WorldWideScience

Sample records for californium 247

  1. Metabolism and toxicity of californium

    International Nuclear Information System (INIS)

    Metabolism of californium can be compared with that of other transplutonium elements. The most important points are as follows: a fast blood clearance and fast bone uptake more important than liver uptake, a relatively high urinary excretion and kidney retention. Blood clearance of californium can be compared with that of americium. Distribution of californium 252 nitrate after intramuscular injection in rats was studied. There are very few experimental data on acute or long term toxicity of californium. (28 references)

  2. Magnetism in californium

    International Nuclear Information System (INIS)

    A SQUID-based magnetic susceptometer has been constructed for studying small radioactive samples at temperatures below 350 K and in magnetic fields up to 50 kilogauss. The device has been used to study californium (element 98) in a number of solid-state forms: the dhcp metal, several oxides (Cf2O3 in both the bcc and monoclinic structures, Cf7O12, CfO2 and BaCfO3), several monopnictides (CfN, CfAs and CfSb) and the trichloride (in both the hexagonal and orthorhombic structures). All of these materials were studied in polycrystalline form, and hexagonal CfCl3 was studied in single-crystal form as well. The susceptometer has the sensitivity to measure samples containing less than 10 micrograms of californium. The magnetic susceptibilities of all of the californium materials at temperatures above about 100 K are described well by the Curie-Weiss relationship. This behavior is consistent with the assumption that the magnetic 5f electrons are localized and that the paramagnetic behavior can be interpreted in terms of the properties of the free ion. The measured values of the effective paramagnetic moment, μ/sub eff/, for all the californium materials that were studied are reasonably consistent with theoretical values based on intermediate coupling models. All of the californium materials showed some indications of cooperative magnetic effects. The dhcp metal was observed to order ferromagnetically at 52 K, and all of the californium compounds studied showed signs of antiferromagnetic ordering, mostly at temperatures below 25 K. 91 refs., 50 figs., 19 tabs

  3. Californium Multiplier (CFX)

    International Nuclear Information System (INIS)

    The availability of 252Cf as an economical high-intensity neutron source has made it possible to construct compact neutron irradiation devices with widespread applications. The simplest such device consists of a single 252Cf source within a moderating and shielding medium. Higher neutron flux levels can be attained either through the use of more 252Cf or through source multiplication by means of a subcritical uranium assembly. Although the use of larger 252Cf sources to achieve higher neutron flux is technically straightforward, an economic penalty is paid as the source strength is increased. Larger californium sources imply larger initial investments to cover the cost of source material and larger operating costs resulting from the decay of the 252Cf source. A Californium Multiplier, the CFX, which produces a flux enhancement of 30 when compared to a conventional moderated 252Cf system has been designed, licensed, built, and tested by IRT Corporation. Such systems are now available on a commercial basis for both neutron radiography and neutron activation analysis. The first commercial CFX system was installed at the Research Laboratories of Eastman Kodak Company in Rochester, NY, in March 1975. This device, using 1 mg of 252Cf, is very stable and the neutron flux generated by the CFX is very reproducible. The performance characteristics of this system are summarized

  4. Californium--palladium metal neutron source material

    Science.gov (United States)

    Dahlen, B.L.; Mosly, W.C. Jr.; Smith, P.K.; Albenesius, E.L.

    1974-01-22

    Californium, as metal or oxide, is uniformly dispersed throughout a noble metal matrix, provided in compact, rod or wire form. A solution of californium values is added to palladium metal powder, dried, blended and pressed into a compact having a uni-form distribution of californium. The californium values are decomposed to californium oxide or metal by heating in an inert or reducing atmosphere. Sintering the compact to a high density closes the matrix around the dispersed californium. The sintered compact is then mechanically shaped into an elongated rod or wire form. (4 claims, no drawings) (Official Gazette)

  5. Californium-252 Neutron Sources for Medical Applications

    International Nuclear Information System (INIS)

    Californium-252 neutron sources are being prepared to investigate the value of this radionuclide in diagnosing and treating diseases. A source resembling a cell-loaded radium needle was developed for neutron therapy. Since therapy needles are normally implanted in the body, very conservative design criteria were established to prevent leakage of radioactive. Methods are being developed to prepare very intense californium sources that could be used eventually for neutron radiography and for diagnosis by neutron activation analysis. This paper discusses these methods

  6. Californium Electrodepositions at Oak Ridge National Laboratory

    Energy Technology Data Exchange (ETDEWEB)

    Boll, Rose Ann [ORNL

    2015-01-01

    Electrodepositions of californium isotopes were successfully performed at Oak Ridge National Laboratory (ORNL) during the past year involving two different types of deposition solutions, ammonium acetate (NH4C2H3O2) and isobutanol ((CH3)2CHCH2OH). A californium product that was decay enriched in 251Cf was recovered for use in super-heavy element (SHE) research. This neutron-rich isotope, 251Cf, provides target material for SHE research for the potential discovery of heavier isotopes of Z=118. The californium material was recovered from aged 252Cf neutron sources in storage at ORNL. These sources have decayed for over 30 years, thus providing material with a very high 251Cf-to-252Cf ratio. After the source capsules were opened, the californium was purified and then electrodeposited using the isobutanol method onto thin titanium foils for use in an accelerator at the Joint Institute for Nuclear Research in Dubna, Russia. Another deposition method, ammonium acetate, was used to produce a deposition containing 1.7 0.1 Ci of 252Cf onto a stainless steel substrate. This was the largest single electrodeposition of 252Cf ever prepared. The 252Cf material was initially purified using traditional ion exchange media, such as AG50-AHIB and AG50-HCl, and further purified using a TEVA-NH4SCN system to remove any lanthanides, resulting in the recovery of 3.6 0.1 mg of purified 252Cf. The ammonium acetate deposition was run with a current of 1.0 amp, resulting in a 91.5% deposition yield. Purification and handling of the highly radioactive californium material created additional challenges in the production of these sources.

  7. Historical review of californium-252 discovery and development

    International Nuclear Information System (INIS)

    This paper discusses the discovery and history of californium 252. This isotope may be synthesized by irradiating plutonium 239, plutonium 242, americium 243, or curium 244 with neutrons in a nuclear reactor. Various experiments and inventions involving 252Cf conducted at the Savannah River Plant are discussed. The evolution of radiotherapy using californium 252 is reviewed

  8. Californium-252: a remarkable versatile radioisotope

    Energy Technology Data Exchange (ETDEWEB)

    Osborne-Lee, I.W.; Alexander, C.W.

    1995-10-10

    A product of the nuclear age, Californium-252 ({sup 252}Cf) has found many applications in medicine, scientific research, industry, and nuclear science education. Californium-252 is unique as a neutron source in that it provides a highly concentrated flux and extremely reliable neutron spectrum from a very small assembly. During the past 40 years, {sup 252}Cf has been applied with great success to cancer therapy, neutron radiography of objects ranging from flowers to entire aircraft, startup sources for nuclear reactors, fission activation for quality analysis of all commercial nuclear fuel, and many other beneficial uses, some of which are now ready for further growth. Californium-252 is produced in the High Flux Isotope Reactor (HFIR) and processed in the Radiochemical Engineering Development Center (REDC), both of which are located at the Oak Ridge National Laboratory (ORNL) in Oak Ridge, Tennessee. The REDC/HFIR facility is virtually the sole supplier of {sup 252}Cf in the western world and is the major supplier worldwide. Extensive exploitation of this product was made possible through the {sup 252}Cf Market Evaluation Program, sponsored by the United States Department of Energy (DOE) [then the Atomic Energy Commission (AEC) and later the Energy Research and Development Administration (ERDA)]. This program included training series, demonstration centers, seminars, and a liberal loan policy for fabricated sources. The Market Evaluation Program was instituted, in part, to determine if large-quantity production capability was required at the Savannah River Laboratory (SRL). Because of the nature of the product and the means by which it is produced, {sup 252}Cf can be produced only in government-owned facilities. It is evident at this time that the Oak Ridge research facility can meet present and projected near-term requirements. The production, shipment, and sales history of {sup 252}Cf from ORNL is summarized herein.

  9. Californium-252: a remarkable versatile radioisotope

    International Nuclear Information System (INIS)

    A product of the nuclear age, Californium-252 (252Cf) has found many applications in medicine, scientific research, industry, and nuclear science education. Californium-252 is unique as a neutron source in that it provides a highly concentrated flux and extremely reliable neutron spectrum from a very small assembly. During the past 40 years, 252Cf has been applied with great success to cancer therapy, neutron radiography of objects ranging from flowers to entire aircraft, startup sources for nuclear reactors, fission activation for quality analysis of all commercial nuclear fuel, and many other beneficial uses, some of which are now ready for further growth. Californium-252 is produced in the High Flux Isotope Reactor (HFIR) and processed in the Radiochemical Engineering Development Center (REDC), both of which are located at the Oak Ridge National Laboratory (ORNL) in Oak Ridge, Tennessee. The REDC/HFIR facility is virtually the sole supplier of 252Cf in the western world and is the major supplier worldwide. Extensive exploitation of this product was made possible through the 252Cf Market Evaluation Program, sponsored by the United States Department of Energy (DOE) [then the Atomic Energy Commission (AEC) and later the Energy Research and Development Administration (ERDA)]. This program included training series, demonstration centers, seminars, and a liberal loan policy for fabricated sources. The Market Evaluation Program was instituted, in part, to determine if large-quantity production capability was required at the Savannah River Laboratory (SRL). Because of the nature of the product and the means by which it is produced, 252Cf can be produced only in government-owned facilities. It is evident at this time that the Oak Ridge research facility can meet present and projected near-term requirements. The production, shipment, and sales history of 252Cf from ORNL is summarized herein

  10. Californium-252 Neutron Therapy in China

    International Nuclear Information System (INIS)

    Californium-252 brachytherapy, believed to be the most successful source for neutron therapy, gives most of the cures as well as long-term and complication-free survivals. Chinese radiation oncologists were interested in californium neutron therapy (Cf-NT) in the early 1980s, but 252Cf sources for medical use were not available in China until 1992 when a californium joint venture was established by the China Institute of Atomic Energy (Beijing) and the Research Institute for Nuclear Reactors (Dimitrovgrad) of Russia. In 1995, 25 seeds of 252Cf with a strength of 3 μg each were sent to China for preclinical investigation. Three years later, a high dose rate (HDR) 252Cf source was imported and transferred into a home-made remote after-loader for intracavitary treatment in Chongqing, and a clinical trail was started in February 1999. This is the first time that Cf-NT was performed for cancer patients in China. Since then, Cf-NT in China has developed rapidly. It is estimated that one-tenth of those radiation oncology centers with brachytherapy practice will be equipped with californium units in 5 yr. That means more than 30 units will be in use in hospitals. That is significant compared with other countries, but it is just one, on average, for each province or one per 40 million people in China. Progress also has been achieved in the 252Cf treatment delivery equipment. Preliminary clinical trails showed complete response observed in all cases treated, with a rapid clearance of tumors and mild reactions in normal tissues. The short-term results are quite encouraging. To deal with problems due to the demand for Cf-NT in China, attention should be paid to the following particulars: (1) A high-strength miniature source is needed for HDR/MDR interstitial therapy to extend the Cf-NT coverage. (2) Basic work on radiophysics and radiobiology needs to be done, including source calibration, clinical dosimetry, clinical RBE determination, and Cf-NT quality assurance

  11. Californium-252 sales and loans at Oak Ridge National Laboratory

    International Nuclear Information System (INIS)

    The production and distribution in the United States of 252Cf has recently been consolidated at the Oak Ridge National Laboratory (ORNL). The 252Cf Industrial Sales/Loan Program and the 252Cf University Load Program, which were formerly located at the Savannah River Plant (SRP), have been combined with the californium production and distribution activities of the Transuranium Element Production Program at ORNL. Californium-252 is sold to commercial users in the form of bulk californium oxide, palladium-californium alloy pellets, or alloy wires. Neutron source capsules, which are fabricated for loans to DOE or other US government agencies, are still available in all forms previously available. The consolidation of all 252Cf distribution activities at the production site is expected to result in better service to users. In particular, customers for neutrons sources will be ale to select from a wider range of neutron source forms, including custom designs, through a single contact point

  12. Californium-252 encapsulation at the Savannah River Laboratory

    International Nuclear Information System (INIS)

    More than 1 g of the neutron-emitting isotope californium-252 has been encapsulated at SRL for worldwide medical, industrial, and research uses. Bulk sales packages have been prepared for the USDOE sales program since 1971. Doubly-encapsulated sources have been prepared for USDOE's market evaluation program since 1968. Californium-252 sources for loan and sales packages satisfy the criteria for Special Form Radioactive Material. Encapsulation is performed in special neutron-shielded containment facilities at SRL. Development of improved source and shipping package designs and processes is continuing. 17 figures

  13. Production, distribution and applications of californium-252 neutron sources

    International Nuclear Information System (INIS)

    The radioisotope 252Cf is routinely encapsulated into compact, portable, intense neutron sources with a 2.6-yr half-life. A source the size of a person's little finger can emit up to 1011 neutrons s-1. Californium-252 is used commercially as a reliable, cost-effective neutron source for prompt gamma neutron activation analysis (PGNAA) of coal, cement and minerals, as well as for detection and identification of explosives, land mines and unexploded military ordnance. Other uses are neutron radiography, nuclear waste assays, reactor start-up sources, calibration standards and cancer therapy. The inherent safety of source encapsulations is demonstrated by 30 yr of experience and by US Bureau of Mines tests of source survivability during explosions. The production and distribution center for the US Department of Energy (DOE) Californium Program is the Radiochemical Engineering Development Center (REDC) at Oak Ridge National Laboratory (ORNL). DOE sells 252Cf to commercial reencapsulators domestically and internationally. Sealed 252Cf sources are also available for loan to agencies and subcontractors of the US government and to universities for educational, research and medical applications. The REDC has established the Californium User Facility (CUF) for Neutron Science to make its large inventory of 252Cf sources available to researchers for irradiations inside uncontaminated hot cells. Experiments at the CUF include a land mine detection system, neutron damage testing of solid-state detectors, irradiation of human cancer cells for boron neutron capture therapy experiments and irradiation of rice to induce genetic mutations

  14. Production, distribution and applications of californium-252 neutron sources.

    Science.gov (United States)

    Martin, R C; Knauer, J B; Balo, P A

    2000-01-01

    The radioisotope 252Cf is routinely encapsulated into compact, portable, intense neutron sources with a 2.6-yr half-life. A source the size of a person's little finger can emit up to 10(11) neutrons s(-1). Californium-252 is used commercially as a reliable, cost-effective neutron source for prompt gamma neutron activation analysis (PGNAA) of coal, cement and minerals, as well as for detection and identification of explosives, land mines and unexploded military ordinance. Other uses are neutron radiography, nuclear waste assays, reactor start-up sources, calibration standards and cancer therapy. The inherent safety of source encapsulations is demonstrated by 30 yr of experience and by US Bureau of Mines tests of source survivability during explosions. The production and distribution center for the US Department of Energy (DOE) Californium Program is the Radiochemical Engineering Development Center (REDC) at Oak Ridge National Laboratory (ORNL). DOE sells 252Cf to commercial reencapsulators domestically and internationally. Sealed 252Cf sources are also available for loan to agencies and subcontractors of the US government and to universities for educational, research and medical applications. The REDC has established the Californium User Facility (CUF) for Neutron Science to make its large inventory of 252Cf sources available to researchers for irradiations inside uncontaminated hot cells. Experiments at the CUF include a land mine detection system, neutron damage testing of solid-state detectors, irradiation of human cancer cells for boron neutron capture therapy experiments and irradiation of rice to induce genetic mutations. PMID:11003521

  15. Production, Distribution, and Applications of Californium-252 Neutron Sources

    Energy Technology Data Exchange (ETDEWEB)

    Balo, P.A.; Knauer, J.B.; Martin, R.C.

    1999-10-03

    The radioisotope {sup 252}Cf is routinely encapsulated into compact, portable, intense neutron sources with a 2.6-year half-life. A source the size of a person's little finger can emit up to 10{sup 11} neutrons/s. Californium-252 is used commercially as a reliable, cost-effective neutron source for prompt gamma neutron activation analysis (PGNAA) of coal, cement, and minerals, as well as for detection and identification of explosives, laud mines, and unexploded military ordnance. Other uses are neutron radiography, nuclear waste assays, reactor start-up sources, calibration standards, and cancer therapy. The inherent safety of source encapsulations is demonstrated by 30 years of experience and by U.S. Bureau of Mines tests of source survivability during explosions. The production and distribution center for the U. S Department of Energy (DOE) Californium Program is the Radiochemical Engineering Development Center (REDC) at Oak Ridge National Laboratory (ORNL). DOE sells The radioisotope {sup 252}Cf is routinely encapsulated into compact, portable, intense neutron sources with a 2.6- year half-life. A source the size of a person's little finger can emit up to 10 neutrons/s. Californium-252 is used commercially as a reliable, cost-effective neutron source for prompt gamma neutron activation analysis (PGNAA) of coal, cement, and minerals, as well as for detection and identification of explosives, laud mines, and unexploded military ordnance. Other uses are neutron radiography, nuclear waste assays, reactor start-up sources, calibration standards, and cancer therapy. The inherent safety of source encapsulations is demonstrated by 30 years of experience and by U.S. Bureau of Mines tests of source survivability during explosions. The production and distribution center for the U. S Department of Energy (DOE) Californium Program is the Radiochemical Engineering Development Center (REDC) at Oak Ridge National Laboratory(ORNL). DOE sells {sup 252}Cf to commercial

  16. Production of extra pure curium and californium preparations

    International Nuclear Information System (INIS)

    Preparations of curium-244,245,248 and californium-249,252 are used for the production of ionizing radiation sources for different applications and fundamental nuclear-physical investigations, placing high requirements on the radiochemical and chemical purity of the preparations. Extraction chromatography using di-(2-ethylhexyl)phosphoric acid (D2EHPA) as extractant was chosen to prepare extra pure curium and californium preparations. In order to identify the optimal conditions of Cm-Cf separation and to remove impurities from them (reagent and other impurities), investigations were performed into the effect of impurities (Na+, Ca2+, Al3+, Fe2+, Fe3+ taken as example), extractant and eluent concentration and solution flow rate on the efficiency of mutual purification of Cm and Cf. Both theoretical and experimental estimations were made of the maximum concentration at which the impurities do not affect the process. The conditions chosen allow mutual purification of milligram amounts of Cm and Cf from impurity elements at E(pur) =102 - 103 during a single chromatographic cycle (E(pur) =>103) using a column with 5 - 10 cm3 volume. In this case the production yield exceeds 98%. The purification of milligram amounts of curium and californium from fission products (lanthanides in general, cerium in particular) was performed in D2EHPA-decane-PbO2-HNO3 and D2EHPA-decane-DTPA-H3-Cit extraction chromatography systems. In order to establish the optimal conditions, the effect of [D2EHPA] and eluent on the mutual purification of Cm and Cf and on their purification from cerium and impurity elements was studied in the D2EHPA-decane-PbO2-HNO3 system. During a single chromatographic cycle the mutual purification factors of TPE and of their purification from impurity cations achieve 102-103, from cerium - E(pur) > 10. In the D2EHPA-decane-DTPA-H3Cit system, the effect of concentration of extractant and eluent pH on the efficiency of Cm and Cf purification from lanthanides was

  17. Prompt neutron spectrum of the spontaneous fission of californium-252

    International Nuclear Information System (INIS)

    The californium-252 spontaneous fission neutron spectrum was measured in the energy range of 0.01 to 10 MeV by the time-of-flight technique using various neutron detectors. The measurements of 252Cf neutron spectrum at energies of 0.01 to 5 MeV were performed as a function of fission fragment kinetic energy. The mean neutron spectrum energy in the range of 0.7 to 10 MeV was found from the results of measurements. The irregularity in the 252Cf neutron spectrum in the neutron energy range of less than 0.7 MeV compared to theoretical values is discussed. The mechanism of 252Cf neutron emission is also discussed on the basis of neutron yield angle measurements. 12 references

  18. Solving the Hydration Structure of the Heaviest Actinide Aqua Ion Known: The Californium(III) Case

    Energy Technology Data Exchange (ETDEWEB)

    Den Auwer, Ch.; Guillaumont, D. [CEA Marcoule, Nucl Energy Div, Radiochem Proc Dept, SCPS LILA, 30 (France); Galbis, E.; Pappalardo, Rafael R.; Marcos Sanchez, E. [Univ Seville, Dept Quim Fis, E-41012 Seville (Spain); Hernandez-Cobos, J. [Inst Ciencias Fis, Cuernavaca 62251, Morelos (Mexico); Le Naour, C.; Simoni, E. [Univ Paris Sud, Inst Phys Nucl Orsay, Paris (France)

    2010-07-01

    In summary, the first MC simulation of the trivalent cation of californium, based on an exchangeable hydrated ion-water intermolecular potential, has been shown to extend and improve the hydrated ion model. Likewise, the CfL{sub III}-edge EXAFS spectrum of an acidic 1 mm Cf(ClO{sub 4}){sub 3} aqueous solution recorded under optimized experimental conditions has greatly improved the signal/noise ratio of the only previously recorded spectrum. The comparison of the experimental EXAFS spectrum with the two computed ones, obtained from two different intermolecular potentials that predict eight (BP86) or nine (MP2) water molecules in the first coordination shell, leads to the conclusion that the lowest hydration number is preferred. Then, as Cf{sup III} is the heaviest actinide aqua ion for which there is experimental information, the actinide contraction is supported by the present study. (For U{sup III}, R{sub U-O}=2.56 Angstroms, and CN=9{+-}1; for Pu{sup III}, R{sub Pu-O}=2.51 Angstroms and CN=9{+-}1; for Cm{sup III}, R{sub Cm-O}=2.47 Angstroms and CN=9{+-}1). The role of the second hydration shell is important in defining the structure and dynamics of the Cf{sup III} aqua ion, but the contribution of second-shell water molecules to the EXAFS signal as back-scatters is marginal. Finally, this work gives an illustrative example of the benefits which can be achieved from the combination of experimental X-ray absorption spectroscopy and computer simulations. The usefulness of the simultaneous analysis of the results as well as the importance of the structural statistical average has been clearly demonstrated herein. Each technique independently was not adequate. We believe that this study traces out a still poorly explored combined methodology which may be extremely useful for many other complexes and chemical problems. A systematic theoretical and experimental examination of the other known actinide cations on the same basis should be undertaken to confirm the

  19. Separation of californium from actinides and lanthanides in aqueous solution by electrochemical formation of amalgams

    International Nuclear Information System (INIS)

    The electrochemical reduction of transneptunium elements (Pu to Cf) and rare earths (Eu, Tm) from aqueous complexing solutions to amalgams was studied over a wide range of cathodic potentials in order to achieve optimal separation of californium. The reduction in acetate media (pH 4.5-4.6) at potentials around -1.7 to -1.9 V1 leads to a quantitative extraction of californium into the mercury phase, while more negative potentials are required for the reduction of the lighter transuranium elements and of the lanthanides. Hence, the optimal conditions for the separation of californium from the investigated actinides and lanthanides were determined. Separation factors α between 25 and 90 were found except in the case of Cf/Eu, where poor values (α varying from 7 to 12) were observed. More negative cathodic potentials decrease the selectivity of the reduction process. A similar study with lithium citrate solutions (pH ∝6) shows that satisfactory separation of californium from lighter and heavier actinides is achievable. A separation factor of 88 is obtained for Cf/Am at -1.98 V. The anodic stripping of mixed amalgams (Pu, Am, Cm, Bk, Tm and Cf) Hg in nitric and acetic acid soultions at potentials ranging from +0.1 to -0.7 V proceeds slowly and proved to be ineffective for the separation of californium from light actinides under conditions described. (orig.)

  20. On-line slurry analyses by californium-252

    International Nuclear Information System (INIS)

    In chemical processing technology on-line activation methods gain an increasing importance for process monitoring and control. A method is described according to which the different fluorspar contents at various strategic points of a flotation plant are determined through neutron activation by 100 μg californium-252. A continuous analytical system for onstream process control of slurries was designed and constructed. A compact facility, called SUSAC, allows continuous application of the method on an industrial scale. The main components of the SUSAC facility are the irradiation and measurement cells. The cells are equipped with multistage countercurrent stirrers ensuring a proper radial and vertical distribution of the sample. The hollow shaft of the stirrer of the irradiation cell houses the Cf-source. The NaI-detector has been installed in a recess in the bottom of the measuring cell. The volumes are 9 dm3 for the irradiation cell, 7.5 dm3 for the measuring cell, 1/2 dm3 for the vonnection line and 4 dm3 for feed and drainage lines including the pump. Investigations on the following topics are discussed: selection of stirrers, residence time, flow rate, pulp density, calibration measurements. (T.G.)

  1. Biomedical neutron research at the Californium User Facility for neutron science

    International Nuclear Information System (INIS)

    The Californium User Facility for Neutron Science has been established at Oak Ridge National Laboratory (ORNL). The Californium User Facility (CUF) is a part of the larger Californium Facility, which fabricates and stores compact 252Cf neutron sources for worldwide distribution. The CUF can provide a cost-effective option for research with 252Cf sources. Three projects at the CUF that demonstrate the versatility of 252Cf for biological and biomedical neutron-based research are described: future establishment of a 252Cf-based neutron activation analysis system, ongoing work to produce miniature high-intensity, remotely afterloaded 252Cf sources for tumor therapy, and a recent experiment that irradiated living human lung cancer cells impregnated with experimental boron compounds to test their effectiveness for boron neutron capture therapy

  2. Biomedical neutron research at the Californium User Facility for neutron science

    Energy Technology Data Exchange (ETDEWEB)

    Martin, R.C. [Oak Ridge National Lab., TN (United States); Byrne, T.E. [Roane State Community College, Harriman, TN (United States); Miller, L.F. [Univ. of Tennessee, Knoxville, TN (United States)

    1997-04-01

    The Californium User Facility for Neutron Science has been established at Oak Ridge National Laboratory (ORNL). The Californium User Facility (CUF) is a part of the larger Californium Facility, which fabricates and stores compact {sup 252}Cf neutron sources for worldwide distribution. The CUF can provide a cost-effective option for research with {sup 252}Cf sources. Three projects at the CUF that demonstrate the versatility of {sup 252}Cf for biological and biomedical neutron-based research are described: future establishment of a {sup 252}Cf-based neutron activation analysis system, ongoing work to produce miniature high-intensity, remotely afterloaded {sup 252}Cf sources for tumor therapy, and a recent experiment that irradiated living human lung cancer cells impregnated with experimental boron compounds to test their effectiveness for boron neutron capture therapy.

  3. Proposed Californium-252 User Facility for Neutron Science at Oak Ridge National Laboratory

    International Nuclear Information System (INIS)

    The Radiochemical Engineering Development Center (REDC) at ORNL has petitioned to establish a Californium-252 User Facility for Neutron Science for academic, industrial, and governmental researchers. The REDC Californium Facility (CF) stores the national inventory of sealed 252Cf neutron source for university and research loans. Within the CF, the 252Cf storage pool and two uncontaminated hot cells currently in service for the Californium Program will form the physical basis for the User Facility. Relevant applications include dosimetry and experiments for neutron tumor therapy; fast and thermal neutron activation analysis of materials; experimental configurations for prompt gamma neutron activation analysis; neutron shielding and material damage studies; and hardness testing of radiation detectors, cameras, and electronics. A formal User Facility simplifies working arrangements and agreements between US DOE facilities, academia, and commercial interests

  4. Emergence of californium as the second transitional element in the actinide series.

    Science.gov (United States)

    Cary, Samantha K; Vasiliu, Monica; Baumbach, Ryan E; Stritzinger, Jared T; Green, Thomas D; Diefenbach, Kariem; Cross, Justin N; Knappenberger, Kenneth L; Liu, Guokui; Silver, Mark A; DePrince, A Eugene; Polinski, Matthew J; Van Cleve, Shelley M; House, Jane H; Kikugawa, Naoki; Gallagher, Andrew; Arico, Alexandra A; Dixon, David A; Albrecht-Schmitt, Thomas E

    2015-01-01

    A break in periodicity occurs in the actinide series between plutonium and americium as the result of the localization of 5f electrons. The subsequent chemistry of later actinides is thought to closely parallel lanthanides in that bonding is expected to be ionic and complexation should not substantially alter the electronic structure of the metal ions. Here we demonstrate that ligation of californium(III) by a pyridine derivative results in significant deviations in the properties of the resultant complex with respect to that predicted for the free ion. We expand on this by characterizing the americium and curium analogues for comparison, and show that these pronounced effects result from a second transition in periodicity in the actinide series that occurs, in part, because of the stabilization of the divalent oxidation state. The metastability of californium(II) is responsible for many of the unusual properties of californium including the green photoluminescence. PMID:25880116

  5. 7 CFR 247.27 - Financial management.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Financial management. 247.27 Section 247.27... AGRICULTURE CHILD NUTRITION PROGRAMS COMMODITY SUPPLEMENTAL FOOD PROGRAM § 247.27 Financial management. (a) What are the Federal requirements for State and local agencies with regard to financial...

  6. 32 CFR 247.5 - Responsibilities.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false Responsibilities. 247.5 Section 247.5 National... DEPARTMENT OF DEFENSE NEWSPAPERS, MAGAZINES AND CIVILIAN ENTERPRISE PUBLICATIONS § 247.5 Responsibilities. (a... Commands shall: (1) Publish Combatant Command newspapers, if authorized. In discharging this...

  7. 7 CFR 247.18 - Nutrition education.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Nutrition education. 247.18 Section 247.18 Agriculture... CHILD NUTRITION PROGRAMS COMMODITY SUPPLEMENTAL FOOD PROGRAM § 247.18 Nutrition education. (a) What are the State agency's responsibilities in ensuring that nutrition education is provided? The State...

  8. Fissile analysis of Hanford waste using Californium Multiplier/Delayed Neutron Counter system

    International Nuclear Information System (INIS)

    Measurement of low-level (10 ng/g or lower) fissile material (mainly plutonium) in Hanford waste and process samples is becoming increasingly important. A system has been designed consisting of a Californium Multiplier (CFX) and a Delayed Neutron Counter (DNC) to characterize these samples. This report describes hardware and analytical capability of the CFX/DNC system

  9. Study of the shielding for spontaneous fission sources of Californium-252

    International Nuclear Information System (INIS)

    A shielding study is made to attenuate, until maximum permissible levels, the neutrons radiation and photons emitted by spontaneous fission coming from a source of Californium-252. The compound package by a database (Library DLC-23) and the ANISNW code is used, in it version for personal computer. (Author)

  10. Dicty_cDB: SSI247 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSI247 (Link to dictyBase) - - - Contig-U12269-1 SSI247Z (Link... to Original site) - - SSI247Z 692 - - - - Show SSI247 Library SS (Link to library) Clone ID SSI247 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSI2-B/SSI247Q.Seq.d/ Representative seq. ID SSI24...7Z (Link to Original site) Representative DNA sequence >SSI247 (SSI247Q) /CSM/SS/SSI2-B/SSI247Q.Seq.d/ XXXXX...f*kgrsitifsccsfw yrfvayfwlhckgilqdnqqsnrqshrrfsssllpm*wfrlvakwwfnafhysihfishy as**eitiqrt*ylc**yssiigsmg*itf

  11. Californium (252Cf) and its use as neutron source in science medicine and technology

    International Nuclear Information System (INIS)

    The application of radionuclides in science and nuclear techniques basically is related to unstable isotopes, which are produced from stable elements in nuclear reactor. Their specifications are various from view point of application . Using of physical and chemical properties of radionuclides in chemistry, for with marking the organic compounds we can exactly explain the mechanism of chemical reactions in medical, biology and bio-chemistry. In these cases the behaviour of radionuclides is very important and the selection of the suitable radionuclides is determined between the elements for investigation aims. The special specification of radio-nuclides analysis such as, half-life, kind of ray and energy should be considered with an special accuracy as well as the laws security regulations from view point of ray-protection should be completely observed mean time working these radio-nuclides. It should be considered that application of radio-isotopes is very important from their special specifications point of view. Applying the radionuclides from technology point of view in sciences and nuclear techniques aren't only limited to three analyses of α, β, and γ, but we can use the share of neutron which are produced from spli ting of heavy nucleus such as Californium252 as a neutron source in the depths of the sea and also determining the concentration of low quantity elements on moon and other spheres. The radioisotope of Californium252 is a neutron useful radiator for investigation in nuclear medical and technology because of automatically rapid split to 3.2% Californium252 radiates 1.34 * 109N/m in each mil/GH which suitable replacement for neutron sources based on (a, n) reaction, for example, Radium-Brellium or Amersium-Brellium. The energy distribution of radiated neutrons from analyzing of Californium252 like the spectrum of neutron which is produced from splitting of U235, Pu239 nucleus has the maximum energy in quantity, En=1 MeV in the range of 1.5 MeV. The

  12. Contribution to clinical dosimetry of californium 252 sources used at Gustave Roussy institute

    International Nuclear Information System (INIS)

    The main characteristics of californium 252 sources are presented in the first part of the report. Dose measurements around Californium sources were performed with a pair of ionization multiplication chambers: the first one has an Aluminium wall and is filled with Argon, the second one a plastic tissue-equivalent gas. A set of experiments was performed in order to investigate the relative influence of beta rays on the response of both chambers. Besides the experimental work a computer program was written to calculate the dose distribution around the actual sources made of a series of small active sources placed in catheters. Theoretical data around small sources can be found in the litterature. The comparison between experimental results and theoretical ones has shown a good agreement. The computer program will be included as a sub-routine in the more general computer program used for patients treated with interstitial therapy

  13. Safety Analysis Report for Packaging (SARP) of the Oak Ridge National Laboratory TRU Californium Shipping Container

    International Nuclear Information System (INIS)

    An analytical evaluation of the Oak Ridge National Laboratory TRU Californium Shipping Container was made in order to demonstrate its compliance with the regulations governing off-site shipment of packages that contain radioactive material. The evaluation encompassed five primary categories: structural integrity, thermal resistance, radiation shielding, nuclear criticality safety, and quality assurance. The results of this evaluation demonstrate that the container complies with the applicable regulations

  14. Emergence of californium as the second transitional element in the actinide series

    OpenAIRE

    Cary, Samantha K.; Vasiliu, Monica; Baumbach, Ryan E.; Stritzinger, Jared T.; GREEN, THOMAS D.; Diefenbach, Kariem; Cross, Justin N.; Knappenberger, Kenneth L.; Liu, Guokui; Silver, Mark A.; DePrince, A. Eugene; Polinski, Matthew J.; Van Cleve, Shelley M.; House, Jane H.; Kikugawa, Naoki

    2015-01-01

    A break in periodicity occurs in the actinide series between plutonium and americium as the result of the localization of 5f electrons. The subsequent chemistry of later actinides is thought to closely parallel lanthanides in that bonding is expected to be ionic and complexation should not substantially alter the electronic structure of the metal ions. Here we demonstrate that ligation of californium(III) by a pyridine derivative results in significant deviations in the properties of the resu...

