol 96 (2007), Two new species of Muscidae (diptera) from Kenya, ... and biodiversity of syrphidae (Diptera) in East Africa, Abstract. Marc De Meyer, Edward Vanden Berghe, Andy E Whittington.

  8. Measurements of the neutron capture cross sections and incineration potentials of minor-actinides in high thermal neutron fluxes: Impact on the transmutation of nuclear wastes; Mesures des sections efficaces de capture et potentiels d'incineration des actinides mineurs dans les hauts flux de neutrons: Impact sur la transmutation des dechets

    Energy Technology Data Exchange (ETDEWEB)

    Bringer, O

    2007-10-15

    This thesis comes within the framework of minor-actinide nuclear transmutation studies. First of all, we have evaluated the impact of minor actinide nuclear data uncertainties within the cases of {sup 241}Am and {sup 237}Np incineration in three different reactor spectra: EFR (fast), GT-MHR (epithermal) and HI-HWR (thermal). The nuclear parameters which give the highest uncertainties were thus highlighted. As a result of fact, we have tried to reduce data uncertainties, in the thermal energy region, for one part of them through experimental campaigns in the moderated high intensity neutron fluxes of ILL reactor (Grenoble). These measurements were focused onto the incineration and transmutation of the americium-241, the curium-244 and the californium-249 isotopes. Finally, the values of 12 different cross sections and the {sup 241}Am isomeric branching ratio were precisely measured at thermal energy point. (author)

  9. A gas secondary electron detector

    CERN Document Server

    Drouart, A; Alamanos, N; Auger, F; Besson, P; Bougamont, E; Bourgeois, P; Lobo, G; Pollacco, E C; Riallot, M

    2002-01-01

    A new Secondary Electron gas Detector (SED) is under development to be used in conjunction with an emissive foil to detect low energy heavy ions as an alternative to micro-channel plates. It could measure position and time of flight. Secondary electrons are accelerated to 10 keV so that they can cross through the 0.9 mu m Mylar entrance window. The electrons then are multiplied in the isobutane gas of the detector at 4-10 Torr. A time resolution of 150 ps and a spatial resolution of 3 mm have been obtained by using californium fission fragments on a prototype detector of 7x7 cm sup 2. The advantage of the SED against MCP is that its size is not limited. Our final goal is to build a large size detector (15x40 cm sup 2) that will operate at the focal plane of the VAMOS magnetic spectrometer at GANIL.

  10. Environmental assessment of the thermal neutron activation explosive detection system for concourse use at US airports

    Energy Technology Data Exchange (ETDEWEB)

    Jones, C.G.

    1990-08-01

    This document is an environmental assessment of a system designed to detect the presence of explosives in checked airline baggage or cargo. The system is meant to be installed at the concourse or lobby ticketing areas of US commercial airports and uses a sealed radioactive source of californium-252 to irradiate baggage items. The major impact of the use of this system arises from direct exposure of the public to scattered or leakage radiation from the source and to induced radioactivity in baggage items. Under normal operation and the most likely accident scenarios, the environmental impacts that would be created by the proposed licensing action would not be significant. 44 refs., 19 figs., 18 tabs.

  11. Chelation and stabilization of berkelium in oxidation state +IV

    Science.gov (United States)

    Deblonde, Gauthier J.-P.; Sturzbecher-Hoehne, Manuel; Rupert, Peter B.; An, Dahlia D.; Illy, Marie-Claire; Ralston, Corie Y.; Brabec, Jiri; de Jong, Wibe A.; Strong, Roland K.; Abergel, Rebecca J.

    2017-09-01

    Berkelium (Bk) has been predicted to be the only transplutonium element able to exhibit both +III and +IV oxidation states in solution, but evidence of a stable oxidized Bk chelate has so far remained elusive. Here we describe the stabilization of the heaviest 4+ ion of the periodic table, under mild aqueous conditions, using a siderophore derivative. The resulting Bk(IV) complex exhibits luminescence via sensitization through an intramolecular antenna effect. This neutral Bk(IV) coordination compound is not sequestered by the protein siderocalin—a mammalian metal transporter—in contrast to the negatively charged species obtained with neighbouring trivalent actinides americium, curium and californium (Cf). The corresponding Cf(III)-ligand-protein ternary adduct was characterized by X-ray diffraction analysis. Combined with theoretical predictions, these data add significant insight to the field of transplutonium chemistry, and may lead to innovative Bk separation and purification processes.

  12. The CARIBU EBIS control and synchronization system

    Science.gov (United States)

    Dickerson, Clayton; Peters, Christopher

    2015-01-01

    The Californium Rare Isotope Breeder Upgrade (CARIBU) Electron Beam Ion Source (EBIS) charge breeder has been built and tested. The bases of the CARIBU EBIS electrical system are four voltage platforms on which both DC and pulsed high voltage outputs are controlled. The high voltage output pulses are created with either a combination of a function generator and a high voltage amplifier, or two high voltage DC power supplies and a high voltage solid state switch. Proper synchronization of the pulsed voltages, fundamental to optimizing the charge breeding performance, is achieved with triggering from a digital delay pulse generator. The control system is based on National Instruments realtime controllers and LabVIEW software implementing Functional Global Variables (FGV) to store and access instrument parameters. Fiber optic converters enable network communication and triggering across the platforms.

  13. Off-line commissioning of EBIS and plans for its integration into ATLAS and CARIBU

    Energy Technology Data Exchange (ETDEWEB)

    Ostroumov, P. N., E-mail: ostroumov@anl.gov; Barcikowski, A.; Dickerson, C. A.; Mustapha, B.; Perry, A.; Sharamentov, S. I.; Vondrasek, R. C.; Zinkann, G. [Argonne National Laboratory, Argonne, Illinois 60439 (United States)

    2016-02-15

    An Electron Beam Ion Source Charge Breeder (EBIS-CB) has been developed at Argonne to breed radioactive beams from the CAlifornium Rare Isotope Breeder Upgrade (CARIBU) facility at Argonne Tandem Linac Accelerator System (ATLAS). The EBIS-CB will replace the existing ECR charge breeder to increase the intensity and significantly improve the purity of reaccelerated radioactive ion beams. The CARIBU EBIS-CB has been successfully commissioned offline with an external singly charged cesium ion source. The performance of the EBIS fully meets the specifications to breed rare isotope beams delivered from CARIBU. The EBIS is being relocated and integrated into ATLAS and CARIBU. A long electrostatic beam transport system including two 180° bends in the vertical plane has been designed. The commissioning of the EBIS and the beam transport system in their permanent location will start at the end of this year.

  14. Populations of selected microbial and fungal species growing on the surface of rape seeds following treatment with desiccants or plant growth regulators.

    Science.gov (United States)

    Frac, Magdalena; Jezierska-Tys, Stefania; Tys, Jerzy

    2010-01-01

    The aim of this study was to determine the effects of desiccants and plant growth regulators on selected microbial species affecting rape seeds, with special emphasis on the growth of fungi and identification of the genus and species composition. The experimental material in the study was seeds of winter rape cv. Californium that were collected from the field during combine harvest. The chemical agents applied, both desiccants and growth regulators, generally decreased the populations of bacteria occurring on the surface of rape seeds. The responses of fungi depended upon the type of agent applied and were manifested as either stimulation or inhibition of the growth of the fungal species. The fungi isolated from the surface of rape seeds were characteristic of those found in the field environment (Cladosporium and Penicillium) and typical for those present on the surface of rape seeds (Alternaria).

  15. Reliability of semiconductor and gas-filled diodes for over-voltage protection exposed to ionizing radiation

    Directory of Open Access Journals (Sweden)

    Stanković Koviljka

    2009-01-01

    Full Text Available The wide-spread use of semiconductor and gas-filled diodes for non-linear over-voltage protection results in a variety of possible working conditions. It is therefore essential to have a thorough insight into their reliability in exploitation environments which imply exposure to ionizing radiation. The aim of this paper is to investigate the influence of irradiation on over-voltage diode characteristics by exposing the diodes to californium-252 combined neutron/gamma radiation field. The irradiation of semiconductor over-voltage diodes causes severe degradation of their protection characteristics. On the other hand, gas-filled over-voltage diodes exhibit a temporal improvement of performance. The results are presented with the accompanying theoretical interpretations of the observed changes in over-voltage diode behaviour, based on the interaction of radiation with materials constituting the diodes.

  16. Triton and alpha-particle contribution from LiF converter for neutron dosimeter

    CERN Document Server

    Camacho, M E; Balcazar, M

    1999-01-01

    A personnel neutron dosimeter prototype based on chemical and electrochemical etched CR-39 detector, combined with LiF converter, has been calibrated using an ICRP-like phantom, under a heavy-water moderated Californium source neutron spectra; A conversion factor of 1.052+-126 spots cm sup - sup 2 mSv sup - sup 1 was obtained. The sealing properties of the detector holder showed a ten-fold reduction in radon background when it was tested in a high radon atmosphere. A convenient mechanical shock resistance was achieved in LiF converters by sintering to 11 tons pressure LiF powder at 650 deg. C, during one hour.

  17. Study of reproducibility of measurements with the spectrometer of Bonner multispheres

    Energy Technology Data Exchange (ETDEWEB)

    Azevedo, G.A.; Pereira, W.W.; Patrao, K.C.S.; Fonseca, E.S., E-mail: geisadeazevedo@gmail.com, E-mail: walsan@ird.gov.br, E-mail: karla@ird.gov.br, E-mail: evaldo@ird.gov.br [Instituto de Radionprotecao e Dosimetria (IRD/CNEN-RJ), Rio de Janeiro, RJ (Brazil)

    2013-07-01

    This work aims to study the metrological behavior of the Bonner Multisphere Spectrometer (BMS) of the LN / LNMRI / IRD - Laboratorio Metrologia de Neutrons / Laboratorio Nacional de Metrologia e Radiacao Ionizante / Instituto de Radioprotecao e Dosimetria, for measurements in repeatability and reproducibility conditions. Initially, a simulation was done by applying the Monte Carlo method, using the MCNP code and respecting the ISO 8529-1 (2001), using the sources of Californium ({sup 252} Cf), Americium-Beryllium ({sup 241} AmBe) and californium in heavy water (Cf + D{sub 2}O), all located at a distance of 100 cm from the neutron detector ({sup 6}Li (Eu) - crystal scintillator). In this program, the counting of neutrons that are captured by the detector was made. The source is located in the center of a sphere of radius 300 cm. Analyzes the impact of these neutrons in a point of the sphere wall, which in this case acted as a neutron detector and from there, it is estimated the number of neutrons that collide in the whole sphere. The purpose is to obtain the neutron count for different energy bands in a solid field of neutrons, since they have a spectrum ranging from a low to a high energy that can also vary within a particular environment. Wishes to obtain new fields with different sources and moderators materials to be used as new reference fields. Measurements are being conducted for these fields, with the aim of analyzing the variability conditions of the measurement (repeatability and reproducibility) in LEN - Laboratorio de Espectrometria de Neutrons of the LN/LMNRI/IRD. Thus, the spectrometer will be used to improve both the knowledge of the spectrum as the standard of neutrons of the lab, proving that a spectrometry is essential for correct measurement.

  18. A revision of Dimocarpus (Sapindaceae)

    NARCIS (Netherlands)

    Leenhouts, P.W.

    1971-01-01

    Dimocarpus Lour., Fl. Coch. (1790) 233. — Lectotype: D. lichi Lour. ( D. longan). Euphoria Auct. non Comm. ex Juss., Gen. (1789) 247, nom. illeg.: Gmel., Syst. Nat. 2 (1791) 611; Radlk., Pfl. R. Heft 98 (1932) 894—910.

  19. Právnický elektronický slovník (PES)

    Czech Academy of Sciences Publication Activity Database

    Cvrček, František

    2015-01-01

    Roč. 154, č. 3 (2015), s. 247-260 ISSN 0231-6625 Institutional support: RVO:68378122 Keywords : legal language * legal dictionaries * linguistic analysis of legal texts Subject RIV: AG - Legal Sciences

  20. Verdine and glaucony facies from surficial sediments of the eastern continental margin of India

    Digital Repository Service at National Institute of Oceanography (India)

    Rao, V.P.; Thamban, M.; Lamboy, M.

    The present paper reports the first mineralogical description of green grains (verdine and glaucony) from sediments of the eastern continental margin of India. Only 24 of the 82 sediment samples studied, at depths between 18 and 247 m, contain green...

  1. Effects of recovery sleep after one work week of mild sleep restriction on interleukin-6 and cortisol secretion and daytime sleepiness and performance

    National Research Council Canada - National Science Library

    Pejovic, Slobodanka; Basta, Maria; Vgontzas, Alexandros N; Kritikou, Ilia; Shaffer, Michele L; Tsaoussoglou, Marina; Stiffler, David; Stefanakis, Zacharias; Bixler, Edward O; Chrousos, George P

    2013-01-01

    .... To assess whether extended recovery sleep reverses the effects of mild sleep restriction on sleepiness/alertness, inflammation, and stress hormones, 30 healthy young men and women (mean age ± SD, 24.7 ± 3.5 yr...

  2. Bezradnost metodologie kosmologie?

    Czech Academy of Sciences Publication Activity Database

    Havlík, Vladimír

    2015-01-01

    Roč. 63, č. 2 (2015), s. 247-266 ISSN 0015-1831 Institutional support: RVO:67985955 Keywords : methodology of science * anomalies * dark energy * dark matter * I. Lakatos * T. Kuhn Subject RIV: AA - Philosophy ; Religion

  3. Potential of cassava flour as a gelling agent in media for plant tissue ...

    African Journals Online (AJOL)

    Administrator

    African Journal of Biotechnology Vol. 3 (4), pp. 244-247, April ... has important applications in plant biotechnology. The technology is ... include micropropagation, virus elimination, plant ... marine algae such as Gelidiella and Gracilaria species.

  4. Ilmus väärt artiklikogumik / Arvo Tering

    Index Scriptorium Estoniae

    Tering, Arvo, 1949-

    2008-01-01

    Arvustus: Ajalookirjutaja aeg = Aetas historicum / Eesti Rahvusraamatukogu ; koost. Piret Lotman. - Tallinn, 2008. - 247 lk. - (Eesti Rahvusraamatukogu toimetised. A, Raamat ja aeg, 1736-6984 ; nr. 1) ; (Eesti Rahvusraamatukogu toimetised ; 11)

  5. Influence of anthropometry on race performance in extreme endurance triathletes: World Challenge Deca Iron Triathlon 2006

    National Research Council Canada - National Science Library

    Knechtle, Beat; Knechtle, Patrizia; Andonie, Jorge Luis; Kohler, Götz

    2007-01-01

    ...) cm and body mass index (BMI) 24.7 (2.2) kg/m2). None. Direct measurement of body mass, height, leg length, skinfold thicknesses, limb circumference and calculation of BMI, skeletal muscle mass (SM), percentage SM (%SM...

  6. DIFERENCIAS EN ESTRÉS PERCIBIDO, SALUD MENTAL Y FÍSICA DE ACUERDO AL TIPO DE RELACIÓN HUMANO-PERRO / DIFFERENCES IN PERCEIVED STRESS, MENTAL HEALTH, AND PHYSICAL HEALTH ACCORDING TO TYPES OF HUMAN-PET DOG RELATIONSHIPS

    National Research Council Canada - National Science Library

    MÓNICA TERESA GONZÁLEZ RAMÍREZ; RENÉ LANDERO HERNÁNDEZ

    2011-01-01

    .... Self-reportquestionnaires were filled out by 247 volunteers owning atleast one dog. The results show lower levels of perceived stressand higher levels of mental health in those individuals whoconsider the dog a member of the family...

  7. Mineral Chemistry of Tourmaline from Mashak Pahar, South Purulia ...

    Indian Academy of Sciences (India)

    9

    Both the types show inclusion of quartz. 180 .... tourmaline in equilibrium with biotite and other minerals (Wolf and London 1997). ... occurrence of disseminated long accessory tourmaline grains within Migmatized quartz tourmaline. 247.