  15. 7 CFR 247.4 - Agreements.

    Science.gov (United States)

    2010-01-01

    ... provide, or cause to be provided, nutrition education to participants, as required in § 247.18; (2) An... Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS COMMODITY SUPPLEMENTAL FOOD PROGRAM § 247.4 Agreements. (a) What agreements...

  16. Dicty_cDB: AFM247 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AF (Link to library) AFM247 (Link to dictyBase) - - - - - (Link to Original site) - - AFM...247Z 829 - - - - Show AFM247 Library AF (Link to library) Clone ID AFM247 (Link to dictyBase) Atlas ID... - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/AF/AFM2-B/AFM...247Q.Seq.d/ Representative seq. ID - (Link to Original site) Representative DNA sequence >AFM...247 (AFM247Q) /CSM/AF/AFM2-B/AFM247Q.Seq.d/ XXXXXXXXXXTCCCTTTAGTCCTANATAANAGGTGGTACCAATTT

  17. Erythroderma: analysis of 247 cases

    Directory of Open Access Journals (Sweden)

    Cidia Vasconcellos

    1995-06-01

    Full Text Available The profile of 247 patients with erythroderma during a 23 year period from January, 1962 through March, 1985, with a follow-up period ranging from 1 to 26 years were analysed. The patients presented with diffuse erythema, scaling and pruritus of more than 2 months' duration, and the age ranged from 16 to 60 years. Psoriasis was the most frequent underlying disease with an estimated frequency of 44.9%, the reaction to the use of drugs appeared in 7.3% of total cases and association with reticulosis showed a frequency of 4.1%. The cause of the erythroderma could not be determined in 29.2% of the cases. Sex differences in terms of underlying diseases were not observed. One or more skin biopsies along with the clinical findings were diagnostic or suggestive of the underlying disease in 63.6% of the cases. Repeated skin biopsies are recommended as the best method for etiologic diagnosis of erythroderma. At P=0.05 significance level, masculine/feminine ratio of 2 : 1 was found. The question arises wether causal agent of erythroderma may not be somehow related to different exposure by sex to environmental antigens.

  18. Measurements of integral cross sections in the californium-252 fission neutron spectrum

    International Nuclear Information System (INIS)

    In a low-scattering arrangement cross sections averaged over the californium-252 spontaneous fission neutron spectrum were measured. The reactions 27Al(n,α)46Ti, 47Ti, 48Ti(n,p), 54Fe,56Fe(n,p), 58Ni(n,p), 64Zn(n,p), 115In(n,n') were studied in order to obtain a consistent set of threshold detectors used in fast neutron flux density measurements. Overall uncertainties between 2 and 2.5% could be achieved; corrections due to neutron scattering in source and samples are discussed

  19. Measurement of californium-252 gamma photons depth dose distribution in tissue equivalent material. Vol. 4

    International Nuclear Information System (INIS)

    Phantom of tissue equivalent material with and without bone was used measuring depth dose distribution of gamma-rays from californium-252 source. The source was positioned at center of perspex walled phantom. Depth dose measurements were recorded for X, Y and Z planes at different distances from source. TLD 700 was used for measuring the dose distribution. Results indicate that implantation of bone in tissue equivalent medium cause changes in the gamma depth dose distribution which varies according to variation in bone geometry. 9 figs

  20. Spontaneous Partitioning of Californium from Curium: Curious Cases from the Crystallization of Curium Coordination Complexes

    Energy Technology Data Exchange (ETDEWEB)

    Cary, Samantha K.; Silver, Mark A.; Liu, Guokui; Wang, Jamie C.; Bogart, Justin A.; Stritzinger, Jared T.; Arico, Alexandra A.; Hanson, Kenneth; Schelter, Eric J.; Albrecht-Schmitt, Thomas E.

    2015-12-07

    The reaction of 248CmCl3 with excess 2,6-pyridinedicarboxylic acid (DPA) under mild solvothermal conditions results in crystallization of the tris-chelate complex Cm(HDPA)3·H2O. Approximately half of the curium remains in solution at the end of this process, and evaporation of the mother liquor results in crystallization of the bis-chelate complex [Cm(HDPA)- (H2DPA)(H2O)2Cl]Cl·2H2O. 248Cm is the daughter of the α decay of 252Cf and is extracted in high purity from this parent. However, trace amounts of 249,250,251Cf are still present in all samples of 248Cm. During the crystallization of Cm(HDPA)3·H2O and [Cm(HDPA)(H2DPA)(H2O)2Cl]Cl·2H2O, californium(III) spontaneously separates itself from the curium complexes and is found doped within crystals of DPA in the form of Cf(HDPA)3. These results add to the growing body of evidence that the chemistry of californium is fundamentally different from that of earlier actinides.

  1. 40 CFR 247.11 - Vehicular products.

    Science.gov (United States)

    2010-07-01

    ... PROCUREMENT GUIDELINE FOR PRODUCTS CONTAINING RECOVERED MATERIALS Item Designations § 247.11 Vehicular products. (a) Lubricating oils containing re-refined oil, including engine lubricating oils, hydraulic fluids, and gear oils, excluding marine and aviation oils. (b) Tires, excluding airplane tires....

  2. 48 CFR 247.301-70 - Definition.

    Science.gov (United States)

    2010-10-01

    ..., DEPARTMENT OF DEFENSE CONTRACT MANAGEMENT TRANSPORTATION Transportation in Supply Contracts 247.301-70 Definition. “Integrated logistics managers” or “third-party logistics providers” means providers of multiple logistics services. Some examples of logistics services are the management of transportation,...

  3. 7 CFR 247.6 - State Plan.

    Science.gov (United States)

    2010-01-01

    ... serving women, infants, and children, program outreach, and nutrition education. (Collaboration with the... commodities; (7) A description of plans for providing nutrition education to participants; (8) A description... CHILD NUTRITION PROGRAMS COMMODITY SUPPLEMENTAL FOOD PROGRAM § 247.6 State Plan. (a) What is the...

  4. 7 CFR 247.30 - Claims.

    Science.gov (United States)

    2010-01-01

    ... of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS COMMODITY SUPPLEMENTAL FOOD PROGRAM § 247.30 Claims. (a) What happens if a... program funds through negligence, fraud, theft, embezzlement, or other causes, FNS must initiate...

  5. 7 CFR 247.33 - Fair hearings.

    Science.gov (United States)

    2010-01-01

    ... Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS COMMODITY SUPPLEMENTAL FOOD PROGRAM § 247.33 Fair hearings. (a) What is a fair... program, or a claim to repay the value of commodities received as a result of fraud. State and...

  6. 32 CFR 247.4 - Policy.

    Science.gov (United States)

    2010-07-01

    ... commercial product, commodity, or service. (2) Subscribe, even at no cost, to a commercial or feature wire or... 1 to § 247.1. (r) Commercial sponsors of Armed Forces Professional Entertainment Program events and... entertainment reviews may be carried if written objectively and if there is no implication of endorsement by...

  7. 48 CFR 52.247-57 - Transportation Transit Privilege Credits.

    Science.gov (United States)

    2010-10-01

    ... Privilege Credits. 52.247-57 Section 52.247-57 Federal Acquisition Regulations System FEDERAL ACQUISITION... Clauses 52.247-57 Transportation Transit Privilege Credits. As prescribed in 47.305-13(b)(4), insert the... of the trade, that offerors may have potential transit credits available and the Government...

  8. 48 CFR 52.247-2 - Permits, Authorities, or Franchises.

    Science.gov (United States)

    2010-10-01

    ... Franchises. 52.247-2 Section 52.247-2 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION....247-2 Permits, Authorities, or Franchises. As prescribed in 47.207-1(a), insert the following clause: Permits, Authorities, or Franchises (JAN 1997) (a) The offeror does □, does not □, hold authorization...

  9. 25 CFR 247.18 - What are the sanitation prohibitions?

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false What are the sanitation prohibitions? 247.18 Section 247.18 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR FISH AND WILDLIFE USE OF COLUMBIA RIVER TREATY FISHING ACCESS SITES § 247.18 What are the sanitation prohibitions? (a) You cannot...

  10. 7 CFR 247.7 - Selection of local agencies.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Selection of local agencies. 247.7 Section 247.7 Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS COMMODITY SUPPLEMENTAL FOOD PROGRAM § 247.7 Selection of local...

  11. Fast and efficient charge breeding of the Californium rare isotope breeder upgrade electron beam ion source

    Energy Technology Data Exchange (ETDEWEB)

    Ostroumov, P. N., E-mail: ostroumov@anl.gov; Barcikowski, A.; Dickerson, C. A.; Perry, A.; Sharamentov, S. I.; Vondrasek, R. C.; Zinkann, G. P. [Argonne National Laboratory, Argonne, Illinois 60439 (United States); Pikin, A. I. [Brookhaven National Laboratory, Upton, New York 11973 (United States)

    2015-08-15

    The Electron Beam Ion Source (EBIS), developed to breed Californium Rare Isotope Breeder Upgrade (CARIBU) radioactive beams at Argonne Tandem Linac Accelerator System (ATLAS), is being tested off-line. A unique property of the EBIS is a combination of short breeding times, high repetition rates, and a large acceptance. Overall, we have implemented many innovative features during the design and construction of the CARIBU EBIS as compared to the existing EBIS breeders. The off-line charge breeding tests are being performed using a surface ionization source that produces singly charged cesium ions. The main goal of the off-line commissioning is to demonstrate stable operation of the EBIS at a 10 Hz repetition rate and a breeding efficiency into single charge state higher than 15%. These goals have been successfully achieved and exceeded. We have measured (20% ± 0.7%) breeding efficiency into the single charge state of 28+ cesium ions with the breeding time of 28 ms. In general, the current CARIBU EBIS operational parameters can provide charge breeding of any ions in the full mass range of periodic table with high efficiency, short breeding times, and sufficiently low charge-to-mass ratio, 1/6.3 for the heaviest masses, for further acceleration in ATLAS. In this paper, we discuss the parameters of the EBIS and the charge breeding results in a pulsed injection mode with repetition rates up to 10 Hz.

  12. Fast and efficient charge breeding of the Californium rare isotope breeder upgrade electron beam ion source

    International Nuclear Information System (INIS)

    The Electron Beam Ion Source (EBIS), developed to breed Californium Rare Isotope Breeder Upgrade (CARIBU) radioactive beams at Argonne Tandem Linac Accelerator System (ATLAS), is being tested off-line. A unique property of the EBIS is a combination of short breeding times, high repetition rates, and a large acceptance. Overall, we have implemented many innovative features during the design and construction of the CARIBU EBIS as compared to the existing EBIS breeders. The off-line charge breeding tests are being performed using a surface ionization source that produces singly charged cesium ions. The main goal of the off-line commissioning is to demonstrate stable operation of the EBIS at a 10 Hz repetition rate and a breeding efficiency into single charge state higher than 15%. These goals have been successfully achieved and exceeded. We have measured (20% ± 0.7%) breeding efficiency into the single charge state of 28+ cesium ions with the breeding time of 28 ms. In general, the current CARIBU EBIS operational parameters can provide charge breeding of any ions in the full mass range of periodic table with high efficiency, short breeding times, and sufficiently low charge-to-mass ratio, 1/6.3 for the heaviest masses, for further acceleration in ATLAS. In this paper, we discuss the parameters of the EBIS and the charge breeding results in a pulsed injection mode with repetition rates up to 10 Hz

  13. Design of a homogeneous subcritical nuclear reactor based on thorium with a source of californium 252

    International Nuclear Information System (INIS)

    Full text: One of the energy alternatives to fossil fuels which do not produce greenhouse gases is the nuclear energy. One of the drawbacks of this alternative is the generation of radioactive wastes of long half-life and its relation to the generation of nuclear materials to produce weapons of mass destruction. An option to these drawbacks of nuclear energy is to use Thorium as part of the nuclear fuel which it becomes in U233 when capturing neutrons, that is a fissile material. In this paper Monte Carlo methods were used to design a homogeneous subcritical reactor based on thorium. As neutron reflector graphite was used. The reactor core is homogeneous and is formed of 70% light water as moderator, 12% of enriched uranium UO2(NO3)4 and 18% of thorium Th(NO3)4 as fuel. To start the nuclear fission chain reaction an isotopic source of californium 252 was used with an intensity of 4.6 x 107 s-1. In the design the value of the effective multiplication factor, whose value turned out keff <1 was calculated. Also, the neutron spectra at different distances from the source and the total fluence were calculated, as well as the values of the ambient dose equivalent in the periphery of the reactor. (Author)

  14. Fast and efficient charge breeding of the Californium rare isotope breeder upgrade electron beam ion source.

    Science.gov (United States)

    Ostroumov, P N; Barcikowski, A; Dickerson, C A; Perry, A; Pikin, A I; Sharamentov, S I; Vondrasek, R C; Zinkann, G P

    2015-08-01

    The Electron Beam Ion Source (EBIS), developed to breed Californium Rare Isotope Breeder Upgrade (CARIBU) radioactive beams at Argonne Tandem Linac Accelerator System (ATLAS), is being tested off-line. A unique property of the EBIS is a combination of short breeding times, high repetition rates, and a large acceptance. Overall, we have implemented many innovative features during the design and construction of the CARIBU EBIS as compared to the existing EBIS breeders. The off-line charge breeding tests are being performed using a surface ionization source that produces singly charged cesium ions. The main goal of the off-line commissioning is to demonstrate stable operation of the EBIS at a 10 Hz repetition rate and a breeding efficiency into single charge state higher than 15%. These goals have been successfully achieved and exceeded. We have measured (20% ± 0.7%) breeding efficiency into the single charge state of 28+ cesium ions with the breeding time of 28 ms. In general, the current CARIBU EBIS operational parameters can provide charge breeding of any ions in the full mass range of periodic table with high efficiency, short breeding times, and sufficiently low charge-to-mass ratio, 1/6.3 for the heaviest masses, for further acceleration in ATLAS. In this paper, we discuss the parameters of the EBIS and the charge breeding results in a pulsed injection mode with repetition rates up to 10 Hz. PMID:26329185

  15. Neutron activation analysis at the Californium User Facility for Neutron Science

    International Nuclear Information System (INIS)

    The Californium User Facility (CUF) for Neutron Science has been established to provide 252Cf-based neutron irradiation services and research capabilities including neutron activation analysis (NAA). A major advantage of the CUF is its accessibility and controlled experimental conditions compared with those of a reactor environment The CUF maintains the world's largest inventory of compact 252Cf neutron sources. Neutron source intensities of ≤ 1011 neutrons/s are available for irradiations within a contamination-free hot cell, capable of providing thermal and fast neutron fluxes exceeding 108 cm-2 s-1 at the sample. Total flux of ≥109 cm-2 s-1 is feasible for large-volume irradiation rabbits within the 252Cf storage pool. Neutron and gamma transport calculations have been performed using the Monte Carlo transport code MCNP to estimate irradiation fluxes available for sample activation within the hot cell and storage pool and to design and optimize a prompt gamma NAA (PGNAA) configuration for large sample volumes. Confirmatory NAA irradiations have been performed within the pool. Gamma spectroscopy capabilities including PGNAA are being established within the CUF for sample analysis

  16. Long-term effects of an intracavitary treatment with californium-252 on normal tissue

    International Nuclear Information System (INIS)

    About one hundred fifty swine were exposed to either radium-226 or californium-252 sources in the uterine cervix to determine an RBE for both acute and long-term effects. That value for early changes in the tissues at risk in the treatment of cervical cancer was between 6.2 and 6.8. The incidence of complications increased with time after exposure, especially among animals treated with 252Cf. Analysis of rectal injury showed that ulceration occurred frequently within a year postexposure at doses between 1600 and 2400 rad calculated at 2 cm lateral to the source midline. Fat necrosis and smooth muscle atrophy, resulting in a local rectal stricture, were delayed changes observed in some animals. The lower ureter was the site for a greater frequency of complications than the GI tract. Ureteral stricture often occurred at doses of 1200 rad from 252Cf and 7000 rad from 226Ra. Observation of delayed effects in the uterine-cervix in animals held up to 4 years postexposure indicate that the RBE for 252Cf may be increased to a value as high as 18, while repair may have even decreased it to about 5.6 in the rectum. Fifty swine are still being observed for long-term effects after doses above 800 rad from 252Cf and 5000 rad from 226Ra

  17. Manganese determination om minerals by activation analysis, using the californium-252 as a neutron source

    International Nuclear Information System (INIS)

    Neutron Activation Analysis, using a Californium-252 neutron source, has been applied for the determination of manganese in ores such as pyrolusite, rodonite (manganese silicate)' and blending used in dry-batteries The favorable nuclear properties of manganese, such as high thermal neutron cross-section for the reaction 55Mn (n.gamma)56 Mn, high concentration of manganese in the matrix and short half - life of 56Mn, are an ideal combination for non-destructive analysis of manganese in ores. Samples and standards of manganese dioxide were irradiated for about 20 minutes, followed by a 4 to 15 minutes decay and counted in a single channel pulse-height discrimination using a NaI(Tl) scintillation detector. Counting time was equal to 10 minutes. The interference of nuclear reactions 56Fe(n,p)56Mn and 59 Co (n, α)56 were studied, as well as problems in connection with neutron shadowing during irradiation, gamma-rays attenuation during counting and influence of granulometry of samples. One sample,was also analysed by wet-chemical method (sodium bismuthate) in order to compare results. As a whole, i t was shown that the analytical method of neutron activation for manganese in ores and blending, is a method simple, rapid and with good precision and accuracy. (author)

  18. Five-year cure of cervical cancer treated using californium-252 neutron brachytherapy

    International Nuclear Information System (INIS)

    Female pelvic carcinoma is one of the common malignancies seen at the University of Kentucky Medical Center and often presents in an advanced stage. In 1976, the authors began to test californium-252 neutron brachytherapy (NT) for its efficacy for control of primary and recurrent advanced uterine, cervix, and vaginal cancers. The first protocol used was 5000-5500 rad of whole pelvis irradiation followed by 1-2 Cf-252 insertions using a single tandem placed in the utero-cervico-vaginal region. Of 27 patients with primary carcinomas treated, 10 are alive and well 5 year later (37%). Two of two recurrent tumors were locally controlled but failed later. These patients had advanced cervical, vaginal, or endometrial carcinomas. In 1977, a transitional year, treatment of only unfavorable stages and presentations with NT was initiated. Similar results were obtained with NT as compared to conventional photon therapy (PT). Further improvement in treatment results can be anticipated as NT brachytherapy is used for advanced cancer therapy by more effective treatment schedules and radiation doses. Cf-252 can be used as a radium substitute and achieved similar rates of tumor control and 5-year survivals. 21 references, 2 tables

  19. Uptake and distribution of californium-252 chloride administered intraperitoneally, intravenously or intratracheally and the effect of in vivo DTPA chelation on intratracheal instillation in the rat

    International Nuclear Information System (INIS)

    The first phase of this investigation, comprising of three groups of animals, was designed to study the fate of californium-252 chloride administered intraperitoneally, intravenously or intratracheally. The second phase, which consisted of two groups of animals, was designed to examine the effectiveness of DTPA chelation therapy in accelerating the excretion and preventing the deposition of californium-252 chloride instilled into the lungs of rats. Immediately following the dose administration of 2 uCi of californium-252 chloride which was dissolved in 0.2 ml of 0.9% NaCl at pH 3.5, each rat was placed in a metabolism cage. Each rat in the first group of phase II was given intraperitoneal injection of CaNa3 DTPA (50 mg/kg) and each rat in the second group was given intraperitoneal injections of 0.9% NaCl. Injections of the DTPA or the NaCl sham were initiated immediately after the intratracheal administration of californium-252 chloride and were continued every three days until sacrifice. Following intraperitoneal, intravenous or intratracheal administration, the whole body retention of californium as a function of time was described by a three component exponential equation. For each mode of administration the short term component exhibited a biological half-life of between 5 and 10 hours; the intermediate component between 4 and 6 days; and the long term component between 200 and 300 days. The organ data obtained following intraperitoneal and intravenous administration were indistinguishable. On day one, the liver retained about 9% of the administered dose and the kidneys retained 2.4%. Retention for these organs decreased to about 1% by day 32. The femurs maintained an almost constant level of 4.5% of the injected dose over the 32 days. The lungs, spleen, heart, and testes showed significant retention of californium

  20. ENEA results in the international comparison organized by BIPM for the measurament of neutron fluxes of a Californium source

    International Nuclear Information System (INIS)

    During the period between May 1978 and August 1984 under the auspices of Section III of CCEMRI of CIPM it has been carried out the international intercomparison of Californium neutron source emission rate. The previous intercomparison was based on Ra-Be (α -n) source measuraments, which took place between 1959 and 1965, and the results showed a total spread of +- 3%. Owing to the better accuracy achived over the following decade the Ra-Be intercomparison was no longer representative of the state of the art, therefore it was decided to arrange the intercomparison based on Californium which in the meantime reached a wide use in the world. Contributions to the intercomparison were received from fourteen laboratories representative of twelve Nations plus the BIPM. The results put into evidence a considerable advance on accuracy in the neutron source emission rate measuraments. The standard deviation of the residuals obtained from least square fit of normalized data resulted +- 0,57%. In the present report it is widely described the Manganese bath method used at ENEA, CRE Casaccia in Roma, and the experimental procedure followed for its absolute calibration. All measuraments are reported and analysed, including those effectuated for corrective factors determination. The final results obtained at ENEA for the circulated Californium source is (3,457 +- 0,013) 10*H7 neutron/s. The analysis of data from all partecipantes has been effectuated and concluded by J. Axton in March 1986 and the conclusions which have been showed in the present report put in evidence the satisfactory results achived by the ENEA

  1. Dicty_cDB: AFB247 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AF (Link to library) AFB247 (Link to dictyBase) - - - Contig-U16373-1 AFB247P (Link to Original ... fnssfkf****y***w*y***rinkk*www**i**qi*kskttt**kr** skw ***q****kfk*kpyck***iyitii*lssfr*irkgkretrl*nhl*y*t ...

  2. 40 CFR 247.14 - Park and recreation products.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Park and recreation products. 247.14 Section 247.14 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES... and recreation products. (a) Playground surfaces and running tracks containing recovered rubber...

  3. 7 CFR 247.28 - Storage and inventory of commodities.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Storage and inventory of commodities. 247.28 Section..., DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS COMMODITY SUPPLEMENTAL FOOD PROGRAM § 247.28 Storage and inventory of commodities. (a) What are the requirements for storage of commodities? State and local...

  4. Dicty_cDB: SHK247 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SH (Link to library) SHK247 (Link to dictyBase) - - - Contig-U10899-1 | Contig-U12190-1 SHK247P ... 4-21.b_022.ab1 Whole-genome shotgun library of the elephant ... shark (aka elephant ... fish) Callorhinchus milii geno ...

  5. 7 CFR 247.12 - Rights and responsibilities.

    Science.gov (United States)

    2010-01-01

    ... § 247.33(a); (2) The local agency will make nutrition education available to all adult participants, and... AGRICULTURE CHILD NUTRITION PROGRAMS COMMODITY SUPPLEMENTAL FOOD PROGRAM § 247.12 Rights and responsibilities...; and (3) The local agency will provide information on other nutrition, health, or assistance...

  6. Dicty_cDB: AFA247 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AF (Link to library) AFA247 (Link to dictyBase) - - - Contig-U16254-1 AFA247P (Link to Original ... 220 4e-56 DQ507282_1( DQ507282 |pid:none) Belgica antarctica ... clone Ba-U06 va... 220 5e-56 AY197611_1( AY197611 ...

  7. 48 CFR 952.247-70 - Foreign travel.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Foreign travel. 952.247-70... SOLICITATION PROVISIONS AND CONTRACT CLAUSES Text of Provisions and Clauses 952.247-70 Foreign travel. As prescribed in 947.7002, insert the following clause: Foreign Travel (JUN 2010) Contractor foreign...

  8. 48 CFR 3452.247-70 - Foreign travel.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 7 2010-10-01 2010-10-01 false Foreign travel. 3452.247... 3452.247-70 Foreign travel. As prescribed in 3447.7000, insert the following clause in all solicitations and resultant cost-reimbursement contracts: Foreign Travel (AUG 1987) Foreign travel shall not...

  9. 8 CFR 247.14 - Surrender of documents.

    Science.gov (United States)

    2010-01-01

    ... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Surrender of documents. 247.14 Section 247.14 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS ADJUSTMENT OF... I-551 or any other form of Permanent Resident Card, immigrant identification card, resident...

  10. 40 CFR 247.10 - Paper and paper products.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Paper and paper products. 247.10... COMPREHENSIVE PROCUREMENT GUIDELINE FOR PRODUCTS CONTAINING RECOVERED MATERIALS Item Designations § 247.10 Paper and paper products. Paper and paper products, excluding building and construction paper grades....

  11. Dicty_cDB: SFF247 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SF (Link to library) SFF247 (Link to dictyBase) - - - Contig-U16243-1 SFF247E (Link to Original ... o... 732 0.0 X75329_1( X75329 |pid:none) M.indica (Manila ) THMF5 mRNA for 3-ket... 408 e-112 AM474896_9( AM4 ...

  12. Dicty_cDB: SFI247 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SF (Link to library) SFI247 (Link to dictyBase) - - - Contig-U16243-1 SFI247P (Link to Original ... .. 239 e-102 X75329_1( X75329 |pid:none) M.indica (Manila ) THMF5 mRNA for 3-ket... 235 e-102 AK230209_1( AK2 ...

  13. Feasibility and market potential of protein determination of wheat using californium-252

    International Nuclear Information System (INIS)

    To evaluate the feasibility of protein determination by capture gamma-ray analysis using californium-252 neutrons, an in-situ protein analysis system for use by grain handlers has been examined. Three 227 kilogram (approximately) lots of wheat were used to determine the amount of nitrogen present. Protein analyses by the Kjeldahl method were obtained from samples taken before and after the capture gamma-ray analyses. The 5.267-MeV gamma-ray was selected for use in this study as a compromise between efficiency and interference from other elements. The associated counting equipment was a multichannel analyzer with pulse shaping electronic and analysis computing equipment. A linear regression program was used to compare the regions of interest to the Kjeldahl protein averages. The counts composing each peak were summed and normalized using the total count of the hydrogen peak. The normalized nitrogen percentages indicate a significant correlation between the spectral regions and the Kjeldahl analyses. To a first approximation, the value of wheat is the wheat protein. At the present time, protein testing of wheat is destructive, cumbersome, and time-consuming as compared to the potential for capture gamma-ray analysis testing. Assuming that such a protein analysis unit can analyze 42 tonne of wheat per hour, over 120 units would be needed to monitor one-half the U.S. annual wheat production. A 0.5% improvement in processor realizations and grain throughput value of $167.00 per tonne will result in a projected savings of $150,000 per year per unit

  14. Oxygen enhancement ratio (OER) and therapeutic gain factor (GF) for californium-252 at low dose rate

    International Nuclear Information System (INIS)

    The potential benefit of the introduction of californium-252 in interstitial and intracavitary therapy is related to the greater efficiency of its neutron emission against anoxic cancer cells. In that respect, the oxygen enhancement ratio (OER) of the 252Cf emission has been determined for a continuous low dose rate irradiation. The biological system is growth inhibition in Vicia faba bean roots. A new Vicia faba ''BelB'' strain has been used, which better tolerates long periods (up to about 10 hours) of anoxia. In a first series of experiments, for a 252Cf (Dsub(n+γ)) dose rate of 0.11 Gy.h-1, an OER of 1.4+-0.1 was observed (the γ contribution Dγ to the total absorbed dose Dsub(n+γ) was 0.35 at the position of the root tips). In a second series of experiments, in somewhat different geometrical conditions with a 252Cf (Dsub(n+γ)) dose rate of 0.13 Gy.h-1, an OER of 1.5+-0.1 was observed (Dγ/Dsub(n+γ)=0.42). The OER values observed for similar irradiation times, with iridium-192 γ-rays, were 2.3+-0.2 and 2.6+-0.1 respectively, which leads to therapeutic gain factors (GF) of 1.6 and 1.7 respectively. These GF values are slightly lower than those previously obtained (GF=1.8) on the same system, with d(50)-Be p(75)-Be and 15 MeV neutron beams

  15. Application of TSH bioindicator for studying the biological efficiency of neutrons from californium-252 source

    International Nuclear Information System (INIS)

    The effectiveness of neutrons from a Californium-252 source in the induction of various abnormalities in the Tradescantia clone 4430 stamen hair cells (TSH-assay) was studied. The special attention was paid to check whether any enhancement in effects caused by process of boron neutron capture is visible in the cells enriched with boron ions. Two chemicals (borax and BSH) were applied to introduce boron-10 ions into cells. Inflorescence, normal or pretreated with chemicals containing boron, were irradiated in the air with neutrons from a Cf-252 source at KAERI, Taejon, Korea. To estimate the relative biological effectiveness (RBE) in the induction of gene mutations of the neutron beam under the study, Tradescantia inflorescences, without any chemical pretreatment, were irradiated with various doses of X-rays. The ranges of radiation doses used were 0-0.1 Gy in neutrons and 0-0.5 Gy in X-rays. After the time needed to complete the postirradiation repair Tradescantia cuttings were transferred to Cracow, where screening of gene and lethal; mutations, cell cycle alterations in somatic cells have been done, and dose response relationships were figured. The maximal RBE values were estimated in the range of 4.6-6.8. Alterations of RBE value were observed; from 6.8 to 7.8 in the case of plants pretreated with 240 ppm of B-10 from borax, and 4.6 to 6.1 in the case of 400 ppm of B-10 from BSH. Results showed a slight, although statistically insignificant increase in biological efficacy of radiation from the Cf-252 source in samples pretreated with boron containing chemicals. (author)

  16. Divalent and trivalent gas-phase coordination complexes of californium: evaluating the stability of Cf(ii).

    Science.gov (United States)

    Dau, Phuong D; Shuh, David K; Sturzbecher-Hoehne, Manuel; Abergel, Rebecca J; Gibson, John K

    2016-08-01

    The divalent oxidation state is increasingly stable relative to the trivalent state for the later actinide elements, with californium the first actinide to exhibit divalent chemistry under moderate conditions. Although there is evidence for divalent Cf in solution and solid compounds, there are no reports of discrete complexes in which Cf(II) is coordinated by anionic ligands. Described here is the divalent Cf methanesulfinate coordination complex, Cf(II)(CH3SO2)3(-), prepared in the gas phase by reductive elimination of CH3SO2 from Cf(III)(CH3SO2)4(-). Comparison with synthesis of the corresponding Sm and Cm complexes reveals reduction of Cf(III) and Sm(III), and no evidence for reduction of Cm(III). This reflects the comparative 3+/2+ reduction potentials: Cf(3+) (-1.60 V) ≈ Sm(3+) (-1.55 V) ≫ Cm(3+) (-3.7 V). Association of O2 to the divalent complexes is attributed to formation of superoxides, with recovery of the trivalent oxidation state. The new gas-phase chemistry of californium, now the heaviest element to have been studied in this manner, provides evidence for Cf(II) coordination complexes and similar chemistry of Cf and Sm. PMID:27424652

  17. Hypoxic versus normoxic external-beam irradiation of cervical carcinoma combined with californium-252 neutron brachytherapy. Comparative treatment results of a 5-year randomized study

    Czech Academy of Sciences Publication Activity Database

    Tačev, T.; Vacek, Antonín; Ptáčková, B.; Strnad, V.

    2005-01-01

    Roč. 181, č. 5 (2005), s. 273-284. ISSN 0179-7158 Institutional research plan: CEZ:AV0Z50040507 Keywords : cervical carcinoma * hypoxyradiotherapy * californium-252 Subject RIV: BO - Biophysics Impact factor: 3.490, year: 2005

  18. 7 CFR 58.247 - Insect and rodent control program.

    Science.gov (United States)

    2010-01-01

    ....247 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING... AND STANDARDS UNDER THE AGRICULTURAL MARKETING ACT OF 1946 AND THE EGG PRODUCTS INSPECTION ACT... any commercial pest control service, if one is utilized, a specially designated employee should...

  19. Dicty_cDB: VFK247 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFK247 (Link to dictyBase) - - - Contig-U12091-1 - (Link to Original site) ... hmvnsmmvivisfyillkkvihlnmifisf*vllllkmklalllik qln*mis *vvhqfnivnvnhmkvqafyhysqnisfyqvvlnqdlimlnqqninqdyyi ...

  20. Dicty_cDB: AFO247 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AF (Link to library) AFO247 (Link to dictyBase) - - - Contig-U10734-1 AFO247Z (Link to Original ... RT1 Zarlenga v1 Ascaris suum cDNA 5' similar to SW:ERP 5_CAEEL Q11067 PROBABLE PROTEIN DISULFIDE ISOMERASE ... PROTEIN DISULFIDE ISOMERASE A4 PRECURSOR (PROTEIN ERP -72) (ERP 72), mRNA sequence. 60 4e-05 1 dna update ...

  1. 48 CFR 252.247-7023 - Transportation of supplies by sea.

    Science.gov (United States)

    2010-10-01

    ... by sea. 252.247-7023 Section 252.247-7023 Federal Acquisition Regulations System DEFENSE ACQUISITION... of Provisions And Clauses 252.247-7023 Transportation of supplies by sea. As prescribed in 247.573(b)(1), use the following clause: Transportation of Supplies by Sea (MAY 2002) (a) Definitions. As...

  2. 48 CFR 247.305-70 - Returnable containers other than cylinders.

    Science.gov (United States)

    2010-10-01

    ... other than cylinders. 247.305-70 Section 247.305-70 Federal Acquisition Regulations System DEFENSE... Supply Contracts 247.305-70 Returnable containers other than cylinders. Use the clause at 252.247-7021, Returnable Containers Other Than Cylinders, in solicitations and contracts for supplies involving...

  3. 48 CFR 252.247-7021 - Returnable containers other than cylinders.

    Science.gov (United States)

    2010-10-01

    ... other than cylinders. 252.247-7021 Section 252.247-7021 Federal Acquisition Regulations System DEFENSE... CLAUSES Text of Provisions And Clauses 252.247-7021 Returnable containers other than cylinders. As prescribed in 247.305-70, use the following clause: Returnable Containers Other Than Cylinders (MAY 1995)...

  4. Design, construction, and characterization of a facility for neutron capture gamma ray analysis of sulfur in coal using californium-252

    International Nuclear Information System (INIS)

    A study of neutron capture gamma ray analysis of sulfur in coal using californium-252 as a neutron source is reported. Both internal and external target geometries are investigated. The facility designed for and used in this study is described. The external target geometry is found to be inappropriate because of the low thermal neutron flux at the sample location, which must be outside the biological shielding. The internal target geometry is found to have a sufficient thermal neutron flux, but an excessive gamma ray background. A water filled plastic facility, rather than the paraffin filled steel one used in this study, is suggested as a means of increasing flexibility and decreasing the beackground in the internal target geometry

  5. Evidence for live 247Cm in the early solar system

    Science.gov (United States)

    Tatsumoto, M.; Shimamura, T.

    1980-01-01

    Variations of the 238U/235U ratio in the Allende meteorite, ranging from -35% to + 19%, are interpreted as evidence of live 247Cm in the early Solar System. The amounts of these and other r-products in the Solar System indicate values of (9,000??3,000) Myr for the age of the Galaxy and ??? 8 Myr for the time between the end of nucleosynthesis and the formation of meteoritic grains. Three possible explanations are presented for the different values of the latter time period which are indicated by the decay products of 247Cm, 26Al, 244Pu and 129I. ?? 1980 Nature Publishing Group.

  6. CDC 24/7: Saving Lives, Protecting People

    Centers for Disease Control (CDC) Podcasts

    2012-06-04

    24/7, CDC provides health information, responds to public health emergencies and natural disasters, and monitors disease.  Created: 6/4/2012 by Office of the Associate Director of Communciation (OADC).   Date Released: 6/4/2012.

  7. 48 CFR 52.247-12 - Supervision, Labor, or Materials.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Supervision, Labor, or....247-12 Supervision, Labor, or Materials. As prescribed in 47.207-5(b), insert a clause substantially... when the contractor is required to furnish supervision, labor, or materials: Supervision, Labor,...

  8. 7 CFR 247.5 - State and local agency responsibilities.

    Science.gov (United States)

    2010-01-01

    ... providing nutrition education to participants; (10) Establishing appeals and fair hearing procedures for...) Providing nutrition education and information on the availability of other nutrition and health assistance..., DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS COMMODITY SUPPLEMENTAL FOOD PROGRAM § 247.5 State...

  9. 48 CFR 247.301-71 - Evaluation factor or subfactor.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Evaluation factor or... Contracts 247.301-71 Evaluation factor or subfactor. For contracts that will include a significant requirement for transportation of items outside CONUS, include an evaluation factor or subfactor that...

  10. 48 CFR 52.247-28 - Contractor's Invoices.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Contractor's Invoices. 52....247-28 Contractor's Invoices. As prescribed in 47.207-9(c), insert the following clause in... services: Contractor's Invoices (APR 1984) The Contractor shall submit itemized invoices as instructed...

  11. 48 CFR 52.247-66 - Returnable Cylinders.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Returnable Cylinders. 52....247-66 Returnable Cylinders. As prescribed in 47.305-17, insert the following clause: Returnable Cylinders (MAY 1994) (a) Cylinder, referred to in this clause, is a pressure vessel designed for...

  12. Operational experience with the Argonne National Laboratory Californium Rare Ion Breeder Upgrade facility and electron cyclotron resonance charge breeder

    Science.gov (United States)

    Vondrasek, R.; Clark, J.; Levand, A.; Palchan, T.; Pardo, R.; Savard, G.; Scott, R.

    2014-02-01

    The Californium Rare Ion Breeder Upgrade (CARIBU) of the Argonne National Laboratory Argonne Tandem Linac Accelerator System (ATLAS) facility provides low-energy and accelerated neutron-rich radioactive beams to address key nuclear physics and astrophysics questions. A 350 mCi 252Cf source produces fission fragments which are thermalized and collected by a helium gas catcher into a low-energy particle beam with a charge of 1+ or 2+. An electron cyclotron resonance (ECR) ion source functions as a charge breeder in order to raise the ion charge sufficiently for acceleration in the ATLAS linac. The ECR charge breeder has achieved stable beam charge breeding efficiencies of 10.1% for 23Na7+, 17.9% for 39K10+, 15.6% for 84Kr17+, and 12.4% for 133Cs27+. For the radioactive beams, a charge breeding efficiency of 11.7% has been achieved for 143Cs27+ and 14.7% for 143Ba27+. The typical breeding times are 10 ms/charge state, but the source can be tuned such that this value increases to 100 ms/charge state with the best breeding efficiency corresponding to the longest breeding times—the variation of efficiencies with breeding time will be discussed. Efforts have been made to characterize and reduce the background contaminants present in the ion beam through judicious choice of q/m combinations. Methods of background reduction are being investigated based upon plasma chamber cleaning and vacuum practices.

  13. Long-term effects of an intracavitary treatment with californium-252 on normal tissue. [Swine, /sup 226/Ra

    Energy Technology Data Exchange (ETDEWEB)

    Sullivan, M.F.; Beamer, J.L.; Mahony, T.D.; Cross, F.T.; Lund, J.E.; Endres, G.W.R.

    1976-01-01

    About one hundred fifty swine were exposed to either radium-226 or californium-252 sources in the uterine cervix to determine an RBE for both acute and long-term effects. That value for early changes in the tissues at risk in the treatment of cervical cancer was between 6.2 and 6.8. The incidence of complications increased with time after exposure, especially among animals treated with /sup 252/Cf. Analysis of rectal injury showed that ulceration occurred frequently within a year postexposure at doses between 1600 and 2400 rad calculated at 2 cm lateral to the source midline. Fat necrosis and smooth muscle atrophy, resulting in a local rectal stricture, were delayed changes observed in some animals. The lower ureter was the site for a greater frequency of complications than the GI tract. Ureteral stricture often occurred at doses of 1200 rad from /sup 252/Cf and 7000 rad from /sup 226/Ra. Observation of delayed effects in the uterine-cervix in animals held up to 4 years postexposure indicate that the RBE for /sup 252/Cf may be increased to a value as high as 18, while repair may have even decreased it to about 5.6 in the rectum. Fifty swine are still being observed for long-term effects after doses above 800 rad from /sup 252/Cf and 5000 rad from /sup 226/Ra.

  14. 48 CFR 1852.247-71 - Protection of the Florida manatee.

    Science.gov (United States)

    2010-10-01

    ... manatee. 1852.247-71 Section 1852.247-71 Federal Acquisition Regulations System NATIONAL AERONAUTICS AND... and Clauses 1852.247-71 Protection of the Florida manatee. As prescribed in 1847.7001, insert the following clause: Protection of the Florida Manatee (MAR 1989) (a) Pursuant to the Endangered Species Act...

  15. 19 CFR 10.247 - Verification and justification of claim for preferential treatment.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Verification and justification of claim for preferential treatment. 10.247 Section 10.247 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF... Promotion and Drug Eradication Act § 10.247 Verification and justification of claim for...

  16. 48 CFR 252.247-7024 - Notification of transportation of supplies by sea.

    Science.gov (United States)

    2010-10-01

    ... transportation of supplies by sea. 252.247-7024 Section 252.247-7024 Federal Acquisition Regulations System... supplies by sea. As prescribed in 247.574(c), use the following clause: Notification of Transportation of Supplies by Sea (MAR 2000) (a) The Contractor has indicated by the response to the solicitation...

  17. 48 CFR 252.247-7022 - Representation of extent of transportation by sea.

    Science.gov (United States)

    2010-10-01

    ... of transportation by sea. 252.247-7022 Section 252.247-7022 Federal Acquisition Regulations System... transportation by sea. As prescribed in 247.574(a), use the following provision: Representation of Extent of Transportation By Sea (AUG 1992) (a) The Offeror shall indicate by checking the appropriate blank in paragraph...

  18. 48 CFR 52.247-40 - Ex Dock, Pier, or Warehouse, Port of Importation.

    Science.gov (United States)

    2010-10-01

    ... Warehouse, Port of Importation. 52.247-40 Section 52.247-40 Federal Acquisition Regulations System FEDERAL... Provisions and Clauses 52.247-40 Ex Dock, Pier, or Warehouse, Port of Importation. As prescribed in 47.303-12..., pier, or warehouse, port of importation: Ex Dock, Pier, or Warehouse, Port of Importation (APR 1984)...

  19. The Void in the Sculptor Group Spiral Galaxy NGC 247

    CERN Document Server

    Wagner-Kaiser, R; Sarajedini, A; Chakrabarti, S

    2014-01-01

    The dwarf galaxy NGC 247, located in the Sculptor Filament, displays an apparent void on the north side of its spiral disk. The existence of the void in the disk of this dwarf galaxy has been known for some time, but the exact nature and cause of this strange feature has remained unclear. We investigate the properties of the void in the disk of NGC 247 using photometry of archival Hubble Space Telescope data to analyze the stars in and around this region. Based on a grid of isochrones from log(t)=6.8 to log(t)=10.0, we assign ages using nearest-neighbor interpolation. Examination of the spatial variation of these ages across the galaxy reveals an age difference between stars located inside the void region and stars located outside this region. We speculate that the void in NGC 247's stellar disk may be due to a recent interaction with a nearly dark sub-halo that collided with the disk and could account for the long-lived nature of the void.

  20. Property Enrichment of Aged Nickel Base Superalloy Supercast 247A

    Directory of Open Access Journals (Sweden)

    Lavakumar Avala

    2013-12-01

    Full Text Available The commercial nickel-base superalloy Supercast 247A can be used for applications in which is required high mechanical strength and corrosion resistance at elevated temperatures, such as turbine blades and automotive turbocharger rotors. The mechanical properties are totally connected to the morphology, size and distribution of γ' phase and carbides. In order to improve the mechanical properties, the material is subjected to solution and aging heat treatment, to raise the volume fraction of γ' phase in the matrix and to form carbides at grain boundaries. In the present study the Supercast 247A superalloy was remelted and cast to obtain the desired polycrystalline test bars by controlling casting parameters, followed by the investigation of precipitation morphology and mechanical properties with respect to solution treatment and aging treatment. The experimental results show that by well controlled casting parameters the Supercast 247A owns excellent castability to form a superalloy with fine grain structure, resistance to indentation as well as superior strength.

  1. Results with the electron cyclotron resonance charge breeder for the 252Cf fission source project (Californium Rare Ion Breeder Upgrade) at Argonne Tandem Linac Accelerator System

    International Nuclear Information System (INIS)

    The construction of the Californium Rare Ion Breeder Upgrade, a new radioactive beam facility for the Argonne Tandem Linac Accelerator System (ATLAS), is nearing completion. The facility will use fission fragments from a 1 Ci 252Cf source; thermalized and collected into a low-energy particle beam by a helium gas catcher. In order to reaccelerate these beams, an existing ATLAS electron cyclotron resonance (ECR) ion source was redesigned to function as an ECR charge breeder. Thus far, the charge breeder has been tested with stable beams of rubidium and cesium achieving charge breeding efficiencies of 9.7% into 85Rb17+ and 2.9% into 133Cs20+.

  2. Ab initio full-potential study of mechanical properties and magnetic phase stability of californium monopnictides (CfN and CfP)

    Science.gov (United States)

    Amari, S.; Bouhafs, B.

    2016-09-01

    Based on the first-principles methods, the structural, elastic, electronic, properties and magnetic ordering of californium monopnictides CfX (X = P) have been studied using the full-potential augmented plane wave plus local orbitals (FP-L/APW + lo) method within the framework of density functional theory (DFT). The electronic exchange correlation energy is described by generalized gradient approximation GGA and GGA+U (U is the Hubbard correction). The GGA+U method is applied to the rare-earth 5f states. We have calculated the lattice parameters, bulk modulii and the first pressure derivatives of the bulk modulii. The elastic properties of the studied compounds are only investigated in the most stable calculated phase. In order to gain further information, we have calculated Young's modulus, shear modulus, anisotropy factor and Kleinman parameter by the aid of the calculated elastic constants. The results mainly show that californium monopnictides CfX (X = P) have an antiferromagnetic spin ordering. Density of states (DOS) and charge densities for both compounds are also computed in the NaCl (B1) structure.

  3. 7 CFR 247.10 - Distribution and use of CSFP commodities.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Distribution and use of CSFP commodities. 247.10... SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS COMMODITY SUPPLEMENTAL FOOD PROGRAM § 247.10 Distribution and use of CSFP commodities. (a) What are the requirements for distributing CSFP commodities...

  4. 32 CFR Appendix D to Part 247 - AFIS Print Media Directorate

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false AFIS Print Media Directorate D Appendix D to.... 247, App. D Appendix D to Part 247—AFIS Print Media Directorate A. General. The Print Media Directorate (PMD), an element of AFIS, develops, publishes, and distributes a variety of print media...

  5. 24 CFR 247.10 - Inapplicability to substantial rehabilitation or demolition; right of disposition unimpaired.

    Science.gov (United States)

    2010-04-01

    ... rehabilitation or demolition; right of disposition unimpaired. 247.10 Section 247.10 Housing and Urban... FOR HOUSING-FEDERAL HOUSING COMMISSIONER, DEPARTMENT OF HOUSING AND URBAN DEVELOPMENT MORTGAGE AND... or demolition; right of disposition unimpaired. This subpart shall not apply in any case in which...

  6. 7 CFR 247.35 - Local agency appeals of State agency actions.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Local agency appeals of State agency actions. 247.35 Section 247.35 Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS COMMODITY SUPPLEMENTAL FOOD PROGRAM §...

  7. 7 CFR 247.23 - State provision of administrative funds to local agencies.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false State provision of administrative funds to local agencies. 247.23 Section 247.23 Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS COMMODITY SUPPLEMENTAL...

  8. Anatomy of a controversy: Application of the Langevin technique to the analysis of the Californium-252 Source-Driven Noise Analysis method for subcriticality determination

    International Nuclear Information System (INIS)

    The expressions for the power spectral density of the noise equivalent sources have been calculated explicitly for the (a) stochastic transport equation, (b) the one-speed transport equaton, (c) the one-speed P1 equations, (d) the one-speed diffusion equation and (e) the point kinetic equation. The stochastic nature of Fick's law in (d) has been emphasized. The Langevin technique has been applied at various levels of approximation to the interpretation of the Californium-252 Source-Driven Noise Analysis (CSDNA) experiment for determining the reactivity in subcritical media. The origin of the controversy surrounding this method has been explained. The foundations of the CSDNA method as a viable experimental technique to infer subcriticality from a measured ratio of power spectral densities of the outputs of two neutron detectors and a third external source detector has been examined by solving the one-speed stochastic diffusion equation for a point external Californium-252 source and two detectors in an infinite medium. The expression relating reactivity to the measured ratio of PSDs was found to depend implicitly on k itself. Through a numerical analysis fo this expression, the authors have demonstrated that for a colinear detector-source-detector configuration for neutron detectors far from the source, the expression for the subcritical multiplication factor becomes essentially insensitive to k, hence, demonstrating some possibility for the viability of this technique. However, under more realistic experimental conditions, i.e., for finite systems in which diffusion theroy is not applicable, the measurement of the subcritical multiplication factor from a single measured ratio of PSDs, without extensive transport calculations, remains doubtful

  9. Application of SCGE assay, classical cytogenetics and FISH for studying in vitro californium-252 neutrons irradiations and BSH pretreatment on human lymphocytes

    International Nuclear Information System (INIS)

    Recently, there has been observed a tendency to apply various energy neutrons for tumor therapy and particularly low energy neutrons from various sources, including californium-252 source, for cancer radiotherapy based on the neutron capture. In this study peripheral blood lymphocytes were used as a model for human cells and three methods were applied to assess the effectiveness of californium-252 neutrons irradiations in vitro in normal cells or pre-treated with compound enriched in B-10 ion. Human blood samples or isolated lymphocytes were irradiated with neutrons from isotopic 252Cf source at the Faculty of Nuclear Physics and Technics at University of Mining and Metallurgy (both neutron source and samples were placed in polyethylene block). Chemical pretreatment with BSH (Na210B12H11SH) was done to introduce boron-10 ion into cells in order to check any enhancement effect due to the process of boron neutron capture. Comet assay was done to investigate the DNA damage. Classical cytogenetics was applied to assess the frequencies of unstable aberrations (dicentrics and rings). Fluorescence in situ hybridization (FISH) with probes for chromosomes 1, 4 (14.3% of whole genome) and pancentromeric probe was performed to evaluate the frequencies of stable aberrations. Linear (or close to linear) increase of DNA damage and aberration frequency was observed with dose of radiation both for lymphocytes untreated or pre-treated with BSH. Very little differences (statistically insignificant) due to radiation dose and BSH pretreatment were observed in the frequencies of SCEs detected in the second mitosis. There is no significant difference between boron pre-treated and not treated cells, and even slightly higher effects were observed in case of the highest dose without BSH pretreatment. The level of translocations observed is comparable with the frequencies of dicentrics and rings. (author)

  10. Californium-252 neutron sources

    International Nuclear Information System (INIS)

    Major production programs for the Savannah River reactors and the High Flux Isotopes Reactor at Oak Ridge have made 252Cf one of the most available and, at the USAEC's sales price of $10/μg, one of the least-expensive isotopic neutron sources. Reactor production has totaled approximately 2 g, and, based on expected demand, an additional 10 g will be produced in the next decade. The approximately 800 mg chemically separated to date has been used to prepare over 600 neutron sources. Most, about 500, have been medical sources containing 1 to 5 μg of 252Cf plated in needles for experimental cancer therapy studies. The remainder have generally been point sources containing 10 μg to 12 mg of oxide for activation, well logging, or radiography uses. Bulk sources have also been supplied to the commercial encapsulators. The latest development has been the production of 252Cf cermet wire which can be cut into almost contamination-free lengths of the desired 252Cf content. Casks are available for transport of sources up to 50 mg. Subcritical assemblies have been developed to multiply the source neutrons by a factor of 10 to 40, and collimators and thermalizers have also been extensively developed to shape the neutron flux and energy distributions for special applications. (U.S.)

  11. Calculations of Nuclear Astrophysics and Californium Fission Neutron Spectrum Averaged Cross Section Uncertainties Using ENDF/B-VII.1, JEFF-3.1.2, JENDL-4.0 and Low-fidelity Covariances

    International Nuclear Information System (INIS)

    Nuclear astrophysics and californium fission neutron spectrum averaged cross sections and their uncertainties for ENDF materials have been calculated. Absolute values were deduced with Maxwellian and Mannhart spectra, while uncertainties are based on ENDF/B-VII.1, JEFF-3.1.2, JENDL-4.0 and Low-Fidelity covariances. These quantities are compared with available data, independent benchmarks, EXFOR library, and analyzed for a wide range of cases. Recommendations for neutron cross section covariances are given and implications are discussed

  12. 17 CFR 247.775 - Exemption from the definition of “broker” for banks effecting certain excepted or exempted...

    Science.gov (United States)

    2010-04-01

    .... (2) Interdealer quotation system has the same meaning as in 17 CFR 240.15c2-11. (3) Insurance company... securities. 247.775 Section 247.775 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION... OF BROKER § 247.775 Exemption from the definition of “broker” for banks effecting certain excepted...

  13. Protective effect of CV247 against cisplatin nephrotoxicity in rats.

    Science.gov (United States)

    Máthé, C; Szénási, G; Sebestény, A; Blázovics, A; Szentmihályi, K; Hamar, P; Albert, M

    2014-08-01

    CV247 (CV), an aqueous mixture of copper (Cu) and manganese (Mn) gluconates, vitamin C and sodium salicylate increased the antitumour effects of cisplatin (CDPP; cis-diamminedichloroplatinum) in vitro. We hypothesized that the antioxidant and cyclooxygenase-2 (COX-2; prostaglandin-endoperoxide synthase 2) inhibitory components of CV can protect the kidneys from CDPP nephrotoxicity in rats. CDPP (6.5 mg/kg, intraperitoneally) slightly elevated serum creatinine (Crea) and blood urea nitrogen (BUN) 12 days after treatment. Kidney histology demonstrated extensive tubular epithelial damage and COX-2 immunoreactivity increased 14 days after treatment. A large amount of platinum (Pt) accumulated in the kidney of CDPP-treated rats. Furthermore, CDPP decreased renal iron (Fe), molybdenum (Mo), zinc (Zn), Cu and Mn concentrations and increased plasma Fe and Cu concentrations. CDPP elevated plasma free radical concentration. Treatment with CV alone for 14 days (twice 3 ml/kg/day orally) did not influence these parameters. Chronic CV administration after CDPP reduced renal histological damage and slightly decreased COX-2 immunoreactivity, while failed to prevent the increase in Crea and BUN levels. Blood free radical concentration was reduced, that is, CV improved redox homeostasis. CV restored plasma Fe and renal Fe, Mo and Zn, while decreased Pt and elevated Cu and Mn concentrations in the kidney. Besides the known synergistic antitumour effects with CDPP, CV partially protected the kidneys from CDPP nephrotoxicity probably through its antioxidant effect. PMID:23653282

  14. Switching Investigations on a SiC MOSFET in a TO-247 Package

    DEFF Research Database (Denmark)

    Anthon, Alexander; Hernandez Botella, Juan Carlos; Zhang, Zhe;

    2014-01-01

    This paper deals with the switching behavior of a SiC MOSFET in a TO-247 package. Based on simulations, critical parasitic inductances in the circuit layout are analyzed and their effect on the switching losses highlighted. Especially the common source inductance, a critical parameter in a TO-247...... package, has a major influence on the switching energy. Crucial design guidelines for an improved double pulse test circuit are introduced which are used for practical investigations on the switching behavior. Switching energies of a SiC MOSFET in a TO-247 package is measured depending on varying gate...

  15. Complications of laparoscopic cholecystectomy: an experience of 247 cases

    International Nuclear Information System (INIS)

    Laparoscopic cholecystectomy needs lot of training and experience in developing countries like Pakistan. After the introduction of laparoscopic cholecystectomy several studies have been conducted to evaluate the complications of laparoscopic cholecystectomy and to establish the efficacy and safety of the procedure. The aim of this study was to determine the complications of laparoscopic cholecystectomy in a teaching hospital during the learning process. Methods: This descriptive case series was conducted in the department of General Surgery at Social Security Teaching Hospital, Islamabad, from October 2012 to February 2015. Patients of more than 15 years of age having symptomatic gallstones were included. Patients with dilated common bile duct (>8 mm in diameter), jaundice, acute cholecystitis, mass at porta hepatis and positive hepatitis B or C virology were excluded. Results: A sample of 247 consecutive patients was studied. Of them, 218 (88.26%) were females and 29 (11.74 %) were males. Their age ranged from 15 to 73 years (mean 43.37). Six (2.43%) patients developed epigastric port site wound infection. Four patients (1.62%) had bleeding. There was bile leakage in 2 (0.82 %) patients postoperatively. Two patients (0.82%) had collection (haematoma) in pouch of Morrison. One patient (0.41%) had duodenal injury. Eighteen (7.29 %) laparoscopic procedures were converted to open cholecystectomy. The mean postoperative hospital stay was 1.8 days. Conclusion: Complication rate is high in early learning phase of laparoscopic surgery which can be reduced with proper training of surgeons and they should perform these procedures under supervision of experienced laparoscopic surgeons during their learning phase. (author)

  16. Californium interrogation prompt neutron (CIPN) instrument for non-destructive assay of spent nuclear fuel-Design concept and experimental demonstration

    Science.gov (United States)

    Henzlova, D.; Menlove, H. O.; Rael, C. D.; Trellue, H. R.; Tobin, S. J.; Park, Se-Hwan; Oh, Jong-Myeong; Lee, Seung-Kyu; Ahn, Seong-Kyu; Kwon, In-Chan; Kim, Ho-Dong

    2016-01-01

    This paper presents results of the first experimental demonstration of the Californium Interrogation Prompt Neutron (CIPN) instrument developed within a multi-year effort launched by the Next Generation Safeguards Initiative Spent Fuel Project of the United States Department of Energy. The goals of this project focused on developing viable non-destructive assay techniques with capabilities to improve an independent verification of spent fuel assembly characteristics. For this purpose, the CIPN instrument combines active and passive neutron interrogation, along with passive gamma-ray measurements, to provide three independent observables. This paper describes the initial feasibility demonstration of the CIPN instrument, which involved measurements of four pressurized-water-reactor spent fuel assemblies with different levels of burnup and two initial enrichments. The measurements were performed at the Post-Irradiation Examination Facility at the Korea Atomic Energy Institute in the Republic of Korea. The key aim of the demonstration was to evaluate CIPN instrument performance under realistic deployment conditions, with the focus on a detailed assessment of systematic uncertainties that are best evaluated experimentally. The measurements revealed good positioning reproducibility, as well as a high degree of insensitivity of the CIPN instrument's response to irregularities in a radial burnup profile. Systematic uncertainty of individual CIPN instrument signals due to assembly rotation was found to be orientation in the instrument.

  17. Association of CD247 polymorphisms with rheumatoid arthritis: a replication study and a meta-analysis.

    Directory of Open Access Journals (Sweden)

    María Teruel

    Full Text Available Given the role of CD247 in the response of the T cells, its entailment in autoimmune diseases and in order to better clarify the role of this gene in RA susceptibility, we aimed to analyze CD247 gene variants previously associated with other autoimmune diseases (rs1052237, rs2056626 and rs864537 in a large independent European Caucasian population. However, no evidence of association was found for the analyzed CD247 single-nucleotide polymorphisms (SNPs with RA and with the presence/absence of anti-cyclic citrullinated polypeptide. We performed a meta-analysis including previously published GWAS data from the rs864537 variant, revealing an overall genome-wide significant association between this CD247 SNP and RA with anti-CCP (OR = 0.90, CI 95% = 0.87-0.93, Poverall = 2.1×10(-10. Our results show for first time a GWAS-level association between this CD247 polymorphism and RA risk.

  18. Library open 24/7: A study of user needs and library management concerns

    Institute of Scientific and Technical Information of China (English)

    BAO; Xueming

    2009-01-01

    Facing competition from Web-based information service development,academic librarians need to find ways to attract more users to the physical library buildings.This study investigated user needs and library management concerns for a 24/7 service through two surveys:1)User feedback survey at Seton Hall University Library,and 2)Survey of Academic Library Deans and Directors in the USA.Based on these two surveys,the paper not only discussed the current status of libraries open 24/7 in the USA and showed the demographics of users of the 24/7 service at Seton Hall University,it also stated reasons to use the 24/7 service.In addition,the paper revealed library management concerns of the24/7 service.Three implications,which have been guided by Scott Bennett’s theory of learning commons for planning library space,were drawn from the findings in this paper.

  19. Biological Efficiency of Californium-252 Source Evaluated by Comet Assay, Classical Cytogenetics and FISH in Human Lymphocytes Irradiated without and with BSH Pretreatment

    International Nuclear Information System (INIS)

    Biological effectiveness of californium-252 source was evaluated after irradiations in vitro of normal or pre-treated with compound enriched in B-10 ion cells. Peripheral blood lymphocytes were used as a model for human cells. DNA and chromosomal damage were studied to compare biological effectiveness of irradiation. Human blood samples or isolated lymphocytes were irradiated with the isotopic source of 252Cf, at the Faculty of Physics and Nuclear Techniques at the University of Mining and Metallurgy (both neutron source and samples were placed in ''infinite'' polyethylene block). Chemical pretreatment with Na210B12H11SH (BSH) was performed to introduce boron-10 ion into cells in order to check any enhancement effect due to the process of boron neutron capture. Single cell gel electrophoresis also known as the Comet assay was done to investigate the DNA damage. Classical cytogenetic analysis was applied to assess the frequencies of unstable aberrations (dicentrics, rings and a centric fragments). To evaluate the frequencies of stable aberrations the fluorescence in situ hybridisation (FISH) with probes for chromosomes 1, 4 (14.3% of the whole genome) was performed. Linear (or close to linear) increase with radiation dose were observed for the DNA damage and aberration frequencies in lymphocytes both untreated or pre-treated with BSH. Levels of translocations evaluated for the whole genome were comparable with the frequencies of dicentrics and rings. No significant differences were detected due to radiation dose in the frequencies of sister chromatid exchanges (SCE) detected in the second mitosis. No statistically significant differences were observed in various biological end-points between normal or boron pre-treated cells. (author)

  20. 40 CFR 408.247 - Effluent limitations guidelines representing the degree of effluent reduction attainable by the...

    Science.gov (United States)

    2010-07-01

    ... control technology (BCT). 408.247 Section 408.247 Protection of Environment ENVIRONMENTAL PROTECTION... 40 Protection of Environment 28 2010-07-01 2010-07-01 true Effluent limitations guidelines... degree of effluent reduction attainable by the application of the best conventional pollutant...

  1. 5 CFR 531.247 - Maximum payable rate rule for GM employees.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Maximum payable rate rule for GM... REGULATIONS PAY UNDER THE GENERAL SCHEDULE Determining Rate of Basic Pay Special Rules for Gm Employees § 531.247 Maximum payable rate rule for GM employees. (a) A rate received by a GM employee may qualify as...

  2. Burner Rig Hot Corrosion of Five Ni-Base Alloys Including Mar-M247

    Science.gov (United States)

    Nesbitt, James A.; Helmink, R.; Harris, K.; Erickson, G.

    2000-01-01

    The hot corrosion resistance of four new Ni-base superalloys was compared to that of Mar-M247 by testing in a Mach 0.3 burner rig at 900 C for 300 1-hr cycles. While the Al content was held the same as in the Mar-M247, the Cr and Co levels in the four new alloys were decreased while other strengthening elements (Re, Ta) were increased. Surprisingly, despite their lower Cr and Co contents, the hot corrosion behavior of all four new alloys was superior to that of the Mar-M247 alloy. The Mar-M247 alloy began to lose weight almost immediately whereas the other four alloys appeared to undergo an incubation period of 50-150 1-hr cycles. Examination of the cross-sectional microstructures showed regions of rampant corrosion attack (propagation stage) in all five alloys after 300 1-hr cycles . This rampant corrosion morphology was similar for each of the alloys with Ni and Cr sulfides located in an inner subscale region. The morphology of the attack suggests a classic "Type I", or high temperature, hot corrosion attack.

  3. 48 CFR 3052.247-72 - F.o.b. destination only.

    Science.gov (United States)

    2010-10-01

    ... CLAUSES Text of Provisions and Clauses 3052.247-72 F.o.b. destination only. As prescribed in (HSAR) 48 CFR 3047.305-70(c), insert the following provision: F.O.B. Destination Only (DEC 2003) Offers are invited... 48 Federal Acquisition Regulations System 7 2010-10-01 2010-10-01 false F.o.b. destination...

  4. Formation and characterization of Y:247 film through spray pyrolysis technique

    Indian Academy of Sciences (India)

    Suman Anand; O N Srivastava

    2004-04-01

    The synthesis of high temperature superconducting films of Y:247 (c ∼ K) have been successfully achieved. The difficulty in synthesis owing to narrow range of stability of Y:247 has been taken care of through several quenching modes, e.g. quenching of the films synthesized at ∼ 850°C, in air or in liquid nitrogen. The energy dispersive analysis of X-rays (EDAX) and transmission electron microscopy (TEM) studies of the as processed film, Y2Ba4Cu7O14+, exhibit nearly correct cationic stoichiometry of 2 : 4 : 7; also narrow regions (< 50 Å) of minority Y:124 phase and stacking faults capable of working as flux pinning sites have been invariably found to be present. In addition to Y:247, Ag admixed films have also been investigated. The c here is ∼ 70–75 K which is similar to that of the film without silver. Representative estimates of transport critical current density (c) for Y:247 films is ∼ 103 A/cm2, and with silver corresponding to Y2Ba4Cu7O14+ (Ag0.1) is found to be ∼ 104 A/cm2.

  5. 48 CFR 247.372 - DD Form 1654, Evaluation of Transportation Cost Factors.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false DD Form 1654, Evaluation... Transportation in Supply Contracts 247.372 DD Form 1654, Evaluation of Transportation Cost Factors. Contracting personnel may use the DD Form 1654 to furnish information to the transportation office for development...

  6. 48 CFR 247.371 - DD Form 1653, Transportation Data for Solicitations.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false DD Form 1653... Supply Contracts 247.371 DD Form 1653, Transportation Data for Solicitations. The transportation specialist prepares the DD Form 1653 to accompany requirements for the acquisition of supplies. The...

  7. 48 CFR 247.370 - DD Form 1384, Transportation Control and Movement Document.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false DD Form 1384... Transportation in Supply Contracts 247.370 DD Form 1384, Transportation Control and Movement Document. The transportation office of the shipping activity prepares the DD Form 1384 to accompany all shipments made...

  8. Using Technology 24/7 for Regional Assistance after Shutdown of Major Industries

    Science.gov (United States)

    Brinkman, Patricia; Hart, Melanie; Olinsky, Christine; Merkowitz, Rose Fisher

    2011-01-01

    People facing unemployment or who are underemployed need access to community and financial information and resources 24/7. Collaborating with community agencies and organizations, FCS educators developed a website with comprehensive local and state resources and educational tools that the consumer might otherwise not have been aware were…

  9. 7 CFR 247.13 - Provisions for non-English or limited-English speakers.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Provisions for non-English or limited-English speakers... § 247.13 Provisions for non-English or limited-English speakers. (a) What must State and local agencies do to ensure that non-English or limited-English speaking persons are aware of their rights...

  10. Yeast Interacting Proteins Database: YGR247W, YOR327C [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available YGR247W CPD1 Cyclic nucleotide phosphodiesterase, hydrolyzes ADP-ribose 1'', 2''-cyclic phosphate ... e to ADP-ribose 1''-phosphate ; may have a role in tRNA splicing; no detectable p ... odiesterase, hydrolyzes ADP-ribose 1'', 2''-cyclic phosphate ... to ADP-ribose 1''-phosphate ; may have a role in tR ...