  8. ORF Alignment: NC_006361 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available VVHSSYQ Sbjct: 1 ... RIGAHVRLDSDPIGFGEKLGADVIQMFVVDPQSWDKPVPHPRTEEILASPIDVVVHSSYQ 60 ... Query: 122 QDKGGFAVPILIENTAGGNHAMARHFDM...IGRLWDAVGEFGAGFCLDTCHAWAGGEDLVGV 181 ... QDKGGFAVPILIENTAGGNHAMARHFDMIGRLWDAVGEFGAGFCL...DTCHAWAGGEDLVGV Sbjct: 121 QDKGGFAVPILIENTAGGNHAMARHFDMIGRLWDAVGEFGAGFCLDTCHAWAGGEDLVGV 180 ... Query: 242 EGVADD 247 ... EGVADD Sbjct: 241 EGVADD 246

  9. 48 CFR 1847.305-70 - NASA contract clauses.

    Science.gov (United States)

    2010-10-01

    ... Government assistance is required in the delivery or receipt of the items. (b) The contracting officer shall insert a clause substantially as stated at 1852.247-73, Bills of Lading, in f.o.b. origin solicitations...

  10. Alzheimer's Disease Facts and Figures

    Medline Plus

    Full Text Available alz.org | Find Your Chapter 24/7 Helpline: 1.800.272.3900 Find your chapter: search by state In My Area | Alzheimer's & Dementia | Life with ALZ | Research | Professionals | We ...

  11. Alzheimer's Project

    Medline Plus

    Full Text Available | News | Events | Press | Contact 24/7 Helpline: 1.800.272.3900 Find your chapter: search by state Home > News & Events > Upcoming Events > HBO Alzheimer’s Project In the News Walk to End ...

  12. Gclust Server: 42591 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available 42591 SCE_YOR247W=SRL1 Cluster Sequences Related Sequences(180) 210 Mannoprotein that exhibits a tight...ted Sequences(180) Sequence length 210 Representative annotation Mannoprotein that exhibits a tight associat

  13. 75 FR 24706 - Agency Forms Undergoing Paperwork Reduction Act Review

    Science.gov (United States)

    2010-05-05

    ..., and prevention of physical and mental diseases and impairments of man.'' (2) 42 U.S.C. 247b-4, Section... (for case participants only) administered over the telephone or in-person; (7) a physical exam of the...

  14. A model for the pressure dependence of diffusion in condensed matter

    Indian Academy of Sciences (India)

    Author Affiliations. Kamal Kapoor1 Rashmi Kumari2 Narasingh Dass1 Rajendra Kumar3. Physics Department, College of Engineering Roorkee, Roorkee 247 667, India; Physics Department, IIMT, Meerut, India; Physics Department, Gurukul Kangri Vishwavidyalaya, Haridwar, India ...

  15. SALINITY, WATER TEMPERATURE, FLUORESCENCE, PHOTOSYNTHETIC ACTIVE RADIATION (PAR) and other profile data collected in the Gulf of Alaska on the ALPHA HELIX cruises HX242, HX244 and others as part of the NEP project from 2001-04-18 to 2003-08-11 (NODC Accession 0115255)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NODC Accession 0115255 includes profile, biological and physical data collected aboard the ALPHA HELIX during cruises HX242, HX244, HX247, HX271 and HX275 in the...

  16. Towards a methodology for educational modelling: a case in educational assessment

    NARCIS (Netherlands)

    Giesbers, Bas; Van Bruggen, Jan; Hermans, Henry; Joosten-ten Brinke, Desirée; Burgers, Jan; Koper, Rob; Latour, Ignace

    2005-01-01

    Giesbers, B., van Bruggen, J., Hermans, H., Joosten-ten Brinke, D., Burgers, J., Koper, R., & Latour, I. (2007). Towards a methodology for educational modelling: a case in educational assessment. Educational Technology & Society, 10 (1), 237-247.

  17. A new temperature-dependent equation of state of solids

    Indian Academy of Sciences (India)

    Author Affiliations. Kamal Kapoor1 Anuj Kumar2 Narsingh Dass1. Physics Department, College of Engineering Roorkee, Roorkee 247 667, India; Physics Department, Gurukul Kangri Vishwavidyalaya, Haridwar 249 404, India ...

  18. SILICATE, WATER TEMPERATURE, FLUORESCENCE, PHOTOSYNTHETIC ACTIVE RADIATION (PAR) and other profile and discrete sample data collected in the Gulf of Alaska on the ALPHA HELIX cruises HX242, HX244 and others as part of the NEP project from 2001-04-18 to 2003-08-11 (NODC Accession 0113348)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NODC Accession 0113348 includes profile, discrete sample, biological, chemical and physical data collected aboard the ALPHA HELIX during cruises HX242, HX244, HX247,...

  19. Communication, timing, and common learning

    Czech Academy of Sciences Publication Activity Database

    Steiner, Jakub; Stewart, C.

    2011-01-01

    Roč. 146, č. 1 (2011), s. 230-247 ISSN 0022-0531 Institutional research plan: CEZ:AV0Z70850503 Keywords : common knowledge * learning * communication Subject RIV: AH - Economics Impact factor: 1.235, year: 2011

  20. Drug: D00105 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available 8301] 2 Agents affecting individual organs 24 Hormones 247 Estrogen and progesterone preparations 2473 Estra...(JAN/USP/INN) USP drug classification [BR:br08302] Hormonal Agents, Stimulant/Replacement/Modifying (Sex Hormones

  1. Drug: D00189 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available ng individual organs 24 Hormones 247 Estrogen and progesterone preparations 2479 Others D00189 Pregnanediol ...e as: C05484 Therapeutic category: 2479 Therapeutic category of drugs in Japan [BR:br08301] 2 Agents affecti

  2. Drug: D04070 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available BR:br08301] 2 Agents affecting individual organs 24 Hormones 247 Estrogen and progesterone preparations 2479...ted (USP) USP drug classification [BR:br08302] Hormonal Agents, Stimulant/Replacement/Modifying (Sex Hormones

  3. Drug: D01953 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available sts Therapeutic category of drugs in Japan [BR:br08301] 2 Agents affecting individual organs 24 Hormones 247...monal Agents, Stimulant/Replacement/Modifying (Sex Hormones/Modifiers) Estrogens

  4. Trematodes of fishes of the Indo-west Pacific: told and untold richness

    Czech Academy of Sciences Publication Activity Database

    Cribb, T.H.; Bray, R. A.; Diaz, P.E.; Huston, D.C.; Kudlai, Olena; Martin, S.B.; Yong, R.Q.-Y.; Cutmore, S.C.

    2016-01-01

    Roč. 93, č. 3 (2016), s. 237-247 ISSN 0165-5752 Institutional support: RVO:60077344 Keywords : Great Barrier reef * French Polynesia * Cardicola forsteri Subject RIV: EH - Ecology, Behaviour Impact factor: 1.181, year: 2016

  5. Pramana – Journal of Physics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Author Affiliations. Sonal Singhal1 A K Saxena1 S Dasgupta1. Solid State Devices and VLSI Technology Group, Department of Electronics and Computer Engineering, Indian Institute of Technology Roorkee, Roorkee 247 667, India ...

  6. CHLOROPHYLL A, growth rate and graze rate (or grazing rate) site samples data collected in the Gulf of Alaska on the ALPHA HELIX cruises HX242, HX244 and others as part of the NEP project from 2001-04-18 to 2003-08-10 (NODC Accession 0114241)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NODC Accession 0114241 includes site samples and biological data collected aboard the ALPHA HELIX during cruises HX242, HX244, HX247, HX271 and HX275 in the Gulf of...

  7. Effect of carbon on corrosion resistance of powder-processed Fe–0 ...

    Indian Academy of Sciences (India)

    Metallurgical and Materials Engineering Department, National Institute of Technology Srinagar, Srinagar 190 006, India; Department of Mechanical Engineering, Indian Institute of Technology, New Delhi 110 016, India; Metallurgical and Materials Engineering Department, Indian Institute of Technology, Roorkee 247 667, ...

  8. Sustainable urban water supply in south India: Desalination, efficiency improvement, or rainwater harvesting?

    National Research Council Canada - National Science Library

    Veena Srinivasan; Steven M. Gorelick; Lawrence Goulder

    2010-01-01

    ...; no Indian city provides 24/7 water supply. Current approaches to addressing the problem have been utility centric, overlooking the significance of decentralized activities by consumers, groundwater extraction via private wells, and aquifer...

  9. Microstructure and wear behaviour of FeAl-based composites ...

    Indian Academy of Sciences (India)

    Author Affiliations. RAVI KANT1 UJJWAL PRAKASH1 VIJAYA AGARWALA1 V V SATYA PRASAD2. Department of Metallurgical and Materials Engineering, IIT Roorkee, Roorkee 247 667, India; Defence Metallurgical Research Laboratory, Kanchanbagh, Hyderabad 500 058, India ...

  10. Materials science: Nanomagnets boost thermoelectric output

    Science.gov (United States)

    Boona, Stephen R.

    2017-09-01

    The direct conversion of heat into electricity -- a reversible process known as the thermoelectric effect -- can be greatly enhanced in some materials by embedding them with a small number of magnetic nanoparticles. See Letter p.247

  11. Optimizing feed force for turned parts through the Taguchi

    Indian Academy of Sciences (India)

    Author Affiliations. Hari Singh1 Pradeep Kumar2. Mechanical Engineering Department, National Institute of Technology, Kurukshetra 136 119, India; Department of Mechanical and Industrial Engineering, Indian Institute of Technology, Roorkee 247 667, India ...

  12. Tobacco habits and risk of lung, oropharyngeal and oral cavity cancer: a population-based case-control study in Bhopal, India

    National Research Council Canada - National Science Library

    Dikshit, R P; Kanhere, S

    2000-01-01

    .... In all, 163 lung, 247 oropharyngeal and 148 oral cavity cancer cases from the Population-Based Cancer Registry records and 260 controls randomly selected from a tobacco survey conducted in the Bhopal...

  13. Gclust Server: 92309 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available Syn_sll0094 Cluster Sequences Related Sequences(247) 457 sensory transduction histidine kinase 1 1.00e-99 0.0 0...Sequence length 457 Representative annotation sensory transduction histidine kinase Number of Sequences

  14. Influence of fretting on the fatigue strength at the vise clamp ...

    Indian Academy of Sciences (India)

    Author Affiliations. Abdulhaqq A Hamid1 2 Rafi K Yahya1. Mechanical Engineering Department, College of Engineering, University of Mosul, Mosul, Iraq; Mechanical and Industrial Engineering Department, Indian Institute of Technology, Roorkee 247 667, India ...

  15. The Prevalence of Enterhaemorrhagic Escherichia Coli in children ...

    African Journals Online (AJOL)

    EHEC), the pathogenicity of other strains of Escherichia coli and other organisms in children presenting with and without diarrhoea in the hospital. Subjects and Methods: A total of 247 stool samples collected from children aged 1 month to 7 ...

  16. Motivating the Army Acquisition Workforce

    Science.gov (United States)

    2016-04-07

    characteristics and organizational climate. Journal of Applied Psychology , 71(2), 247–259. doi:10.1037/0021-9010.71.2.247 U.S. General Accounting...and managers constantly deal with the problem of increasing their workforce’s motivation to improve organizational achievement. This is no different...motive theories. Needs theories, such as Abraham Maslow’s hierarchy of needs, are heavily rooted in psychology ; they hold that individuals are motivated

  17. METALLIC AND CERAMIC MATERIALS RESEARCH Task Order 0003: Metallic Materials, Processing and Performance Development for Air Force Applications

    Science.gov (United States)

    2015-10-01

    Solid State Joining 3.3.1.1 Inertia Friction Welding of Dissimilar Superalloys Mar-M247 and LSHR Many advanced applications require different...result in welding defects such as liquation cracking, strain age cracking, etc. In this work, inertia friction welding (IFW) was used to weld two...pp 1628-1633. [15] O.N. Senkov, D.W. Mahaffey, S.L. Semiatin, and C. Woodward, "Inertia Friction Welding of Dissimilar Superalloys Mar-M247and

  18. Circulating cell-free DNA and its integrity as a prognostic marker for breast cancer

    OpenAIRE

    Iqbal, Sobuhi; Vishnubhatla, Sreenivas; Raina, Vinod; Sharma, Surabhi; Gogia, Ajay; Deo, Suryanarayana S V; Mathur, Sandeep; Shukla, Nutan Kumar

    2015-01-01

    The aim of our study was to look for alternative predictive biomarkers for breast cancer management in limited resource setup. A comprehensive analysis of circulating cell-free DNA (CCFD) in serum at baseline was performed to assess its prognostic potential. Quantitative polymerase chain reaction (qPCR) of ALU sequences using ALU115 and ALU247 primers was carried out in patients (N: baseline 148, postoperative 47) and 51 healthy controls. Mean serum DNA integrity, levels of ALU 247 and levels...

  19. Impact of V2 mutations on escape from a potent neutralizing anti-V3 monoclonal antibody during in vitro selection of a primary human immunodeficiency virus type 1 isolate.

    Science.gov (United States)

    Shibata, Junji; Yoshimura, Kazuhisa; Honda, Akiko; Koito, Atsushi; Murakami, Toshio; Matsushita, Shuzo

    2007-04-01

    KD-247, a humanized monoclonal antibody to an epitope of gp120-V3 tip, has potent cross-neutralizing activity against subtype B primary human immunodeficiency virus type 1 (HIV-1) isolates. To assess how KD-247 escape mutants can be generated, we induced escape variants by exposing bulked primary R5 virus, MOKW, to increasing concentrations of KD-247 in vitro. In the presence of relatively low concentrations of KD-247, viruses with two amino acid mutations (R166K/D167N) in V2 expanded, and under high KD-247 pressure, a V3 tip substitution (P313L) emerged in addition to the V2 mutations. However, a virus with a V2 175P mutation dominated during passaging in the absence of KD-247. Using domain swapping analysis, we demonstrated that the V2 mutations and the P313L mutation in V3 contribute to partial and complete resistance phenotypes against KD-247, respectively. To identify the V2 mutation responsible for the resistance to KD-247, we constructed pseudoviruses with single or double amino acid mutations in V2 and measured their sensitivity to neutralization. Interestingly, the neutralization phenotypes were switched, so that amino acid residue 175 (Pro or Leu) located in the center of V2 was exchanged, indicating that the amino acid at position 175 has a crucial role, dramatically changing the Env oligomeric state on the membrane surface and affecting the neutralization phenotype against not only anti-V3 antibody but also recombinant soluble CD4. These data suggested that HIV-1 can escape from anti-V3 antibody attack by changing the conformation of the functional envelope oligomer by acquiring mutations in the V2 region in environments with relatively low antibody concentrations.

  20. Coalition Battle Management Language (C-BML) (Language de gestion du champ de bataille (C-BML)

    Science.gov (United States)

    2012-02-01

    that this style of blended asynchronous-synchronous group communication should be a part of any distributed development activity. 5.1.7 System...LUXEMBOURG Building 247 DANEMARK Voir Belgique Porton Down Danish Acquisition and Logistics Organization (DALO) Salisbury SP4 0JQ Lautrupbjerg 1...247 29, Avenue de la Division Leclerc ul. Ostrobramska 109 Porton Down BP 72, 92322 Châtillon Cedex 04-041 Warszawa Salisbury SP4 0JQ GERMANY

  1. Blue to Green: How Past Energy Transitions Inform the Department of Defense’s Energy Strategy

    Science.gov (United States)

    2012-06-01

    Gasifipedia: Supporting Technologies,” 247 The jatropha plant, jatropha curcas , yields seeds that when crushed, secretes oil that can serve as the feedstock...converts the natural oils from renewable sources such as jatropha , camelina, and algae into middle distillate fuels.247 During hydrotreatment...www.nature.com/news/2007/071010/full/449652a.html (accessed April 13, 2012). Like jatropha , the seeds from the Camelina plant have a high oil

  2. Bacillus zeae sp. nov., isolated from the rhizosphere of Zea mays.

    Science.gov (United States)

    Kämpfer, Peter; Busse, Hans-Jürgen; McInroy, John A; Hu, Chia-Hui; Kloepper, Joseph W; Glaeser, Stefanie P

    2017-05-01

    A Gram-positive-staining, aerobic organism, isolated from the rhizosphere of Zea mays, was investigated in detail. Based on 16S rRNA gene sequence similarity comparisons, strain JJ-247T was grouped into the genus Bacillus, most closely related to Bacillus foraminis (98.4 %). The 16S rRNA gene sequence similarity to the sequences of the type strains of other species of the genus Bacillus was Bacillus. The polar lipid profile contained the major components diphosphatidylglycerol, phosphatidylglycerol, phosphatidylethanolamine and an unidentified aminophospholipid. The major quinone was menaquinone MK-7, and the major polyamine was spermidine. The genomic DNA G+C content of strain JJ-247T was 44.5 mol%. DNA-DNA hybridizations with the type strain B. foraminis LMG 23147T resulted in values below 70 %. In addition, physiological and biochemical test results allowed a clear phenotypic differentiation of strain JJ-247T from B. foraminis. As a consequence, JJ-247T represents a novel species of the genus Bacillus, for which we propose the name Bacillus zeae sp. nov., with JJ-247T (=CCM 8726T=LMG 29876T) as the type strain.