  11. 7 CFR 247.2 - The purpose and scope of CSFP.

    Science.gov (United States)

    2010-01-01

    ... Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS COMMODITY SUPPLEMENTAL FOOD PROGRAM § 247.2 The purpose and scope of CSFP... and local agencies. Food packages include such nutritious foods as infant formula and cereal,...

  12. 48 CFR 52.247-8 - Estimated Weights or Quantities Not Guaranteed.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Estimated Weights or... Provisions and Clauses 52.247-8 Estimated Weights or Quantities Not Guaranteed. As prescribed in 47.207-3(e... transportation-related services when weights or quantities are estimates: Estimated Weights or Quantities...

  13. 48 CFR 52.247-63 - Preference for U.S.-Flag Air Carriers.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Preference for U.S.-Flag... Clauses 52.247-63 Preference for U.S.-Flag Air Carriers. As prescribed in 47.405, insert the following clause: Preference for U.S.-Flag Air Carriers (JUN 2003) (a) Definitions. As used in this...

  14. Prevalence of Plasmodium vivax VK210 and VK247 subtype in Myanmar

    Directory of Open Access Journals (Sweden)

    Kang Yoon-Joong

    2010-07-01

    Full Text Available Abstract Background Plasmodium vivax is divided into two subtypes, a dominant form, VK210 and a variant form, VK247. This division is dependent on the amino acid composition of the circumsporozoite (CS protein. In this study, the prevalence of the VK247 variant form of P. vivax was investigated in Myanmar. Methods The existence of malaria parasites in blood samples was determined by microscopic examination, polymerase chain reaction (PCR and DNA hybridization assays. To test for antibodies against P. vivax and Plasmodium falciparum in blood samples, an indirect immunofluorescence antibody test (IFAT was performed using asexual blood antigens. An enzyme-linked immunosorbent assay with synthetic VK210 and VK247 antigens was carried out to discriminate between the P. vivax subtypes. Results By thick smear examination, 73 (n = 100 patients were single infected with P. vivax, one with P. falciparum and 13 with both species. By thin smear, 53 patients were single infected with P. vivax, eight with only P. falciparum and 16 with both. Most of the collected blood samples were shown to be P. vivax positive (n = 95 by PCR. All cases that were positive for P. falciparum by PCR (n = 43 were also positive for P. vivax. However, 52 cases were single infected with P. vivax. IFAT showed antibody titres from 1:32 to 1:4,096. Additionally, using specific antibodies for VK210 and VK247, ELISA showed that 12 patients had antibodies for only the VK210 subtype, 4 patients had only VK247 subtype antibodies and 21 patients had antibodies for both subtypes. Using a DNA hybridization test, 47 patients were infected with the VK210 type, one patient was infected with VK247 and 23 patients were infected with both subtypes. Conclusions The proportion of the VK247 subtype in Myanmar was 43.1% (n = 25 among 58 positive cases by serodiagnosis and 25.6% (n = 24 among 94 positive cases by genetic diagnosis. In both diagnostic methods, the infection status of malaria patients is

  15. Solution heat-treatment of Nb-modified MAR-M247 superalloy

    International Nuclear Information System (INIS)

    MAR-M247 superalloy has excellent mechanical properties and good oxidation resistance at elevated temperatures. Niobium is an element known as γ′ phase hardener in nickel-based superalloys, besides promoting homogeneous distribution of MC carbides. This work is inserted in a project that aims to evaluate the total replacement of tantalum by niobium atoms in MAR-M247 superalloy (10.2 Co, 10.2 W, 8.5Cr, 5.6 Al, 1.6 Nb, 1.4 Hf, 1.1 Ti, 0.7 Mo, 0.15 C, 0.06 Zr, 0.015 B, Ni balance—wt.%). Based on microstructural characterizations (SEM and FEG-SEM, both with EDS) of the as-cast material and heat-treated materials as well as utilizing Thermocalc simulations and experiments of differential thermal analysis (DTA), heat-treatment at 1260 °C for 8 h was chosen as an ideal condition for the solution of Nb-modified MAR-M247 superalloy. The hardness of as-cast and ideally solution treated materials was 390 ± 14 HV and 415 ± 6 HV, respectively. - Highlights: ► DTA and microstructure of MAR-M247(Nb) showed a good agreement with Thermocalc. ► An ideal condition for solution heat-treatment of MAR-M247(Nb) is 1260 °C for 8 h. ► It was an observed evidence of incipient melting in samples heat-treated at 1280 °C.

  16. Solution heat-treatment of Nb-modified MAR-M247 superalloy

    Energy Technology Data Exchange (ETDEWEB)

    Soares Azevedo e Silva, Paulo Ricardo, E-mail: paulori@alunos.eel.usp.br [Universidade de Sao Paulo (USP), Escola de Engenharia de Lorena (EEL), Departamento de Engenharia de Materiais DEMAR, Polo Urbo-Industrial Gleba AI-6, Caixa Postal 116, 12600-970, Lorena, Sao Paulo (Brazil); Baldan, Renato, E-mail: renato@ppgem.eel.usp.br [Universidade de Sao Paulo (USP), Escola de Engenharia de Lorena (EEL), Departamento de Engenharia de Materiais DEMAR, Polo Urbo-Industrial Gleba AI-6, Caixa Postal 116, 12600-970, Lorena, Sao Paulo (Brazil); Nunes, Carlos Angelo, E-mail: cnunes@demar.eel.usp.br [Universidade de Sao Paulo (USP), Escola de Engenharia de Lorena (EEL), Departamento de Engenharia de Materiais DEMAR, Polo Urbo-Industrial Gleba AI-6, Caixa Postal 116, 12600-970, Lorena, Sao Paulo (Brazil); Carvalho Coelho, Gilberto, E-mail: coelho@demar.eel.usp.br [Universidade de Sao Paulo (USP), Escola de Engenharia de Lorena (EEL), Departamento de Engenharia de Materiais DEMAR, Polo Urbo-Industrial Gleba AI-6, Caixa Postal 116, 12600-970, Lorena, Sao Paulo (Brazil); UniFoa, Centro Universitario de Volta Redonda, Nucleo de Pesquisa, Campus Tres Pocos, Avenida Paulo Erlei Alves Abrantes, 1325, Bairro Tres Pocos, 27240-560, Volta Redonda, Rio de Janeiro (Brazil); and others

    2013-01-15

    MAR-M247 superalloy has excellent mechanical properties and good oxidation resistance at elevated temperatures. Niobium is an element known as {gamma} Prime phase hardener in nickel-based superalloys, besides promoting homogeneous distribution of MC carbides. This work is inserted in a project that aims to evaluate the total replacement of tantalum by niobium atoms in MAR-M247 superalloy (10.2 Co, 10.2 W, 8.5Cr, 5.6 Al, 1.6 Nb, 1.4 Hf, 1.1 Ti, 0.7 Mo, 0.15 C, 0.06 Zr, 0.015 B, Ni balance-wt.%). Based on microstructural characterizations (SEM and FEG-SEM, both with EDS) of the as-cast material and heat-treated materials as well as utilizing Thermocalc simulations and experiments of differential thermal analysis (DTA), heat-treatment at 1260 Degree-Sign C for 8 h was chosen as an ideal condition for the solution of Nb-modified MAR-M247 superalloy. The hardness of as-cast and ideally solution treated materials was 390 {+-} 14 HV and 415 {+-} 6 HV, respectively. - Highlights: Black-Right-Pointing-Pointer DTA and microstructure of MAR-M247(Nb) showed a good agreement with Thermocalc. Black-Right-Pointing-Pointer An ideal condition for solution heat-treatment of MAR-M247(Nb) is 1260 Degree-Sign C for 8 h. Black-Right-Pointing-Pointer It was an observed evidence of incipient melting in samples heat-treated at 1280 Degree-Sign C.

  17. Prediction of fatigue lives of MAR-M247 LC based on the crack closure concept

    Energy Technology Data Exchange (ETDEWEB)

    Gelmedin, Domnin; Lang, Karl-Heinz [Karlsruhe Institute of Technology, Institute for Applied Materials - Materials Science and Engineering (IAM-WK) Campus Sued, Engelbert-Arnold-Strasse 4, 76131 Karlsruhe (Germany); Newman, James C. Jr. [Department of Aerospace Engineering, Mississippi State University, 314C Walker Engineering Building P. O. Box A Mississippi State, MS 39762 (United States)

    2012-10-15

    Low cycle fatigue (LCF), high cycle fatigue (HCF), and combined LCF and HCF tests are carried out on MAR-M247 LC at 650 C in air environment. Under combined LCF and HCF loading, block striations form on the fracture surface which are used to complete an effective crack growth curve by using the linear summation model. Crack growth lives starting from equivalent initial flaw sizes are calculated by the crack closure code FASTRAN and compared with experimental fatigue lives. Under HCF loading, predicted and experimental fatigue lives agree well for lifetimes above 10{sup 5} cycles. Lower lifetimes are overestimated indicating that the linear summation model is not valid for MAR-M247 LC in this loading range. Interactions between the non-crystallographic HCF crack growth and striated crack growth that is caused by the LCF loading are probably responsible for this behavior. (Copyright copyright 2012 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

  18. Study on Application of Grey Prediction Model in Superalloy MAR-247 Machining

    OpenAIRE

    Chen Shao-Hsien

    2015-01-01

    Superalloy MAR-247 is mainly applied in the space industry and die industry. With its characteristics of mechanical property, fatigue resistance, and high temperature corrosion resistance, therefore, it is mainly applied in machine parts of high temperature and corrosion resistance, such as turbine blades and rotor of the aeroengine and turbine assembly in the nuclear power plant. However, considering that its properties of high strength, low thermal conductivity, being difficult to soften, a...

  19. Evaluation of Cm-247 neutron cross sections in the resonance region

    International Nuclear Information System (INIS)

    The neutron cross sections of Cm-247 are evaluated in the resonance (resolved and unresolved) region up to 10 keV. Average resonance parameters (i.e. spacing D, fission and radiative widths, neutron strength functions) are determined for unresolved region calculations. Moreover for a better comparison with the experimental data, fission cross section is calculated up to 10 MeV. In addition, the average number of neutrons emitted per fission as a function of energy is estimated

  20. 48 CFR 3052.247-71 - F.o.b. origin only.

    Science.gov (United States)

    2010-10-01

    ... CLAUSES Text of Provisions and Clauses 3052.247-71 F.o.b. origin only. As prescribed in (HSAR) 48 CFR 3047.305-70(b), insert the following provision: F.O.B. Origin Only (DEC 2003) Offers are invited on the... 48 Federal Acquisition Regulations System 7 2010-10-01 2010-10-01 false F.o.b. origin only....

  1. A novel thymoma-associated immunodeficiency with increased naive T cells and reduced CD247 expression.

    Science.gov (United States)

    Christopoulos, Petros; Dopfer, Elaine P; Malkovsky, Miroslav; Esser, Philipp R; Schaefer, Hans-Eckart; Marx, Alexander; Kock, Sylvia; Rupp, Nicole; Lorenz, Myriam R; Schwarz, Klaus; Harder, Jan; Martin, Stefan F; Werner, Martin; Bogdan, Christian; Schamel, Wolfgang W A; Fisch, Paul

    2015-04-01

    The mechanisms underlying thymoma-associated immunodeficiency are largely unknown, and the significance of increased blood γδ Τ cells often remains elusive. In this study we address these questions based on an index patient with thymoma, chronic visceral leishmaniasis, myasthenia gravis, and a marked increase of rare γδ T cell subsets in the peripheral blood. This patient showed cutaneous anergy, even though he had normal numbers of peripheral blood total lymphocytes as well as CD4(+) and CD8(+) T cells. Despite his chronic infection, analyses of immunophenotypes and spectratyping of his lymphocytes revealed an unusual accumulation of naive γδ and αβ T cells, suggesting a generalized T cell activation defect. Functional studies in vitro demonstrated substantially diminished IL-2 and IFN-γ production following TCR stimulation of his "untouched" naive CD4(+) T cells. Biochemical analysis revealed that his γδ and αβ T cells carried an altered TCR complex with reduced amounts of the ζ-chain (CD247). No mutations were found in the CD247 gene that encodes the homodimeric ζ protein. The diminished presence of CD247 and increased numbers of γδ T cells were also observed in thymocyte populations obtained from three other thymoma patients. Thus, our findings describe a novel type of a clinically relevant acquired T cell immunodeficiency in thymoma patients that is distinct from Good's syndrome. Its characteristics are an accumulation of CD247-deficient, hyporresponsive naive γδ and αβ T cells and an increased susceptibility to infections. PMID:25732729

  2. THE DEVELOPMENT OF BIOCHEMICAL OXYGEN DEMAND SENSOR USING LOCAL YEAST: Candida fukuyamaensis, UICC Y-247

    OpenAIRE

    Endang Saepudin; Fenny Triana Zulfia; Ivandini Tribidasari Anggraningrum

    2011-01-01

    In order to shorten the measurement time of biochemical oxygen demand (BOD), a BOD sensor based on yeastmetabolism was developed. Local yeast, Indonesian Origin, Candida fukuyamaensis UICC Y-247, was used as atransducer. The yeast was immobilized as a thin film in agarose matrix with the auxiliary of Nafion® acting as themembrane for ion exchange process. The film was then attached to gold-modified glassy carbons and used as transduceron the working electrodes. The measurements were conducted...

  3. Estimation of Al, Hf, Ta in 247Cm-alloy by ICP-AES

    International Nuclear Information System (INIS)

    The present paper discusses a new method developed for analysis of Al, Hf and Ta in Nickel based 247Cm super alloy by Inductively Coupled Plasma Atomic Emission Spectrometer (ICP-AES). The procedure employs the dissolution of alloy in a mixture of Sulphuric acid, Nitric acid and Hf and subsequent analysis by sequential ICP-AES (Model JY Ultima 2C HR, France). A Relative Standard Deviation of less than ± 5% has been achieved for all the elements. (author)

  4. The energy and monetary implications of the '24/7' 'always on' society

    International Nuclear Information System (INIS)

    This paper reviews the trends in society, technology and energy demand of the past 30 years, together with the growth of the 'on-demand' culture. The '24/7' or 'always on' society can be defined as one where people demand-and generally receive-what they want 'now'. It has grown up in parallel with developments in information technology, which have produced the services needed to meet that demand. Larger numbers of appliances, resulting from greater affluence and disposable income, have increased energy use, despite energy efficiencies in other areas. While monetary factors suggest that changes brought about by the 24/7 society will generally be self-correcting at the macro-economic level, there will nevertheless be effects for individuals, such as potentially severe impacts on the fuel poor as electricity prices rise. We conclude with a view of future directions. As the 24/7 culture continues to grow, there is scope for designers and for information technology to manage and reduce energy consumption. This includes buildings, their services systems, and the mix of new technologies that will be deployed over the next 20 years or so, including the possibilities for data exchange and control at the interface between energy suppliers and consumers, coupled with greater understanding of the behaviour of the consumers themselves

  5. The energy and monetary implications of the '24/7 'always on' society

    International Nuclear Information System (INIS)

    This paper reviews the trends in society, technology and energy demand of the past 30 years, together with the growth of the 'on-demand' culture. The '24/7' or 'always on' society can be defined as one where people demand - and generally receive - what they want 'now'. It has grown up in parallel with developments in information technology, which have produced the services needed to meet that demand. Larger numbers of appliances, resulting from greater affluence and disposable income, have increased energy use, despite energy efficiencies in other areas. While monetary factors suggest that changes brought about by the 24/7 society will generally be self-correcting at the macro-economic level, there will nevertheless be effects for individuals, such as potentially severe impacts on the fuel poor as electricity prices rise. We conclude with a view of future directions. As the 24/7 culture continues to grow, there is scope for designers and for information technology to manage and reduce energy consumption. This includes buildings, their services systems, and the mix of new technologies that will be deployed over the next 20 years or so, including the possibilities for data exchange and control at the interface between energy suppliers and consumers, coupled with greater understanding of the behaviour of the consumers themselves. (author)

  6. Californium Recovery from Palladium Wire

    Energy Technology Data Exchange (ETDEWEB)

    Burns, Jon D. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States)

    2014-08-01

    The recovery of 252Cf from palladium-252Cf cermet wires was investigated to determine the feasibility of implementing it into the cermet wire production operation at Oak Ridge National Laboratory’s Radiochemical Engineering Development Center. The dissolution of Pd wire in 8 M HNO3 and trace amounts of HCl was studied at both ambient and elevated temperatures. These studies showed that it took days to dissolve the wire at ambient temperature and only 2 hours at 60°C. Adjusting the ratio of the volume of solvent to the mass of the wire segment showed little change in the kinetics of dissolution, which ranged from 0.176 mL/mg down to 0.019 mL/mg. A successful chromatographic separation of 153Gd, a surrogate for 252Cf, from Pd was demonstrated using AG 50x8 cation exchange resin with a bed volume of 0.5 mL and an internal diameter of 0.8 cm.

  7. Deep Fabry-Perot Hα observations of two Sculptor group galaxies, NGC 247 and 300

    Science.gov (United States)

    Hlavacek-Larrondo, J.; Marcelin, M.; Epinat, B.; Carignan, C.; de Denus-Baillargeon, M.-M.; Daigle, O.; Hernandez, O.

    2011-09-01

    It has been suggested that diffuse ionized gas can extend all the way to the end of the H I disc, and even beyond, such as in the case of the warped galaxyNGC 253 (Bland-Hawthorn et al.). Detecting ionized gas at these radii could carry significant implications as to the distribution of dark matter in galaxies. With the aim of detecting this gas, we carried out a deep Hα kinematical analysis of two Sculptor group galaxies, NGC 247 and 300. The Fabry-Perot data were taken at the 36-cm Marseille Telescope in La Silla, Chile, offering a large field of view. With almost 20 hours of observations for each galaxy, very faint diffuse emission is detected. Typical emission measures of 0.1 cm-6 pc are reached. For NGC 247, emission extending up to a radius comparable with that of the H I disc (r˜ 13 arcmin) is found, but no emission is seen beyond the H I disc. For NGC 300, we detect ionized gas on the entirety of our field of view (rmax˜ 14 arcmin), and find that the bright H II regions are embedded in a diffuse background. Using the deep data, extended optical rotation curves are obtained, as well as mass models. These are the most extended optical rotation curves thus far for these galaxies. We find no evidence suggesting that NGC 247 has a warped disc, and to account for our non-detection of Hα emission beyond its H I disc, as opposed to the warped galaxy NGC 253, our results favour the model in which, only through a warp, ionization by hot young stars in the central region of a galaxy can let photons escape and ionize the interstellar medium in the outer parts.

  8. High cycle fatigue of nickel-based superalloy MAR-M 247 at high temperatures

    Czech Academy of Sciences Publication Activity Database

    Šmíd, Miroslav; Kunz, Ludvík; Hutař, Pavel; Hrbáček, K.

    Amsterdam : Elsevier, 2014 - (Gulagliano, M.; Vergani, L.), s. 329-332 ISSN 1877-7058. - (Procedia Engineering. 74). [ICMFM 2014 International Colloquium on Mechanical Fatigue of Metals /17./. Verbania (IT), 25.06.2014-27.06.2014] R&D Projects: GA MPO FR-TI4/030; GA MŠk(CZ) EE2.3.20.0214 Institutional support: RVO:68081723 Keywords : High cycle fatigue * Superalloy * MAR-M 247 * High temperature * Fracture surface * S-N curve Subject RIV: JL - Materials Fatigue, Friction Mechanics

  9. Molecular line survey of Orion A from 215 to 247 GHz

    International Nuclear Information System (INIS)

    Molecular line emission from the core of the Orion molecular cloud has been surveyed from 215 to 247 GHz to an average sensitivity of about 0.2 K. A total of 544 resolvable lines were detected, of which 517 are identified and attributed to 25 distinct chemical species. A large fraction of the lines are partially blended with other identified transitions. Because of the large line width in the Orion core, the spectrum is near the confusion limit for the weakest lines identified (roughly-equal0.2 K)

  10. Mesotelioma maligno: Experiencia clínico-patológica de 247 casos Malignant mesothelioma: Clinical and pathological features from 247 cases

    Directory of Open Access Journals (Sweden)

    RAÚL BARRERA R

    2010-09-01

    Full Text Available Objetivo: Este estudio describe la frecuencia, características patológicas, ocupación y exposición a asbesto en una cohorte grande de casos de mesotelioma maligno (MM admitidos en el Instituto Nacional de Enfermedades Respiratorias (INER, en México. Método: Se llevó a cabo un estudio retrospectivo y transversal en los registros médicos de pacientes diagnosticados con MM entre los años 1991-2007. Resultados: De los 247pacientes, 184 fueron hombres y 63 fueron mujeres con un promedio de edad de 51 y 60 años. Disnea y dolor torácico fueron los principales síntomas observados. Exposición a fibras de asbesto fue referida sólo en 34% de los casos, aunque una exposición directa sólo puedo ser documentada en cinco de ellos. Las características clínicas de los pacientes con MM fueron similares en aquellos con y sin exposición a asbesto reconocida. Conclusión: Aunque se observa una tendencia creciente en el número de casos con MM, en muchos de ellos no fue posible establecer una fuente de exposición a asbesto como la causa de contaminación para el desarrollo de la enfermedad.Objective: This study describes the frequency, occupational, clinical, and pathological features in a large cohort of cases of Malignant Mesothelioma (MM from the National Institute of Respiratory Diseases (INER, in México. Methods: A retrospective and transversal study was carried out in medical records of patients diagnosed with MM between the years 1991 to 2007. Results: Of the 247 patients, 184 were male and 63 were female with an average age of 51-60 years. Dyspnea and chest pain were the presenting symptoms in most of the patients. Exposure to asbestos was referred only in 34% of cases but direct exposition only was documented in five of them. Clinical features of MM patients were similar in asbestos related and non-asbestos related malignant mesothelioma. Conclusion: Although a growing tendency is observed in, the number of cases with MM, in many of them

  11. Strain-Life Assessment of Grainex Mar-M 247 for NASA's Turbine Seal Test Facility

    Science.gov (United States)

    Delgado, Irebert R.; Halford, Gary R.; Steinetz, Bruce M.; Rimnac, Clare M.

    2004-01-01

    NASA s Turbine Seal Test Facility is used to test air-to-air seals for use primarily in advanced jet engine applications. Combinations of high temperature, high speed, and high pressure limit the disk life, due to the concern of crack initiation in the bolt holes of the Grainex Mar-M 247 disk. The primary purpose of this current work is to determine an inspection interval to ensure safe operation. The current work presents high temperature fatigue strain-life data for test specimens cut from an actual Grainex Mar-M 247 disk. Several different strain-life models were compared to the experimental data including the Manson-Hirschberg Method of Universal Slopes, the Halford-Nachtigall Mean Stress Method, and the Modified Morrow Method. The Halford-Nachtigall Method resulted in only an 18 percent difference between predicted and experimental results. Using the experimental data at a 99.95 percent prediction level and the presence of 6 bolt holes it was found that the disk should be inspected after 665 cycles based on a total strain of 0.5 percent at 649 C.

  12. Microstructure and oxidation performance of a –' Pt-aluminide bond coat on directionally solidified superalloy CM-247LC

    Indian Academy of Sciences (India)

    Md Zafir Alam; N Hazari; Dipak K Das

    2014-10-01

    The microstructure of a Pt-modified -' bond coat on CM-247LC Ni-base superalloy has been examined and its cyclic oxidation performance at 1100 °C in air is comparatively evaluated with that of a conventional -(Ni, Pt)Al bond coat. The -' bond coat was effective in imparting oxidation resistance to the CM-247LC alloy for about 100 h, whereas the coating imparted oxidation resistance for significantly longer duration of about 1000 h. The nature of surface damage that occurred to the -' coating during oxidation has been compared with that reported in the case of coating.

  13. QCW diode-side-pumped Nd:YAG ceramic laser with 247 W output power at 1123 nm

    Science.gov (United States)

    Li, C. Y.; Peng, Q. J.; Wang, B. S.; Bo, Y.; Cui, D. F.; Xu, Z. Y.; Feng, X. Q.; Pan, Y. B.

    2011-05-01

    We demonstrate for the first time a diode-side-pumped quasi-continuous-wave (QCW) operation of a 1123 nm Nd:YAG ceramic laser. The single 1123 nm wavelength is acquired through precise coating. With a pump power of 1000 W, an output power of 247 W is obtained, corresponding to an optical-optical conversion efficiency of 24.7%. At the maximal output power, the pulse repetition rate and pulse width are measured to be 1.1 kHz and 180 μs, respectively. The numerical simulations for wavelength selectivity from 1112, 1116 and 1123 nm are discussed in detail.

  14. 32 CFR Appendix C to Part 247 - Mailing of DoD Newspapers, Magazines, CE Guides, and Installation Maps; Sales and Distribution of...

    Science.gov (United States)

    2010-07-01

    ..., and Installation Maps; Sales and Distribution of Non-DoD Publications C Appendix C to Part 247... Appendix C to Part 247—Mailing of DoD Newspapers, Magazines, CE Guides, and Installation Maps; Sales and... installation maps to incoming DoD personnel and their families to orient them to their new...

  15. Design of a homogeneous subcritical nuclear reactor based on thorium with a source of californium 252; Diseno de un reactor nuclear subcritico homogeneo a base de Torio con una fuente de Californio 252

    Energy Technology Data Exchange (ETDEWEB)

    Delgado H, C. E.; Vega C, H. R. [Universidad Autonoma de Zacatecas, Unidad Academica de Estudios Nucleares, Cipres No. 10, Fracc. La Penuela, 98068 Zacatecas, Zac. (Mexico); Sajo B, L., E-mail: ce_delgado89@hotmail.com [Universidad Simon Bolivar, Laboratorio de Fisica Nuclear, Apdo. 89000, 1080A Caracas (Venezuela, Bolivarian Republic of)

    2015-10-15

    Full text: One of the energy alternatives to fossil fuels which do not produce greenhouse gases is the nuclear energy. One of the drawbacks of this alternative is the generation of radioactive wastes of long half-life and its relation to the generation of nuclear materials to produce weapons of mass destruction. An option to these drawbacks of nuclear energy is to use Thorium as part of the nuclear fuel which it becomes in U{sup 233} when capturing neutrons, that is a fissile material. In this paper Monte Carlo methods were used to design a homogeneous subcritical reactor based on thorium. As neutron reflector graphite was used. The reactor core is homogeneous and is formed of 70% light water as moderator, 12% of enriched uranium UO{sub 2}(NO{sub 3}){sub 4} and 18% of thorium Th(NO{sub 3}){sub 4} as fuel. To start the nuclear fission chain reaction an isotopic source of californium 252 was used with an intensity of 4.6 x 10{sup 7} s{sup -1}. In the design the value of the effective multiplication factor, whose value turned out k{sub eff} <1 was calculated. Also, the neutron spectra at different distances from the source and the total fluence were calculated, as well as the values of the ambient dose equivalent in the periphery of the reactor. (Author)

  16. Manganese determination om minerals by activation analysis, using the californium-252 as a neutron source; Determinacao de manganes em minerios, por analise por ativacao, usando californio-252 como fonte de neutrons

    Energy Technology Data Exchange (ETDEWEB)

    Cardoso, Antonio

    1976-07-01

    Neutron Activation Analysis, using a Californium-252 neutron source, has been applied for the determination of manganese in ores such as pyrolusite, rodonite (manganese silicate)' and blending used in dry-batteries The favorable nuclear properties of manganese, such as high thermal neutron cross-section for the reaction {sup 55}Mn (n.gamma){sup 56} Mn, high concentration of manganese in the matrix and short half - life of {sup 56}Mn, are an ideal combination for non-destructive analysis of manganese in ores. Samples and standards of manganese dioxide were irradiated for about 20 minutes, followed by a 4 to 15 minutes decay and counted in a single channel pulse-height discrimination using a NaI(Tl) scintillation detector. Counting time was equal to 10 minutes. The interference of nuclear reactions {sup 56}Fe(n,p){sup 56}Mn and {sup 59} Co (n, {alpha}){sup 56} were studied, as well as problems in connection with neutron shadowing during irradiation, gamma-rays attenuation during counting and influence of granulometry of samples. One sample,was also analysed by wet-chemical method (sodium bismuthate) in order to compare results. As a whole, i t was shown that the analytical method of neutron activation for manganese in ores and blending, is a method simple, rapid and with good precision and accuracy. (author)

  17. 40 CFR 174.524 - Glyphosate Oxidoreductase GOX or GOXv247 in all plants; exemption from the requirement of a...

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 23 2010-07-01 2010-07-01 false Glyphosate Oxidoreductase GOX or... REQUIREMENTS FOR PLANT-INCORPORATED PROTECTANTS Tolerances and Tolerance Exemptions § 174.524 Glyphosate... Glyphosate Oxidoreductase GOX or GOXv247 enzyme in all plants are exempt from the requirement of a...

  18. 48 CFR 52.247-46 - Shipping Point(s) Used in Evaluation of F.o.b. Origin Offers.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Shipping Point(s) Used in... Text of Provisions and Clauses 52.247-46 Shipping Point(s) Used in Evaluation of F.o.b. Origin Offers... when price evaluation for shipments from various shipping points is contemplated: Shipping...

  19. 17 CFR 247.701 - Exemption from the definition of “broker” for certain institutional referrals.

    Science.gov (United States)

    2010-04-01

    ... in a merger, acquisition, tender offer or similar transaction; providing venture capital, equity... which the bank has a contractual or other written arrangement of the type specified in section 3(a)(4)(B... type of compensation that would not be considered incentive compensation under § 247.700(b)(1) or...

  20. 12 CFR 303.247 - Continue or resume status as an insured institution following termination under section 8 of the...

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 4 2010-01-01 2010-01-01 false Continue or resume status as an insured... § 303.247 Continue or resume status as an insured institution following termination under section 8 of... continue or resume its status as an insured depository institution. This section covers institutions...

  1. Phosphorylation of HOX11/TLX1 on Threonine-247 during mitosis modulates expression of cyclin B1

    Directory of Open Access Journals (Sweden)

    Chesney Alden

    2010-09-01

    Full Text Available Abstract Background The HOX11/TLX1 (hereafter referred to as HOX11 homeobox gene was originally identified at a t(10;14(q24;q11 translocation breakpoint, a chromosomal abnormality observed in 5-7% of T cell acute lymphoblastic leukemias (T-ALLs. We previously reported a predisposition to aberrant spindle assembly checkpoint arrest and heightened incidences of chromosome missegregation in HOX11-overexpressing B lymphocytes following exposure to spindle poisons. The purpose of the current study was to evaluate cell cycle specific expression of HOX11. Results Cell cycle specific expression studies revealed a phosphorylated form of HOX11 detectable only in the mitotic fraction of cells after treatment with inhibitors to arrest cells at different stages of the cell cycle. Mutational analyses revealed phosphorylation on threonine-247 (Thr247, a conserved amino acid that defines the HOX11 gene family and is integral for the association with DNA binding elements. The effect of HOX11 phosphorylation on its ability to modulate expression of the downstream target, cyclin B1, was tested. A HOX11 mutant in which Thr247 was substituted with glutamic acid (HOX11 T247E, thereby mimicking a constitutively phosphorylated HOX11 isoform, was unable to bind the cyclin B1 promoter or enhance levels of the cyclin B1 protein. Expression of the wildtype HOX11 was associated with accelerated progression through the G2/M phase of the cell cycle, impaired synchronization in prometaphase and reduced apoptosis whereas expression of the HOX11 T247E mutant restored cell cycle kinetics, the spindle checkpoint and apoptosis. Conclusions Our results demonstrate that the transcriptional activity of HOX11 is regulated by phosphorylation of Thr247 in a cell cycle-specific manner and that this phosphorylation modulates the expression of the target gene, cyclin B1. Since it is likely that Thr247 phosphorylation regulates DNA binding activity to multiple HOX11 target sequences, it is

  2. Energy levels of 247Cm populated in the α decay of 98251Cf

    International Nuclear Information System (INIS)

    α -Particle, conversion-electron, and γ -ray singles spectra of 251Cf sources containing few Bq activities were measured with high-resolution semiconductor detectors. α-γ coincidence and level half-life measurements were also performed. On the basis of these measurements the following single-particle states have been identified in 247Cm : 9/2 - [734] , 0 keV; 5/2 + [622] , 227.4 keV; 7/2 + [624] , 285.4 keV; 1/2 + [620] , 404.9 keV; 1/2 + [631] , 518.6 keV . The measured single-particle energies are in good agreement with energies calculated with a Woods-Saxon single-particle potential. From the measured half-life of the 227.4-keV level and the E3 branching ratio, a B(E3) value of 5 W.u. has been deduced between the 5/2 + [622] and 9/2 - [734] bands. The large B(E3) value is an indication of octupole mixing in the 227.4-keV level

  3. DECOMMISSIONING OF THE 247-F FUEL MANUFACTURING FACILITY AT THE SAVANNAH RIVER SITE

    International Nuclear Information System (INIS)

    Building 247-F at SRS was a roughly 110,000 ft2 two-story facility designed and constructed during the height of the cold war naval buildup to provide additional naval nuclear fuel manufacturing capacity in early 1980s. The building layout is shown in Fig. 1. A photograph of the facility is shown in Fig. 2. The manufacturing process employed a wide variety of acids, bases, and other hazardous materials. As the cold war wound down, the need for naval fuel declined. Consequently, the facility was shut down and underwent initial deactivation. All process systems were flushed with water and drained using the existing process drain valves. However, since these drains were not always installed at the lowest point in piping and equipment systems, a significant volume of liquid remained after initial deactivation was completed in 1990. At that time, a non-destructive assay of the process area identified approximately 17 (+/- 100%) kg of uranium held up in equipment and piping

  4. LOW CYCLE FATIGUE BEHAVIOUR OF NICKEL BASE SUPERALLOYS IN713 LC AND MAR-M-247 HIP AT ELEVATED TEMPERATURE

    Czech Academy of Sciences Publication Activity Database

    Šulák, Ivo; Obrtlík, Karel

    Lausanne: Federation of european materials societies, 2014 - (Hofmann, M.) [Junior Euromat 2014. 21.07.2014-25.07.2014, Lausanne] R&D Projects: GA MŠk(CZ) EE2.3.20.0214 Institutional support: RVO:68081723 Keywords : IN713LC LG * MAR-M247 * High Temperature * Low Cycle Fatigue Subject RIV: JL - Materials Fatigue, Friction Mechanics http://www.dgm.de/tagungen/?tgnr=1511& cat =prg&edate=25.07.2014&lg=en&op=us

  5. EFFECT OF HIP ON LOW CYCLE FATIGUE OF MAR-M247 AT 900°C

    Czech Academy of Sciences Publication Activity Database

    Šulák, Ivo; Obrtlík, Karel; Škorík, Viktor; Hrbáček, K.

    Ostrava : Tanger Ltd, 2014. ISBN 978-80-87294-52-9. [METAL 2014. International Conference on Metallurgy and Materials /22./. Brno (CZ), 21.05.2014-23.05.2014] R&D Projects: GA MŠk(CZ) EE2.3.30.0063 Institutional support: RVO:68081723 Keywords : MAR-M-247 * High temperature * Low cycle fatigue Subject RIV: JL - Materials Fatigue, Friction Mechanics

  6. Prediction of maximum casting defect size in MAR-M-247 alloy processed by hot isostatic pressing

    Czech Academy of Sciences Publication Activity Database

    Šmíd, Miroslav; Fintová, Stanislava; Kunz, Ludvík; Hutař, Pavel; Hrbáček, K.

    2015-01-01

    Roč. 22, č. 1 (2015), s. 25-32. ISSN 1335-0803 R&D Projects: GA MPO FR-TI4/030; GA MŠk(CZ) EE2.3.20.0214 Institutional support: RVO:68081723 Keywords : MAR-M 247 * Superalloys * Fatigue * Casting defects * Elevated temperatures Subject RIV: JL - Materials Fatigue, Friction Mechanics http://ojs.mateng.sk/index.php/Mateng/article/view/160/249

  7. VLA observations of NGC 247: identification of compact radio sources including three candidate UD H II regions

    International Nuclear Information System (INIS)

    A high resolution, Very Large Array continuum survey of NGC 247 was undertaken in order to identify compact thermal and nonthermal radio sources, such as supernova remnants (SNRs) and H II regions. NGC 247 was observed at two frequencies, 20 cm and 6 cm, in order to calculate the spectral index, and the survey resulted in the identification of 19 compact radio sources. Using the spectral index to discriminate between source types, we identify two candidate SNRs and one H II region. Three of the radio sources have inverted spectra, indicative of ultradense H II (UD H II) regions, the short-lived, dense cores where massive stars form. Four of the sources are thermal in origin, but were not detected at 20 cm, so they could be H II regions or UD H II regions. The rest of the sources are nonthermal or undetermined. We compare the radio images with Hα, V band, and infrared archive images to look for correspondences that confirm that the sources reside in NGC 247 and are not background sources. We find that over two-thirds of the radio sources have counterparts in the Hα or V band images and are associated with NGC 247. The most luminous radio source in NGC 247 is a candidate SNR, and if confirmed as an SNR, it would be a very luminous extragalactic SNR. The H II regions and UD H II regions are calculated to have ionizing luminosities of between 4-10 × 1050 s–1; each individual source would require between 41-100 O7.5V stars to produce the corresponding ionizing luminosity. The ionizing luminosity of the UD H II regions indicates that these UD H II regions represent the lower luminosity population of the known UD H II regions and thus, they may represent a more typical population of UD H II regions that can be found and studied in the nearby galaxies as opposed to more extreme examples that have been found previously.

  8. LCF- and LCF/HCF-behaviour of the superalloy MAR-M247LC

    Energy Technology Data Exchange (ETDEWEB)

    Gelmedin, Domnin; Lang, Karl-Heinz [Karlsruhe Institute of Technology (KIT), Karlsruhe (Germany). Inst. fuer Werkstoffkunde I

    2010-07-01

    The fatigue behaviour of the Nickel-base superalloy Mar-M247LC was investigated at 650 C in air environment under total strain control. Pure low cycle fatigue (LCF) loading, pure high cycle fatigue (HCF) loading and superimposed LCF/HCF loading were realised. In LCF tests with a strain ratio of zero and a hold time of 60 seconds the cyclic deformation and the lifetime behaviour was investigated. The dependence of the fatigue limit on the mean strain was estimated in HCF tests at a frequency of 60 Hz using an ultimate number of cycles of ten million. Finally the influence of superimposed HCF and LCF loadings was examined. At high total strain ranges of the HCF loading the lifetime of the superalloy as reduced about more than one magnitude compared to the lifetime under pure LCF loading. With decreasing HCF loadings the reduction of the lifetime decreases. This life time reduction can be explained by the interaction of the LCF and the superimposed HCF loading. Crack initiation and first crack propagation is predominantly induced by the LCF loading. After reaching an adequate long fatigue crack length the superimposed HCF loading contributes considerably to the crack growth. This contribution can be determined evaluating the distance between the LCF marking lines which form on the fracture surface. The higher the superimposed HCF loading was the longer the distance between the LCF marking lines and the lower the crack length were when first LCF marking lines could be recognized. On the basis of this cognition the life time under superimposed LCF/HCF loading was modelled using a model basing on fracture mechanics. (orig.)

  9. Who Should Be at the Bedside 24/7: Doctors, Families, Nurses?

    Science.gov (United States)

    Gershengorn, Hayley B; Garland, Allan

    2016-02-01

    Critical illness does not keep to regular, daytime business hours; we must provide high-quality care and support for intensive care unit (ICU) patients 24 hours per day, 7 days per week. Whether this mandates the presence of similar numbers and types of personnel throughout all hours of the day, however, has been the subject of much debate and substantial research. In this article, we review the available literature on the consequences of having three groups of care providers at a patient's bedside overnight: physicians, visitors, and nurses. Though few of the studies on this topic are randomized and prospective, several themes have emerged from the existing data. First, there is dramatic variation in practice between and within countries. Second, the weight of evidence does not indicate that patient outcomes are improved by having an intensivist present overnight in ICUs that are staffed by intensivists during the daytime hours. Third, although visitation is highly restricted in many ICUs-out of concerns for disruption of care and a negative physiological or psychological impact on patients-the available data suggest that patients and their families generally benefit from open visitation policies. And finally, although there is little debate that nurses are (and should be) available in the ICU 24/7, existing data do not provide much of a consensus about the details. Uncertainties include whether outcomes are better when each nurse is assigned only one patient (or, more generally, the optimal patient:nurse ratio), who these nurses should be (e.g., registered nurses vs. other personnel), and what their roles should entail (e.g., managing ventilators). As such, we cannot yet identify the optimal overnight nurse staffing strategy. What is clear is that the critical care community needs more and better data to further define these aspects of the relationship between ICU structure and ICU outcomes. PMID:26820278

  10. Selection of etching methods of primary carbides in MAR-M247 nickel-base superalloy for computer-aided quantitative metallography

    International Nuclear Information System (INIS)

    The usefulness of various etching methods for revealing the structure of MAR-M247 nickel-base superalloy and image acquisition methods were analyzed from a desire to estimate primary carbides quantitatively. The analysis was carried out on images registered using light and scanning electron microscopes. The analyzed images contained a complete range of primary carbides occurring in the matrix and on the grain boundaries of MAR-M247 alloy

  11. Construction of recombinants between molecular clones of murine retrovirus MCF 247 and Akv: determinant of an in vitro host range property that maps in the long terminal repeat.

    OpenAIRE

    Holland, C A; Wozney, J; Chatis, P A; Hopkins, N.; Hartley, J W

    1985-01-01

    The leukemogenic mink cell focus-forming (MCF) retroviruses such as MCF 247 have biological properties distinct from those of their ecotropic progenitors. Nucleotide sequences encoding portions of gp70, Prp15E, and the long terminal repeat differ between the two types of viruses. To investigate the role of each of these genetic elements in determining the biological properties of MCF viruses, we prepared infectious molecular clones of MCF 247 and generated a set of recombinants between these ...

  12. Decommissioning of the 247-F Fuel Manufacturing Facility at the Savannah River Site (SRS)

    International Nuclear Information System (INIS)

    Building 247-F at SRS was a roughly 110,000 ft2 two-story facility designed and constructed during the height of the cold war naval buildup to provide additional naval nuclear fuel manufacturing capacity in early 1980's. The manufacturing process employed a wide variety of acids, bases, and other hazardous materials. As the need for naval fuel declined, the facility was shut down and underwent initial deactivation, which was completed in 1990. All process systems were flushed with water and drained using the existing process drain valves. However, since these drains were not always installed at the lowest point in piping and equipment systems, a significant volume of liquid remained after initial deactivation. After initial deactivation, a non-destructive assay of the process area identified approximately 17 (±100%) kg of uranium held up in equipment and piping. The facility was placed in Surveillance and Maintenance mode until 2003, when the decision was made to perform final deactivation, and then decommission the facility. The following lessons were learned as a result of the D and D of building 247-F. Successful D and D of a major radiochemical process building requires significant up-front planning by a team of knowledgeable personnel led by a strong project manager. The level of uncertainty and resultant risk to timely, cost effective project execution was found to be high. Examples of the types of problems encountered which had high potential to adversely impact cost and schedule performance are described below. Low level and sanitary waste acceptance criteria do not allow free liquids in waste containers. These liquids, which are often corrosive, must be safely removed from the equipment before it is loaded to waste containers. Drained liquids must be properly managed, often as hazardous or mixed waste. Tapping and draining of process lines is a dangerous operation, which must be performed carefully. The temptation to become complacent when breaking into

  13. Aerosol and cloud typing with an automated 24/7 aerosol lidar

    Science.gov (United States)

    Baars, Holger; Seifert, Patric; Wandinger, Ulla

    2015-04-01

    Modern sophisticated multi-wavelength Raman polarization lidars have the ability to measure autonomous and unattended in 24/7 mode. These aerosol lidars can deliver backscatter, extinction, and depolarization profiles of the atmosphere which can be used for a target categorization, i.e. the determination of different aerosol and cloud types. However, to derive the optical particle properties a calibration of the lidar signals in the free atmosphere, where only Rayleigh scattering occurs, is needed. This calibration is usually done manually case by case and thus prohibits automatic data analysis and particle typing. To overcome this limitation, the mobile EARLINET lidar PollyXT of TROPOS was deployed continuously without changes in the instrumental setup during two field campaigns in the framework of the German HD(CP)2 project to obtain temporally stable lidar signals. The temporal stability together with the high performance and good characterization of the lidar lead to the possibility of an absolute lidar calibration. The corresponding calibration constant was derived in two ways: first by using manually Raman and Klett retrievals for selected periods and second by using the aerosol optical depth (AOD) from co-located AERONET sun photometer measurements. The derived calibration constants show a high temporal stability and a good agreement between both methods and thus allowed the continuous calibration of the lidar and the retrieval of the attenuated backscatter coefficient at three wavelengths. In addition, the calibrated volume depolarization ratio, obtained following EARLINET recommendations, is continuously available. After correction for the molecular contribution, these four quantities were used for an aerosol and cloud typing in terms of particle size and shape. The final categorization leads to 11 categories, e.g. clean atmosphere, small spherical particles, large non-spherical particles, water droplets, ice crystals and corresponding mixtures. In this

  14. 24/7 Solar Minimum Polar Cap and Auroral Ion Temperature Observations

    Science.gov (United States)

    Sojka, Jan J.; Nicolls, Michael; van Eyken, Anthony; Heinselman, Craig; Bilitza, Dieter

    2011-01-01

    During the International Polar Year (IPY) two Incoherent Scatter Radars (ISRs) achieved close to 24/7 continuous observations. This presentation describes their data sets and specifically how they can provide the International Reference Ionosphere (IRI) a fiduciary E- and F-region ionosphere description for solar minimum conditions in both the auroral and polar cap regions. The ionospheric description being electron density, ion temperature and electron temperature profiles from as low as 90 km extending to several scale heights above the F-layer peak. The auroral location is Poker Flat in Alaska at 65.1 N latitude, 212.5 E longitude where the NSF s new Poker Flat Incoherent Scatter Radar (PFISR) is located. This location during solar minimum conditions is in the auroral region for most of the day but is at midlatitudes, equator ward of the cusp, for about 4-8 h per day dependent upon geomagnetic activity. In contrast the polar location is Svalbard, at 78.2 N latitude, 16.0 E longitude where the EISCAT Svalbard Radar (ESR) is located. For most of the day the ESR is in the Northern Polar Cap with a noon sector passage often through the dayside cusp. Of unique relevance to IRI is that these extended observations have enabled the ionospheric morphology to be distinguished between quiet and disturbed geomagnetic conditions. During the IPY year, 1 March 2007 - 29 February 2008, about 50 solar wind Corotating Interaction Regions (CIRs) impacted geospace. Each CIR has a two to five day geomagnetic disturbance that is observed in the ESR and PFISR observations. Hence, this data set also enables the quiet-background ionospheric climatology to be established as a function of season and local time. These two separate climatologies for the ion temperature at an altitude of 300 km are presented and compared with IRI ion temperatures. The IRI ion temperatures are about 200-300 K hotter than the observed values. However, the MSIS neutral temperature at 300 km compares favorably

  15. Manchester Business Answers 24/7: A case study in providing online enquiry support at an academic library

    OpenAIRE

    Mark Greenwood and Karen Bradshaw

    2009-01-01

    The Manchester Business School (MBS) library service of the John Rylands University Library at the University of Manchester has a wide variety of customers, some of whom are not in a position to visit the library buildings frequently. Manchester Business Answers 24/7 is an online enquiry-type service to help them get the most out of a large range of e-resources and, crucially, the expert specialist knowledge of library staff. It is based around a searchable database of frequently asked questi...

  16. Curium-245 and curium-247 neutron cross sections between 10 keV and 10 MeV

    International Nuclear Information System (INIS)

    The optical model code 2PLUS and the statistical model codes COMNUC and CASCADE were used to compute neutron cross sections for Cm-245 and Cm-247 between 10 keV and 10 MeV. Cross sections for elastic and inelastic scattering, radiative capture, fission, and the (n,2n) reactions were computed. The parameters for the fission model were selected to yield agreement with the cross sections from the Physics-8 bomb shot. Pu-239 cross sections were calculated and compared with existing cross section evaluations to demonstrate the validity of the calculational methods

  17. A Luminous X-Ray Flare from the Nucleus of the Dormant Bulgeless Spiral Galaxy NGC 247

    OpenAIRE

    FENG, HUA; Ho, Luis C.; Kaaret, Philip; Tao, Lian; Yamaoka, Kazutaka; Zhang, Shuo; Grisé, Fabien

    2015-01-01

    NGC 247 is a nearby late-type bulgeless spiral galaxy that contains an inactive nucleus. We report a serendipitous discovery of an X-ray flare from the galaxy center with a luminosity of up to 2 x 10^(39) erg s^(−1) in the 0.3–10 keV band with XMM-Newton. A Chandra observation confirms that the new X-ray source is spatially coincident with the galaxy nucleus. The XMM-Newton data revealed a hard power-law spectrum with a spectral break near 3–4 keV, no pulsations on timescales longer than 150 ...

  18. 238U/235U variations in meteorites: extant 247Cm and implications for Pb-Pb dating.

    Science.gov (United States)

    Brennecka, G A; Weyer, S; Wadhwa, M; Janney, P E; Zipfel, J; Anbar, A D

    2010-01-22

    The 238U/235U isotope ratio has long been considered invariant in meteoritic materials (equal to 137.88). This assumption is a cornerstone of the high-precision lead-lead dates that define the absolute age of the solar system. Calcium-aluminum-rich inclusions (CAIs) of the Allende meteorite display variable 238U/235U ratios, ranging between 137.409 +/- 0.039 and 137.885 +/- 0.009. This range implies substantial uncertainties in the ages that were previously determined by lead-lead dating of CAIs, which may be overestimated by several million years. The correlation of uranium isotope ratios with proxies for curium/uranium (that is, thorium/uranium and neodymium/uranium) provides strong evidence that the observed variations of 238U/235U in CAIs were produced by the decay of extant curium-247 to uranium-235 in the early solar system, with an initial 247Cm/235U ratio of approximately 1.1 x 10(-4) to 2.4 x 10(-4). PMID:20044543

  19. A Gene Encoding a DUF247 Domain Protein Cosegregates with the S Self-Incompatibility Locus in Perennial Ryegrass

    DEFF Research Database (Denmark)

    Manzanares, Chloe; Barth, Susanne; Thorogood, Daniel;

    2016-01-01

    The grass family (Poaceae), the fourth largest family of flowering plants, encompasses the most economically important cereal, forage, and energy crops, and exhibits a unique gametophytic self-incompatibility (SI) mechanism that is controlled by at least two multiallelic and independent loci, S and...... function 247 (DUF247) gene is involved in its determination. Using a total of 10,177 individuals from seven different mapping populations segregating for S, we narrowed the S-locus to a genomic region containing eight genes, the closest recombinant marker mapping at a distance of 0.016 cM. Of the eight...... genes cosegregating with the S-locus, a highly polymorphic gene encoding for a protein containing a DUF247 was fully predictive of known S-locus genotypes at the amino acid level in the seven mapping populations. Strikingly, this gene showed a frameshift mutation in self-compatible darnel (Lolium...

  20. Fission cross section measurements of Cm-247, Cf-250 and Es-254 from 0.1 eV to 80 keV

    International Nuclear Information System (INIS)

    Fission cross section measurements were made with the RINS system over the neutron energy range from approximately 0.1 eV to 80 keV upon samples of Cm-247, Cf-250 and Es-254. The Cm-247 measurement was undertaken to complete the RINS fission cross section measurement sequence of the curium isotopes, Es-254 was measured because it is a very heavy odd-odd nucleus which might show interesting nuclear structure effects in its fission cross section, and Cf-250 was measured to account for its buildup as a daughter product from the 276-day halflife Es-254. 6 refs., 3 figs

  1. Effect of Process Variables on the Inertia Friction Welding of Superalloys LSHR and Mar-M247

    Science.gov (United States)

    Mahaffey, D. W.; Senkov, O. N.; Shivpuri, R.; Semiatin, S. L.

    2016-06-01

    The effect of inertia friction welding process parameters on microstructure evolution, weld plane quality, and the tensile behavior of welds between dissimilar nickel-base superalloys was established. For this purpose, the fine-grain, powder metallurgy alloy LSHR was joined to coarse-grain cast Mar-M247 using a fixed level of initial kinetic energy, but different combinations of the flywheel moment of inertia and initial rotation speed. It was found that welds made with the largest moment of inertia resulted in a sound bond with the best microstructure and room-temperature tensile strength equal to or greater than that of the parent materials. A relationship between the moment of inertia and weld process efficiency was established. The post-weld tensile behavior was interpreted in the context of observed microstructure gradients and weld-line defects.

  2. TREATMENT OF 247 CASES OF PROLAPSE OF LUMBAR INTERVERTEBRAL DISC WITH COMPREHENSIVE PLUM-BLOSSOM MAGNETIC NEEDLE THERAPY

    Institute of Scientific and Technical Information of China (English)

    张保平; 周日清; 周登芳

    2004-01-01

    Objective: To observe the therapeutic effect of comprehensive plum-blossom magnetic needle therapy on prolapse of lumbar intervertebral disc. Methods: 247 cases of prolapse of lumbar intervertebral disc were treated first with manual treatment and then with plum-blossom magnetic needle therapy and effect-increasing pad therapy at specified points and reactive points. Results: After treatment for 2 therapeutic courses,153 cases were cured accounting for 61.94%, 71 cases were markedly effective accounting for 28.75%, 22 cases were improved accounting for8.91% and the rest one failed,accounting for 0.45%. Conclusion: The comprehensive plum-blossom magnetic needle therapy has a better therapeutic effect on prolapse of lumbar intervertebral disc.

  3. Effect of Process Variables on the Inertia Friction Welding of Superalloys LSHR and Mar-M247

    Science.gov (United States)

    Mahaffey, D. W.; Senkov, O. N.; Shivpuri, R.; Semiatin, S. L.

    2016-08-01

    The effect of inertia friction welding process parameters on microstructure evolution, weld plane quality, and the tensile behavior of welds between dissimilar nickel-base superalloys was established. For this purpose, the fine-grain, powder metallurgy alloy LSHR was joined to coarse-grain cast Mar-M247 using a fixed level of initial kinetic energy, but different combinations of the flywheel moment of inertia and initial rotation speed. It was found that welds made with the largest moment of inertia resulted in a sound bond with the best microstructure and room-temperature tensile strength equal to or greater than that of the parent materials. A relationship between the moment of inertia and weld process efficiency was established. The post-weld tensile behavior was interpreted in the context of observed microstructure gradients and weld-line defects.

  4. Expression of the benign HEXA mutations, Arg247Trp and Arg249Trp, associated with beta-hexosaminidase A pseudodeficiency

    Energy Technology Data Exchange (ETDEWEB)

    Cao, Z.; Petroulakis, E.; Salo, T. [Univ. of Manitoba (Canada)] [and others

    1994-09-01

    {beta}-Hexosaminidase (Hex A) is a heterodimer of {alpha} and {beta} subunits encoded by the HEXA and HEXB genes, respectively. Mutations in the HEXA gene typically cause Tay-Sachs disease or less severe forms of G{sub M2} gangliosidosis. However, two benign mutations (Arg247Trp and Arg249Trp) in the {alpha}-subunit of Hex A account for Hex A deficiency in {approximately}36% of non-Jewish enzyme-defined Tay-Sachs disease carriers. These mutations do not result in any apparent clinical phenotype in individuals who are genetic compounds with a second disease-causing mutation. We expressed the {alpha}-subunit harboring each of the benign mutations separately to study activity toward the synthetic substrate, 4-MUGS, for comparison to activity from enzymes containing mutations associated with other forms of G{sub M2} gangliosidosis. The C739T (Arg247Trp;benign), C745T (Arg 249Trp; benign), G805A (Gly269Ser; adult-onset), G749A (Gly250Asp; juvenile), and C508T (Arg170Trp; infantile) mutations were introduced into the {alpha}-subunit cDNA. These were transfected alone, or with the {beta}-subunit cDNA, to generate Hex S ({alpha}{alpha}) or Hex A ({alpha}{beta}), respectively. The activities were monitored using 4-MUGS, and the levels of {alpha}-subunit protein were assessed by Western blotting. Repeated experiments show that the benign mutations produce approximately 35% of normal Hex S and 40% of normal Hex A activity. This level is much higher than that of Hex A harbouring the Gly169Ser adult-onset mutation (12%). A sequential decrease in expressed Hex A activity is observed as mutations associated with more severe phenotypes are expressed. The benign mutations also result in lower levels of mature {alpha}-subunit protein compared to normal, and slightly reduced levels of {alpha}-subunit precursor protein. The Hex A deficiency resulting from benign mutations is not as great as that associated with disease-causing mutations.

  5. A massive, distant proto-cluster at z=2.47 caught in a phase of rapid formation?

    CERN Document Server

    Casey, C M; Capak, P; Fu, H; Kovac, K; Lilly, S; Sanders, D B; Scoville, N Z; Treister, E

    2015-01-01

    Numerical simulations of cosmological structure formation show that the Universe's most massive clusters, and the galaxies living in those clusters, assemble rapidly at early times (2.5 2 based on associations of 5-40 galaxies around rare sources, the observational evidence for rapid cluster formation is weak. Here we report observations of an asymmetric, filamentary structure at z = 2.47 containing seven starbursting, submillimeter-luminous galaxies and five additional AGN within a volume of 4000 Mpc$^{3}$. As the expected lifetime of both the luminous AGN and starburst phase of a galaxy is ~100 Myr, we conclude that these sources were likely triggered in rapid succession by environmental factors, or, alternatively, the duration of these cosmologically rare phenomena is much longer than prior direct measurements suggest. The stellar mass already built up in the structure is $\\sim10^{12}M_{\\odot}$ and we estimate that the cluster mass will exceed that of the Coma supercluster at $z \\sim 0$. The filamentary s...

  6. Alfa247®: Un modelo de aprendizaje diferenciado para la enseñanza del Nordic Walking

    Directory of Open Access Journals (Sweden)

    Rodolfo Iván Martínez Lemos

    2010-03-01

    Full Text Available La técnica alfa y el método de los 7 pasos constituyen un modelo de aprendizaje diferenciado para la enseñanza del Nordic Walking (NW. NW consiste en caminar con bastones especialmente diseñados y utilizando una técnica precisa que moviliza una gran parte de la masa muscular total y tiene efectos beneficiosos probados sobre la salud. Alfa247® hace posible que cualquier persona, con independencia de su nivel de habilidad o condición física, pueda familiarizarse y aprender la técnica de caminar con bastones. Este nuevo concepto de movimiento saludable está todavía dando sus primeros pasos en España y es probable que en un futuro próximo pueda jugar un papel importante dentro del currículo de la Educación Física Escolar, como ya ha hecho en otros países del entorno.

  7. A Luminous X-ray Flare From The Nucleus of The Dormant Bulgeless Spiral Galaxy NGC 247

    CERN Document Server

    Feng, Hua; Kaaret, Philip; Tao, Lian; Yamaoka, Kazutaka; Zhang, Shuo; Grisé, Fabien

    2015-01-01

    NGC 247 is a nearby late-type bulgeless spiral galaxy that contains an inactive nucleus. We report a serendipitous discovery of an X-ray flare from the galaxy center with a luminosity up to 2*10^39 erg/s in the 0.3-10 keV band with XMM-Newton. A Chandra observation confirms that the new X-ray source is spatially coincident with the galaxy nucleus. The XMM-Newton data revealed a hard power-law spectrum with a spectral break near 3-4 keV, no pulsations on timescales longer than 150 ms, and a flat power spectrum consistent with Poisson noise from 1 mHz to nearly 10 Hz. Follow-up observations with Swift detected a second flux peak followed by a luminosity drop by factor of almost 20. The spectral and temporal behaviors of the nuclear source are well consistent with the scenario that the flare was due to an outburst of a low-mass X-ray binary that contains a stellar-mass black hole emitting near its Eddington limit at the peak. However, it cannot be ruled out that the sudden brightening in the nucleus was due to a...

  8. MC carbide structures in M(lc2)ar-M247. M.S. Thesis - Final Report

    Science.gov (United States)

    Wawro, S. W.

    1982-01-01

    The morphologies and distribution of the MC carbides in Mar-M247 ingot stock and castings were investigated using metallographic, X-ray diffraction and energy-dispersive X-ray analysis techniques. The MC carbides were found to form script structures during solidification. The script structures were composed of three distinct parts. The central cores and elongated arms of the MC carbide script structures had compositions (Ti, Cr, Hf, Ta, W)C and lattice parameters of 4.39 A. The elongated script arms terminated in enlarged, angular "heads". The heads had compositions (Ti, Hf, Ta, W)C and lattice parameters of approximately 4.50 A. The heads had a higher Hf content than the cores and arms. The size of the script structures, as well as the relative amount of head-type to core and arm-type MC carbide, was found to be determined by solidification conditions. No carryover of the MC carbides from the ingot stock to the remelted and cast material was observed.

  9. Towards low-friction and wear-resistant plasma sintering dies via plasma surface co-alloying CM247 nickel alloy with V/Ag and N

    Directory of Open Access Journals (Sweden)

    Zhang Zhenxue

    2015-01-01

    Full Text Available Nickel based superalloys have good oxidation and creep resistance and hence they can function under high mechanical stress and high temperatures. However, their undesirable tribological behaviour is the major technical barrier to the challenging high-temperature, lubricant-free plasma sintering tool application. In this study, nickel based CM247 superalloy surfaces were co-alloyed using innovative active screen plasma technology with both interstitial element (e.g. N and substitutional alloying elements (e.g. V and Ag to provide a synergy effect to enhance its tribological properties. The tribological behaviour of the plasma co-alloyed CM247 superalloy surfaces were fully evaluated using reciprocal and pin-on-disc tribometers at temperatures from room temperature to 600 ∘C. The experimental results demonstrate that the co-alloyed surface with N, Ag and V can effectively lower the friction coefficient, which is expected to help demoulding during lubricant-free plasma sintering.

  10. Critical and subcritical masses of curium-245, -246 and -247 calculated with a combination of MCNP4A code and JENDL-3.2 library

    International Nuclear Information System (INIS)

    Critical masses of three curium isotopes, 245Cm, 246Cm and 247Cm, were calculated with a combination of the current version of the Japanese Evaluated Nuclear Data Library, JENDL-3.2, and a continuous energy Monte Carlo neutron transport code, MCNP4A. The subcritical masses corresponding to the neutron multiplication factor keff=0.9 and 0.8 were also computed in the same way. The subcritical masses that correspond to keff=0.9 for 246Cm metal and 246CmO2 with a 30-cm-thick stainless steel reflector were computed as 25.2 kg and 41.8 kg, respectively. The minimum critical mass for 245Cm was obtained as 65.6 g in a sphere of a homogeneous mixture of granulated 245Cm metal and water surrounded by a fully thick water reflector. The corresponding quantity for 247Cm was found to be 2.19 kg. The critical masses of 245Cm, 246Cm and 247Cm metals were computed also for reference by replacing the JENDL-3.2 with the ENDF/B-VI; they were reduced by 23%, 45% and 2%, respectively, from each corresponding value, which revealed a large dependence of the results on the evaluated nuclear data libraries. The present report was prepared for revision of the ANSI/ANS-8.15, the American National Standard for Nuclear Criticality Control of Special Actinide Elements. (author)

  11. A Luminous X-Ray Flare from the Nucleus of the Dormant Bulgeless Spiral Galaxy NGC 247

    Science.gov (United States)

    Feng, Hua; Ho, Luis C.; Kaaret, Philip; Tao, Lian; Yamaoka, Kazutaka; Zhang, Shuo; Grisé, Fabien

    2015-07-01

    NGC 247 is a nearby late-type bulgeless spiral galaxy that contains an inactive nucleus. We report a serendipitous discovery of an X-ray flare from the galaxy center with a luminosity of up to 2× {10}39 erg s-1 in the 0.3-10 keV band with XMM-Newton. A Chandra observation confirms that the new X-ray source is spatially coincident with the galaxy nucleus. The XMM-Newton data revealed a hard power-law spectrum with a spectral break near 3-4 keV, no pulsations on timescales longer than 150 ms, and a flat power spectrum consistent with Poisson noise from 1 mHz to nearly 10 Hz. Follow-up observations with Swift detected a second flux peak followed by a luminosity drop by a factor of almost 20. The spectral and temporal behaviors of the nuclear source are consistent with the scenario that the flare was due to an outburst of a low-mass X-ray binary that contains a stellar-mass black hole emitting near its Eddington limit at the peak. However, it cannot be ruled out that the sudden brightening in the nucleus was due to accretion onto a possible low-mass nuclear black hole, fed by a tidally disrupted star or a gas cloud; the Monitor of All-sky X-ray Image observations limit the peak luminosity of the flare to less than ˜ {10}43 erg s-1, suggesting that it is either a low-mass black hole or an inefficient tidal disruption event.

  12. HPLC MS/MS method for quantification of meprobamate in human plasma: application to 24/7 clinical toxicology.

    Science.gov (United States)

    Delavenne, Xavier; Gay-Montchamp, Jean Pierre; Basset, Thierry

    2011-01-15

    We described the development and full validation of rapid and accurate liquid chromatography method, coupled with tandem mass spectrometry detection, for quantification of meprobamate in human plasma with [(13)C-(2)H(3)]-meprobamate as internal standard. Plasma pretreatment involved a one-step protein precipitation with acetonitrile. Separation was performed by reversed-phase chromatography on a Luna MercuryMS C18 (20 mm×4 mm×3 μm) column using a gradient elution mode. The mobile phase was a mix of distilled water containing 0.1% formic acid and acetonitrile containing 0.1% formic acid. The selected reaction monitoring transitions, in electrospray positive ionization, used for quantification were 219.2→158.2 m/z and 223.1→161.1m/z for meprobamate and internal standard, respectively. Qualification transitions were 219.2→97.0 and 223.1→101.1 m/z for meprobamate and internal standard, respectively. The method was linear over the concentration range of 1-300 mg/L. The intra- and inter-day precision values were below 6.4% and accuracy was within 95.3% and 103.6% for all QC levels (5, 75 and 200 mg/L). The lower limit of quantification was 1 mg/L. Total analysis time was reduced to 6 min including sample preparation. The present method is successfully applied to 24/7 clinical toxicology and demonstrated its usefulness to detect meprobamate poisoning. PMID:21185792

  13. Microstructure and transformation behavior of Ni24.7Ti50.3Pd25 high temperature shape-memory alloy with Sc micro-addition

    International Nuclear Information System (INIS)

    NiTiPd shape-memory alloys (SMAs) are potential functional materials for use as solid-state actuators in the temperature range 100–250 °C. The present study investigates the effect of 1.0 at.% Sc micro-addition to Ni24.7Ti50.3Pd25 alloy, Sc replacing either Ti or Ni. Results show that all the three alloys studied have stable transformation behavior on stress-free thermal cycling and hence, are suitable for cyclic actuation applications. However, the addition of Sc to NiTiPd alloy leads to decrease of transformation temperatures, the magnitude of decrease being greater for the alloy with Sc replacing Ni. The martensite finish (Mf) temperature of 181 °C for the NiTiPd alloy decreased to 139 °C for Sc replacing Ti and 83 °C for Sc replacing Ni. Also, the indentation modulus of NiTiPdSc (Sc replacing Ni) alloy is found to be significantly low compared to the other alloys. Analysis indicates that the observed differences in the alloy properties are related to the solubility of Sc in the NiTiPd matrix. While the quaternary NiTiPdSc alloy, Sc replacing Ti, has a single phase microstructure, the alloy with Sc replacing Ni shows the presence of Sc-rich and TiPd-type second phases in the microstructure. TEM examination revealed that the TiPd-type phase has a distinct rod-like morphology (30–50 nm) arranged in a grid-like structure. The transformation and indentation behavior of the alloys is elucidated using thermodynamic calculations of frictional energy and an electronic structure based analysis. - Highlights: • TEM of Ni23.7Ti50.3Pd25Sc1 showed distinct grid of TiPd-type phase nanorods < 50 nm. • Stress-free thermal cycling of all the three alloys showed stable transformation behavior. • Ni24.7Ti49.3Pd25Sc1 and Ni23.7Ti50.3Pd25Sc1 showed single and multiphase structures. • Sc micro-addition (1 at.%) to Ni24.7Ti50.3Pd25 alloy decreased TTs significantly. • Ni23.7Ti50.3Pd25Sc1 exhibited lower modulus of 67 GPa to 85 GPa of Ni24.7Ti50.3Pd25

  14. Live Birth Sex Ratio after In Vitro Fertilization and Embryo Transfer in China - An Analysis of 121,247 Babies from 18 Centers

    OpenAIRE

    Bu, Zhiqin; Chen, Zi-Jiang; Huang, Guoning; Zhang, Hanwang; Wu, Qiongfang; Ma, Yanping; Shi, Juanzi; Xu, Yanwen; Zhang, Songying; Zhang, Cuilian; Zhao, Xiaoming; Zhang, Bo; Huang, Yuanhua; Sun, Zhengyi; Kang, Yuefan

    2014-01-01

    In order to study the impact of procedures of IVF/ICSI technology on sex ratio in China, we conducted this multi-center retrospective study including 121,247 babies born to 93,895 women in China. There were 62,700 male babies and 58,477 female babies, making the sex ratio being 51.8% (Male: Female  = 107∶100). In univariate logistic regression analysis, sex ratio was imbalance toward females of 50.3% when ICSI was preformed compared to 47.7% when IVF was used (P

  15. Preliminary results of hydrologic testing the composite middle sentinel bluffs basalt flow bottom at Borehole RRL-2 (3,247--3,344 feet)

    International Nuclear Information System (INIS)

    This report presents preliminary results and description of hydrologic test activities for the composite Middle Sentinel Bluffs basalt flow bottom (3,247-3,344 feet) at Borehole RRL-2. Hydrologic tests conducted include one constant discharge air-lift and two slug tests. Preliminary results indicate an observed hydraulic head for the test interval of 405.5 feet above mean sea level. Transmissivity values determined from hydrologic tests performed range between 203 and 847 ft2/day, with an assigned best estimate of 770 ft2 day. The best estimate of equivalent hydraulic conductivity, based on an effective test thickness of 77.5 feet, is 9.9 ft/day

  16. Thermodynamic study of niobium oxides with O/Nb ratios from 2.47 to 2.50 using a high-temperature galvanic cell

    International Nuclear Information System (INIS)

    The partial molar free energy, enthalpy, and entropy of oxygen in niobium oxides with O/Nb ratios from 2.47 to 2.50 were measured with a galvanic cell in the temperature range from 1084 to 1325 K. The partial molar enthalpies of oxygen of the Nb2O/sub 5-x/ and V phases were observed to be nearly independent of composition, indicating the presence of only weak interactions between defects. The value of the slope for the plots of log x in Nb2O/sub 5-x/ against log P/sub O2/ was observed to be -1/5.2 which is interpreted in terms of a defect structure involving both singly ionized and doubly ionized oxygen vacancies. The previously proposed phase diagram in the vicinity of Nb2O/sub 5-x/ was confirmed by the present emf measurements. 15 references, 7 figures, 2 tables

  17. The multifaceted effects of agmatine on functional recovery after spinal cord injury through Modulations of BMP-2/4/7 expressions in neurons and glial cells.