  3. Ionization cross section, pressure shift and isotope shift measurements of osmium

    Science.gov (United States)

    Hirayama, Yoshikazu; Mukai, Momo; Watanabe, Yutaka; Oyaizu, Michihiro; Ahmed, Murad; Kakiguchi, Yutaka; Kimura, Sota; Miyatake, Hiroari; Schury, Peter; Wada, Michiharu; Jeong, Sun-Chan

    2017-11-01

    In-gas-cell laser resonance ionization spectroscopy of neutral osmium atoms was performed with the use of a two-color two-step laser resonance ionization technique. Saturation curves for the ionization scheme were measured, and the ionization cross section was experimentally determined by solving the rate equations for the ground, intermediate and ionization continuum populations. The pressure shift and pressure broadening in the resonance spectra of the excitation transition were measured. The electronic factor {F}247 for the transition {λ }1=247.7583 nm to the intermediate state was deduced from the measured isotope shifts of stable {}{188,189,{190,192}}Os isotopes. The efficient ionization scheme, pressure shift, nuclear isotope shift and {F}247 are expected to be useful for applications of laser ion sources to unstable nuclei and for nuclear spectroscopy based on laser ionization techniques.

  4. Prognostic value of free DNA quantification in serum and cerebrospinal fluid in glioma patients.

    Science.gov (United States)

    Shi, Wei; Lv, Chenglin; Qi, Jing; Zhao, Wei; Wu, Xiujie; Jing, Rongrong; Wu, Xinhua; Ju, Shaoqing; Chen, Jian

    2012-03-01

    Unlike uniformly truncated DNA released from apoptotic nondiseased cells, free DNA released from dead tumor cells varies in size. Free DNA has been considered as a candidate biomarker for malignant tumors. We obtained serum samples from 70 patients with glioma and 22 healthy volunteers as control and cerebrospinal fluid (CSF) samples from 20 patients with glioma and eight nonneoplastic controls with hydrocephalus or arachnoid cyst and performed preoperative analysis of free DNA concentration and integrity by a quantitative polymerase chain reaction. With two primers sets amplifying short and long free DNA fragments (ALU115 and ALU247), free DNA integrity was determined by ratio of the concentration of ALU247 over ALU115 (ALU247/115). Our results indicate that free DNA integrity and the ratio of long fragments to short fragments may be a useful diagnostic assay for glioma. In summary, the CSF-free DNA concentration and integrity may serve as a new marker for the diagnosis of glioma.

  5. Origin of uranium isotope variations in early solar nebula condensates.

    Science.gov (United States)

    Tissot, François L H; Dauphas, Nicolas; Grossman, Lawrence

    2016-03-01

    High-temperature condensates found in meteorites display uranium isotopic variations ((235)U/(238)U), which complicate dating the solar system's formation and whose origin remains mysterious. It is possible that these variations are due to the decay of the short-lived radionuclide (247)Cm (t 1/2 = 15.6 My) into (235)U, but they could also be due to uranium kinetic isotopic fractionation during condensation. We report uranium isotope measurements of meteoritic refractory inclusions that reveal excesses of (235)U reaching ~+6% relative to average solar system composition, which can only be due to the decay of (247)Cm. This allows us to constrain the (247)Cm/(235)U ratio at solar system formation to (1.1 ± 0.3) × 10(-4). This value provides new clues on the universality of the nucleosynthetic r-process of rapid neutron capture.

  6. Evaluation of Heat Capacity and Resistance to Cyclic Oxidation of Nickel Superalloys

    Directory of Open Access Journals (Sweden)

    Przeliorz R.

    2014-08-01

    Full Text Available Paper presents the results of evaluation of heat resistance and specific heat capacity of MAR-M-200, MAR-M-247 and Rene 80 nickel superalloys. Heat resistance was evaluated using cyclic method. Every cycle included heating in 1100°C for 23 hours and cooling for 1 hour in air. Microstructure of the scale was observed using electron microscope. Specific heat capacity was measured using DSC calorimeter. It was found that under conditions of cyclically changing temperature alloy MAR-M-247 exhibits highest heat resistance. Formed oxide scale is heterophasic mixture of alloying elements, under which an internal oxidation zone was present. MAR-M-200 alloy has higher specific heat capacity compared to MAR-M-247. For tested alloys in the temperature range from 550°C to 800°C precipitation processes (γ′, γ″ are probably occurring, resulting in a sudden increase in the observed heat capacity.

  7. Thermophysical properties of nickel-based cast superalloys

    Directory of Open Access Journals (Sweden)

    R. Przeliorz

    2015-07-01

    Full Text Available The article presents tests results of specific heat storage capacity and oxidation resistance of nickel - based cast Mar M - 200, Mar - M - 247 and Rene 80 superalloys. Specific heat measurements were conducted with the use of differential scanning calorimetry (DSC, with the use of high - temperature calorimeter multi (HTC Setaram. Oxidation resistance tests were conducted with the use of cyclic temperature change method. Each cycle consisted of heating by temperature of 1 100 °C and next quick cooling in air. It was proved that the biggest value of specific heat Cp was found in alloy Mar - M - 200, and the lowest in alloy Mar - M - 247. Relatively good oxidation resistance has been found in alloy Mar - M - 247.

  8. Characterizations of a loss-of-function mutation in the Kir3.4 channel subunit

    DEFF Research Database (Denmark)

    Calloe, Kirstine; Ravn, Lasse Steen; Schmitt, Nicole

    2007-01-01

    and two-electrode voltage-clamp revealed that Kir3.4-G247R basal current was reduced compared to wild-type Kir3.4 and co-expression with the muscarinic acetylcholine receptor type 2 showed that also the acetylcholine induced current was severely reduced in Kir3.4-G247R, indicating that the mutation...... the lack of clear clinical manifestations and further studies are necessary to elucidate if mutations in Kir3.4 are predisposing AF. Udgivelsesdato: 2007-Dec-28...

  9. Reversible optic neuropathy with OPA1 exon 5b mutation

    DEFF Research Database (Denmark)

    Cornille, K.; Milea, D.; Amati-Bonneau, P.

    2008-01-01

    A new c.740G>A (R247H) mutation in OPA1 alternate spliced exon 5b was found in a patient presenting with bilateral optic neuropathy followed by partial, spontaneous visual recovery. R247H fibroblasts from the patient and his unaffected father presented unusual highly tubular mitochondrial network......, significant increased susceptibility to apoptosis, oxidative phosphorylation uncoupling, and altered OPA1 protein profile, supporting the pathogenicity of this mutation. These results suggest that the clinical spectrum of the OPA1-associated optic neuropathies may be larger than previously described......, and that spontaneous recovery may occur in cases harboring an exon 5b mutation Udgivelsesdato: 2008/5...

  10. New Antioxidative Secondary Metabolites from the Fruits of a Beibu Gulf Mangrove, Avicennia marina

    Directory of Open Access Journals (Sweden)

    Cheng-Hai Gao

    2014-07-01

    Full Text Available Further chemical investigation of the fruits of the mangrove, Avicennia marina, afforded three new phenylethyl glycosides, marinoids J–L (1–3, and a new cinnamoyl glycoside, marinoid M (4. The structures of isolates were elucidated on the basis of extensive spectroscopic analysis and by comparison of the data with those of related secondary metabolites. The antioxidant activity of the isolates was evaluated using the cellular antioxidant assay (CAA, and compounds 1–4 showed antioxidant activities, with EC50 values ranging from 23.0 ± 0.71 μM to 247.8 ± 2.47 μM.

  11. Gclust Server: 68950 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available 68950 Npun1_NpF2112 Cluster Sequences Related Sequences(583) 247 oxidoreductase, short chain dehydrogenase...0 0.0 0.0 0.0 Show 68950 Cluster ID 68950 Sequence ID Npun1_NpF2112 Link to cluster sequences Cluster Sequences Link to related se...quences Related Sequences(583) Sequence length 247 Represen.../reductase family [Pseudomonas syringae pv. tomato str. DC3000] 1 1.00e-45 0.0 0.0 4....tative annotation oxidoreductase, short chain dehydrogenase/reductase family [Pseudomonas syringae pv. tomat

  12. Circulating cell-free DNA and its integrity as a prognostic marker for breast cancer.

    Science.gov (United States)

    Iqbal, Sobuhi; Vishnubhatla, Sreenivas; Raina, Vinod; Sharma, Surabhi; Gogia, Ajay; Deo, Suryanarayana S V; Mathur, Sandeep; Shukla, Nutan Kumar

    2015-01-01

    The aim of our study was to look for alternative predictive biomarkers for breast cancer management in limited resource setup. A comprehensive analysis of circulating cell-free DNA (CCFD) in serum at baseline was performed to assess its prognostic potential. Quantitative polymerase chain reaction (qPCR) of ALU sequences using ALU115 and ALU247 primers was carried out in patients (N: baseline 148, postoperative 47) and 51 healthy controls. Mean serum DNA integrity, levels of ALU 247 and levels of ALU 115 were significantly higher in patients than in healthy females. No significant differences were observed in the levels ALU 247 and ALU 115 between stage IV and earlier stages of the disease. The DNA integrity was significantly higher in stage IV than earlier stages. A significant decrease in DNA integrity was observed after surgery (pre: 0.55 ± 0.23 vs post: 0.43 ± 0.30; P = 0.002) while no such change could be observed for ALU 247 and ALU 115. Baseline DNA integrity was significantly higher in relapsed patients than in patients who were free of disease (P = 0.005). Higher baseline DNA integrity was also indicated, though statistically not significant, in patients who died (P = 0.14). In contrast, ALU 247 and ALU 115 levels were decreased in died patients as compared to survivors (24.8 ± 34.80 vs 73.5 ± 170.83, P = 0.02 for ALU 247 and 41.0 ± 47.99 vs 159.5 ± 299.54, P = 0.005 for ALU 115). Baseline levels of ALU 115 and ALU 247 were lower in relapsed patients, though statistically not significant. In univariate analysis, the only clinic-pathological parameter associated with disease prognosis was tumor size. The hazards of 5-year overall mortality was 3.60 (95 % CI: 1.03 12.53, P = 0.03) among patients with lower baseline serum levels of CCFD (ALU 247 integrity. Baseline serum levels of CCFD and its integrity were found to be potential prognostic biomarkers in patients of primary breast cancer at our centre.

  13. Speciallægen er ikke i front på de danske akutafdelinger

    DEFF Research Database (Denmark)

    Mackenhauer, Julie; Møller, Cecilie; Fjældstad, Alexander

    2013-01-01

    The Danish health care system is undergoing a major reorganisation, resulting in fewer emergency departments (ED) with consultants in attendance 24/7. This questionnaire-based study evaluates the status of the reorganisation with emphasis on physician attendance and recruitment. 76% of the EDs...... are not staffed by consultants 24/7, 51% report difficulties in recruiting qualified personnel and 33% report problems connected to retaining them. 71% believe that a specialty in emergency medicine could help solve these problems. Danish EDs do not comply with the visions of the reorganisation plan....

  14. Compensated bismuth-loaded plastic scintillators for neutron detection using low-energy pseudo-spectroscopy

    Energy Technology Data Exchange (ETDEWEB)

    Dumazert, Jonathan, E-mail: jonathan.dumazert@cea.fr [CEA, LIST, Laboratoire Capteurs Architectures Electroniques, 91191 Gif-sur-Yvette (France); Coulon, Romain; Bertrand, Guillaume H.V.; Normand, Stéphane [CEA, LIST, Laboratoire Capteurs Architectures Electroniques, 91191 Gif-sur-Yvette (France); Méchin, Laurence [CNRS, UCBN, Groupe de Recherche en Informatique, Image, Automatique et Instrumentation de Caen, 14050 Caen (France); Hamel, Matthieu [CEA, LIST, Laboratoire Capteurs Architectures Electroniques, 91191 Gif-sur-Yvette (France)

    2016-05-21

    Gadolinium-covered modified plastic scintillators show a high potential for the deployment of cost-effective neutron detectors. Taking advantage of the low-energy photon and electron signature of thermal neutron captures in gadolinium-155 and gadolinium-157 however requires a background correction. In order to display a trustable rate, dual compensation schemes appear as an alternative to Pulse Shape Discrimination. This paper presents the application of such a compensation scheme to a two-bismuth loaded plastic scintillator system. A detection scintillator interacts with incident photon and fast neutron radiations and is covered with a gadolinium converter to become thermal neutron-sensitive as well. In the meantime, an identical compensation scintillator, covered with terbium, solely interacts with the photon and fast neutron part of incident radiations. After the acquisition and the treatment of the counting signals from both sensors, a hypothesis test determines whether the resulting count rate after subtraction falls into statistical fluctuations or provides a robust image of neutron activity. A laboratory prototype is tested under both photon and neutron radiations, allowing us to investigate the performance of the overall compensation system. The study reveals satisfactory results in terms of robustness to a cesium-137 background and in terms of sensitivity in presence of a californium-252 source.

  15. Systematic studies of the fundamental chemistry of pyrochlore oxides. An{sub 2}Zr{sub 2}O{sub 7} [An=Pu, Am, Cm, Bk and Cf

    Energy Technology Data Exchange (ETDEWEB)

    Haire, R.G.; Assefa, Z. [Oak Ridge National Laboratory, Oak Ridge, TN (United States); Raison, P.E. [Commissariat a l' Energie Atomique, CEA-Cadarache DRN/DEC/SPUA/LACA (France)

    2002-11-01

    Our efforts to pursue the fundamental science of actinide pyrochlore oxides, An{sub 2}Zr{sub 2}O{sub 7}, (An=plutonium through californium), are presented. We have addressed their structural and chemical behavior via X-ray diffraction, Raman spectroscopy and by considering the pseudo-oxidation potentials of the actinides. The structure, fundamental chemistry, ionic radii and the electronic configuration of the specific actinide involved in these oxide systems all have a significant impact on their science. We are also exploring a calculational approach based on valence-bond relationships to assess the position of the oxygen atoms located at the general crystallographic position. The oxygen position is important regarding the chemical behavior and thermal stability of these materials. Also considered is the structural stability of the materials regarding self-irradiation, and with some compounds, their resistance towards oxidation. These aspects will be discussed using a systematic evaluation of the five-actinide systems together with comparable lanthanide systems studied. (author)

  16. 1982 US-CEC neutron personnel dosimetry intercomparison study

    Energy Technology Data Exchange (ETDEWEB)

    Swaja, R.E.; Sims, C.S.; Greene, R.T.; Schraube, H.; Burger, G.

    1983-11-01

    A neutron personnel dosimetry intercomparison study was conducted during April 19-23, 1982, as a joint effort between the United States and the Commission of European Communities. Dosimeters from 48 participating agencies were mounted on cylindrical phantoms and exposed to a range of low-level dose equivalents (0.48-13.91 mSv neutron and 0.02-1.32 mSv gamma) in nine different radiation fields. Exposure conditions considered in this study included four mixed-field spectra produced using the Health Physics Research Reactor, four monoenergetic neutron fields generated by accelerators, and one 15-cm D/sub 2/O-moderated californium source spectrum. In general, neutron results reported by the participating agencies were consistent with expected dosimeter performance based on energy response characteristics of the detection systems. Albedo dosimeters, which were the most popular neutron monitoring systems used in this study, provided the best overall accuracy for all exposure conditions. Film, Cr-39 recoil track, and Th-232 fission track systems generally underestimated dose equivalents relative to reference values. Associated gamma measurements showed that TLD monitors produced more accurate results than film dosimeters although both systems overestimated gamma dose equivalents in mixed radiation fields. 24 references, 10 figures, 19 tables.