    Directory of Open Access Journals (Sweden)

    Yu Mi Park

    Full Text Available Presently, few treatments for spinal cord injury (SCI are available and none have facilitated neural regeneration and/or significant functional improvement. Agmatine (Agm, a guanidinium compound formed from decarboxylation of L-arginine by arginine decarboxylase, is a neurotransmitter/neuromodulator and been reported to exert neuroprotective effects in central nervous system injury models including SCI. The purpose of this study was to demonstrate the multifaceted effects of Agm on functional recovery and remyelinating events following SCI. Compression SCI in mice was produced by placing a 15 g/mm(2 weight for 1 min at thoracic vertebra (Th 9 segment. Mice that received an intraperitoneal (i.p. injection of Agm (100 mg/kg/day within 1 hour after SCI until 35 days showed improvement in locomotor recovery and bladder function. Emphasis was made on the analysis of remyelination events, neuronal cell preservation and ablation of glial scar area following SCI. Agm treatment significantly inhibited the demyelination events, neuronal loss and glial scar around the lesion site. In light of recent findings that expressions of bone morphogenetic proteins (BMPs are modulated in the neuronal and glial cell population after SCI, we hypothesized whether Agm could modulate BMP- 2/4/7 expressions in neurons, astrocytes, oligodendrocytes and play key role in promoting the neuronal and glial cell survival in the injured spinal cord. The results from computer assisted stereological toolbox analysis (CAST demonstrate that Agm treatment dramatically increased BMP- 2/7 expressions in neurons and oligodendrocytes. On the other hand, BMP- 4 expressions were significantly decreased in astrocytes and oligodendrocytes around the lesion site. Together, our results reveal that Agm treatment improved neurological and histological outcomes, induced oligodendrogenesis, protected neurons, and decreased glial scar formation through modulating the BMP- 2/4/7 expressions following

  18. The effect of tantalum on the structure/properties of two polycrystalline nickel-base superalloys: B-1900 + Hf MAR-M247. M.S. Thesis, Final Report

    Science.gov (United States)

    Janowski, G. M.

    1985-01-01

    The microstructure, phase compositions, and phase fractions were studied in conventionally cast B-1900 + Hf and both conventionally cast and directionally solidified MAR-M247 as a function of tantalum concentration. The hot tensile and creep rupture properties of the solutionized and aged MAR-M247-type alloys were also determined as a function of tantalum level. The effects of tantalum on the microstructure and phase compositions of B-1900 + Hf and MAR-M247 (conventionally cast and directionally solidified) were found to be very similar. The addition of tantalum to the as cast and heat treated alloys was shown to cause the partial replacement of the Hf in the MC carbides by Ta, although the degree of replacement was decreased by the solutionizing and aging heat treatment. The gamma prime and minor phase fractions (primarily MC type carbides) both increased approximately linearly with tantalum concentration. The gamma prime phase compositions were relatively insensitive to tantalum variations with the exception of the tantalum and/or hafnium levels. Bulk tantalum additions increased the tantalum, chromium, and cobalt levels of the gamma phase in both alloy series. The increase in the concentrations of the latter two elements in the gamma phase was a result of the decrease in the gamma phase fraction with increasing bulk tantalum concentration and constant gamma/gamma prime partitioning ratio. Tantalum additions increased the yield stress and ultimate tensile strength of the directionally solidified MAR-M247 type alloys and had no significant effect on ductility.

  19. Nature of the soft ULX in NGC 247: super-Eddington outflow and transition between the supersoft and soft ultraluminous regimes

    CERN Document Server

    Feng, Hua; Kaaret, Philip; Grise, Fabien

    2016-01-01

    We report on XMM-Newton/Chandra/Swift/HST observations of the ultraluminous X-ray source (ULX) in NGC 247, which is found to make transitions between the supersoft ultraluminous (SSUL) regime with a spectrum dominated by a cool ($\\sim 0.1$ keV) blackbody component and the soft ultraluminous (SUL) regime with comparable luminosities shared by the blackbody and power-law components. Multi-epoch observations revealed an anti-correlation between the blackbody radius and temperature, $R_{\\rm bb} \\propto T_{\\rm bb}^{-2.8 \\pm 0.3}$, ruling out a standard accretion disk as the origin of the soft X-ray emission. The soft X-ray emission is much more variable on both short and long timescales in the SSUL regime than in the SUL regime. We suggest that the SSUL regime may be an extension of the ultraluminous state toward the high accretion end, being an extreme case of the SUL regime, with the blackbody emission arising from the photosphere of thick outflows and the hard X-rays being emission leaked from the embedded accr...

  20. Fatigue Crack Growth Behavior Evaluation of Grainex Mar-M 247 for NASA's High Temperature, High Speed Turbine Seal Test Rig

    Science.gov (United States)

    Delgado, Irebert R.; Steinetz, Bruce M.; Rimnac, Clare M.; Lewandowski, John J.

    2008-01-01

    The fatigue crack growth behavior of Grainex Mar-M 247 is evaluated for NASA s Turbine Seal Test Facility. The facility is used to test air-to-air seals primarily for use in advanced jet engine applications. Because of extreme seal test conditions of temperature, pressure, and surface speeds, surface cracks may develop over time in the disk bolt holes. An inspection interval is developed to preclude catastrophic disk failure by using experimental fatigue crack growth data. By combining current fatigue crack growth results with previous fatigue strain-life experimental work, an inspection interval is determined for the test disk. The fatigue crack growth life of the NASA disk bolt holes is found to be 367 cycles at a crack depth of 0.501 mm using a factor of 2 on life at maximum operating conditions. Combining this result with previous fatigue strain-life experimental work gives a total fatigue life of 1032 cycles at a crack depth of 0.501 mm. Eddy-current inspections are suggested starting at 665 cycles since eddy current detection thresholds are currently at 0.381 mm. Inspection intervals are recommended every 50 cycles when operated at maximum operating conditions.

  1. Structural Benchmark Creep Testing for Microcast MarM-247 Advanced Stirling Convertor E2 Heater Head Test Article SN18

    Science.gov (United States)

    Krause, David L.; Brewer, Ethan J.; Pawlik, Ralph

    2013-01-01

    This report provides test methodology details and qualitative results for the first structural benchmark creep test of an Advanced Stirling Convertor (ASC) heater head of ASC-E2 design heritage. The test article was recovered from a flight-like Microcast MarM-247 heater head specimen previously used in helium permeability testing. The test article was utilized for benchmark creep test rig preparation, wall thickness and diametral laser scan hardware metrological developments, and induction heater custom coil experiments. In addition, a benchmark creep test was performed, terminated after one week when through-thickness cracks propagated at thermocouple weld locations. Following this, it was used to develop a unique temperature measurement methodology using contact thermocouples, thereby enabling future benchmark testing to be performed without the use of conventional welded thermocouples, proven problematic for the alloy. This report includes an overview of heater head structural benchmark creep testing, the origin of this particular test article, test configuration developments accomplished using the test article, creep predictions for its benchmark creep test, qualitative structural benchmark creep test results, and a short summary.

  2. Biological, chemical and other data collected aboard the THOMAS G. THOMPSON during cruise TN247 in the Coastal Waters of SE Alaska, North Pacific Ocean and South Pacific Ocean from 2010-03-11 to 2010-04-27 (NODC Accession 0104408)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NODC accession 0104408 includes biological, chemical, optical, physical and underway data collected aboard the THOMAS G. THOMPSON during cruise TN247 in the Coastal...

  3. Survey of potential markets for devices using Californium-252

    International Nuclear Information System (INIS)

    Potential applications for devices or systems containing 252Cf in the years from 1975 to 1980 are estimated. The estimated number of devices and associated business value were derived from a survey of 46 industrial, educational and governmental organizations conducted from Jan. to May, 1975. Applications for devices and systems based on 252Cf are expected to increase by a factor of 7 in the 6-y period from 1975 to 1980. The annual business value of 252Cf devices should increase from 1.5 million dollars in 1975 to 10.8 million dollars in 1980. The potential European market should be several times as large as the US market, based on actual sales of 252Cf, which have been two to four times greater in Europe than in the US

  4. The protective cell petrus for the production of californium 252

    International Nuclear Information System (INIS)

    The alpha, beta, gamma, neutron cell which is described in the present paper is devoted to the transplutonium element production and study. It is located at the CEN in Fontenay-aux-Roses (France). The 4 feet ordinary concrete shielding made of stacked blocs allows the manipulation of radioactive sources as high as 1000 curies of 1 MeV gamma rays and with a fast neutrons flux of 109 n.cm-2.s-1. The airtight alpha containment box is equipped with two transfer systems, one consists of a parallelepiped shaped airtight box located in a turntable, the other uses standard cylindrical containers made of polyethylene. The general equipment and the main setting up are also described. (authors)

  5. Californium-252 neutron activation facility at the Savannah River Laboratory

    International Nuclear Information System (INIS)

    A neutron irradiation facility has been established to develop new analytical methods and for the support of research programs. A major component of this facility is a 252Cf source which provides both fission spectrum and thermal neutrons. (U.S.)

  6. Californium-252 brachytherapy for anal and ano-rectal carcinoma

    International Nuclear Information System (INIS)

    Surgery has historically been the standard treatment for anal, ano-rectal and rectal carcinoma but is prone to local or regional failure. Over the past 15 years there has been increasing interest in and success with radiation therapy and combined chemoradiotherapy for treatment of anal and ano-rectal cancers. Cf-252 brachytherapy combined with external beam teletherapy has been investigated for anal and ano-rectal lesions at the Univ. of Kentucky with encouraging results

  7. Mobile equipment for neutron radiography using a californium-252 source

    International Nuclear Information System (INIS)

    The basic requirements for successful neutron radiography are first summarised and the use of 252Cf is placed in perspective by comparing its properties with those of sources based on the Be (γ, n) and Be (α, n) reactions which have a broadly similar range of applications. The more essential design features of mobile neutron radiography equipment are next examined in some detail, to show how the often conflicting requirements of optimum beam production and adequate shielding may be reconciled. An assembly with a maximum dimension around 1 m with a source of 1 mg is used as an example. The design data used are reproduced in graphical form to permit designs to be scaled to suit the source available and the requirements. The selection of suitable image recorders for 252Cf radiography is discussed with the conclusion that the gadolinium foil-film combinations are likely to remain the normal choice. Demonstration radiographs are presented with particular reference to the location of residual casting sand in gas-cooled turbine blades. Finally, it is suggested that other applications for mobile 252Cf-based neutron radiography equipment will be found in the ordnance, aero-space, chemical and nuclear fuel manufacturing industries. (author)

  8. Automated absolute activation analysis with californium-252 sources

    Energy Technology Data Exchange (ETDEWEB)

    MacMurdo, K.W.; Bowman, W.W.

    1978-09-01

    A 100-mg /sup 252/Cf neutron activation analysis facility is used routinely at the Savannah River Laboratory for multielement analysis of many solid and liquid samples. An absolute analysis technique converts counting data directly to elemental concentration without the use of classical comparative standards and flux monitors. With the totally automated pneumatic sample transfer system, cyclic irradiation-decay-count regimes can be pre-selected for up to 40 samples, and samples can be analyzed with the facility unattended. An automatic data control system starts and stops a high-resolution gamma-ray spectrometer and/or a delayed-neutron detector; the system also stores data and controls output modes. Gamma ray data are reduced by three main programs in the IBM 360/195 computer: the 4096-channel spectrum and pertinent experimental timing, counting, and sample data are stored on magnetic tape; the spectrum is then reduced to a list of significant photopeak energies, integrated areas, and their associated statistical errors; and the third program assigns gamma ray photopeaks to the appropriate neutron activation product(s) by comparing photopeak energies to tabulated gamma ray energies. Photopeak areas are then converted to elemental concentration by using experimental timing and sample data, calculated elemental neutron capture rates, absolute detector efficiencies, and absolute spectroscopic decay data. Calculational procedures have been developed so that fissile material can be analyzed by cyclic neutron activation and delayed-neutron counting procedures. These calculations are based on a 6 half-life group model of delayed neutron emission; calculations include corrections for delayed neutron interference from /sup 17/O. Detection sensitivities of < or = 400 ppB for natural uranium and 8 ppB (< or = 0.5 (nCi/g)) for /sup 239/Pu were demonstrated with 15-g samples at a throughput of up to 140 per day. Over 40 elements can be detected at the sub-ppM level.

  9. Californium-based neutron radiography for corrosion detection in aircraft

    International Nuclear Information System (INIS)

    In support of an overall program aimed at minimizing disassembly and reducing inspection time during aircraft maintenance, a series of projects has been carried out to determine the feasibility of applying neutron radiographic techniques to the nondestructive (NDT) inspection of aircraft and aircraft components. These investigations have clearly demonstrated the superiority of neutron radiography over all other NDT techniques in its ability to detect surface and subsurface corrosion in aircraft structure. This capability is particularly significant where the corrosion is hidden behind thick metallic structural members. The neutron radiographic technique has been applied successfully to detect corrosion in the wing tank of E-2C, C-130, and DC-9 aircraft; rear stabilators of F-4 and F-111 aircraft; aft spar, starboard and port wing, and rudder of the F-8; fuselage skin of the 727; rotary blades of AH-1 and SH-3 helicopters; rotary tail flaps of the UH-2 helicopter; and nose landing gear of A-7 aircraft

  10. Automated absolute activation analysis with californium-252 sources

    International Nuclear Information System (INIS)

    A 100-mg 252Cf neutron activation analysis facility is used routinely at the Savannah River Laboratory for multielement analysis of many solid and liquid samples. An absolute analysis technique converts counting data directly to elemental concentration without the use of classical comparative standards and flux monitors. With the totally automated pneumatic sample transfer system, cyclic irradiation-decay-count regimes can be pre-selected for up to 40 samples, and samples can be analyzed with the facility unattended. An automatic data control system starts and stops a high-resolution gamma-ray spectrometer and/or a delayed-neutron detector; the system also stores data and controls output modes. Gamma ray data are reduced by three main programs in the IBM 360/195 computer: the 4096-channel spectrum and pertinent experimental timing, counting, and sample data are stored on magnetic tape; the spectrum is then reduced to a list of significant photopeak energies, integrated areas, and their associated statistical errors; and the third program assigns gamma ray photopeaks to the appropriate neutron activation product(s) by comparing photopeak energies to tabulated gamma ray energies. Photopeak areas are then converted to elemental concentration by using experimental timing and sample data, calculated elemental neutron capture rates, absolute detector efficiencies, and absolute spectroscopic decay data. Calculational procedures have been developed so that fissile material can be analyzed by cyclic neutron activation and delayed-neutron counting procedures. These calculations are based on a 6 half-life group model of delayed neutron emission; calculations include corrections for delayed neutron interference from 17O. Detection sensitivities of 239Pu were demonstrated with 15-g samples at a throughput of up to 140 per day. Over 40 elements can be detected at the sub-ppM level

  11. Effects of MAR-M247 substrate (modified) composition on coating oxidation coating/substrate interdiffusion. M.S. Thesis. Final Report; [protective coatings for hot section components of gas turbine engines

    Science.gov (United States)

    Pilsner, B. H.

    1985-01-01

    The effects of gamma+gamma' Mar-M247 substrate composition on gamma+beta Ni-Cr-Al-Zr coating oxidation and coating/substrate interdiffusion were evaluated. These results were also compared to a prior study for a Ni-Cr-Al-Zr coated gamma Ni-Cr-Al substrate with equivalent Al and Cr atomic percentages. Cyclic oxidation behavior at 1130 C was investigated using change in weight curves. Concentration/distance profiles were measured for Al, Cr, Co, W, and Ta. The surface oxides were examined by X-ray diffraction and scanning electron microscopy. The results indicate that variations of Ta and C concentrations in the substrate do not affect oxidation resistance, while additions of grain boundary strengthening elements (Zr, Hf, B) increase oxidation resistance. In addition, the results indicate that oxidation phenomena in gamma+beta/gamma+gamma' Mar-M247 systems have similar characteristics to the l gamma+beta/gamma Ni-Cr-Al system.

  12. Microstructure and transformation behavior of Ni{sub 24.7}Ti{sub 50.3}Pd{sub 25} high temperature shape-memory alloy with Sc micro-addition

    Energy Technology Data Exchange (ETDEWEB)

    Ramaiah, K.V., E-mail: kvramaiah@nal.res.in [Materials Science Division, CSIR-National Aerospace Laboratories, Bangalore 560 017 (India); Saikrishna, C.N. [Materials Science Division, CSIR-National Aerospace Laboratories, Bangalore 560 017 (India); Gouthama [Department of Materials Science and Engineering, Indian Institute of Technology, Kanpur 208 016 (India); Bhaumik, S.K. [Materials Science Division, CSIR-National Aerospace Laboratories, Bangalore 560 017 (India)

    2015-08-15

    NiTiPd shape-memory alloys (SMAs) are potential functional materials for use as solid-state actuators in the temperature range 100–250 °C. The present study investigates the effect of 1.0 at.% Sc micro-addition to Ni{sub 24.7}Ti{sub 50.3}Pd{sub 25} alloy, Sc replacing either Ti or Ni. Results show that all the three alloys studied have stable transformation behavior on stress-free thermal cycling and hence, are suitable for cyclic actuation applications. However, the addition of Sc to NiTiPd alloy leads to decrease of transformation temperatures, the magnitude of decrease being greater for the alloy with Sc replacing Ni. The martensite finish (M{sub f}) temperature of 181 °C for the NiTiPd alloy decreased to 139 °C for Sc replacing Ti and 83 °C for Sc replacing Ni. Also, the indentation modulus of NiTiPdSc (Sc replacing Ni) alloy is found to be significantly low compared to the other alloys. Analysis indicates that the observed differences in the alloy properties are related to the solubility of Sc in the NiTiPd matrix. While the quaternary NiTiPdSc alloy, Sc replacing Ti, has a single phase microstructure, the alloy with Sc replacing Ni shows the presence of Sc-rich and TiPd-type second phases in the microstructure. TEM examination revealed that the TiPd-type phase has a distinct rod-like morphology (30–50 nm) arranged in a grid-like structure. The transformation and indentation behavior of the alloys is elucidated using thermodynamic calculations of frictional energy and an electronic structure based analysis. - Highlights: • TEM of Ni{sub 23.7}Ti{sub 50.3}Pd{sub 25}Sc{sub 1} showed distinct grid of TiPd-type phase nanorods < 50 nm. • Stress-free thermal cycling of all the three alloys showed stable transformation behavior. • Ni{sub 24.7}Ti{sub 49.3}Pd{sub 25}Sc{sub 1} and Ni{sub 23.7}Ti{sub 50.3}Pd{sub 25}Sc{sub 1} showed single and multiphase structures. • Sc micro-addition (1 at.%) to Ni{sub 24.7}Ti{sub 50.3}Pd{sub 25} alloy decreased TTs

  13. Comprehensive Survey of miRNA-mRNA Interactions Reveals That Ccr7 and Cd247 (CD3 zeta) are Posttranscriptionally Controlled in Pancreas Infiltrating T Lymphocytes of Non-Obese Diabetic (NOD) Mice

    Science.gov (United States)

    Macedo, Claudia; Sakamoto-Hojo, Elza T.; Donadi, Eduardo A.; Passos, Geraldo A.

    2015-01-01

    In autoimmune type 1 diabetes mellitus (T1D), auto-reactive clones of CD4+ and CD8+ T lymphocytes in the periphery evolve into pancreas-infiltrating T lymphocytes (PILs), which destroy insulin-producing beta-cells through inflammatory insulitis. Previously, we demonstrated that, during the development of T1D in non-obese diabetic (NOD) mice, a set of immune/inflammatory reactivity genes were differentially expressed in T lymphocytes. However, the posttranscriptional control involving miRNA interactions that occur during the evolution of thymocytes into PILs remains unknown. In this study, we postulated that miRNAs are differentially expressed during this period and that these miRNAs can interact with mRNAs involved in auto-reactivity during the progression of insulitis. To test this hypothesis, we used NOD mice to perform, for the first time, a comprehensive survey of miRNA and mRNA expression as thymocytes mature into peripheral CD3+ T lymphocytes and, subsequently, into PILs. Reconstruction of miRNA-mRNA interaction networks for target prediction revealed the participation of a large set of miRNAs that regulate mRNA targets related to apoptosis, cell adhesion, cellular regulation, cellular component organization, cellular processes, development and the immune system, among others. The interactions between miR-202-3p and the Ccr7 chemokine receptor mRNA or Cd247 (Cd3 zeta chain) mRNA found in PILs are highlighted because these interactions can contribute to a better understanding of how the lack of immune homeostasis and the emergence of autoimmunity (e.g., T1D) can be associated with the decreased activity of Ccr7 or Cd247, as previously observed in NOD mice. We demonstrate that these mRNAs are controlled at the posttranscriptional level in PILs. PMID:26606254

  14. Missense mutations in PBP2A Affecting ceftaroline susceptibility detected in epidemic hospital-acquired methicillin-resistant Staphylococcus aureus clonotypes ST228 and ST247 in Western Switzerland archived since 1998.

    Science.gov (United States)

    Kelley, William L; Jousselin, Ambre; Barras, Christine; Lelong, Emmanuelle; Renzoni, Adriana

    2015-04-01

    The development and maintenance of an arsenal of antibiotics is a major health care challenge. Ceftaroline is a new cephalosporin with activity against methicillin-resistant Staphylococcus aureus (MRSA); however, no reports concerning MRSA ceftaroline susceptibility have been reported in Switzerland. We tested the in vitro activity of ceftaroline against an archived set of 60 MRSA strains from the University Hospital of Geneva collected from 1994 to 2003. Our results surprisingly revealed ceftaroline-resistant strains (MIC, >1 μg/ml in 40/60 strains; EUCAST breakpoints, susceptible [S], ≤1 μg/ml; resistant [R], >1 μg/ml) were present from 1998 to 2003. The detected resistant strains predominantly belonged to sequence type 228 (ST228) (South German clonotype) but also to ST247 (Iberian clonotype). A sequence analysis of these strains revealed missense mutations in the penicillin-binding protein 2A (PBP2A) allosteric domain (N146K or E239K and N146K-E150K-G246E). The majority of our ST228 PBP2A mutations (N146K or E150K) were distinct from ST228 PBP2A allosteric domain mutations (primarily E239K) recently described for MRSA strains collected in Thailand and Spain during the 2010 Assessing Worldwide Antimicrobial Resistance Evaluation (AWARE) global surveillance program. We also found that similar allosteric domain PBP2A mutations (N146K) correlated with ceftaroline resistance in an independent external ST228 MRSA set obtained from the nearby University Hospital of Lausanne, Lausanne, Switzerland, collected from 2003 to 2008. Thus, ceftaroline resistance was observed in our archived strains (including two examples of an MIC of 4 µg/ml for the Iberian ST247 clonotype with the triple mutation N146K/E150K/G246E), at least as far back as 1998, considerably predating the commercial introduction of ceftaroline. Our results reinforce the notion that unknown parameters can potentially exert selective pressure on PBP2A that can subsequently modulate ceftaroline

  15. Did CDM particles of mass 2.47 x 10(-3) eV interact with precursor biopolymers and nucleic acids to initiate and boost lifeforms on Earth?

    Science.gov (United States)

    Rosen, Gerald

    2011-06-01

    Recent observations and theoretical studies have shown that non-baryonic Cold Dark Matter (CDM), which constitutes about 84% of all matter in the Universe, may feature a complex-scalar-field that carries particles of mass ≅ 2.47 x 10(-3)eV with the associated Compton range m(-1) ≅8.02 x 10(-3) cm, a distance on the scale of extended bionucleic acids and living cells. Such a complex-scalar-field can enter a weak-isospin Lorentz-invariant interaction that generates the flow of right-handed electrons and induces a chirality-imbued quantum chemistry on the m (-1) scale. A phenomenological Volterra-type equation is proposed for the CDM-impacted time development of N, the number of base pairs in the most advanced organism at Earth-age t. The solution to this equation suggests that the boosts in N at t ≅ 1.1 Gyr (advent of the first living prokaryotic cells), at t ≅ 2.9 Gyr (advent of eukaryotic single-celled organisms) and finally at t ≅ 4.0 Gyr (the Cambrian explosion) may be associated with three multi-Myr-duration cosmic showers of the complex-scalar-field CDM particles. If so, the signature of the particles may be detectible in Cambrian rocks. PMID:21057875

  16. Did CDM Particles of Mass 2.47 × 10-3 eV Interact with Precursor Biopolymers and Nucleic Acids to Initiate and Boost Lifeforms on Earth?

    Science.gov (United States)

    Rosen, Gerald

    2011-06-01

    Recent observations and theoretical studies have shown that non-baryonic Cold Dark Matter (CDM), which constitutes about 84% of all matter in the Universe, may feature a complex-scalar-field that carries particles of mass m ≅ 2.47 × {10^{{ - 3}}}eV with the associated Compton range {m^{{ - 1}}} ≅ 8.02 × {10^{{ - 3}}}cm, a distance on the scale of extended bionucleic acids and living cells. Such a complex-scalar-field can enter a weak-isospin Lorentz-invariant interaction that generates the flow of right-handed electrons and induces a chirality-imbued quantum chemistry on the m -1 scale. A phenomenological Volterra-type equation is proposed for the CDM-impacted time development of N, the number of base pairs in the most advanced organism at Earth-age t. The solution to this equation suggests that the boosts in N at t ≅ 1.1 Gyr (advent of the first living prokaryotic cells), at t ≅ 2.9 Gyr (advent of eukaryotic single-celled organisms) and finally at t ≅ 4.0 Gyr (the Cambrian explosion) may be associated with three multi-Myr-duration cosmic showers of the complex-scalar-field CDM particles. If so, the signature of the particles may be detectible in Cambrian rocks.

  17. 40 CFR 247.3 - Definitions.

    Science.gov (United States)

    2010-07-01

    ..., such as phenol or cresol, with aldehydes; Plastic fencing means a barrier with an open-weave pattern... warning or barrier in construction and other areas; Plastic lumber landscaping timbers and posts are used... surfaces are materials placed between railroad tracks, and between the track and the road at highway...

  18. 40 CFR 247.17 - Miscellaneous products.

    Science.gov (United States)

    2010-07-01

    ..., or plastic. (e) Mats containing recovered rubber and/or plastic. (f)(1) Non-road signs containing recovered plastic or aluminum and road signs containing recovered aluminum. (2) Sign supports and posts... Miscellaneous products. (a) Pallets containing recovered wood, plastic, or paperboard. (b) Sorbents...

  19. 32 CFR 247.3 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... information program, that support DoD command internal communication requirements. Usually, they are... commands. Media covered by this part may serve the command communication needs of one or several commands... paper. Authorized news and information sources include the Office of the Assistant Secretary of...

  20. 40 CFR 247.12 - Construction products.

    Science.gov (United States)

    2010-07-01

    ... ash, recovered rubber, recovered steel, recovered wood, or recovered plastic. (k) Modular threshold... and block containing: (1) Coal fly ash; (2) Ground granulated blast furnace slag (GGBF); (3..., stucco, masonry, wood, and metal surfaces. (h) Carpet cushion made from bonded polyurethane,...

  1. 7 CFR 247.20 - Program violations.

    Science.gov (United States)

    2010-01-01

    ...) Selling commodities obtained in the program, or exchanging them for non-food items; (4) Physical abuse, or threat of physical abuse, of program staff; or (5) Committing dual participation. (b) What are...

  2. 32 CFR 247.6 - Procedures.

    Science.gov (United States)

    2010-07-01

    ...-community communication, which enhances mutual support. (F) The newspaper increases organizational... attitudes and increase knowledge. (B) News reports and feature stories on individuals and organizational... mission performance. Recognition of excellence in individual or organizational performance motivates...

  3. Capture cross section measurement analysis in the Californium-252 spectrum with the Monte Carlo method

    International Nuclear Information System (INIS)

    Absolute average capture cross sections of gold, thorium, tantalum, molybdenum, copper and strontium in 252Cf spontaneous fission neutron spectrum were simulated for two types of experiment setups preformed by Z. Dezso and J. Csikai and by L. Green. The experiments were simulated with MCNP5 using cross section data from the ENDF/B-VII.0 library. The determination of neutron backscattering was calculated with the use of neutron flagging. Correction factors to experimentally measured values were determined to obtain average cross sections in a pure 252Cf spontaneous fission spectrum. Influence of concrete wall thickness, air moisture and room size on the average cross section was analyzed. Correction factors amounted to about 30%. Corrected values corresponding to average cross sections in a pure 252Cf spectrum were calculated for 197Au, 232Th, 181Ta, 98Mo, 65Cu and 84Sr. Average cross sections were also calculated with the RR-UNC software using IRDFF-v.1.05 and ENDF/B-VII.0 libraries. The revised average radiative capture cross sections are 75.5±0.1 mb for 197Au, 87.0±1.6 mb for 232Th , 98.0±4.5 mb for 181Ta, 21.2±0.5 mb for 98Mo, 10.3±0.3 mb for 63Cu, and 34.9±6.5 mb for 84Sr. - Highlights: • Average capture cross sections in 252Cf spontaneous fission spectrum were simulated. • Calculations were done using MCNP5 code and ENDF/B-VII.0 library. • Correction factors for self-shielding and room return effects were taken into account. • The revised average radiative capture cross sections for different materials are published

  4. Multi-element neutron activation analysis of sediment using a californium-252 source

    International Nuclear Information System (INIS)

    The application of a 252Cf source to the neutron activation analysis of several elements in small (approximately 1.5 in. in dia) cores was studied using high-resolution gamma ray spectroscopy and manual data reduction. (U.S.)

  5. OER of californium-252 at low dose rate for growth inhibition in Vicia faba

    International Nuclear Information System (INIS)

    OER of 252Cf, at low dose rate, has been determined for growth inhibition in Vicia faba roots. A new strain ''BelB'' was used; it was found to be more resistant to prolonged anoxia. Two sets of linear 252Cf sources were used (linear activity 0.31 and 0.47 (μg.cm-1)) in somewhat different geometrical arrangements. The (n+γ) 252Cf dose rates at the level of the root tips were 0.11 and 0.13 Gy.h-1 respectively. The relative contribution of the γ component Dsub(γ) to the total absorbed dose Dsub(n+γ) at the level of the root tips was evaluated Dsub(γ)/Dsub(n+γ)=0.35 for the first source-geometry and 0.42 for the second source-geometry. The reference radiation was the γ emission of 192Ir, used in the same geometrical conditions and for similar irradiation times. Irradiations performed in aerobic and anoxic conditions were alternated. OER values of 1.4 +- 0.1 and 1.5 +- 0.1 were observed for the 252Cf emission with the first and second source-geometry respectively. The corresponding OER values for 192Ir were 2.3 +- 0.2 and 2.6 +- 0.1; the derived oxygen gain factors were then equal to 1.6 and 1.7 repectively

  6. Density functional theory and Hartree-Fock studies: geometry, vibrational frequencies and electronic properties of Anderson-type heteropolyanion, [XM6O24]n- (X=TeVI, IVII and M=Mo, W) and [SbVW6O24]7-.