  17. Application of the backward extrapolation method to pulsed neutron sources

    Energy Technology Data Exchange (ETDEWEB)

    Talamo, Alberto; Gohar, Yousry

    2018-01-01

    Particle detectors operated in pulse mode are subjected to the dead-time effect. When the average of the detector counts is constant over time, correcting for the dead-time effect is simple and can be accomplished by analytical formulas. However, when the average of the detector counts changes over time it is more difficult to take into account the dead-time effect. When a subcritical nuclear assembly is driven by a pulsed neutron source, simple analytical formulas cannot be applied to the measured detector counts to correct for the dead-time effect because of the sharp change of the detector counts over time. This work addresses this issue by using the backward extrapolation method. The latter can be applied not only to a continuous (e.g. californium) external neutron source but also to a pulsed external neutron source (e.g. by a particle accelerator) driving a subcritical nuclear assembly. The backward extrapolation method allows to obtain from the measured detector counts both the dead-time value and the real detector counts.

  18. The cross sections of fusion-evaporation reactions: the most promising route to superheavy elements beyond Z=118

    Science.gov (United States)

    Jadambaa, Khuyagbaatar

    2017-11-01

    The synthesis of superheavy elements beyond oganesson (Og), which has atomic number Z = 118, is currently one of the main topics in nuclear physics. An absence of sufficient amounts of target material with atomic numbers heavier than californium (Z = 98) forces the use of projectiles heavier than 48Ca (Z = 20), which has been successfully used for the discoveries of elements with Z = 114 - 118 in complete fusion reactions. Experimental cross sections of 48Ca with actinide targets behave very differently to "cold" and "hot" fusion-evaporation reactions, where doubly-magic lead and deformed actinides are used as targets, respectively. The known cross sections of these reactions have been analysed compared to calculated fission barriers. It has been suggested that observed discrepancies between the cross sections of 48Ca-induced and other fusionevaporation reactions originate from the shell structure of the compound nucleus, which lies in the island of the stability. Besides scarcely known data on other reactions involving heavier projectiles, the most promising projectile for the synthesis of the elements beyond Og seems to be 50Ti. However, detailed studies of 50Ti, 54Cr, 58Fe and 64Ni-induced reactions are necessary to be performed in order to fully understand the complexities of superheavy element formation.

  19. Report to the DOE nuclear data committee. [EV RANGE 10-100; CROSS SECTIONS; PHOTONEUTRONS; NEUTRONS; GAMMA RADIATION; COUPLED CHANNEL THEORY; DIFFERENTIAL CROSS SECTIONS; MEV RANGE 01-10; ; CAPTURE; GAMMA SPECTRA; THERMAL NEUTRONS; COMPUTER CALCULATIONS; DECAY; FISSION PRODUCTS; FISSION YIELD; SHELL MODELS; NUCLEAR DATA COLLECTIONS

    Energy Technology Data Exchange (ETDEWEB)

    Struble, G.L.; Haight, R.C.

    1981-03-01

    Topics covered include: studies of (n, charged particle) reactions with 14 to 15 MeV neutrons; photoneutron cross sections for /sup 15/N; neutron radiative capture; Lane-model analysis of (p,p) and (n,n) scattering on the even tin isotopes; neutron scattering cross sections for /sup 181/Ta, /sup 197/Au, /sup 209/Bi, /sup 232/Th, and /sup 238/U inferred from proton scattering and charge exchange cross sections; neutron-induced fission cross sections of /sup 245/Cm and /sup 242/Am; fission neutron multiplicities for /sup 245/Cm and /sup 242/Am; the transport of 14 MeV neutrons through heavy materials 150 < A < 208; /sup 249/Cm energy levels from measurement of thermal neutron capture gamma rays; /sup 231/Th energy levels from neutron capture gamma ray and conversion electron spectroscopy; new measurements of conversion electron binding energies in berkelium and californium; nuclear level densities; relative importance of statistical vs. valence neutron capture in the mass-90 region; determination of properties of short-lived fission products; fission yield of /sup 87/Br and /sup 137/I from 15 nuclei ranging from /sup 232/Th to /sup 249/Cf; evaluation of charged particle data for the ECPL library; evaluation of secondary charged-particle energy and angular distributions for ENDL; and evaluated nuclear structure libraries derived from the table of isotopes. (GHT)

  20. Activation analysis of ITER blanket first wall

    Energy Technology Data Exchange (ETDEWEB)

    Lopatkin, A.; Muratov, V. [RDIPE (NIKIET), Moscow (Russian Federation)

    1998-09-01

    To analyze the activation of ITER blanket structural components, the authors have prepared the AUCDAS code that calculates changes in nuclide concentrations and radioactivity characteristics during neutron irradiation and during cooling. UCDAS takes into account all neutron reactions and decay types, the prepared library of constants contains nuclear data of nuclides from hydrogen to californium. A comparative analysis of the results as obtained using UCDAS code and the widely known FISPACT code is given. The analysis of decay heat, gas generation and activity of ITER blanket first wall`s structural components was carried out. The beryllium coating, copper alloy and stainless steel were analysed. Calculations were performed for the first plasma burning pulse, 6 months and 1 year of operation in accordance with the ITER scenario. The materials recommended by ITER central team and their Russian analogs were considered: TGR and B1 (beryllium coating), GlidCop AL-25 Ds and Br-MKX (copper alloy), 316LN-IG and 12Cr18Ni10Ti (stainless steel). It has been demonstrated that there is a difference in all of the considered characteristics between the above materials. It is caused by impurities which are present in the materials. The report also considers the accumulation of gases (H, D, T, He{sup 3}, He{sup 4}) in the above materials. Besides, the change in the activity of irradiated materials during the cooling of up to 10{sup 7} years was calculated. (orig.) 7 refs.

  1. Toward achieving flexible and high sensitivity hexagonal boron nitride neutron detectors

    Science.gov (United States)

    Maity, A.; Grenadier, S. J.; Li, J.; Lin, J. Y.; Jiang, H. X.

    2017-07-01

    Hexagonal boron nitride (h-BN) detectors have demonstrated the highest thermal neutron detection efficiency to date among solid-state neutron detectors at about 51%. We report here the realization of h-BN neutron detectors possessing one order of magnitude enhancement in the detection area but maintaining an equal level of detection efficiency of previous achievement. These 3 mm × 3 mm detectors were fabricated from 50 μm thick freestanding and flexible 10B enriched h-BN (h-10BN) films, grown by metal organic chemical vapor deposition followed by mechanical separation from sapphire substrates. Mobility-lifetime results suggested that holes are the majority carriers in unintentionally doped h-BN. The detectors were tested under thermal neutron irradiation from californium-252 (252Cf) moderated by a high density polyethylene moderator. A thermal neutron detection efficiency of ˜53% was achieved at a bias voltage of 200 V. Conforming to traditional solid-state detectors, the realization of h-BN epilayers with enhanced electrical transport properties is the key to enable scaling up the device sizes. More specifically, the present results revealed that achieving an electrical resistivity of greater than 1014 Ωṡcm and a leakage current density of below 3 × 10-10 A/cm2 is needed to fabricate large area h-BN detectors and provided guidance for achieving high sensitivity solid state neutron detectors based on h-BN.

  2. Design of the low energy beam transport line between CARIBU and the EBIS charge breeder

    Energy Technology Data Exchange (ETDEWEB)

    Perry, A., E-mail: aperry4@hawk.iit.edu [Argonne National Laboratory, Argonne, IL 60439, USA and Illinois Institute of Technology, Chicago, IL 60616 (United States); Ostroumov, P. N.; Barcikowski, A.; Dickerson, C.; Kondrashev, S. A.; Mustapha, B.; Savard, G. [Argonne National Laboratory, Argonne, IL 60439 (United States)

    2015-01-09

    An Electron Beam Ion Source Charge Breeder (EBIS-CB) has been developed to breed radioactive beams from the CAlifornium Rare Isotope Breeder Upgrade (CARIBU) facility at ATLAS. The EBIS-CB will replace the existing ECR charge breeder to increase the intensity and improve the purity of reaccelerated radioactive ion beams. The EBIS-CB is in the final stage of off-line commissioning. Currently, we are developing a low energy beam transport (LEBT) system to transfer CARIBU beams to the EBIS-CB. As was originally planned, an RFQ cooler-buncher will precede the EBIS-CB. Recently, it was decided to include a multi-reflection time-of-flight (MR-TOF) mass-spectrometer following the RFQ. MR-TOF is a relatively new technology used to purify beams with a mass-resolving power up to 3×10{sup 5} as was demonstrated in experiments at CERN/ISOLDE. Very high purity singly-charged radioactive ion beams will be injected into the EBIS for charge breeding and due to its inherent properties, the EBIS-CB will maintain the purity of the charge bred beams. Possible contamination of residual gas ions will be greatly suppressed by achieving ultra-high vacuum in the EBIS trap. This paper will present and discuss the design of the LEBT and the overall integration of the EBIS-CB into ATLAS.

  3. Analysis of patents on mining technology

    Energy Technology Data Exchange (ETDEWEB)

    Menyailo, N.I.; Grishchenko, A.N.; Ratner, M.V.; Kobylyanskii, A.Ya.; Tyshlek, E.G.

    1987-09-01

    Analyses the current work being carried out with the aim of developing and perfecting coal mining technology with regard to improving safety and working conditions (equipment is currently responsible for 6.3% of all hazards in coal mines) by examining patents of class ES 21 S produced in the USSR, USA, UK, FRG, Japan and France between 1970-1984. By far the majority of patents is concerned with improving technology and productivity and a disappointing number deals with safety matters (only 7.2% of the patents for new cutter loader designs deal with dust suppression systems and most of these come from the FRG; no patents for powered mining complexes deal with the problem of noise and vibration reduction). The patents with the most direct relevance to health and safety concern remote control devices for mining equipment, in particular, devices based on radioactive isotopes (e.g. cesium-137, americum-241, selenium-75, californium-252) but measures for monitoring them and protecting against them are not found.

  4. MinT: Middleware for Cooperative Interaction of Things

    Directory of Open Access Journals (Sweden)

    Soobin Jeon

    2017-06-01

    Full Text Available This paper proposes an Internet of Things (IoT middleware called Middleware for Cooperative Interaction of Things (MinT. MinT supports a fully distributed IoT environment in which IoT devices directly connect to peripheral devices easily construct a local or global network, and share their data in an energy efficient manner. MinT provides a sensor abstract layer, a system layer and an interaction layer. These enable integrated sensing device operations, efficient resource management, and active interconnection between peripheral IoT devices. In addition, MinT provides a high-level API to develop IoT devices easily for IoT device developers. We aim to enhance the energy efficiency and performance of IoT devices through the performance improvements offered by MinT resource management and request processing. The experimental results show that the average request rate increased by 25% compared to Californium, which is a middleware for efficient interaction in IoT environments with powerful performance, an average response time decrease of 90% when resource management was used, and power consumption decreased by up to 68%. Finally, the proposed platform can reduce the latency and power consumption of IoT devices.

  5. MinT: Middleware for Cooperative Interaction of Things

    Science.gov (United States)

    Jeon, Soobin; Jung, Inbum

    2017-01-01

    This paper proposes an Internet of Things (IoT) middleware called Middleware for Cooperative Interaction of Things (MinT). MinT supports a fully distributed IoT environment in which IoT devices directly connect to peripheral devices easily construct a local or global network, and share their data in an energy efficient manner. MinT provides a sensor abstract layer, a system layer and an interaction layer. These enable integrated sensing device operations, efficient resource management, and active interconnection between peripheral IoT devices. In addition, MinT provides a high-level API to develop IoT devices easily for IoT device developers. We aim to enhance the energy efficiency and performance of IoT devices through the performance improvements offered by MinT resource management and request processing. The experimental results show that the average request rate increased by 25% compared to Californium, which is a middleware for efficient interaction in IoT environments with powerful performance, an average response time decrease of 90% when resource management was used, and power consumption decreased by up to 68%. Finally, the proposed platform can reduce the latency and power consumption of IoT devices. PMID:28632182

  6. An Account of Oak Ridge National Laboratory's Thirteen Research Reactors

    Energy Technology Data Exchange (ETDEWEB)

    Rosenthal, Murray Wilford [ORNL

    2009-08-01

    The Oak Ridge National Laboratory has built and operated 13 nuclear reactors in its 66-year history. The first was the graphite reactor, the world's first operational nuclear reactor, which served as a plutonium production pilot plant during World War II. It was followed by two aqueous-homogeneous reactors and two red-hot molten-salt reactors that were parts of power-reactor development programs and by eight others designed for research and radioisotope production. One of the eight was an all-metal fast burst reactor used for health physics studies. All of the others were light-water cooled and moderated, including the famous swimming-pool reactor that was copied dozens of times around the world. Two of the reactors were hoisted 200 feet into the air to study the shielding needs of proposed nuclear-powered aircraft. The final reactor, and the only one still operating today, is the High Flux Isotope Reactor (HFIR) that was built particularly for the production of californium and other heavy elements. With the world's highest flux and recent upgrades that include the addition of a cold neutron source, the 44-year-old HFIR continues to be a valuable tool for research and isotope production, attracting some 500 scientific visitors and guests to Oak Ridge each year. This report describes all of the reactors and their histories.

  7. Neutron Detector Signal Processing to Calculate the Effective Neutron Multiplication Factor of Subcritical Assemblies

    Energy Technology Data Exchange (ETDEWEB)

    Talamo, Alberto [Argonne National Lab. (ANL), Argonne, IL (United States). Nuclear Engineering Division; Gohar, Yousry [Argonne National Lab. (ANL), Argonne, IL (United States). Nuclear Engineering Division

    2016-06-01

    This report describes different methodologies to calculate the effective neutron multiplication factor of subcritical assemblies by processing the neutron detector signals using MATLAB scripts. The subcritical assembly can be driven either by a spontaneous fission neutron source (e.g. californium) or by a neutron source generated from the interactions of accelerated particles with target materials. In the latter case, when the particle accelerator operates in a pulsed mode, the signals are typically stored into two files. One file contains the time when neutron reactions occur and the other contains the times when the neutron pulses start. In both files, the time is given by an integer representing the number of time bins since the start of the counting. These signal files are used to construct the neutron count distribution from a single neutron pulse. The built-in functions of MATLAB are used to calculate the effective neutron multiplication factor through the application of the prompt decay fitting or the area method to the neutron count distribution. If the subcritical assembly is driven by a spontaneous fission neutron source, then the effective multiplication factor can be evaluated either using the prompt neutron decay constant obtained from Rossi or Feynman distributions or the Modified Source Multiplication (MSM) method.

  8. Fast neutron tomography with real-time pulse-shape discrimination in organic scintillation detectors

    Energy Technology Data Exchange (ETDEWEB)

    Joyce, Malcolm J., E-mail: m.joyce@lancaster.ac.uk [Department of Engineering, Lancaster University, Lancaster, Lancashire LA1 4YW (United Kingdom); Agar, Stewart [Department of Engineering, Lancaster University, Lancaster, Lancashire LA1 4YW (United Kingdom); Aspinall, Michael D. [Hybrid Instruments Ltd., Gordon Manley Building, Lancaster Environment Centre, Lancaster University, Lancaster LA1 4YW (United Kingdom); Beaumont, Jonathan S.; Colley, Edmund; Colling, Miriam; Dykes, Joseph; Kardasopoulos, Phoevos; Mitton, Katie [Department of Engineering, Lancaster University, Lancaster, Lancashire LA1 4YW (United Kingdom)

    2016-10-21

    A fast neutron tomography system based on the use of real-time pulse-shape discrimination in 7 organic liquid scintillation detectors is described. The system has been tested with a californium-252 source of dose rate 163 μSv/h at 1 m and neutron emission rate of 1.5×10{sup 7} per second into 4π and a maximum acquisition time of 2 h, to characterize two 100×100×100 mm{sup 3} concrete samples. The first of these was a solid sample and the second has a vertical, cylindrical void. The experimental data, supported by simulations with both Monte Carlo methods and MATLAB®, indicate that the presence of the internal cylindrical void, corners and inhomogeneities in the samples can be discerned. The potential for fast neutron assay of this type with the capability to probe hydrogenous features in large low-Z samples is discussed. Neutron tomography of bulk porous samples is achieved that combines effective penetration not possible with thermal neutrons in the absence of beam hardening.

  9. Report on the workshop "Decay spectroscopy at CARIBU: advanced fuel cycle applications, nuclear structure and astrophysics". 14-16 April 2011, Argonne National Laboratory, USA.

    Energy Technology Data Exchange (ETDEWEB)

    Kondev, F.; Carpenter, M.P.; Chowdhury, P.; Clark, J.A.; Lister, C.J.; Nichols, A.L.; Swewryniak, D. (Nuclear Engineering Division); (Univ. of Massachusetts); (Univ. of Surrey)

    2011-10-06

    A workshop on 'Decay Spectroscopy at CARIBU: Advanced Fuel Cycle Applications, Nuclear Structure and Astrophysics' will be held at Argonne National Laboratory on April 14-16, 2011. The aim of the workshop is to discuss opportunities for decay studies at the Californium Rare Isotope Breeder Upgrade (CARIBU) of the ATLAS facility with emphasis on advanced fuel cycle (AFC) applications, nuclear structure and astrophysics research. The workshop will consist of review and contributed talks. Presentations by members of the local groups, outlining the status of relevant in-house projects and availabile equipment, will also be organized. time will also be set aside to discuss and develop working collaborations for future decay studies at CARIBU. Topics of interest include: (1) Decay data of relevance to AFC applications with emphasis on reactor decay heat; (2) Discrete high-resolution gamma-ray spectroscopy following radioactive decya and related topics; (3) Calorimetric studies of neutron-rich fission framgents using Total ABsorption Gamma-Ray Spectrometry (TAGS) technique; (4) Beta-delayed neutron emissions and related topics; and (5) Decay data needs for nuclear astrophysics.

  10. The cross sections of fusion-evaporation reactions: the most promising route to superheavy elements beyond Z=118

    Directory of Open Access Journals (Sweden)

    Jadambaa Khuyagbaatar

    2017-01-01

    Full Text Available The synthesis of superheavy elements beyond oganesson (Og, which has atomic number Z = 118, is currently one of the main topics in nuclear physics. An absence of sufficient amounts of target material with atomic numbers heavier than californium (Z = 98 forces the use of projectiles heavier than 48Ca (Z = 20, which has been successfully used for the discoveries of elements with Z = 114 - 118 in complete fusion reactions. Experimental cross sections of 48Ca with actinide targets behave very differently to “cold” and “hot” fusion-evaporation reactions, where doubly-magic lead and deformed actinides are used as targets, respectively. The known cross sections of these reactions have been analysed compared to calculated fission barriers. It has been suggested that observed discrepancies between the cross sections of 48Ca-induced and other fusionevaporation reactions originate from the shell structure of the compound nucleus, which lies in the island of the stability. Besides scarcely known data on other reactions involving heavier projectiles, the most promising projectile for the synthesis of the elements beyond Og seems to be 50Ti. However, detailed studies of 50Ti, 54Cr, 58Fe and 64Ni-induced reactions are necessary to be performed in order to fully understand the complexities of superheavy element formation.

  11. Intracavitary moderator balloon combined with (252)Cf brachytherapy and boron neutron capture therapy, improving dosimetry in brain tumour and infiltrations.

    Science.gov (United States)

    Brandão, S F; Campos, T P R

    2015-07-01

    This article proposes a combination of californium-252 ((252)Cf) brachytherapy, boron neutron capture therapy (BNCT) and an intracavitary moderator balloon catheter applied to brain tumour and infiltrations. Dosimetric evaluations were performed on three protocol set-ups: (252)Cf brachytherapy combined with BNCT (Cf-BNCT); Cf-BNCT with a balloon catheter filled with light water (LWB) and the same set-up with heavy water (HWB). Cf-BNCT-HWB has presented dosimetric advantages to Cf-BNCT-LWB and Cf-BNCT in infiltrations at 2.0-5.0 cm from the balloon surface. However, Cf-BNCT-LWB has shown superior dosimetry up to 2.0 cm from the balloon surface. Cf-BNCT-HWB and Cf-BNCT-LWB protocols provide a selective dose distribution for brain tumour and infiltrations, mainly further from the (252)Cf source, sparing the normal brain tissue. Malignant brain tumours grow rapidly and often spread to adjacent brain tissues, leading to death. Improvements in brain radiation protocols have been continuously achieved; however, brain tumour recurrence is observed in most cases. Cf-BNCT-LWB and Cf-BNCT-HWB represent new modalities for selectively combating brain tumour infiltrations and metastasis.

  12. Intracavitary moderator balloon combined with 252Cf brachytherapy and boron neutron capture therapy, improving dosimetry in brain tumour and infiltrations

    Science.gov (United States)

    Brandão, S F

    2015-01-01

    Objective: This article proposes a combination of californium-252 (252Cf) brachytherapy, boron neutron capture therapy (BNCT) and an intracavitary moderator balloon catheter applied to brain tumour and infiltrations. Methods: Dosimetric evaluations were performed on three protocol set-ups: 252Cf brachytherapy combined with BNCT (Cf-BNCT); Cf-BNCT with a balloon catheter filled with light water (LWB) and the same set-up with heavy water (HWB). Results: Cf-BNCT-HWB has presented dosimetric advantages to Cf-BNCT-LWB and Cf-BNCT in infiltrations at 2.0–5.0 cm from the balloon surface. However, Cf-BNCT-LWB has shown superior dosimetry up to 2.0 cm from the balloon surface. Conclusion: Cf-BNCT-HWB and Cf-BNCT-LWB protocols provide a selective dose distribution for brain tumour and infiltrations, mainly further from the 252Cf source, sparing the normal brain tissue. Advances in knowledge: Malignant brain tumours grow rapidly and often spread to adjacent brain tissues, leading to death. Improvements in brain radiation protocols have been continuously achieved; however, brain tumour recurrence is observed in most cases. Cf-BNCT-LWB and Cf-BNCT-HWB represent new modalities for selectively combating brain tumour infiltrations and metastasis. PMID:25927876

  13. Investigation of Workplace-like Calibration Fields via a Deuterium-Tritium (D-T) Neutron Generator.

    Science.gov (United States)

    Mozhayev, Andrey V; Piper, Roman K; Rathbone, Bruce A; McDonald, Joseph C

    2017-04-01

    Radiation survey meters and personal dosimeters are typically calibrated in reference neutron fields based on conventional radionuclide sources, such as americium-beryllium (Am-Be) or californium-252 (Cf), either unmodified or heavy-water moderated. However, these calibration neutron fields differ significantly from the workplace fields in which most of these survey meters and dosimeters are being used. Although some detectors are designed to yield an approximately dose-equivalent response over a particular neutron energy range, the response of other detectors is highly dependent upon neutron energy. This, in turn, can result in significant over- or underestimation of the intensity of neutron radiation and/or personal dose equivalent determined in the work environment. The use of simulated workplace neutron calibration fields that more closely match those present at the workplace could improve the accuracy of worker, and workplace, neutron dose assessment. This work provides an overview of the neutron fields found around nuclear power reactors and interim spent fuel storage installations based on available data. The feasibility of producing workplace-like calibration fields in an existing calibration facility has been investigated via Monte Carlo simulations. Several moderating assembly configurations, paired with a neutron generator using the deuterium tritium (D-T) fusion reaction, were explored.

  14. Production of medical radioisotopes in the ORNL High Flux Isotope Reactor (HFIR) for cancer treatment and arterial restenosis therapy after PTCA

    Energy Technology Data Exchange (ETDEWEB)

    Knapp, F.F. Jr.; Beets, A.L.; Mirzadeh, S.; Alexander, C.W.; Hobbs, R.L.

    1998-06-01

    The High Flux Isotope Reactor (HFIR) at the Oak Ridge National Laboratory (ORNL) represents an important resource for the production of a wide variety of medical radioisotopes. In addition to serving as a key production site for californium-252 and other transuranic elements, important examples of therapeutic radioisotopes which are currently routinely produced in the HFIR for distribution include dysprosium-166 (parent of holmium-166), rhenium-186, tin-117m and tungsten-188 (parent of rhenium-188). The nine hydraulic tube (HT) positions in the central high flux region permit the insertion and removal of targets at any time during the operating cycle and have traditionally represented a major site for production of medical radioisotopes. To increase the irradiation capabilities of the HFIR, special target holders have recently been designed and fabricated which will be installed in the six Peripheral Target Positions (PTP), which are also located in the high flux region. These positions are only accessible during reactor refueling and will be used for long-term irradiations, such as required for the production of tin-117m and tungsten-188. Each of the PTP tubes will be capable of housing a maximum of eight HT targets, thus increasing the total maximum number of HT targets from the current nine, to a total of 57. In this paper the therapeutic use of reactor-produced radioisotopes for bone pain palliation and vascular brachytherapy and the therapeutic medical radioisotope production capabilities of the ORNL HFIR are briefly discussed.

  15. Loneliness as Related to Various Personality and Environmental Measures: Research with the German Adaptation of the UCLA Loneliness Scale.

    Science.gov (United States)

    Stephan, Ekkehard; And Others

    1988-01-01

    Administered University of California-Los Angeles (UCLA) Loneliness Scale, Freiburg Personality Inventory, and other questions to 247 West German college students. Loneliness was found to be correlated with several personality subscales (psychosomatic complaints, depression, and neuroticism; negative correlation with social skills, self-esteem,…

  16. 'n Begronde bedieningsmodel vir die diakonia van die gemeente

    African Journals Online (AJOL)

    15 Feb 2012 ... 'n model (Pastoral Family Model) (2008:235–237). Hy gee ook belangrike aspekte van die toepassing van die model weer (2008:244–247), maar .... geleenthede is gereël waar lidmate die sinodebesluite kon bespreek, asook die rigting waarin die kerkraad dink met die oog op 'n nuwe bedieningsmodel.

  17. Simple Relationships for Estimating Procurement Cost of U.S. Navy Ship Categories.

    Science.gov (United States)

    1982-03-01

    SSN-589 SCORPION 290 SSN-590 SCULPIN 234 SSN-591 SHARK 273 SSN-592 SNOOK 230 SSN-594 PERMIT 395 SSN-595 PLUNGER 331 SSN-596 BARB 333 SSN-603 POLLACK...SUNFISH 282 SSN-651 QUEENFISH 281 SSN-652 PUFFER 324 SSN-653 RAY 279 SSN-662 GURNARD 333 SSN-663 HAMMERHEAD 235 SSN-664 SEA DEVIL 247 SSN-665 GUITARRO

  18. Micro and nanohardness testing of laser welds

    Czech Academy of Sciences Publication Activity Database

    Šebestová, H.; Čtvrtlík, Radim; Chmelíčková, H.; Tomáštík, J.

    2014-01-01

    Roč. 15, č. 3 (2014), s. 247-253 ISSN 1454-9069 R&D Projects: GA TA ČR TA01010517 Institutional support: RVO:68378271 Keywords : Vickers microhardness * depth sensing indentation * laser welding Subject RIV: JP - Industrial Processing Impact factor: 1.658, year: 2014

  19. Creep properties of simulated heat-affected zone of HR3C austenitic steel

    Czech Academy of Sciences Publication Activity Database

    Sklenička, Václav; Kuchařová, Květa; Kvapilová, Marie; Svoboda, Milan; Král, Petr; Dvořák, Jiří

    2017-01-01

    Roč. 128, JUN (2017), s. 238-247 ISSN 1044-5803 R&D Projects: GA MŠk(CZ) LQ1601 Institutional support: RVO:68081723 Keywords : HR3C steel * Welding * Heat affected zone * Creep * Microstructure * Fractography Subject RIV: JG - Metallurgy Impact factor: 2.714, year: 2016

  20. The origin and early evolution of whales: macroevolution ...

    Indian Academy of Sciences (India)

    2009-10-29

    Oct 29, 2009 ... S Bajpai1 J G M Thewissen2 A Sahni3. Department of Earth Sciences, Indian Institute of Technology, Roorkee 247 677, India; Department of Anatomy and Neurobiology, Northeastern Ohio Universities College of Medicine, Rootstown, Ohio 44272, USA; Geology Department, Panjab University, Chandigarh ...

  1. An Examination of the Meanings of Trademarks and Their Graphic Elements.

    Science.gov (United States)

    Johnson, Edward A.

    A study used semiotics to examine the graphic elements within corporate trademarks. The trademarks from 247 "Fortune" 500 corporations were placed into 86 different categories of graphic elements intended to connote 14 different qualities. Subjects, 40 college students and 61 business professionals, evaluated 9 sets of 12 trademarks in…

  2. Download this PDF file

    African Journals Online (AJOL)

    Prof. Dennis Ocholla

    Green bowling, is well known in many circles of life as the sport of the aged, also known colloquially among. African urban communities as (Umdlalo womagrizza) ... passive recreation activity, it emerged from Figure 4 above that watching television (247 f = 95.1%) and radio listening. (129 f = 49.6%) were the most preferred ...

  3. The Contribution of the Library to the Reputation of a University

    Science.gov (United States)

    Weiner, Sharon

    2009-01-01

    This paper explores the relationship between a peer-assessed reputation rating for each of the 247 doctoral universities and cross-institutional performance indicators for universities and their libraries. Using multiple regression, the variable of library expenditures, was the only consistently significant one using combinations of variables.…

  4. IDRC in Brazil

    International Development Research Centre (IDRC) Digital Library (Canada)

    that help the government promote creativity and entrepreneurship. □ Wage inequalities in Brazil and India. Funding: $247,200. Duration: 2013–2015. Grantee: Centro Brasileiro de Analise e Planejamento, Brazil. Although poverty in Brazil and India has diminished, inequality among wage earners remains high. Think tanks ...

  5. The Relation between Different Facets of Creativity and the Dark Side of Personality

    Science.gov (United States)

    Dahmen-Wassenberg, Phoebe; Kämmerle, Monika; Unterrainer, Human-Friedrich; Fink, Andreas

    2016-01-01

    This study examined the relation between different facets of creativity and personality, focusing on the dark side of personality. In a sample of 247 students, psychometric measures for the assessment of the dark triad of personality (subclinical narcissism, Machiavellianism, subclinical psychopathy), personality organization (structural deficit:…

  6. Composition of raw cow milk and artisanal yoghurt collected in ...

    African Journals Online (AJOL)

    PONKA ROGER

    2013-12-04

    -IDF 152A. Jaubert A, Martin P (1992). Reverse-phase HPLC analysis of goat caseins 72: 235-247. Karman AH, Van Boekel MAJS (1986). Evaluation of the Kjeldahl factor for conversion of the nitrogen content of milk and milk ...

  7. Doing a Good Job - The Effect of Primary Task Quality on Well-Being and Job Satisfaction

    DEFF Research Database (Denmark)

    Sasser, Maja; Sørensen, Ole H.

    2016-01-01

    and thus their assessment of primary task quality. The paper proposes a measure for primary task quality and uses it in the analyses of responses from 1,247 preschool teachers and teaching assistants in 94 public daycare centers in Denmark. The results indicate that an important factor for employees...

  8. Prevalence of Malocclusion among School children

    African Journals Online (AJOL)

    Tope

    Angle's class II div 2 and 1.8% Angle's class III malocclusion. Increased overjet and overbite was observed in 24.7% and 9.8% respectively. Anterior open bite was present in 4.1% while crossbite was found anteriorly and posteriorly in 7% and 4.5% respectively. Crowding in the upper (11.1%) and lower anterior segment ...

  9. EST Table: FY031717 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available FY031717 bmte29g10 11/11/04 56 %/220 aa ref|XP_001603367.1| PREDICTED: hypothetical... protein [Nasonia vitripennis] 11/11/04 41 %/247 aa FBpp0173676|DmojGI24459-PA 11/11/04 36 %/133 aa F52A8.2#CE17

  10. Browse Title Index

    African Journals Online (AJOL)

    Items 51 - 100 of 247 ... Vol 29, No 1 (2016), Insights from Hans Achterhuis Applied to the Violence on LGBT Communities in Uganda, Abstract. Jaco Beyers. Vol 28, No 1 (2015), Interpreting Luguru Religious Practice through Colonialist Eyes: Child Sacrifice and East African Dance in Brett Young's The Crescent Moon ...

  11. Self-help treatment for insomnia through television and book: A randomized trial.

    NARCIS (Netherlands)

    van Straten, A.; Cuijpers, P.; Smit, H.F.E.; Spermon, M.; Verbeek, I.