    Science.gov (United States)

    Alizadeh, M H; Salimi, A R

    2006-12-01

    The geometry, IR and Raman spectra and electronic properties of Anderson-type heteropolyanions with main-group high oxidation state heteroatom, [Te(VI)Mo(6)O(24)](6-), [I(VII)Mo(6)O(24)](5-), [Sb(V)W(6)O(24)](7-), [Te(VI)W(6)O(24)](6-) and [I(VII)W(6)O(24)](5-) have been investigated using Hartree-Fock (HF) and density functional theory (DFT) methods. HF method has good results in geometry parameters but poorer than DFT method in the results of vibrational frequencies. Also we have investigated the effect of LanL2DZ augmented in the vibrational frequencies. With attention to relative charge and size of the cavity occupied by XO(6) subunit in these anions, we suggest that the general formula [XO(6)(n-)@M(6)O(18)] to describe electronic properties of these anions. PMID:16716646

  7. Digital reference service : libraries online 24/7

    OpenAIRE

    Vijayakumar, Manju; Vijayakumar, J. K.

    2005-01-01

    The integration of the Internet Technology in to Libraries has not changed its mission of providing excellent information service to users but it has added several new dimensions and opened new avenues to their tasks. Reference librarians, while assisting users in the library, now have an additional set of remote users, who access the reference service online, who are more demanding, less patient users who have greater expectations. This paper discusses the methods in Online Reference service...

  8. Dicty_cDB: AFI247 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available e antennae Lambda ZAP II library Apisproteins of mammals, mRNA sequence. 56 5e-10 2 AZ68...ces producing significant alignments: (bits) Value N BE844390 |BE844390.1 EST134 Apis mellifera femal...CRGVQHPTRGLFLRHYLSEVTKDKLPDIDSSVENGTVM DSIDFIIQNFTE--- ---kinglqlvqrfsplsvkpsklwpisnwpilaldytfkhskplttvvwslvsknwpsr ls...vmnrvlvlvhlltf*mnvssivikkl mlfqfnsfqiwln*fvllmlkkliqhyhiykilsntfn Frame C: **kkinqq*hk... 3e-09 3 AY193838 |AY193838.1 Entamoeba histolytica vacuolar sorting protein 35-l

  9. Dicty_cDB: SSE247 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available telium discoideum chromosome 2 map 6445720-6776760 strain AX4, complete sequence. 54 2e-10 7 AC116986 |AC116986.2 Dict...ete sequence. 76 5e-10 6 AC116955 |AC116955.2 Dictyostelium discoideum chromosome 2 map 5455881-5481449 stra...in AX4, complete sequence. 68 2e-09 5 AC116967 |AC116967.2 Dictyostelium discoideum chromosome 2 map 5481549-5500786 stra...lium discoideum chromosome 2 map complement(3622543-3568102) strain AX4, complete sequence. 66 3e-07 1 AC114261 |AC114261.2 Dict...-07 1 AC115577 |AC115577.2 Dictyostelium discoideum chromosome 2 map 4657875-4914984 strain AX4, complete se

  10. 47 CFR 90.247 - Mobile repeater stations.

    Science.gov (United States)

    2010-10-01

    ... communication with its associated pack-carried or hand-carried units, shall not exceed 6 watts except when the same frequency is also used by the same station for direct communication with vehicular mobile units...

  11. 7 CFR 247.37 - Civil rights requirements.

    Science.gov (United States)

    2010-01-01

    ... against should file a discrimination complaint with the USDA Director, Office of Civil Rights, Room 326W, Whitten Building, 1400 Independence Avenue, SW., Washington, DC 20250-9410, or telephone (202) 720-5964....

  12. 32 CFR Appendix B to Part 247 - CE Publications

    Science.gov (United States)

    2010-07-01

    ... statement of work with appropriate contractual terms and conditions, using 48 CFR chapter I and II as guides... Printing. While CE contracts are not subject to the FAR (48 CFR chapter I) or the DFARS (48 CFR chapter II... sources include the OASD(PA), AFIS, the Military Departments and their subordinate levels of command,...

  13. 7 CFR 2.47 - Administrator, Rural Utilities Service.

    Science.gov (United States)

    2010-01-01

    ... Comptroller General (4 CFR chapter II), with respect to the claims of the Rural Utilities Service. (10... Secretary by Executive Order 12580, 3 CFR, 1987 Comp., p. 193, under the following provisions of the... standards and section 1-601 of Executive Order 12088, 3 CFR, 1978 Comp., p. 243, to enter into an...

  14. Dicty_cDB: SSJ247 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 5 Homology vs Protein Score E Sequences producing significant alignments: (bits) Value ( P25323 ) RecName: Full=Myosin light...fs*kdcfscwipsmg*isstei *nqkiyf*i*rkpfgscyc*fws**nywpnscnanchvvhqvmlhqry*mqlvmigklic gvlvsslifyyvvshhstviqsqkslnklwkptmnsqknig...nments: (bits) Value N M64176 |M64176.1 D.discoideum myosin light chain kin... chain kinase A; Sho... 284 4e-82 A40811( A40811 ;A37125)myosin-light-chain kinase (EC 2.7.1... WSIGVITYILLCGFPPFYGDTVPEIFEQIMEANYEFPEEYWGGISKEAKDFIGKLLVVDV SKRLNATNALNHPWLKSNNSNNTIDTVKMKEYIVERQKTQTKLVN*kni

  15. Web Based Prognostics and 24/7 Monitoring

    Science.gov (United States)

    Strautkalns, Miryam; Robinson, Peter

    2013-01-01

    We created a general framework for analysts to store and view data in a way that removes the boundaries created by operating systems, programming languages, and proximity. With the advent of HTML5 and CSS3 with JavaScript the distribution of information is limited to only those who lack a browser. We created a framework based on the methodology: one server, one web based application. Additional benefits are increased opportunities for collaboration. Today the idea of a group in a single room is antiquated. Groups will communicate and collaborate with others from other universities, organizations, as well as other continents across times zones. There are many varieties of data gathering and condition-monitoring software available as well as companies who specialize in customizing software to individual applications. One single group will depend on multiple languages, environments, and computers to oversee recording and collaborating with one another in a single lab. The heterogeneous nature of the system creates challenges for seamless exchange of data and ideas between members. To address these limitations we designed a framework to allow users seamless accessibility to their data. Our framework was deployed using the data feed on the NASA Ames' planetary rover testbed. Our paper demonstrates the process and implementation we followed on the rover.

  16. Dicty_cDB: SFJ247 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AAAGCCAAGATCCAAGATAAAGAA GGTATTCCACCAGATCAACAAAGATTAATCT sequence update 2001. 6. 1 Translated Amino Acid sequence ---m*xqxpxxxrf...kinxcr*tir rwsysf*lqyskrihspfsfkikrwyanlc*nshw*nnhfrs*rf**h*kc*sqdpr*rr ystrstkin Frame B: ---m*xqxpxxxrfppd

  17. Maintaining Mission Critical Systems in a 247 Environment

    CERN Document Server

    Curtis, Peter M

    2011-01-01

    "This book is meant to offer Architects, Property Mangers, Facility Managers, Building Engineers, Information Technology Professionals, Data Center Personnel, Electrical & Mechanical Technicians and students in undergraduate, graduate, or continuing education programs relevant insight into the Mission Critical Environment with an emphasis on business resiliency, data center efficiency, and green power technology. Industry improvements, standards, and techniques have been incorporated into the text and address the latest issues prevalent in the Mission Critical Industry. An emphasis on green technologies and certifications is presented throughout the book. In addition, a description of the United States energy infrastructure's dependency on oil, in relation to energy security in the mission critical industry, is discussed. In conjunction with this, either a new chapter will be created on updated policies and regulations specifically related to the mission critical industry or updates to policies and regula...

  18. 8 CFR 247.12 - Disposition of case.

    Science.gov (United States)

    2010-01-01

    ... Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS ADJUSTMENT OF STATUS OF... and shall constitute notice to him of such adjustment. The alien's nonimmigrant status shall be for... retain his status as an immigrant and files with the district director Form I-508 and, if...

  19. ED 'vending machine' sells patient meds 24/7.

    Science.gov (United States)

    2008-05-01

    A vending machine stocked with your most commonly used drugs can be a relatively inexpensive investment in patient and staff satisfaction. Rice Memorial Hospital in Willmar, MN, has installed such a machine, which includes several safeguards: * It has several internal cameras, serving as backup systems to ensure the proper drug is being dispensed to the proper patient. * The machine cannot be accessed by anyone unless they have received a magnetic swipe card from the prescribing physician. * The code is only given to a physician authorized to enter the web portal of the prescription vendor. PMID:18686529

  20. Dicty_cDB: VHC247 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available q--- ---vv*ylvkchhhyhhhqqtpyqlqtiqlhyhnnqiqptqclqlfhflvavlv*ipiva ivnl*dhqnhlitmvkkvkkkekkrilikkaanqigklnqkrmkiekkikimikian...nhlqql*lqfchlklklhkqhhhhhhhhhhhh hhhhhhhhhhlqqkitplll*itliqlnl*m*rknnslqfqllsknqilhqkhyhhqilh qkhyhyqilhqkhyyhqihlfpinlhhhqypnq...nordered pieces. 30 0.006 3 AC106705 |AC106705.7 Homo sapiens 3 BAC RP11-262L17 (Roswell Park Cancer Institute Human...AAAAATCAATGGTATATAGATTTTTAATTTC sequence update 2002.10.25 Translated Amino Acid ...ECRRLLRI QCSRISELNKQNIESGKDTTEVISKMKDLISELSSFKFLLLDIASKDINFIKNQWYIDF* f Translated Amino Acid sequence (All

  1. Dicty_cDB: SSK247 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available .. 34 9.7 AB049544_1( AB049544 |pid:none) Porcine enterovirus 10 gene for RN... 3...4 9.7 AF363453_1( AF363453 |pid:none) Porcine enterovirus 9 strain UKG/4... 34 9.7 protein update 2009. 6.14

  2. Dicty_cDB: SHI247 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available emediation Malus x domestica cDNA clone ABNB001773, mRNA sequence. 78 1e-12 2 CN939...e-13 2 CN914665 |CN914665.1 030110ABNB001773HT (ABNB) Braeburn cultured fruit cells, boron exposed, phytor

  3. Únavové vlastnosti superslitiny MAR-M-247

    Czech Academy of Sciences Publication Activity Database

    Šmíd, Miroslav; Kunz, Ludvík; Hrbáček, K.; Joch, A.; Hutař, Pavel

    2013-01-01

    Roč. 61, 9-10 (2013), s. 346-349. ISSN 0037-6825 R&D Projects: GA MPO FR-TI4/030 Institutional support: RVO:68081723 Keywords : superalloys * structure * fatigue properties Subject RIV: JL - Materials Fatigue, Friction Mechanics

  4. 7 CFR 247.31 - Audits and investigations.

    Science.gov (United States)

    2010-01-01

    .... (a) What is the purpose of an audit? The purpose of an audit is to ensure that: (1) Financial... are maintained; and (4) Applicable laws, regulations, and administrative requirements are followed. (b) When may the Department conduct an audit or investigation of the program? The Department may conduct...

  5. Teaching Children Thinking. Artificial Intelligence Memo Number 247.

    Science.gov (United States)

    Papert, Seymour

    It is possible to maintain a vision of a technologically oriented educational system which is grander than the current one in which new gadgets are used to teach the old material in a thinly disguised old way. Educational innovation, particularly when computers are included, can find better things for children to do and better ways for the child…

  6. The determination of americium, curium and californium in biological samples by combined solvent extraction-liquid scintillation counting

    International Nuclear Information System (INIS)

    A method has been developed to extract Am, Cm and Cf from ashed biological samples dissolved in 8 M LiN03-10-2 M HN03 into a liquid/scintillation cocktail. This new method reduces tissue and instrument background and allows use of a larger sample for analysis than when using a commercial gelling cocktail. The extractant cocktail is 20% N,N,N-trioctyl-N-methylammonium chloride dissolved in toluene containing the scintillators p-terphenyl and 1,4-bis-2-(5-phenyl-oxazolyl)-benzene. Several different types of biological samples were analyzed and radionuclide recoveries greater than 90% were obtained in all cases. (author)

  7. Oxidation-reduction properties of americium, curium, berkelium, californium, einsteinium and fermium, and thermodynamic consequences for the 5f series

    International Nuclear Information System (INIS)

    The amalgamation of 5f elements from Am to Fm has been studied by using 241Am, 244Cm, 249Bk, 249Cf, 252Cf, 253Es, 254Es, 252Fm and 255Fm with two electrochemical methods, radiocoulometry and radiopolarography, perfectly adapted to investigate extremely diluted solutions when the concentration of electroactive species is as low as 10-16M. The theory of radiocoulometry has been developed in the general cases of reversible and irreversible electrode process. It has been used to interpret the experimental data on the kinetic curves of amalgamation, and to estimate the standard rate constant of the electrode process in complexing medium (citric). On the other hand the radiopolarographic method has been applied to study the mechanism of reduction at the dropping mercury electrode of cations M3+ in aqueous medium to the metal M with formation of amalgam. The results are exploited into two directions: 1- Acquisition of some data concerning the oxidation-reduction properties of elements from Am to Fm. Therefore the standard electrode E0 [M(III-0)] potentials for Bk, Cf and Es, and the standard electrode E0 [M(II-0)] potential for Fm are estimated and the relative stability of each oxidation state (from II to VII) of 5f elements is discussed; 2- Acquisition of unknown thermodynamic data on transcalifornium elements. Correlations between 4f and 5f elements are precised and some divergences appear for the second half of 4f and 5f series (i.e. for 65<=Z<=71 and 97<=Z<=103)

  8. Raman and absorption spectrophotometric studies of selected lanthanide, californium-doped lanthanide, and actinide trihalides in the solid state

    International Nuclear Information System (INIS)

    The solid-state absorption spectra of Cf(III) ions as a dopant in lanthanide trihalide hosts (LnCl3: Ln = Ce, Sm, and Y; LnBr3: Ln = Ce, Sm, Tb, and Y; LnI3: Ln = Ce and Y) have been recorded. The spectra of Cf(III) have been correlated with the various crystal structures. The phonon Raman spectra and solid-state absorption spectra of PmF3, PmCl3, PmBr3, and two crystal modifications of PmI3 have been recorded. Symmetry assignments have been made for the Raman-active bands for these trihalides and also the sesquioxide. The room-temperature absorption spectra have been correlated to crystal field effects. The symmetry assignments of the Raman-active phonon modes have been made based on polarized Raman spectra from single crystals of YF3-type orthorhombic TbF3 and PuBr3-type orthorhombic NdBr3. Raman spectra of other isostructural lanthanide compounds have been recorded and compared. Symmetry assignments for these compounds have been made by analogy to the single-crystal assignments. Raman spectra have been obtained and catalogued for a number of actinide compounds. Symmetry assignments have been made for the observed Raman-active phonon bands in this work based on the assignments made for isostructural lanthanide compounds. 29 figs., 22 tabs

  9. Optical Transitions in Highly Charged Californium Ions with High Sensitivity to Variation of the Fine-Structure Constant

    Science.gov (United States)

    Berengut, J. C.; Dzuba, V. A.; Flambaum, V. V.; Ong, A.

    2012-08-01

    We study electronic transitions in highly charged Cf ions that are within the frequency range of optical lasers and have very high sensitivity to potential variations in the fine-structure constant, α. The transitions are in the optical range despite the large ionization energies because they lie on the level crossing of the 5f and 6p valence orbitals in the thallium isoelectronic sequence. Cf16+ is a particularly rich ion, having several narrow lines with properties that minimize certain systematic effects. Cf16+ has very large nuclear charge and large ionization energy, resulting in the largest α sensitivity seen in atomic systems. The lines include positive and negative shifters.

  10. Optical transitions in highly-charged californium ions with high sensitivity to variation of the fine-structure constant

    CERN Document Server

    Berengut, J C; Flambaum, V V; Ong, A

    2012-01-01

    We study electronic transitions in highly-charged Cf ions that are within the frequency range of optical lasers and have very high sensitivity to potential variations in the fine-structure constant, alpha. The transitions are in the optical despite the large ionisation energies because they lie on the level-crossing of the 5f and 6p valence orbitals in the thallium isoelectronic sequence. Cf16+ is a particularly rich ion, having several narrow lines with properties that minimize certain systematic effects. Cf16+ has very large nuclear charge and large ionisation energy, resulting in the largest alpha-sensitivity seen in atomic systems. The lines include positive and negative shifters.

  11. AN INTEGRAL REACTOR PHYSICS EXPERIMENT TO INFER ACTINIDE CAPTURE CROSS-SECTIONS FROM THORIUM TO CALIFORNIUM WITH ACCELERATOR MASS SPECTROMETRY

    International Nuclear Information System (INIS)

    The principle of the proposed experiment is to irradiate very pure actinide samples in the Advanced Test Reactor (ATR) at INL and, after a given time, determine the amount of the different transmutation products. The determination of the nuclide densities before and after neutron irradiation will allow inference of effective neutron capture cross-sections. This approach has been used in the past and the novelty of this experiment is that the atom densities of the different transmutation products will be determined using the Accelerator Mass Spectroscopy (AMS) technique at the ATLAS facility located at ANL. It is currently planned to irradiate the following isotopes: 232Th, 235U, 236U, 238U, 237Np, 238Pu, 239Pu, 240Pu, 241Pu, 242Pu, 241Am, 243Am and 248Cm.

  12. Integral range, energy, residual range, and linear energy transfer distributions for Californium fission fragments in microelectronics materials

    International Nuclear Information System (INIS)

    This report discusses the advantages and limitations of using Cf-252 radiation sources for single event testing of microelectronics for space environments. Integral distributions for the range, energy, residual range, and linear energy transfer of Cf-252 fission fragments in absorber and microelectronic materials have been calculated. Techniques are suggested for determining when single event testing using Cf-252 is appropriate; also, techniques are given for estimating the saturation cross section and thresh old linear energy transfer from test data. 10 refs., 25 figs., 2 tabs

  13. Research and experimental work at Groote Schuur Hospital and the University of Cape Town using californium-252 sources

    International Nuclear Information System (INIS)

    Experiments have been undertaken to determine the high-LET and low-LET components of the absorbed dose from neutron beams. This is achieved by measuring the fluxes of the high-LET and low-LET radiations in a tissue-equivalent phantom individually and simultaneously using a scintillation probe fitted with a pulse shape discriminator. This system was successfully used with a 22 MeV neutron beam from the T(d,n) reaction and has been employed with 252Cf sources. Results obtained in the low-energy ranges (up to 3 MeV) indicate that the electron counts exceed the high-LET counts by a factor of 2 to 3. These results are related to the absorbed dose. Calculations have also been undertaken to establish whether the Paterson-Parker system could be used for the design of 252Cf treatments and the optimum needle activities to yield the desired dose. Experiments are under way to determine the variation of RBE and OER for 252Cf radiations around the source. The inhibition of root growth in Vicia Faba is being used to determine any such effects. Dose rates comparable to that employed in interstitial radiotherapy are being aimed at. A study of dose fractionation effects is also being undertaken. (author)

  14. Accurate determination of Curium and Californium isotopic ratios by inductively coupled plasma quadrupole mass spectrometry (ICP-QMS) in 248Cm samples for transmutation studies

    International Nuclear Information System (INIS)

    The French Atomic Energy Commission has carried out several experiments including the mini-INCA (INcineration of Actinides) project for the study of minor-actinide transmutation processes in high intensity thermal neutron fluxes, in view of proposing solutions to reduce the radiotoxicity of long-lived nuclear wastes. In this context, a Cm sample enriched in 248Cm (∼97 %) was irradiated in thermal neutron flux at the High Flux Reactor (HFR) of the Laue-Langevin Institute (ILL). This work describes a quadrupole ICP-MS (ICP-QMS) analytical procedure for precise and accurate isotopic composition determination of Cm before sample irradiation and of Cm and Cf after sample irradiation. The factors that affect the accuracy and reproducibility of isotopic ratio measurements by ICP-QMS, such as peak centre correction, detector dead time, mass bias, abundance sensitivity and hydrides formation, instrumental background, and memory blank were carefully evaluated and corrected. Uncertainties of the isotopic ratios, taking into account internal precision of isotope ratio measurements, peak tailing, and hydrides formations ranged from 0.3% to 1.3%. This uncertainties range is quite acceptable for the nuclear data to be used in transmutation studies.

  15. MANTRA: An Integral Reactor Physics Experiment to Infer Actinide Capture Cross-sections from Thorium to Californium with Accelerator Mass Spectrometry

    Energy Technology Data Exchange (ETDEWEB)

    G. Youinou; C. McGrath; G. Imel; M. Paul; R. Pardo; F. Kondev; M. Salvatores; G. Palmiotti

    2011-08-01

    The principle of the proposed experiment is to irradiate very pure actinide samples in the Advanced Test Reactor at INL and, after a given time, determine the amount of the different transmutation products. The determination of the nuclide densities before and after neutron irradiation will allow inference of effective neutron capture cross-sections. This approach has been used in the past and the novelty of this experiment is that the atom densities of the different transmutation products will be determined using the Accelerator Mass Spectrometry technique at the ATLAS facility located at ANL. It is currently planned to irradiate the following isotopes: 232Th, 235U, 236U, 238U, 237Np, 238Pu, 239Pu, 240Pu, 241Pu, 242Pu, 241Am, 243Am, 244Cm and 248Cm.

  16. Radiological Characterization Technical Report on Californium-252 Sealed Source Transuranic Debris Waste for the Off-Site Source Recovery Project at Los Alamos National Laboratory

    Energy Technology Data Exchange (ETDEWEB)

    Feldman, Alexander [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2014-04-24

    This document describes the development and approach for the radiological characterization of Cf-252 sealed sources for shipment to the Waste Isolation Pilot Plant. The report combines information on the nuclear material content of each individual source (mass or activity and date of manufacture) with information and data on the radionuclide distributions within the originating nuclear material. This approach allows for complete and accurate characterization of the waste container without the need to take additional measurements. The radionuclide uncertainties, developed from acceptable knowledge (AK) information regarding the source material, are applied to the summed activities in the drum. The AK information used in the characterization of Cf-252 sealed sources has been qualified by the peer review process, which has been reviewed and accepted by the Environmental Protection Agency.

  17. The development and medical applications of a simple facility for partial body in vivo neutron activation analysis using californium-252 sources

    International Nuclear Information System (INIS)

    A simple and cheap facility for partial body neutron activation analysis has been designed, based on the use of two 100 μg 252Cf neutron sources. The results reported show that calcium can be measured in parts of the body such as the tibia with a precision as good as +- 1.6 % for a radiation dose of 2 rem. The uniformity of the thermal neutron flux density is better than +- 3 % over 10 cm. Some applications of this irradiation facility for studies of trace elements, in particular cadmium in liver and aluminium in liver or brain, have also been explored. However, the sensitivity attainable is not yet sufficient for the study of normal levels, but could be of interest in toxicological investigations

  18. Accurate determination of Curium and Californium isotopic ratios by inductively coupled plasma quadrupole mass spectrometry (ICP-QMS) in Cm-248 samples for transmutation studies

    International Nuclear Information System (INIS)

    The French Atomic Energy Commission has carried out several experiments including the mini-INCA (Incineration of Actinides) project for the study of minor-actinide transmutation processes in high intensity thermal neutron fluxes, in view of proposing solutions to reduce the radiotoxicity of long-lived nuclear wastes. In this context, a Cm sample enriched in 248Cm (similar to 97%) was irradiated in thermal neutron flux at the High Flux Reactor (HFR) of the Laue-Langevin Institute (ILL). This work describes a quadrupole ICP-MS (ICP-QMS) analytical procedure for precise and accurate isotopic composition determination of Cm before sample irradiation and of Cm and Cf after sample irradiation. The factors that affect the accuracy and reproducibility of isotopic ratio measurements by ICP-QMS, such as peak centre correction, detector dead time, mass bias, abundance sensitivity and hydrides formation, instrumental background, and memory blank were carefully evaluated and corrected. Uncertainties of the isotopic ratios, taking into account internal precision of isotope ratio measurements, peak tailing, and hydrides' formations ranged from 0. 3% to 1. 3%. This uncertainties' range is quite acceptable for the nuclear data to be used in transmutation studies. (authors)

  19. MANTRA: An Integral Reactor Physics Experiment to Infer Actinide Capture Cross-sections from Thorium to Californium with Accelerator Mass Spectrometry

    International Nuclear Information System (INIS)

    The principle of the proposed experiment is to irradiate very pure actinide samples in the Advanced Test Reactor at INL and, after a given time, determine the amount of the different transmutation products. The determination of the nuclide densities before and after neutron irradiation will allow inference of effective neutron capture cross-sections. This approach has been used in the past and the novelty of this experiment is that the atom densities of the different transmutation products will be determined using the Accelerator Mass Spectrometry technique at the ATLAS facility located at ANL. It is currently planned to irradiate the following isotopes: 232Th, 235U, 236U, 238U, 237Np, 238Pu, 239Pu, 240Pu, 241Pu, 242Pu, 241Am, 243Am, 244Cm and 248Cm.

  20. 24 CFR 247.3 - Entitlement of tenants to occu- pancy.

    Science.gov (United States)

    2010-04-01

    ... health or safety of any person or the right of any tenant to the quiet enjoyment of the leased premises... CFR part 5; or (ii) Knowingly provides incomplete or inaccurate information as required under these... occupancy. Said notice shall be served on the tenant in the same manner as that provided for...

  1. Population 24/7: building time-specific population grid models

    OpenAIRE

    Martin, David; Cockings, Samantha; Leung, Samuel

    2009-01-01

    Many areas of social science research and public policy rely on small area geographical representations of population. Studies of disease prevalence, crime rates, exposure to environmental hazards, transportation modelling and the more applied challenges of emergency planning, service delivery and resource allocation rely fundamentally on statistics relating to the distribution of population. Grid-based population models have considerable advantages for population representation, offering mor...

  2. Yeast Interacting Proteins Database: YLR223C, YOR247W [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available ractions with FHL1, overexpression interferes with silencing at telomeres and HM loci; potential Cdc28p substrate...ce of GPI-anchored mannoproteins; has a high serine-threonine content; expression is induced in cell wall mutants...rferes with silencing at telomeres and HM loci; potential Cdc28p substrate Rows with this...ins; has a high serine-threonine content; expression is induced in cell wall mutants Rows with this prey...in (YPD) 0 Alternative path with 2 intervening proteins (YPD) 0 IST hit 3 IST hit in the opposite bait/prey orientation - ...

  3. Role of defects in fatigue damage mechanisms of cast polycrystalline superalloy MAR-M 247

    Czech Academy of Sciences Publication Activity Database

    Šmíd, Miroslav; Fintová, Stanislava; Kunz, Ludvík; Hutař, Pavel

    Paris : EDP Sciences, 2014 - (Brune, M.; Buffiéne, J.; Morel, F.; Nadot, Y.), Art. n. 03005 ISBN 978-2-7598-1274-5. - (MATEC Web of Confernces. 12). [FDMD II - JIP 2014 International Spring Meeting SF2M Commission Fatigue /14./. Paris (FR), 11.06.2014-13.06.2014] R&D Projects: GA MPO FR-TI4/030 Institutional support: RVO:68081723 Keywords : Superalloys * High-cycle fatigue * Porosity analysis * High temperatures * Fracture surfaces Subject RIV: JL - Materials Fatigue, Friction Mechanics

  4. STS 107 Shuttle Press Kit: Providing 24/7 Space Science Research

    Science.gov (United States)

    2002-01-01

    Space shuttle mission STS-107, the 28th flight of the space shuttle Columbia and the 113th shuttle mission to date, will give more than 70 international scientists access to both the microgravity environment of space and a set of seven human researchers for 16 uninterrupted days. Columbia's 16-day mission is dedicated to a mixed complement of competitively selected and commercially sponsored research in the space, life and physical sciences. An international crew of seven, including the first Israeli astronaut, will work 24 hours a day in two alternating shifts to carry out experiments in the areas of astronaut health and safety; advanced technology development; and Earth and space sciences. When Columbia is launched from Kennedy Space Center's Launch Pad 39A it will carry a SPACEHAB Research Double Module (RDM) in its payload bay. The RDM is a pressurized environment that is accessible to the crew while in orbit via a tunnel from the shuttle's middeck. Together, the RDM and the middeck will accommodate the majority of the mission's payloads/experiments. STS-107 marks the first flight of the RDM, though SPACEHAB Modules and Cargo Carriers have flown on 17 previous space shuttle missions. Astronaut Rick Husband (Colonel, USAF) will command STS-107 and will be joined on Columbia's flight deck by pilot William 'Willie' McCool (Commander, USN). Columbia will be crewed by Mission Specialist 2 (Flight Engineer) Kalpana Chawla (Ph.D.), Mission Specialist 3 (Payload Commander) Michael Anderson (Lieutenant Colonel, USAF), Mission Specialist 1 David Brown (Captain, USN), Mission Specialist 4 Laurel Clark (Commander, USN) and Payload Specialist 1 Ilan Ramon (Colonel, Israeli Air Force), the first Israeli astronaut. STS-107 marks Husband's second flight into space - he served as pilot during STS-96, a 10-day mission that saw the first shuttle docking with the International Space Station. Husband served as Chief of Safety for the Astronaut Office until his selection to command the STS-107 crew. Anderson and Chawla will also be making their second spaceflights. Anderson first flew on STS-89 in January 1998 (the eighth Shuttle-Mir docking mission) while Chawla flew on STS-87 in November 1997 (the fourth U.S. Microgravity Payload flight). McCool, Brown, Clark and Ramon will be making their first flights into space.

  5. 49 CFR 173.247 - Bulk packaging for certain elevated temperature materials.

    Science.gov (United States)

    2010-10-01

    ... 101 and IM 102 portable tanks; UN portable tanks; marine portable tanks conforming to 46 CFR part 64... of the packaging material at any temperature within the design temperature range. Stress is... packaging authorized in this section, such equipment must be of a self-reclosing design, must...

  6. 24/7 population modelling for enhanced assessment of exposure to natural hazards

    OpenAIRE

    Smith, Alan; Martin, David; Cockings, Samantha

    2013-01-01

    There is a growing need for accurate spatio-temporal population estimates free from arbitrary administrative boundaries and temporal divisions to make enhanced assessments of population exposure to natural hazards. The approach proposed here combines the use of a spatio-temporal gridded population model to estimate temporary variations in population with natural hazard exposure estimations. It has been exemplified through a Southampton (UK) centred application using Environment Agency flood m...

  7. High Cycle Fatigue Damage Mechanisms of MAR-M 247 Superalloy at High Temperatures

    Czech Academy of Sciences Publication Activity Database

    Šmíd, Miroslav; Horník, Vít; Hutař, Pavel; Hrbáček, K.; Kunz, Ludvík

    2016-01-01

    Roč. 69, č. 2 (2016), s. 393-397. ISSN 0972-2815 R&D Projects: GA TA ČR(CZ) TA04011525; GA MŠk(CZ) ED1.1.00/02.0068 Institutional support: RVO:68081723 Keywords : High cycle fatigue * S-N curves * Fractography * High temperature * EBSD analysis Subject RIV: JL - Materials Fatigue, Friction Mechanics Impact factor: 0.615, year: 2014

  8. Flame Retardant: Cyberbullies Torment Their Victims 24/7: Here's How to Stop the Abuse

    Science.gov (United States)

    Willard, Nancy

    2006-01-01

    Cyberbullying is the use of electronic information such as e-mail and other digital age tools to bully or harass individuals. Cyberbullies post angry and vulgar messages in online "flaming" wars or hack into a peer's e-mail account to wreak havoc, assaulting the reputations and already fragile egos of their young victims. The devastating effects…

  9. 48 CFR 52.247-64 - Preference for Privately Owned U.S.-Flag Commercial Vessels.

    Science.gov (United States)

    2010-10-01

    ... deployed in connection with United Nations or North Atlantic Treaty Organization humanitarian or... operations; (B) Exercises; or (C) Forces deployed in connection with United Nations or North Atlantic Treaty... connection with United Nations or North Atlantic Treaty Organization humanitarian or peacekeeping operations.)...

  10. Creep in Cast MAR – M247 Nickel – Base Superalloy

    Czech Academy of Sciences Publication Activity Database

    Kvapilová, Marie; Kuchařová, Květa; Král, Petr; Hrbáček, K.; Sklenička, Václav

    Toulouse: Institut Carnot CIRIMAT, 2015. s. 111-112. [CREEP 2015 - International Conference on Creep and Fracture of Engineering Materials and Structures /13./. 31.05.2015-04.06.2015, Toulouse] R&D Projects: GA MŠk(CZ) ED1.1.00/02.0068; GA TA ČR(CZ) TA04011525 Institutional support: RVO:68081723 Keywords : MAR * creep * deformation mechanisms Subject RIV: JG - Metallurgy

  11. 17 CFR 247.741 - Exemption for banks effecting transactions in money market funds.

    Science.gov (United States)

    2010-04-01

    ... (15 U.S.C. 78c(a)(4)) to the extent that it effects transactions on behalf of a customer in securities issued by a money market fund, provided that: (1) The bank either (i) Provides the customer, directly or..., the other bank described in paragraph (a)(1)(B) of this section provides the customer, not later...

  12. 27 CFR 24.247 - Materials authorized for the treatment of distilling material.

    Science.gov (United States)

    2010-04-01

    ... amount used shall not exceed 200 parts per million. 21 CFR 184.1366 (GRAS). Potassium permanganate... distilling material The amount used shall not exceed 10 lbs/1000 gals. (1.2 g/L). 21 CFR 184.1141 (GRAS).1...% (w/v) as benzoic acid. GRAS per FDA advisory opinions dated 9/22/82 and 9/8/83. 21 CFR 184.1021...

  13. 48 CFR 52.247-42 - C.i.f. Destination.

    Science.gov (United States)

    2010-10-01

    ... vessel to the specified point of destination, with the cost of transportation and marine insurance paid... insurance policy or certificate providing the amount and extent of marine insurance coverage specified...

  14. 48 CFR 52.247-48 - F.o.b. Destination-Evidence of Shipment.

    Science.gov (United States)

    2010-10-01

    ... awarded on a free on board (f.o.b.) destination basis, the Contractor— (1) Shall not submit an invoice for payment until the supplies covered by the invoice have been shipped to the destination; and (2) Shall... Contractor's invoice, indicating the carrier's intent to ship the supplies to the destination specified...