    2009-01-01

    Objective: Recently, a Dutch educational broadcasting company developed a 6 week self-help course for insomnia, which consists of a book and television programmes. In this study we examined its effects. Methods: 247 subjects with sleep problems were recruited through the media and randomized to the

  12. Alfred Lameli, Roland Kehrein, Stefan Rabanus (eds): Language and Space. An Internatuinal Handbook of Linguistic Variation. Volume 2. Language Mapping. Part , I, II. Berlin - New York 2010: De Gruyer Mouton, I, 668 s., II, 446 s. (ISBN 978-3-11-019609-2, e-ISBN 978-3-11-021916-6)

    Czech Academy of Sciences Publication Activity Database

    Šipková, Milena

    2015-01-01

    Roč. 7, - (2015), s. 247-256. ISBN 978-83-7654-182-2. ISSN 1898-9276 R&D Projects: GA ČR(CZ) GAP406/11/1786 Keywords : language/linguistic maps * language/linguistic atlases * computerization of language mapping Subject RIV: AI - Linguistics

  13. Opportunities for UAV mapping to support unplanned settlement ...

    African Journals Online (AJOL)

    https://www.esciencecenter.nl/project/improving-open-source-photogrammetric- · workflows-for-processing-big-datasets [Accessed 12-01 2016]. Paar, P. & Rekittke, J. 2011. Low-Cost Mapping and Publishing Methods for Landscape Architectural. Analysis and Design in Slum-Upgrading Projects. Future Internet, 3, 228-247.

  14. Sadhana | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Electronic Commerce and Electronic Business. Guest Editors: Y. Narahari and N. R. S. Raghavan. pp 143-247 Volume 29 Issue 2 April 2004 INR 250 USD 50. Multi-Source Multi-Sensor Information Fusion. Guest Editor: Jitendra R. Raol. pp 865-974 Volume 28 Issue 5 October 2003 INR 250 USD 100. Precision Machining.

  15. Gender Differences in Academic Self-Efficacy: A Meta-Analysis

    Science.gov (United States)

    Huang, Chiungjung

    2013-01-01

    A meta-analysis of 187 studies containing 247 independent studies (N = 68,429) on gender differences in academic self-efficacy identified an overall effect size of 0.08, with a small difference favoring males. Moderator analysis demonstrated that content domain was a significant moderator in explaining effect size variation. Females displayed…

  16. Fluorinated Polyurethanes, Synthesis and Properties

    Directory of Open Access Journals (Sweden)

    Olga Smirnova

    2016-07-01

    Full Text Available Fluorinated polyurethanes with a glass transition temperature as low as −139 °C and a decomposition onset temperature of 247–330 °C were prepared by a reaction of fluorinated alcohols with aromatic and cycloaliphatic diisocyanates in solution or melt.

  17. Fluorinated Polyurethanes, Synthesis and Properties

    OpenAIRE

    Olga Smirnova; Alexey Glazkov; Alexander Yarosh; Alexey Sakharov

    2016-01-01

    Fluorinated polyurethanes with a glass transition temperature as low as −139 °C and a decomposition onset temperature of 247–330 °C were prepared by a reaction of fluorinated alcohols with aromatic and cycloaliphatic diisocyanates in solution or melt.

  18. Intra‑Operative Airway Management in Patients with Maxillofacial ...

    African Journals Online (AJOL)

    from the United States, 24.7% in one study from England, 48% in a study from France, and 55.2% in a study from Jordan.[9‑11]. Difficult mask ventilation and difficult intubation are often seen following maxillofacial trauma. The trauma usually disrupts the facial anatomy with associated edema and bleeding in the oral cavity.

  19. Development and characterization of nickel–zinc spinel ferrite for ...

    Indian Academy of Sciences (India)

    Wintec

    Department of Electronics and Computer Engineering, Indian Institute of Technology, Roorkee 247 667, India. MS received 5 January 2008; ... portable wireless devices operating in the ISM band because they are compact, light weight, less ... potential applications, a nickel–zinc spinel ferrite micro- wave absorber has been ...

  20. Computer aided analysis of breast MRI enhancement kinetics using mean shift c lustering and multifeature iterative region of interest selection

    NARCIS (Netherlands)

    Stoutjesdijk, M.J.; Zijp, M.; Hitge-Boetes, C.; Karssemeijer, N.; Barentsz, J.O.; Huisman, H.

    2012-01-01

    PURPOSE: To evaluate automatic characterization of a breast MR lesion by its spatially coherent region of interest (ROI). MATERIALS AND METHODS: The method delineated 247 enhancing lesions using Otsu thresholding after manually placing a sphere. Mean Shift Clustering subdivided each volume, based on

  1. Robotized Warehouse Systems: Developments and Research Opportunities

    NARCIS (Netherlands)

    K. Azadeh (Kaveh); M.B.M. de Koster (René); D. Roy (Debjit)

    2017-01-01

    textabstractRobotized handling systems are increasingly applied in distribution centers. They require little space, provide flexibility in managing varying demand requirements, and are able to work 24/7. This makes them particularly fit for e-commerce operations. This paper reviews new categories of

  2. Kappa-casein gene polymorphism in Holstein and Iranian native ...

    African Journals Online (AJOL)

    Caseins amount to nearly 80% of the protein output in cow milk. Caseins are biologically important proteins and they are also a raw material for the cheese making industry. The aim of this study was to identify kappa-casein genotype in Holstein and Iranian native cattle. DNA was extracted from 457 blood samples of 247 ...

  3. biomedical challenges of human senescence: a review

    African Journals Online (AJOL)

    2002-12-12

    Dec 12, 2002 ... Conclusion: Biological and clinical studies over the past century clearly reflect a better understanding of the major factors ... Understanding the biology of human senescence is a major scientific challenge for both ...... Effect of dietary restriction of ageing-an update. Rev. Clin. Gerontol. I995; 5:247-258.

  4. An Isolator in Image Guide.

    Science.gov (United States)

    1982-05-11

    used to search for 3. Muller’s method is an improvement on Newton’s method. For more detail one should refer to Peter Henrici , "Elements of Numerical...247 ... C IS NOT KNUWN. FOR MORE DETAIL ABOUI MULLER’S METHOD 248 .. C SEE ’ELEMENTS OF NUMERICAL ANALYSIS’ BY PETER HENRICI , 249 .. C JOHN UILEY A

  5. Optimal lysine:DE ratio in growing pigs is independent of starch or fat as main energy source at two energy intake levels

    NARCIS (Netherlands)

    Bruininx, E.M.A.M.; Borne, van den J.J.G.C.; Eising, I.; Vervenne, P.; Sakkas, P.; Gerrits, W.J.J.

    2015-01-01

    In a 2 × 2 factorial arrangement, 28 growing boars (initial BW of 24.7 ± 1.5 kg) were used to examine the effects of energy source (high starch vs. high fat) and DE level (2.2 vs. 2.7 times the DE requirements for maintenance) on Lys requirements. Pigs were allotted to 1 of 4 dietary treatments. A

  6. Interaction between felsic granitoids and basic dykes in ...

    Indian Academy of Sciences (India)

    37

    Geothermal Reserh. 161 (3) 247–260. Jayananda M, Gireesh R, Sekhamo K-U and Miyazaki T 2014 Coeval felsic and mafic magmas in neoarchean calcalkaline magmatic arcs, Dharwar craton, southern India: Field and petrographic evidence from mafic to hybrid magmatic enclaves and synplutonic mafic dykes; J. Geol.

  7. S¯adhan¯a Vol. 38, 2013 Subject Index

    Indian Academy of Sciences (India)

    variable DOF. 247. Gas–liquid phase separation. Entrainment phenomenon in gas–liquid two- phase flow: A review. 1173. Gasification. Biomass-based gasifiers for internal combus- tion (IC) engines—A review. 461. Gauss–Newton method. Flexibility-based structural damage identifica- tion using Gauss–Newton method.

  8. The Role of Individualism-Collectivism in the Individual Creative Process

    Science.gov (United States)

    Yao, Xiang; Wang, Shuhong; Dang, Junhua; Wang, Lei

    2012-01-01

    This study is among the first to examine how individuals' cultural value orientations impact 2 separate stages of creativity: idea generation and idea implementation. A total of 247 Chinese employees completed questionnaires including individualism-collectivism culture orientation and their idea generation behavior. Supervisor ratings of idea…

  9. 77 FR 38859 - Governors' Designees Receiving Advance Notification of Transportation of Certain Shipments of...

    Science.gov (United States)

    2012-06-29

    ... to Stephen N. Salomon, Division of Intergovernmental Liaison and Rulemaking, Office of Federal and..., DC 20555, by email at Stephen[email protected] or by telephone at 301-415-2368. Dated at Rockville... Management Agency, 2720 Martin Luther King, Jr. Avenue, SE, 2nd Floor, Room 247, Washington, DC 20032, (202...

  10. 76 FR 67229 - Governors' Designees Receiving Advance Notification of Transportation of Certain Shipments of...

    Science.gov (United States)

    2011-10-31

    ... to Stephen N. Salomon, Office of Federal and State Materials and Environmental Management Programs, U.S. Nuclear Regulatory Commission, Washington, DC 20555, by email at Stephen[email protected] or by... King, Jr. Avenue, SE, 2nd Floor, Room 247, Washington, DC 20032, (202) 481-3169, Mobile: (202) 375-9506...

  11. 77 FR 8837 - Termination of the Department of Defense Web-Based TRICARE Assistance Program Demonstration

    Science.gov (United States)

    2012-02-15

    ... such as Skype or iChat. TRIAP services are available 24/7 and ADSMs, their spouses of any age, and... such as Skype or iChat to their non-medical counseling service by early 2012. By terminating the TRIAP...

  12. Browse Title Index

    African Journals Online (AJOL)

    Items 151 - 200 of 247 ... Vol 28, No 1 (2015), Religion as Political Instrument: The Case of Japan and South Africa, Abstract. Jaco Beyers. Vol 15, No 2 (2002):, Religion, Culture and Identity in a Democratic Society, Details. Abdulkader Tayob. Vol 27, No 1 (2014), Religion Education, Intercultural Education and Human Rights: ...

  13. Staff Report to the Senior Department Official on Recognition Compliance Issues. Recommendation Page: American Speech-Language-Hearing Association

    Science.gov (United States)

    US Department of Education, 2010

    2010-01-01

    The American Speech-Language-Hearing Association, Council on Academic Accreditation in Audiology and Speech-Language Pathology (CAA) is a national accrediting agency of graduate education programs in audiology or speech-language pathology. The CAA currently accredits or or preaccredits 319 programs (247 in speech-language pathology and 72 in…

  14. Alzheimer's Disease Facts and Figures

    Medline Plus

    Full Text Available alz.org | Find Your Chapter 24/7 Helpline: 1.800.272.3900 Find your chapter: search by ... under age 65 and have younger-onset Alzheimer's. One in 10 people age 65 and older (10 ...

  15. Alzheimer's Disease Facts and Figures

    Medline Plus

    Full Text Available alz.org | Find Your Chapter 24/7 Helpline: 1.800.272.3900 Find your chapter: search by ... a contribution to the nation valued at $230.1 billion. Approximately two-thirds of caregivers are women, ...

  16. Written on the Writer's Face: Facial Width-to-Height Ratio among Nominees and Laureates of the Nobel Prize in Literature

    Science.gov (United States)

    Lebuda, Izabela; Karwowski, Maciej

    2016-01-01

    This study examined the relationship between facial width-to-height ratio (fWHR), an established marker of testosterone level and dominance, and eminent writers' achievement. The fWHR of laureates (N = 39) and nominees (N = 247) of the Nobel Prize in Literature 1901-1950 was measured together with historiometric data. It was demonstrated that…

  17. Rendimiento en forraje de maíces del trópico húmedo de México en respuesta a densidades de siembra

    National Research Council Canada - National Science Library

    Miguel Angel Sánchez Hernández; Cecilio Ubaldo Aguilar Martínez; Nicolás Valenzuela Jiménez; Bertín Maurilio Joaquín Torres; César Sánchez Hernández; María Concepción Jiménez Rojas; Clemente Villanueva Verduzco

    2013-01-01

    .... En promedio de densidades, el criollo tuvo la mayor altura de planta (Exp1=247, Exp2=216 cm), área foliar total (Exp1=5,834, Exp2=7,516 cm2), diámetro de tallo (Exp1=6.6 cm) y rendimiento de forraje...

  18. Md Maidul Islam

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Chemical Sciences. Md Maidul Islam. Articles written in Journal of Chemical Sciences. Volume 122 Issue 2 March 2010 pp 247-257 Full Papers. DNA minor groove binding of small molecules: Experimental and computational evidence · Prateek Pandya Md Maidul Islam G Suresh Kumar B ...

  19. AcEST: DK957364 [AcEST

    Lifescience Database Archive (English)

    Full Text Available N=CAT2... 249 5e-66 sp|P49317|CATA3_NICPL Catalase isozyme 3 OS=Nicotiana plumbagini... 248 1e-65 sp|O24339|CATA_SOLAP...KFYT 128 >sp|O24339|CATA_SOLAP Catalase OS=Soldanella alpina PE=2 SV=1 Length = 492 Score = 247 bits (631),

  20. Acoustic Vector-Sensor Array Processing

    Science.gov (United States)

    2010-06-01

    monomial in ũ , u− u0. Extending the integral into virtual space transforms the covariance function (Equation 2.4.7) into rn(δ) , ∫ +∞ −∞ Gn(u)ρ(u)e...to a phase shift in the other and 2) modulation by a monomial in one domain corresponds to differentiation in the other. Applied in sequence to

  1. Retrospective study of dog bite cases reported to ECWA Veterinary ...

    African Journals Online (AJOL)

    A retrospective study of dog bite cases reported to ECWA Veterinary Clinic Bukuru was carried out in Plateau State, Nigeria to understand the pattern of occurrence in this region. A total of two hundred and forty seven (247) dog bite cases were reported between May, 2009 and June, 2010. The dogs profile showed that ...

  2. Progressive rod-cone degeneration (PRCD) in selected dog breeds and variability in its phenotypic expression

    Czech Academy of Sciences Publication Activity Database

    Dostál, Jaromír; Hrdlicová, Anna; Horák, Pavel

    2011-01-01

    Roč. 56, č. 5 (2011), s. 243-247 ISSN 0375-8427 Institutional research plan: CEZ:AV0Z50450515 Keywords : canine * retinitis pigmentosa * autosomal Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 0.748, year: 2011

  3. INCREASING THE THERMOSTABILITY OF A NEUTRAL PROTEASE BY REPLACING POSITIVELY CHARGED AMINO-ACIDS IN THE N-TERMINAL TURN OF ALPHA-HELICES

    NARCIS (Netherlands)

    Eijsink, Vincent G H; VRIEND, Gerrit; van den Burg, Bertus; van der Zee, J Rob; Venema, Gerard

    The 247-260 and 289-299 alpha-helices of Bacillus subtilis neutral protease have a lysine in their N-terminal turn. These lysines were replaced by Ser or Asp in order to improve electrostatic interactions with the alpha-helix dipole. After replacing Lys by Ser at positions 249 or 290, the

  4. The Elusive China-Japan-South Korea Free Trade Agreement

    Science.gov (United States)

    2015-09-01

    for Strategic & International Studies, Comparative Connections, 15, no. 3 (January 2014): 1. 247 Jun Hongo , “Chilly Abe-Xi Handshake Follows...Countries: Implications for Korea-Japan FTA.” Korea Institute for International Economic Policy, Working Papers, December 30, 2013, 45. Hongo , Jun

  5. Short-term effect of severe drought on veld condition and water use ...

    African Journals Online (AJOL)

    ... respectively, and towards under optimal water conditions, 2.47; 1.67 and 0.23 kg ha -1mm -1, respectively. Keywords: afrikaans; basal cover; botanical composition; botany; composition; decreaser species; drought; efficiency; free state; grasses; grazing; increaser ii species; mortalities; mortality; soil moisture; south africa; ...

  6. Effects of sowing date on the growth and yield of maize cultivars ...

    African Journals Online (AJOL)

    a

    Effects of harvest and sowing time on the performance of the rotation of winter wheat–summer maize in the North China Plain. Ind. Crop. Prod. 25:239-247. Killi F, Altunbay SG (2005). Seed yield, oil content and yield components of confection and oil seed sunflower cultivars. (Helianthus annuus L) planted on different dates.

  7. 48 CFR 47.303-2 - F.o.b. origin, contractor's facility.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false F.o.b. origin, contractor... insert in solicitations and contracts the clause at 52.247-30, F.o.b. Origin, Contractor's Facility, when... REGULATION CONTRACT MANAGEMENT TRANSPORTATION Transportation in Supply Contracts 47.303-2 F.o.b. origin...

  8. Page 1 * Regd. No. KRN-A 41 Vol. 98, No. 3, October 1989 ...

    Indian Academy of Sciences (India)

    M S Narayanam, P K Pal,. P C Joshi, M M Ali and Baby Simon 247. Canonical sound speed profile for the Central Bay of Bengal . . . . . . . . . . . T V Ramana Murty, S Prasanna Kumar, Y K Somayajulu, J S Sastry and. Rui J P De Figueiredo 255. Wave-induced nearshore circulation along the Calangute-Candolim beach,.

  9. Oxygen consumption of the earthworm species .i.Dendrobaena mrazeki./i

    Czech Academy of Sciences Publication Activity Database

    Šustr, Vladimír; Pižl, Václav

    2009-01-01

    Roč. 45, 5-6 (2009), s. 478-482 ISSN 1164-5563 R&D Projects: GA ČR GA206/03/0056 Institutional research plan: CEZ:AV0Z60660521 Keywords : earthworms * Dendrobaena mrazeki * respiration rate Subject RIV: EH - Ecology, Behaviour Impact factor: 1.247, year: 2009

  10. Ecophysiological characterization of carnivorous plant roots: oxygen fluxes, respiration, and water exudation

    Czech Academy of Sciences Publication Activity Database

    Adamec, Lubomír

    2005-01-01

    Roč. 49, č. 2 (2005), s. 247-255 ISSN 0006-3134 R&D Projects: GA AV ČR(CZ) IAA6005909 Institutional research plan: CEZ:AV0Z6005908 Keywords : terrestrial carnivorous plants * soil anoxia * Genlisea traps Subject RIV: EF - Botanics Impact factor: 0.792, year: 2005

  11. Mental Retardation, Mental Illness, and Seizure Diagnosis.

    Science.gov (United States)

    Pary, Robert

    1993-01-01

    Review of psychiatric hospital discharge summaries for 247 individuals with mental retardation and psychiatric disorders found that 39 had a seizure diagnosis. The only difference between the groups with and without seizures was level of mental retardation. No differences existed concerning length of stay, transfer to state hospital, psychiatric…

  12. The Mars Pathfinder atmospheric structure investigation/meteorology (ASI/MET) experiment

    DEFF Research Database (Denmark)

    Schofield, J.T.; Barnes, J.R.; Crisp, D.

    1997-01-01

    The Mars Pathfinder atmospheric structure investigation/meteorology (ASI/MET) experiment measured the vertical density, pressure, and temperature structure of the martian atmosphere from the surface to 160 km, and monitored surface meteorology and climate for 83 sols (1 sol = 1 martian day = 24.7...

  13. Modelling flow through unsaturated zones: Sensitivity to unsaturated ...

    Indian Academy of Sciences (India)

    Author Affiliations. K S Hari Prasad1 2 M S Mohan Kumar1 M Sekhar1. Department of Civil Engineering, Indian Institute of Science, Bangalore 560 012, India; Department of Civil Engineering, Indian Institute of Technology, Roorkee 247 667, India ...

  14. Statistical downscaling and projection of future temperature and ...

    Indian Academy of Sciences (India)

    2Water Resources Systems Division, National Institute of Hydrology, Roorkee 247 667, India. .... It receives water from glaciers and precipitation during summer and ground flow during winter. The salient characteris- tics of the whole Sutlej catchment (up to ...... A decision support tool for the assessment of regional cli-.

  15. Statistical analysis of long term spatial and temporal trends of ...

    Indian Academy of Sciences (India)

    Water Resources Systems Division, National Institute of Hydrology, Roorkee 247 667, India. ∗. Corresponding author. ..... under research. Figure 3. Homogeneity test of observed time series data (TMax and TMin) using double mass-curves method. ...... a decision support tool for the assessment of regional climate change ...

  16. Disruption of the Putative Vascular Leak Peptide Sequence in the Stabilized Ricin Vaccine Candidate RTA1-33/44-198

    Science.gov (United States)

    2013-01-29

    U.S. Navy, the U.S. Department of Defense, or the NIH. References 1. Audi , J.; Belson, M.; Patel, M.; Schier, J.; Osterloh, J. Ricin poisoning: A...Clin. 2005, 21, 815–824. Toxins 2013, 5 247 4. Marsden, C.J.; Smith, D.C.; Roberts , L.M.; Lord, J.M. Ricin: Current understanding and prospects

  17. Functional Interactions Between c-Src and HER1 Potentiate Neoplastic Transformation: Implications for the Etiology of Human Breast Cancer

    Science.gov (United States)

    2000-07-01

    high levels of HER1 are found in the liver and kidney ( Nexo and Kryger-Baggesen, 1989). In the- ory, therefore, the Y845 peptidomimetic might be more...Berndt, M. C., Gorski, J., White, G. C., II., Lyman, S., Paddock, C., and Muller, W. A. (1990). Science 247, 1219-1222. Nexo , E., and Kryger-Baggesen

  18. Bacteraemia due to Escherichia coli in a Danish university hospital, 1986-1990

    DEFF Research Database (Denmark)

    Olesen, B; Kolmos, H J; Orskov, F

    1995-01-01

    433 episodes of E. coli bactereaemia over a 5-year period in a Danish university hospital were studied with special emphasis on possible differences between nosocomial (NO) and community-acquired (CA) cases. Data from 186 males and 247 females with ages ranging from 9 days to 94 years were recorded...

  19. The importance of quality control in validating concentrations of contaminants of emerging concern in source and treated drinking water samples.

    Science.gov (United States)

    A national-scale survey of 247 contaminants of emerging concern (CECs), including organic and inorganic chemical compounds, and microbial contaminants, was conducted in source and treated drinking water samples from 25 treatment plants across the United States. Multiple methods w...

  20. Preliminary findings on vaginal epithelial cells and body ...

    African Journals Online (AJOL)

    Dr Gatsing

    Animal Reproduction. Science, 77(3, 4): 247-259. Mayor P, Galvez H, Guimaraes DA, Lopez-. Gatius F, Lopez-Bejar M. 2005. Serum estradiol-17β, vaginal cytology and vulval appearance as predictors of estrus cyclicity in the female collared peccary. (Tayassu tajacu) from the eastern. Amazon region. Animal Reproduction.

  1. Stay the Course: Managing Online Presence

    Science.gov (United States)

    Fredrick, Kathy

    2009-01-01

    How can a school librarian share instruction and information with students and colleagues in the virtual world? Library Web pages make resources available 24/7. New tools available to schools can also give new options in making a Web presence known. This article suggests a plan for school librarians on how they can manage their libraries' online…

  2. Introduction to the special section: Designing a better user experience for self-service systems

    NARCIS (Netherlands)

    van der Geest, Thea; Ramey, J.; Rosenbaum, S.; van Velsen, Lex Stefan

    2013-01-01

    June 2013 issue of IEEE Transactions on Professional Communication features a special section on 'Designing a Better User Experience for Self-Service Systems'. Self-service systems offers the users the benefit of 24/7 access to an ever-growing range of services and perhaps also a strong sense of

  3. ANTI-RHEUMATIC FORMULATIONS FROM AYURVEDA

    Science.gov (United States)

    Raut, A. A.; Joshi, A. D.; Antarkar, D. S.; Joshi, V. R.; Vaidya, A. B.

    1991-01-01

    Rheumatic disorders like Amavata, Sandhivata and Vatarakta are elaborately described in ayurvedic literature. Preliminary survey of literature shows that about 247 formulations are recommended for these rheumatic disorders. These formulations generally include guggulu compounds, compounds of plant powders, decoctions, medicated ghees, oils, electuaries etc. Therapeutic potential of ayurvedic concepts and a brief review of Ayurvedic formulations are also discussed. PMID:22556565

  4. Experiment list: SRX861686 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available 8,4.5,1274 GSM1598226: wz247 input; Homo sapiens; ChIP-Seq source_name=Human prostate tumor || tissue=resist...ant prostate tumor (TURP) || antibody=none (input) || tumor id=mix TURP http://dbarchive.biosciencedbc.jp/ky

  5. The Relationships between Shyness and Unsociability and Peer Difficulties: The Moderating Role of Insecure Attachment

    Science.gov (United States)

    Chen, Bin-Bin; Santo, Jonathan Bruce

    2016-01-01

    The main purpose of the study was to examine the moderating role of the insecure mother-child attachment in the relations between social withdraw and peer difficulties. Participants were 487 urban children (247 boys, 240 girls) in elementary schools in Shanghai, the People's Republic of China. Data on attachment-relevant coping styles in insecure…

  6. Amarjit Singh, Dr

    Indian Academy of Sciences (India)

    Amarjit Singh, Dr Ph.D. (Harvard). Date of birth: 19 November 1924. Specialization: Millimeter Wave Tubes, Microwave Tubes and Microwave Electronics Address: 12, Auburn Court, Vernon Hills, IL 60061, USA Contact: Residence: (+1-847) 247 9260. Email: amarjitsingh@ieee.org. YouTube; Twitter; Facebook; Blog ...

  7. Math-Gender Stereotypes in Elementary School Children

    Science.gov (United States)

    Cvencek, Dario; Meltzoff, Andrew N.; Greenwald, Anthony G.

    2011-01-01

    A total of 247 American children between 6 and 10 years of age (126 girls and 121 boys) completed Implicit Association Tests and explicit self-report measures assessing the association of (a) "me" with "male" (gender identity), (b) "male" with "math" (math-gender stereotype), and (c) "me" with "math" (math self-concept). Two findings emerged.…

  8. Supplemental Student Support: Detection and Identification of Buried Targets using Time Reversal Acoustics

    Science.gov (United States)

    2009-11-04

    manmade systems. Perhaps the earliest recorded discussion of a resonant system is that of Galileo Galilei who, in 1602, wrote a letter within which...subfigure is scaled to the maximum value recorded in (b). 247 Bibliography [1] Favaro, A., ed. Le opere di Galileo Galilei . Vol. 10. 1890-1909

  9. Effect of Therapist Color-Blindness on Empathy and Attributions in Cross-Cultural Counseling

    Science.gov (United States)

    Burkard, Alan W.; Knox, Sarah

    2004-01-01

    Empathy and attributions of client responsibility for the cause of and solution to a problem were examined for 247 psychologists who were identified as having low, moderate, and high color-blind racial attitudes. Participants responded to 1 of 4 vignettes that controlled for client race (i.e., African American, European American) and client…

  10. Helicobacter Pylori Transmission and Risk Factors for Infection in Rural China

    Science.gov (United States)

    1999-12-08

    patients aged HP prevalence similar for Asian vegans Weaben: Subjects not representative of 1992246 18-70 (36%) and Asian meateaters (32%) general...Helicobacter pylori infection in vegans and meat- eaters. EpidemioLinfect. 1992; 108:457-462. 247. Malaty HM. Engstrand Lt Pedersen NL. Graham DY

  11. Multimodal Surveillance : Behavior analysis for recognizing stress and aggression

    NARCIS (Netherlands)

    Lefter, I.

    2014-01-01

    Nowadays, camera systems are installed in military areas as well as in public spaces like schools, shopping malls, airports, and football stadiums. Human operators are monitoring the screens, looking for any signs of unwanted behavior and negative incidents. The task requires working personnel 24/7.

  12. A Case of TMI (Too Much Information): Improving the Usability of the Library's Website through the Implementation of LibAnswers and the A-Z Database List (LibGuides v2)

    Science.gov (United States)

    Tobias, Christine

    2017-01-01

    The Michigan State University (MSU) Libraries' Website has a case of TMI: too much information organized by librarians for librarians. Finding relevant information about various library services, including the 24/7 Distance Learning Support Line, and access points to scholarly resources is often cumbersome, and given the limited time and staffing…

  13. Air Launch Characteristics of the MQM-74C Target Drone from DC-130A Airplane

    Science.gov (United States)

    1975-01-09

    are defined in reference (b). ENGINE CHARACTERISTICS The WR24-7 is a target drone turbojet engine. It is housed in the aft fusel - age with the air...installed position on the pylon (-3 ’egrees with respect to the aircraft fusel - age reference line). The installed coefficients vary as the DC-130A

  14. Job Satisfaction Related to Tested Congruence and Differentiation.

    Science.gov (United States)

    Wiggins, James D.; And Others

    1983-01-01

    Studied personality-environment congruence and differentiation, singly and in combination, as measured by the Vocational Preference Inventory. Results indicated that these variables predicted reported job satisfaction for 247 teachers employed in five subject matter areas. Time-related variables and sex were not significantly related to job…

  15. On-Demand Grades: The Effect of Online Grade Book Access on Student Mastery and Performance Goal Orientations, Grade Orientation, Academic Self Efficacy, and Grades

    Science.gov (United States)

    Seldow, Adam Lowell

    2010-01-01

    With the widespread growth of broadband Internet access, teachers, and in many cases, schools and school districts are transitioning from traditional paper-based grade books to student accessible online (Web-based) grade books. Online grade books offer students 24/7, on demand access to grades and various other student data, and have the potential…

  16. Direct and maternal variance component estimates for clean fleece ...

    African Journals Online (AJOL)

    ... -3.17o en -2.47o vir LG, SVG en GVD, respektiewelik. Daar word tot die gevolgtrekking gekom dat die maternale komponent weens die relatiewe klein effek op hierdie eienskappe, geigno- reer kan word. Keywords: Merino sheep, maternal variance, variance components. *To whom correspondence should be addressed.

  17. Complete genome sequence of sweet potato latent virus and its relationship to other potyviruses infecting sweet potato

    Science.gov (United States)

    The complete genome of sweet potato latent virus (SPLV) was determined to be 10,081 nucleotides long, excluding the 3’ poly (A) tail. The genome contains a single large open reading frame encoding a polyprotein of 3,247 amino acids. Its genomic organization is typical of potyviruses and contains mot...

  18. Management and use of dairy cattle feed resources on smallholder certified organic pineapple farms in Central Uganda

    DEFF Research Database (Denmark)

    Kiggundu, Muhammad; Kabi, Fred; Vaarst, Mette

    2014-01-01

    as major dairy cattle feed resources while only 19% reported using elephant grass. Banana peels (25.1%) and sweet potato vines (24.7%) were the most important crop residues fed to cattle. Farmers reported high cost of concentrates and scarcity of feeds as their biggest challenges in dairy cattle production...

  19. Decline in snowfall in response to temperature in Satluj basin ...

    Indian Academy of Sciences (India)

    1Department of Earth Sciences, Indian Institute of Technology, Roorkee 247 667, India. 2Geological Survey of India, State Unit: J&K, Srinagar, 190 008, India. 3National Institute ...... Jaagus J 2006 Climatic changes in Estonia during the sec- ond half of the 20th century in relationship with changes in large-scale atmospheric ...

  20. Dating Infidelity: Behaviors, Reasons and Consequences.

    Science.gov (United States)

    Roscoe, Bruce; And Others

    1988-01-01

    Surveyed older adolescents (N=247) regarding behaviors which constitute infidelity in a dating relationship, reasons for a dating partner to be unfaithful, and reactions to a dating partner's infidelity. Found responses to dating infidelity and extramarital affairs similar with regard to behaviors, causes and consequences. Results suggest…

  1. Science, Technology and Arts Research Journal - Vol 4, No 2 (2015)

    African Journals Online (AJOL)

    Treatment of Sugar Industry Effluent using Microbial Fuel Cells · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. MPD Prasad, V Sridevi, N Aswini, A Vamsi Krishna Reddy, PA Satyanarayana, 247-251. http://dx.doi.org/10.4314/star.v4i2.34 ...

  2. AcEST: BP914963 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 6QAC7|SECA_SULNB Protein translocase subunit secA OS=Sulfuro... 30 7.4 sp|Q751J3|... Sbjct: 213 GLMCRYIIQNRLSEVEQLKGFD--LGGYWFDPTSSSE 247 >sp|A6QAC7|SECA_SULNB Protein translocase subunit secA OS=Sulfuro

  3. Stilbenoids from Dendrobium plicatile

    OpenAIRE

    Chie, Honda; MASAE, YAMAKI; Faculty of Pharmaceutical Sciences, Mukogawa Women's University

    2001-01-01

    From Dendrobium plicatile, four Stilbenoids, 3-hydroxy-2,4,7-trimethoxyphenanthrene, 7- hydroxy-2,3,4-trimethoxy-9,10-dihydrophenanthrene, 2,5-dihydroxy-4-methoxy-9,10-dihydrophenanthrene and 3, 3',5-trihydroxybibenzyl, were isolated with five known stilbenoids. Their structures were determined on the basis of their spectral data.

  4. Bulletin of Materials Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science. C P Vinod. Articles written in Bulletin of Materials Science. Volume 25 Issue 3 June 2002 pp 247-249 Experimental Techniques. A method employing STM for the estimation of relative changes in the work function of modified metal tips · R B Sharma C P Vinod G U Kulkarni.

  5. The Mentoring Relationship as an Educational Experience.

    Science.gov (United States)

    Bova, Breda Murphy; Phillips, Rebecca R.

    A study conducted at the University of New Mexico determined what proteges learned from their mentors and how they learned it. The subjects, 247 men and women in professional associations and graduate programs, completed a questionnaire. Survey findings suggested that proteges learned four categories of skills from their mentors: risk-taking…

  6. Cyberbullying: Taking Control through Research-Based Letter Writing

    Science.gov (United States)

    Connolly, Maureen; Giouroukakis, Vicky

    2012-01-01

    According to a 2009 AP-MTV survey of 1,247 people ages 14-24, 50% of those surveyed have experienced cyberbullying (Gatti 1). Victims were twice as likely to need help from a mental health professional and were three times more likely to drop out of school than those surveyed who did not report being cyberbullied (5). Given this alarming social…

  7. Nnamdi Azikiwe University Journal of International Law and ...

    African Journals Online (AJOL)

    A review of the evolution of the international legal framework for the control of illicit dealings on narcotic drugs and psychotropic substances · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Amaka G Eze, 242-247 ...

  8. Poisoning and Intoxication by Trace Elements in Children. An Abstract Review of the Worldwide Medical Literature 1966-1971.

    Science.gov (United States)

    Public Health Service (DHEW), Washington, DC. Bureau of Community Environmental Management.

    This annotated bibliography of 247 entries is divided into the following categories: (a) general aspects and reviews; (b) sources of poisoning, epidemiology, and pica studies; (c) clinico-pathological studies; (d) diagnosis and screening; (e) laboratory methods; and (f) treatment and prevention. A subject and author index is included. (PD)

  9. "Something's Gotta Give:" Advanced-Degree Seeking Women's Experiences of Sexism, Role Overload, and Psychological Distress

    Science.gov (United States)

    West, Lindsey M.

    2014-01-01

    With the rise in advanced-degree seeking women and the minimal research on the dual impact of sexism and role overload, the current study aims to better understand the impact of sexism and role overload on psychological distress in a particular sample of advanced-degree seeking women. Seventy-six female medical student participants (mean age 24.7)…

  10. Towards Optimization of Macrocognitive Processes: Automating Analysis of the Emergence of Leadership in Ad Hoc Teams

    Science.gov (United States)

    2014-04-21

    of Health Information Technology Change Over Time: A Study of Tele- ICU Functions." Applied Clinical Informatics. Vol. 3, 239-247. Mayfield, E...Health and Rehabilitation Sciences, Ohio State University College of Medicine. Press Coverage and Other Publicity • Rose, Interactive TV appearance

  11. 78 FR 16526 - Endangered and Threatened Wildlife and Plants; Draft Revised Recovery Plan for Pallid Sturgeon

    Science.gov (United States)

    2013-03-15

    .... Submit comments on the draft recovery plan to the Project Leader at this same address. An electronic copy... . FOR FURTHER INFORMATION CONTACT: Project Leader, at the above address, or telephone 406-247-7365... strategy for the pallid sturgeon focuses on the need to better understand certain life history traits and...

  12. Download this PDF file

    African Journals Online (AJOL)

    Patel J, NemotoT, Rosner D, Dao TL. Pickren JW. Axillary lymph node metastasis from an occult breast cancer. Cancer 1981; 47: 2923-2927. 10. Beller FK, Nienhaus H, Niedner W,. Holzgreve W. Bilateral breast cancers: the frequency of undiagnosed cancers. Am J. Obstet Gynecol 1986; 155: 247-253. 11. Halsted W. The ...

  13. Browse Title Index

    African Journals Online (AJOL)

    Items 151 - 200 of 247 ... Issue, Title. Vol 3, No 4 (2008), New gaussian points for the solution of first order ordinary differential equations, Abstract PDF. J.P Chollom, S.E Madugu. Vol 10, No 1 (2015), Nuclear and Atomic Methods Applied in the Determination of Some Heavy Polluting Elements in Some Soil Samples around ...

  14. Escherichia coli bacteraemia in patients with and without haematological malignancies

    DEFF Research Database (Denmark)

    Olesen, B; Kolmos, H J; Orskov, F

    1998-01-01

    We compared serotypes, virulence factors and susceptibility to antibiotics of Escherichia coli strains isolated from 282 patients with bacteraemia. Thirty-five of these were neutropenic patients with haematological malignancy and 247 were patients with a normal or raised total white blood cell co...

  15. A c Asses cultiva sment rs usin t of gen ng sim netic d mple se ...

    African Journals Online (AJOL)

    SAM

    2014-08-07

    Aug 7, 2014 ... st PIC value (0. 74, RM 247, R or 39 genoty c diversity, sim ssistedselect to obtain info ce subspecie dentification k logical param s are not al btained with es, suppleme us genes of e ure are repeat to another by g methodolog e time consum umadevitnau@ remain perman. 4 e netic d mple se vi*, P. Veer.

  16. Download this PDF file

    African Journals Online (AJOL)

    ALADDIN

    2011-10-03

    Oct 3, 2011 ... of kernels per panicle, number of filled kernels and grain yield per plant, and specific combining ability. (SCA) effect was ..... Establishment of a rice protoplast culture and application of an asymmetric protoplast fusion technique to hybrid rice breeding. Plant. Tissue Cult. Lett. 13: 243-247. Ganesan KN ...

  17. Some Crandall–Rabinowitz type results and applications toreaction–diffusion systems

    Czech Academy of Sciences Publication Activity Database

    Väth, Martin

    2018-01-01

    Roč. 458, č. 2 (2018), s. 1324-1343 ISSN 0022-247X Institutional support: RVO:67985840 Keywords : Crandall–Rabinowitz theorem * jumping nonlinearity * splitting of critical point Subject RIV: BA - General Mathematics Impact factor: 1.064, year: 2016 http://www.sciencedirect.com/science/ article /pii/S0022247X17309319?via%3Dihub

  18. Preservice Teachers' Internet Addiction in Terms of Gender, Internet Access, Loneliness and Life Satisfaction

    Science.gov (United States)

    Demirer, Veysel; Bozoglan, Bahadir; Sahin, Ismail

    2013-01-01

    The aim of this study is to investigate pre-service teachers' Internet addiction in terms of gender, Internet accessibility, loneliness and life satisfaction. Statistical analyses were completed on the data by the 247 preservice teachers that filled the surveys completely. According to findings, pre-service teachers' level of loneliness and…

  19. File list: Pol.Epd.50.RNA_polymerase_II.AllCell [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Pol.Epd.50.RNA_polymerase_II.AllCell hg19 RNA polymerase RNA polymerase II Epidermi...247,SRX080162,SRX807622 http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/Pol.Epd.50.RNA_polymerase_II.AllCell.bed ...

  20. Gender Equity Instruction in Teacher Education: What Do Students Learn? What Do Faculty Teach? What Are the Influences?

    Science.gov (United States)

    Pryor, Sherrill Evenson; Mader, Cynthia E.

    This study examined preservice teachers' perceptions of gender-related knowledge sources, faculty attitudes, and preferred curricular approaches in gender-equity instruction. The study also examined faculty perceptions of facilitators and barriers to gender-equity instruction. Participants were 758 preservice teachers at three universities and 247

  1. An effective method for extraction and polymerase chain reaction ...

    African Journals Online (AJOL)

    root

    –3555. Chase MR, Etter RJ, Rex MA, Quattro JM (1998). Extraction and amplification of mitochondrial DNA from formalin-fixed deep-sea molluscs. Biol. Technol. 24: 243–247. Chaw YM, Crane LE, Lange P, Shapiro R (1980). Isolation and.

  2. Møller's energy in the dyadosphere of a charged black hole

    Indian Academy of Sciences (India)

    black hole. OKTAY AYDOGDU and MUSTAFA SALTI. (Pramana – J. Phys. 67, 239–247 (2006)). We have added references which had been missed in our article and have refreshed the reference list. We list below the new references and point out the place where these have been added. • S S Xulu, gr-qc/0304081 (ref.

  3. Chemical nature of catalysts of oxide nanoparticles in environment ...

    Indian Academy of Sciences (India)

    DOI 10.1007/s12034-016-1308-6. Chemical nature of catalysts of oxide nanoparticles in environment prevailing during growth of carbon nanostructures by CCVD. M JANA1,∗, ASIL1 and S RAY1,2. 1Department of Metallurgical and Materials Engineering, Indian Institute of Technology Roorkee, Roorkee 247 667, India.

  4. Stabilization of chromium salt in ordinary portland cement

    Indian Academy of Sciences (India)

    ent methods: differential microcalorimetry, conductometry and FTIR analysis. The main aim of this study is to ... Cement pastes for FTIR analysis were hydrated 28 days in a thermostat at a temperature of. 20. ◦. C. After this curing time they were .... additions containing concrete composites. J. Hazard. Mater. 160: 247–255.

  5. 48 CFR 2152.070 - Applicable clauses.

    Science.gov (United States)

    2010-10-01

    ...-23Assignment of Claims 52.232-33Payment by Electronic Funds Transfer—Central Contractor Registration 52.233... 52.242-13Bankruptcy 52.244-5Competition in Subcontracting 52.245-2Government Property (Fixed-Price Contracts) 52.246-4Inspection of Services—Fixed Price 52.246-25Limitation of Liability—Services 52.247...

  6. Mobile Learning: At the Tipping Point

    Science.gov (United States)

    Franklin, Teresa

    2011-01-01

    Mobile technologies are interfacing with all aspects of our lives including Web 2.0 tools and applications, immersive virtual world environments, and online environments to present educational opportunities for 24/7 learning at the learner's discretion. Mobile devices are allowing educators to build new community learning ecosystems for and by…

  7. Gclust Server: 200020 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available 200020 PPT_80957 Cluster Sequences - 247 fgenesh1_pg.scaffold_90000099; no annotation 1 1.00e-99 14.29...29 0.0 0.0 0.0 0.0 0.0 Show 200020 Cluster ID 200020 Sequence ID PPT_80957 Link to cluster sequences

  8. Gclust Server: 164545 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available 164545 Fal_FRAAL0557 Cluster Sequences - 247 hypothetical protein 1 1.00e-99 0.0 0.0 0.0 0.0 3.23 0.0...0 Show 164545 Cluster ID 164545 Sequence ID Fal_FRAAL0557 Link to cluster sequences Cluster Sequences

  9. PDCD1 genes may protect against extraocular manifestations in Chinese Han patients with Vogt-Koyanagi-Harada syndrome

    NARCIS (Netherlands)

    Meng, Q.L.; Liu, X.L.; Yang, P.Z.; Hou, S.P.; Du, L.P.; Zhou, H.Y.; Kijlstra, A.

    2009-01-01

    Purpose: To analyze the potential association of programmed cell death 1 (PDCD1) with Vogt-Koyanagi-Harada (VKH) syndrome in a Chinese Han population. Methods: Three single nucleotide polymorphism (SNPs), PD-1.3G/A, PD-1.5C/T, and PD-1.6G/A, were genotyped in 247 VKH patients and 289 age-, sex-, and

  10. Why So Conventional? America’s Propensity to Wage Traditional Large-Scale Warfare

    Science.gov (United States)

    2013-12-01

    to South Vietnam, Henry Cabot Lodge, cabled Kennedy “[t]he prospects now are for a shorter war.”247 The political stability and effectiveness that...destroy operations were not working.258 The U.S. ambassador to South Vietnam, Henry Cabot Lodge, so opposed Westmoreland’s attrition strategy he

  11. Role of Household Members in Kolanut Production and Marketing in ...

    African Journals Online (AJOL)

    E M IGBOKWE

    Constraints to kolanut production and marketing were group into .... To ascertain household roles in kola nut production and marketing, activities on kola ..... and in the right place. 0.279 0.247 0.672. Inadequate information on kola production in the study area. 0.282 0.218 0.726. Unavailability of labour to carry out essential ...

  12. Regularity criterion for solutions to the Navier Stokes equations in the whole 3D space based on two vorticity components

    Czech Academy of Sciences Publication Activity Database

    Guo, Z.; Kučera, P.; Skalák, Zdeněk

    2018-01-01

    Roč. 458, č. 1 (2018), s. 755-766 ISSN 0022-247X R&D Projects: GA ČR GA13-00522S Institutional support: RVO:67985874 Keywords : Navier Stokes equations * conditional regularity * regularity criteria * vorticity * Besov spaces * bony decomposition Subject RIV: BA - General Mathematics Impact factor: 1.064, year: 2016

  13. Breeding biology and behavior of Hammond's and western flycatchers in northwestern California

    Science.gov (United States)

    H.F. Sakai

    1988-01-01

    The Hammond's (Empidonax hammondii) and Western (E. difficilis) flycatchers are sympatric within portions of their breeding ranges in north- western California. Westerns are common in a variety of habitats (Bent 1942:247, Johnson 1980:11-23); Hammond's are more abundant at higher elevations (Bent 1942:226, Johnson...

  14. The Impact of Science Teachers' Beliefs on Teaching Science: The Case of Saudi Science Teachers

    Science.gov (United States)

    Alabdulkareem, Saleh Abdullah

    2016-01-01

    The researcher aims to investigate Saudi science teachers' beliefs about learning and teaching issues. The sample consisted of 247 middle school teachers in Riyadh, Saudi Arabia. The study conducted in the academic school year 2014/2015, and utilized a questionnaire and an interview that included 10% of the sample. The questionnaire targeted the…

  15. A small, 1400 deg Kelvin, reactor for Brayton space power systems

    Science.gov (United States)

    Lantz, E.; Mayo, W.

    1972-01-01

    A preliminary cost estimate for a small reactor in Brayton space power systems with (u-233)n or (pu-239)n as the fuel in the T-111 fuel elements totaled to about four million dollars; considered is a 22.8 in. diameter reactor with 247 fuel elements.

  16. In vitro Evaluation of Trimethoprim and Sulfamethoxazole from Fixed ...

    African Journals Online (AJOL)

    trimethoprim (TMP) and sulfamethoxazole (SMX) from fixed-dose combination generic products using a flow-through cell technique. Methods: Absorbance measurement was achieved at 247.8 and 257.9 nm for trimethoprim and sulfamethoxazole, respectively. USP Apparatus 4 with 22.6 mm cells, laminar flow at 16 ml/min, ...

  17. 1311-IJBCS-Article-Ifeany Ichukwu M

    African Journals Online (AJOL)

    hp

    Immunosorbent assay (ELISA) was used to assay for FSH, LH, Testosterone, Estrogen, Progesterone, Prolactin and Cortisol ... Testosterone levels with elevated LH and FSH ..... Metabolism. National Academies Press: Washington, DC; 247. Hariri S, Me Kenna M. 2007. Epidemiology of Human immunodeficiency virus in the.

  18. An Investigation of the Relationship between Cognitive Reactivity and Rumination

    Science.gov (United States)

    Moulds, Michelle L.; Kandris, Eva; Williams, Alishia D.; Lang, Tamara; Yap, Carol; Hoffmeister, Karolin

    2008-01-01

    Teasdale's (Teasdale, J.D. (1988). Cognitive vulnerability to persistent depression. "Cognition and Emotion," 2, 247-274) differential activation hypothesis refers to the ease with which maladaptive cognitive processes are triggered by mild dysphoria as "cognitive reactivity." Supporting this model is evidence of a differential association between…

  19. Effect of carbides on erosion resistance of 23-8-N steel

    Indian Academy of Sciences (India)

    Department of Metallurgical and Materials Engineering, Malaviya National Institute of Technology, Jaipur 302 017, India; Former Department of Metallurgical and Materials Engineering, Indian Institute of Technology, Roorkee 247 667, India (Now at BRCM College of Engineering & Technology, Bahal 127 028, India) ...

  20. Haematological, serum and carcass characteristics of broiler ...

    African Journals Online (AJOL)

    Highest haemoglobin, packed cell volume (PCV) and red blood cells (RBC) values were recorded for birds on 1500ppm compared to other birds with values ranging between 8.40-10.00, 25.00-29.50 and 2.47- 2.77 for Hb, PCV and RBC respectively. The least haemoglobin and PCV values were recorded in diet containing ...