  15. 7 CFR 247.25 - Allowable uses of administrative funds and other funds.

    Science.gov (United States)

    2010-01-01

    ... allowable. For availability of OMB Circulars referenced in this section, see 5 CFR 1310.3. Some examples of... equipment include automated information systems, automated data processing equipment, and other computer... NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS COMMODITY SUPPLEMENTAL FOOD...

  16. Nuclear engineering 24/7 via distance learning: Course development and management experiences

    International Nuclear Information System (INIS)

    This article summarizes a few lessons learned in our early experiences in developing, delivering and implementing a series of distance learning classes for full-time undergraduate students enrolled in the combined-degree BS Mechanical + MS Nuclear Engineering 5-year and co-op based 'MNE- ACCEND' program at the Univ. of Cincinnati. This program is in its third year since inception and currently hosts approximately 35 undergraduate students enrolled in the graduating classes of 2008, 2009, and 2010, which is when these students are expected to complete their BS Mechanical and MS Nuclear Engineering degrees. In addition, 20+ newly confirmed students are expected to enter this program in the fall quarter of 2006 to become our Class of 2011. Therefore, the successful 'follow through' of the DL component of this program continues to be increasingly crucial as this student pipeline reaches a targeted steady-state of about 10 to 15 graduates per class. (authors)

  17. Design of Motor Servo System with Multi-Channel Switching Power Based on TOP247Y%基于TOP247Y的电机伺服系统用多路开关电源设计

    Institute of Scientific and Technical Information of China (English)

    李君; 曾岳南

    2012-01-01

    文中设计了一种基于TOPSwitch-GX系列的电机伺服系统用多路单端反激式开关电源。该电源给系统控制板以及功率器件驱动电路提供5路+15 V、1路-15 V、1路+5 V独立电源,输出功率达到46 W。主要介绍了TOPS-witch-GX系列芯片的特点、开关电源辅助电路设计依据,着重分析了高频变压器的设计步骤,最后设计了基于TL431和光耦PC817的反馈补偿网络保证输出电压的稳定性。%A multi-channel single-end flyback switching power supply is designed for a motor servo system based on TOPSwitch-GX.The power supply to the system control panel and power device driving circuit 5 roads,+15 V,1 road-15V,1 road,+5 V separated power supplies and output power of 46 W.This paper mainly introduced the TOPSwitch-GX series chips feature,switching power supply auxiliary circuit design basis,focus on analyzes the design procedure of high frequency transformer,finally designes feedback compensation network based on TL431 and PC817 to ensure the stability of the output voltage.

  18. 78 FR 46315 - Foreign-Trade Zone (FTZ) 247-Erie, Pennsylvania, Notification of Proposed Production Activity, GE...

    Science.gov (United States)

    2013-07-31

    ...; connection straps; valve assemblies; cable assemblies; clear scraper I-beams; barrel bolt assemblies; hinge...; light assemblies; connection assemblies; receptacles; boxes; connector rings; stator kits; PC cards; box...; threaded pins; locking plates; cotter pins; locking rings; rings; keys; leaf springs; helical spring...

  19. Beverage consumption habits “24/7” among British adults: association with total water intake and energy intake

    Directory of Open Access Journals (Sweden)

    Gibson Sigrid

    2013-01-01

    Full Text Available Abstract Background Various recommendations exist for total water intake (TWI, yet it is seldom reported in dietary surveys. Few studies have examined how real-life consumption patterns, including beverage type, variety and timing relate to TWI and energy intake (EI. Methods We analysed weighed dietary records from the National Diet and Nutrition Survey of 1724 British adults aged 19–64 years (2000/2001 to investigate beverage consumption patterns over 24 hrs and 7 days and associations with TWI and EI. TWI was calculated from the nutrient composition of each item of food and drink and compared with reference values. Results Mean TWI was 2.53 L (SD 0.86 for men and 2.03 L (SD 0.71 for women, close to the European Food Safety Authority “adequate Intake” (AI of 2.5 L and 2 L, respectively. However, for 33% of men and 23% of women TWI was below AI and TWI:EI ratio was In multi-variable regression (adjusted for sex, age, body weight, smoking, dieting, activity level and mis-reporting, replacing 100 g of caloric beverages (milk, fruit juice, caloric soft drinks and alcohol with 100 g non-caloric drinks (diet soft drinks, hot beverages and water was associated with a reduction in EI of 15 kcal, or 34 kcal if food energy were unchanged. Using within-person data (deviations from 7-day mean each 100 g change in caloric beverages was associated with 29 kcal change in EI or 35 kcal if food energy were constant. By comparison the calculated energy content of caloric drinks consumed was 47 kcal/100 g. Conclusions TWI and beverage consumption are closely related, and some individuals appeared to have low TWI. Compensation for energy from beverages may occur but is partial. A better understanding of interactions between drinking and eating habits and their impact on water and energy balance would give a firmer basis to dietary recommendations.

  20. SU-E-J-247: A Simulation of X-Ray Emission with Gold Nanoparticle Irradiated by Energetic Proton Beam

    Energy Technology Data Exchange (ETDEWEB)

    Newpower, M; Ahmad, S; Chen, Y [University of Oklahoma Health Sciences Center, Oklahoma City, OK (United States)

    2014-06-01

    Purpose: To investigate the proton induced X-ray emissions in gold-water mixture materials. Methods: In this study a Monte Carlo simulation was created using the GEANT4 toolkit (version 4.9.6). The geometry in this setup includes a 2 cm × 2 cm × 2 cm target, a scoring sphere (radius = 10 cm) and a 65 MeV planar proton source (2 cm × 2 cm). Four concentrations of a gold-water solution were irradiated with 5×10{sup 5} incident protons at a distance of 0.5 cm perpendicular to the surface of the target. The solutions of gold-water mixture had 10%, 5%, 1% and 0.5% of gold by mass, respectively. The number of photon emitting for the target was counted in the scoring sphere for the energy range of 0-86.0 keV in 0.1 keV bins. For this study the reference physics list PhysListEmStandard was used together with the x-ray fluorescence, Auger electron and PIXE (particle induced xray emission) options enabled. The range cuts for photons and electrons were set at 0.5 mm and 1.0 mm, respectively. Results: In the energy spectra of emitting X-ray fluorescence, peaks from gold K shell characteristic x-rays (68.8 and 66.9 keV) were observed. The number of counts under the peaks of Ka1 and Ka2 was found to increase with the increasing of the gold concentrations in the mixture materials. The X-ray yields (for both Ka1 and Ka2) when fitted with least-square method as a function of gold concentration demonstrate a linear dependency with R{sup 2} > 0.96. The Ka1yield per incident proton was found to be 0.0016 for 10% gold-water mixture solutions. Conclusion: This preliminary study with PIXE technique with gold nanoparticle has demonstrated potentials for its utilization in the development of range and dose verification methodology that is currently of great interest in the field of proton radiation therapy.

  1. Beverage consumption habits “24/7” among British adults: association with total water intake and energy intake

    OpenAIRE

    Gibson Sigrid; Shirreffs Susan M

    2013-01-01

    Abstract Background Various recommendations exist for total water intake (TWI), yet it is seldom reported in dietary surveys. Few studies have examined how real-life consumption patterns, including beverage type, variety and timing relate to TWI and energy intake (EI). Methods We analysed weighed dietary records from the National Diet and Nutrition Survey of 1724 British adults aged 19–64 years (2000/2001) to investigate beverage consumption patterns over 24 hrs and 7 days and associations wi...

  2. Activities for Studying Ponds (Limnology), Grade Level 5-6. Environmental Education Series, Bulletin No. 247-D.

    Science.gov (United States)

    Montgomery County Public Schools, Rockville, MD.

    This bulletin is one in a series of environmental education activity guides for grades K-12, developed and field-tested by teachers in the Montgomery County (Maryland) Public Schools. Primarily for use in the middle grades four through six, the guides are not intended to constitute complete units in themselves. They are, rather, a compilation of…

  3. SU-E-J-247: Time Evolution of Radiation-Induced Lung Injury After Stereotactic Proton Therapy

    International Nuclear Information System (INIS)

    Purpose: Quantitative metrics to assess patient-specific radiation-induced lung injury have the potential to guide individualization of therapy and be early indicators of recurrence. Here we investigate computed tomography (CT) density changes in normal lung after stereotactic Proton Therapy. Methods: Participants in a phase-I clinical trial for stereotactic body radiation therapy (SBRT) with protons are analyzed on a rolling basis. The dataset includes 9 patients with 34 CT images to date. Follow-up images are registered to the planning CT using deformable image registration and the change in CT density is correlated to the dose to examine the time-evolution of Hounsfield Unit (HU) changes after large doses of proton radiation. Results: The lung density observed on the follow-up images increases significantly with dose for all dose levels above 5 Gy(RBE) (p<0.001) for 8/9 patients. The change per unit dose [HU/Gy] varies significantly among the patients, from 0.1 (for the one patient without significant correlation) to 5.7 ΔHU/Gy(RBE). The current population average of ΔHU/Gy(RBE) is 2.1, i.e. a 1 Gy(RBE) increase in dose leads on average to a 2.1 HU increase in CT density. The slope of the dose-response curve is constant for all timepoints investigated (from 3–24+ months). Additionally a pronounced non-linearity in the dose response curve is noted for long follow-up times (>18 months). Conclusion: CT density changes have a robust correlation with proton dose, quantitatively similar to photon dose, and may allow estimation of a patient’s intrinsic radiosensitivity after proton therapy. The stability of the correlation with time however diverges from what is known about CT response after photon irradiation. This could have important implications for clinical decision-making during proton therapy for lung cancer, especially for scheduling of follow-up CT/PET imaging and diagnosis of recurrence

  4. Book Buzz: Online 24/7: Virutal Reading Clubs and What We've Learned About Them

    Directory of Open Access Journals (Sweden)

    Catherine AuYeung

    2007-09-01

    Full Text Available This presentation, originally given at the Ontario Library Association 2007 SuperConference, was based on our experience at Toronto Public Library in developing the online book club site, Book Buzz. We have described our actual experience and what we have learned from it that may be useful for other start-ups. The presentation has been adapted here for a reading audience.Taking part in the presentation were a manager, an electronic services specialist, and a moderator - all librarians. We covered the project’s planning stages, the design phase, and, lastly, what is involved in the day-to-day running of the book club.

  5. Book Buzz: Online 24/7: Virutal Reading Clubs and What We've Learned About Them

    OpenAIRE

    Catherine AuYeung; Sheila Dalton; Sandra Gornall

    2007-01-01

    This presentation, originally given at the Ontario Library Association 2007 SuperConference, was based on our experience at Toronto Public Library in developing the online book club site, Book Buzz. We have described our actual experience and what we have learned from it that may be useful for other start-ups. The presentation has been adapted here for a reading audience.Taking part in the presentation were a manager, an electronic services specialist, and a moderator - all librarians. We cov...

  6. SU-E-J-247: Time Evolution of Radiation-Induced Lung Injury After Stereotactic Proton Therapy

    Energy Technology Data Exchange (ETDEWEB)

    Grassberger, C; Sharp, G; Fintelmann, F; Paganetti, H; Willers, H [Massachusetts General Hospital, Boston, MA (United States)

    2015-06-15

    Purpose: Quantitative metrics to assess patient-specific radiation-induced lung injury have the potential to guide individualization of therapy and be early indicators of recurrence. Here we investigate computed tomography (CT) density changes in normal lung after stereotactic Proton Therapy. Methods: Participants in a phase-I clinical trial for stereotactic body radiation therapy (SBRT) with protons are analyzed on a rolling basis. The dataset includes 9 patients with 34 CT images to date. Follow-up images are registered to the planning CT using deformable image registration and the change in CT density is correlated to the dose to examine the time-evolution of Hounsfield Unit (HU) changes after large doses of proton radiation. Results: The lung density observed on the follow-up images increases significantly with dose for all dose levels above 5 Gy(RBE) (p<0.001) for 8/9 patients. The change per unit dose [HU/Gy] varies significantly among the patients, from 0.1 (for the one patient without significant correlation) to 5.7 ΔHU/Gy(RBE). The current population average of ΔHU/Gy(RBE) is 2.1, i.e. a 1 Gy(RBE) increase in dose leads on average to a 2.1 HU increase in CT density. The slope of the dose-response curve is constant for all timepoints investigated (from 3–24+ months). Additionally a pronounced non-linearity in the dose response curve is noted for long follow-up times (>18 months). Conclusion: CT density changes have a robust correlation with proton dose, quantitatively similar to photon dose, and may allow estimation of a patient’s intrinsic radiosensitivity after proton therapy. The stability of the correlation with time however diverges from what is known about CT response after photon irradiation. This could have important implications for clinical decision-making during proton therapy for lung cancer, especially for scheduling of follow-up CT/PET imaging and diagnosis of recurrence.

  7. Synthesis of new heterocyclic compounds using 2-(4,7-dichloro-3,3-dimethyl-indolin-2-ylidenemalonaldehyde

    Directory of Open Access Journals (Sweden)

    Razieh Mohammadnejad Aghdam

    2013-01-01

    Full Text Available 1-(2,5-Dichlorophenylhydrazine was converted via Fischer synthesis with isopropylmethylketone into 4,7-dichloro-2,3,3-trimethyl-3H-indole. Exposure of the indolenine to the vilsmeier reagent produced amino methylene malondialdehyde which reacted with hydrazine, arylhydrazine, urea, cyanoacetamide and thiourea to give pyrazols, pyrimidones and thiopyrimidone, respectively.

  8. 17 CFR 247.772 - Exemption from the definition of “broker” for banks engaging in securities lending transactions.

    Science.gov (United States)

    2010-04-01

    ... the execution of the loan with the borrower; (2) Receiving, delivering, or directing the receipt or...)); or (2) Any employee benefit plan that owns and invests on a discretionary basis, not less than $...

  9. 17 CFR 247.760 - Exemption from definition of “broker” for banks accepting orders to effect transactions in...

    Science.gov (United States)

    2010-04-01

    ... a plan under 17 CFR 270.12b-1, from the bank, the executing broker or dealer, or any other person... transactions in securities for the account only as an accommodation to the customer; (2) Employee compensation...) of this section; and (ii) Responding to customer inquiries regarding the bank's safekeeping...

  10. 17 CFR 247.700 - Defined terms relating to the networking exception from the definition of “broker.”

    Science.gov (United States)

    2010-04-01

    ..., net worth, income, or marginal federal or state income tax rate, or any requirement for citizenship or... any other person. (c) Nominal one-time cash fee of a fixed dollar amount means a cash payment for...

  11. 17 CFR 247.721 - Defined terms relating to the trust and fiduciary activities exception from the definition of...

    Science.gov (United States)

    2010-04-01

    ... limitation, a fee paid for assessing investment performance or for reviewing compliance with applicable... executed by beneficial owners of investment company shares; (D) Based on the financial performance of the... shares; (3) Providing beneficial owners with account statements showing their purchases, sales,...

  12. 49 CFR 40.247 - What procedures does the BAT or STT follow after a screening test result?

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 1 2010-10-01 2010-10-01 false What procedures does the BAT or STT follow after a... What procedures does the BAT or STT follow after a screening test result? (a) If the test result is an alcohol concentration of less than 0.02, as the BAT or STT, you must do the following: (1) Sign and...

  13. Freeze drying method for preparing radiation source material

    International Nuclear Information System (INIS)

    Fabrication of a neutron source is specifically claimed. A palladium/californium solution is freeze dried to form a powder which, through conventional powder metallurgy, is shaped into a source containing the californium evenly distributed through a palladium metal matrix. (E.C.B.)

  14. Review of RBE and OER values for Cf-neutrons

    International Nuclear Information System (INIS)

    Californium-252, an isotope emitting neutrons, gamma photons and alpha particles, is being investigated for its practical use in intracavitary and interstitial brachytherapy. A review of published RBE and OER values for californium neutrons as a function of dose rate for a variety of biological endpoints is given. (Auth.)

  15. 17 CFR 247.740 - Defined terms relating to the sweep accounts exception from the definition of “broker.”

    Science.gov (United States)

    2010-04-01

    ... securities for sales or sales promotion expenses, for personal service, or for the maintenance of shareholder... investment company's securities for sales or sales promotion expenses, for personal service, or for the... sales load has the same meaning as in 17 CFR 270.6c-10. (b) Money market fund means an open-end...

  16. Erratum: International Journal of Global Energy Issues, Vol. 13, Nos. 1-3, 2000, p.247. Bent Soerensen and Peter Meibom 'A global renewable energy scenario'

    International Nuclear Information System (INIS)

    5.1 ecentralised renewable energy 2050 scenario. The demand categories have already, as shown in Table 6, been simplified under the assumption of an abundant fraction of the supply being in the form of electric energy. We now determine the sources of supply for each demand type. For the vegetable food-fraction, the results of comparing local supply and demand are shown in Figures 38 and 39, where Figure 38 shows the amount of surplus for those geographical grid cells, where supply exceeds demand, and Figure 39 shows the amount of deficit for those local cells where demand exceeds supply. Regional sums are given in Table 10, while the sums of individual contributions to demand and supply are given in Tables 6 and 8. It follows that on average, worldwide supply exceeds demand by 35%. This must be considered reasonable, as there has to be room for variations in crop harvests and thus food production from year to year, and further the transportation required for evening out supply and demand will entail some additional losses. Like today, there is surplus vegetable food production in the Americas and Western Europe (regions 1, 2 and 4), and by the year 2050 also in region 3 (including Russia), due to substantial improvements in agricultural practices assumed for this region. Region 5 (including China and India) will be just self-sufficient by the year 2050, whereas Africa (region 6) will have a deficit that must be covered by imports. In the scenario, Africa is the only region that by 2050 is in a development situation where it may offer labour at lower expense that the other regions, and thus there will be the possibility of paying for food imports by industrial revenues, provided that an education policy is pursued, that will give the workforce the necessary skills. In addition to inter-regional exchange, Figures 38 and 39 indicate scenario requirements for transport of vegetable food within regions, especially from farming areas into cities. The scenario assumptions for inter-regional trade in food is indicated in Figures 55-60, where the regional exports have been selected from the surpluses available. The substantial needs for both vegetable and animal foods in Africa are uniformly imported from regions 1-4. (author)

  17. Development of Abrasion-Resistant Coating for Solar Reflective Films. Cooperative Research and Development Final Report, CRADA Number CRD-07-247

    Energy Technology Data Exchange (ETDEWEB)

    Gray, Matthew [National Renewable Energy Lab. (NREL), Golden, CO (United States)

    2015-10-01

    The purpose of this CRADA is to develop an abrasion-resistant coating, suitable for use on polymeric-based reflective films (e.g., the ReflecTech reflective film), that allows for improved scratch resistance and enables the use of aggressive cleaning techniques (e.g., direct contact methods like brushing) without damaging the specular reflectance properties of the reflective film.

  18. Child Abuse Prevention and Treatment Act, 1974. Public Law 93-247 (S. 1191): Questions and Answers, Analysis, and Text of the Act.

    Science.gov (United States)

    Congress of the U.S., Washington, DC. Senate Committee on Labor and Public Welfare.

    This booklet contains questions and answers concerning the Child Abuse Prevention and Treatment Act, an analysis of the Act by the Congressional Research Service, and a copy of the actual text. The question and answer section provides information about the rationale for the Act, the amount of money available for its implementation, as well as its…

  19. Campylobacter-like organisms and Candida in peptic ulcers and similar lesions of the upper gastrointestinal tract: a study of 247 cases.

    OpenAIRE

    Kalogeropoulos, N K; Whitehead, R.

    1988-01-01

    Campylobacter-like organisms were detected by light microscopy in association with 57 of 102 (56%) of gastric ulcers, all the gastric erosions associated with gastritis, three of five (60%) of gastric erosions without gastritis, five of 13 (39%) of mild superficial gastritis and two of 36 (6%) of normal gastric mucosa. They were also seen in four of 20 (20%) of duodenal ulcers, but not in duodenal erosions with duodenitis or normal duodenal biopsy specimens. They were seen in association with...

  20. "I'm on it 24/7 at the moment" : A qualitative examination of multi-screen viewing behaviours among UK 10-11 year olds

    OpenAIRE

    Cillero Itziar; Gorely Trish; Sebire Simon J; Jago Russell; Biddle Stuart JH

    2011-01-01

    Abstract Background Screen-viewing has been associated with increased body mass, increased risk of metabolic syndrome and lower psychological well-being among children and adolescents. There is a shortage of information about the nature of contemporary screen-viewing amongst children especially given the rapid advances in screen-viewing equipment technology and their widespread availability. Anecdotal evidence suggests that large numbers of children embrace the multi-functionality of current ...

  1. 49 CFR 234.247 - Purpose of inspections and tests; removal from service of relay or device failing to meet test...

    Science.gov (United States)

    2010-10-01

    ... TRANSPORTATION GRADE CROSSING SIGNAL SYSTEM SAFETY AND STATE ACTION PLANS Maintenance, Inspection, and Testing... are required at highway-rail grade crossings located on in service railroad tracks and shall be...

  2. A 24.7-kDa copper-containing oxidase, secreted by Thermobifida fusca, significantly increasing the xylanase/cellulase-catalyzed hydrolysis of sugarcane bagasse.

    Science.gov (United States)

    Chen, Cheng-Yu; Hsieh, Zhi-Shen; Cheepudom, Jatuporn; Yang, Chao-Hsun; Meng, Menghsiao

    2013-10-01

    Thermobifida fusca is a moderately thermophilic soil bacterium belonging to Actinobacteria. It has been known for its capability to degrade plant cell wall polymers except lignin and pectin. To know whether it can produce enzymes to facilitate lignin degradation, the extracellular proteins bound to sugarcane bagasse were harvested and identified by liquid chromatography tandem mass spectrometry. Among the identified proteins, a putative copper-containing polyphenol oxidase of 241 amino acids, encoded by the locus Tfu_1114, was thought to presumably play a role in lignin degradation. This protein (Tfu1114) was thus expressed in E. coli and characterized. Similarly to common laccases, Tfu1114 is able to catalyze the oxidation reaction of phenolic and nonphenolic lignin related compounds such as 2,6-dimethoxyphenol and veratryl alcohol. More interestingly, it can significantly enhance the enzymatic hydrolysis of bagasse by xylanase and cellulase. Tfu1114 is stable against heat, with a half-life of 4.7 h at 90 °C, and organic solvents. It is sensitive to ethylenediaminetetraacetic acid and reducing agents but resistant to sodium azide, a potent inhibitor of laccases. Atomic absorption spectroscopy indicated that the ratio of copper to the protein monomer is 1, instead of 4, a feature of classical laccases. All these data suggest that Tfu1114 is a novel oxidase with laccase-like activity, potentially useful in biotechnology application. PMID:23377789

  3. "I'm on it 24/7 at the moment": A qualitative examination of multi-screen viewing behaviours among UK 10-11 year olds

    Directory of Open Access Journals (Sweden)

    Cillero Itziar

    2011-08-01

    Full Text Available Abstract Background Screen-viewing has been associated with increased body mass, increased risk of metabolic syndrome and lower psychological well-being among children and adolescents. There is a shortage of information about the nature of contemporary screen-viewing amongst children especially given the rapid advances in screen-viewing equipment technology and their widespread availability. Anecdotal evidence suggests that large numbers of children embrace the multi-functionality of current devices to engage in multiple forms of screen-viewing at the same time. In this paper we used qualitative methods to assess the nature and extent of multiple forms of screen-viewing in UK children. Methods Focus groups were conducted with 10-11 year old children (n = 63 who were recruited from five primary schools in Bristol, UK. Topics included the types of screen-viewing in which the participants engaged; whether the participants ever engaged in more than one form of screen-viewing at any time and if so the nature of this multiple viewing; reasons for engaging in multi-screen-viewing; the room within the house where multi-screen-viewing took place and the reasons for selecting that room. All focus groups were transcribed verbatim, anonymised and thematically analysed. Results Multi-screen viewing was a common behaviour. Although multi-screen viewing often involved watching TV, TV viewing was often the background behaviour with attention focussed towards a laptop, handheld device or smart-phone. There were three main reasons for engaging in multi-screen viewing: 1 tempering impatience that was associated with a programme loading; 2 multi-screen facilitated filtering out unwanted content such as advertisements; and 3 multi-screen viewing was perceived to be enjoyable. Multi-screen viewing occurred either in the child's bedroom or in the main living area of the home. There was considerable variability in the level and timing of viewing and this appeared to be a function of whether the participants attended after-school clubs. Conclusions UK children regularly engage in two or more forms of screen-viewing at the same time. There are currently no means of assessing multi-screen viewing nor any interventions that specifically focus on reducing multi-screen viewing. To reduce children's overall screen-viewing we need to understand and then develop approaches to reduce multi-screen viewing among children.

  4. The results of sentinel lymph node imaging and biopsy with a novel lymphoscintigraphy agent 99Tcm-Rituximab in 247 breast cancer patients

    International Nuclear Information System (INIS)

    Objective: The feasibility, reliability and influence factors of sentinel lymph node (SLN) imaging and biopsy with a new imaging agent 99Tcm-Rituximab were investigated in 467 breast cancer patients. Methods: The SLN imaging was taken after peritumoral and subdermal injection of 99Tcm-Rituximab guided by ultrasound. Based on the image, the SLN were identified by a gamma probe and removed, the resected SLN were examined pathologically with both HE and immunohistochemical staining. Results: The success rate of SLN imaging was 99.14% (463/467). A total 837 SLN (1.79 per case) were visualized, which located in axilla, internal mammary, subraclavicular and breast region. The success rate of SLN biopsy (SLNB) was 99.57% (465/467), a total 1182 SLN (2.53 per case) were identified. Pathological examination showed that there were 131 patients with 194 metastatic axillary SLN; one case of micrometastases was confirmed by immunohistochemical staining, whose result of HE staining was negative. The following factors, such as age, image time, biopsy history, pathologic type and clinical stage, had no effect on the results of SLN imaging and SLNB. But the SLN metastasis rates were different in patients with different pathologic type and clinical stage(χ2=14.134, 29.184, all P99Tcm-Rituximab showed potential in both SLN imaging and identification in breast cancer patients. (authors)

  5. Unveiling stomata 24/7: can we use carbonyl sulfide (COS) and oxygen isotopes (18O) to constrain estimates of nocturnal transpiration across different evolutionary plant forms?

    Science.gov (United States)

    Gimeno, Teresa E.; Ogee, Jerome; Bosc, Alexander; Genty, Bernard; Wohl, Steven; Wingate, Lisa

    2015-04-01

    Numerous studies have reported a continued flux of water through plants at night, suggesting that stomata are not fully closed. Growing evidence indicates that this nocturnal flux of transpiration might constitute an important fraction of total ecosystem water use in certain environments. However, because evaporative demand is usually low at night, nocturnal transpiration fluxes are generally an order of magnitude lower than rates measured during the day and perilously close to the measurement error of traditional gas-exchange porometers. Thus estimating rates of stomatal conductance in the dark (gnight) precisely poses a significant methodological challenge. As a result, we lack accurate field estimates of gnight and how it responds to different atmospheric drivers, indicating the need for a different measurement approach. In this presentation we propose a novel method to obtain detectable and robust estimates of gnight. We will demonstrate using mechanistic theory how independent tracers including the oxygen isotope composition of CO2 (δ18O) and carbonyl sulfide (COS) can be combined to obtain robust estimates of gnight. This is because COS and CO18O exchange within leaves are controlled by the light insensitive enzyme carbonic anhydrase. Thus, if plant stomata are open in the dark we will continue to observe COS and CO18O exchange. Using our theoretical model we will demonstrate that the exchange of these tracers can now be measured using advances in laser spectrometry techniques at a precision high enough to determine robust estimates of gnight. We will also present our novel experimental approach designed to measure simultaneously the exchange of CO18O and COS alongside the conventional technique that relies on measuring the total water flux from leaves in the dark. Using our theoretical approach we will additionally explore the feasibility of our proposed experimental design to detect variations in gnight during drought stress and across a variety of plant types that have evolved diverse strategies to control water loss from leaf tissues.

  6. Improvement activities to soil stabilization near Bolivia-Brazil gas pipeline crossing through an embankment over a corrugated drainage pipe, at Km 247 in Mato Grosso do Sul, Brazil; Melhorias para estabilidade do gasoduto Bolivia-Brasil em cruzamento de aterro sobre tubo de drenagem tipo ARMCO, no km 247 em Mato Grosso do Sul

    Energy Technology Data Exchange (ETDEWEB)

    Jorge, Kemal Vieira [TBG - Transportadora Brasileira Gasoduto Bolivia Brasil S.A., Rio de Janeiro, RJ (Brazil); Costa, Cesar Augusto [TBG - Transportadora Brasileira Gasoduto Bolivia Brasil S.A., Campo Grande, MS (Brazil). Gerencia Regional Centro Oeste (CRGO)

    2005-07-01

    A hundred and seventy kilometers from Campo Grande city, on Mato Grosso do Sul State, the Brasil-Bolivia Gas Pipeline crosses a 8,5 meters high landfill, over a drainage systems made of a 2,8 meters of diameter corrugated pipe. This drainage pipe was installed to allow the drainage of the valley, and the landfill above it was built so the Gas pipeline could cross easier the 80 meters deep and 30 degree vertices valley. This paper illustrates the work tasks and solutions taken to monitor and guarantee the integrity of the drainage and landfill structures, as well as the integrity of the Gas Pipeline. Some of the work tasks illustrated are the investigation of the support conditions of the Gas Pipeline, the analysis of a drainage system under the pipeline, on a rocky soil, the analysis of the stability of the landfill, the construction of a gravity retaining walls and the monitoring of the deformations on the drainage pipe. (author)

  7. Exigência de cálcio para codornas japonesas (coturnix coturnix japonica em postura - DOI: 10.4025/actascianimsci.v29i1.247 Calcium requirement for japanese quails (Coturnix coturnix japonica in the laying phase - DOI: 10.4025/actascianimsci.v29i1.247

    Directory of Open Access Journals (Sweden)

    Jocelyn Santiago Brandão

    2007-11-01

    Full Text Available Realizou-se este experimento com o objetivo de determinar as exigências de cálcio de codornas japonesas em postura. Foram utilizadas 105 codornas, distribuídas em sete tratamentos, com três repetições. Os tratamentos consistiram em uma ração basal suplementada com calcário calcítico para alcançar sete níveis de cálcio (2,95; 3,10; 3,25; 3,40; 3,55; 3,70 e 3,85%. As variáveis avaliadas foram: consumo de ração (CR, produção de ovos (PD, massa de ovos (MO, conversão por massa de ovos (CMO, conversão por dúzia de ovos (CDO, peso do ovo (PO, peso e percentagem de gema, albúmem e casca e gravidade específica. O CR e CMO não foram influenciados pelos níveis de cálcio na dieta. A PD, MO e CDO sofreram efeito quadrático dos níveis de cálcio, sendo os valores máximos para estas variáveis estimados com os níveis de 3,45; 3,51 e 3,34% de cálcio. O PO aumentou linearmente com os níveis de cálcio na dieta. Foi verificado efeito quadrático dos níveis de cálcio sobre o peso e percentagem do albúmem e gema e gravidade específica. Recomendase para codornas japonesas o nível de 3,51% de cálcio da ração para a otimização dos índices de desempenho sem afetar negativamente a qualidade interna e externa dos ovos.This trial was performed to determine the requirements of calcium for Japanese quails during the laying period. A hundred and five quails were distributed in seven treatments and three repetitions. The treatments consisted of a basal diet supplemented with limestone in order to produce seven calcium levels (2.95; 3.10; 3.25; 3.40; 3.55; 3.70 and 3.85%. The following variables were evaluated: feed intake (CR, egg production (PD, egg mass (MO, conversion per egg mass (CMO, conversion per egg dozen (CDO, egg weight (PO, the weights and percentages of yolk, albumen and shell, and specific gravity. Calcium levels in the diet had no effect on CR and CMO. On the other hand, there was quadratic effect on PD, MO and CDO, and the maximum levels for these variables were estimated with calcium levels of 3.45; 3.51 and 3.34%, respectively. PO increased linearly with calcium levels in the diet. A quadratic effect of calcium levels was seen on the specific gravity and on weight and percentage of albumen and yolk. Calcium levels of 3.51% are recommended for Japanese quails during the laying period in order to optimize performance indexes without affecting negatively the internal and external egg quality.

  8. A new shipping container for an intense neutron emitter

    International Nuclear Information System (INIS)

    Californium-252 is an intense neutron emitter (2.34 x 1012 n/s·g) used in medicine, research, and industry. The western world's sole source of this rare radioisotope is the Californium Facility at Oak Ridge National Laboratory's Radiochemical Engineering Development Center (REDC). A project has been initiated at the REDC to design a new Type B Californium Shipping Container. This effort is essential for future transportation of californium to meet the needs of users all over the world. The shipping container must meet all requirements for transport by motor freight, air, vessel, and rail, both domestic and foreign. There are unique problems in the design, fabrication, and licensing of a new Type B shipping container that will accommodate up to 60 milligrams of californium-252. One of the first challenges in the design phase of the project is the selection of a material to shield the high neutron flux. The more stringent safety precautions of today's world impel us to consider more exotic materials for such a purpose. The candidate materials must be examined not just for their neutron shielding properties, but also in conjunction with other properties such as thermal and structural requirements to withstand the hypothetical accident conditions. The design and building of such a container is a formidable task requiring much planning. The licensing process, with the complex, interactive federal codes, is a special challenge and may be the biggest on the project in terms of time and money

  9. Application of Cf for the quantitative measurement of nuclear reactor fuel materials

    International Nuclear Information System (INIS)

    Sensitive and rapid measurements of the quantity and geometric distribution of nuclear reactor fuel materials can be made using neutrons from californium. The neutron-induced fission rate in these materials may be measured by detection of either prompt radiations from fission or delayed radiations from radioactive fission products. A number of californium-based instruments are presently in use by the nuclear industry for purposes of process control, quality control, nuclear materials safeguards, and environmentl assessment. An Automated Fuel Rod Scanner (AFRS) is used for high-speed measurement of the uniformity of loading and total fissile content of reactor fuel rods. The fuel rods are moved first through an irradiator containing about 1 mg of californium, and subsequently through high-efficiency detectors for the measurement of fission-product gamma-rays. Multiple detectors on each of two irradiation channels are used to reduce the californium source strength requirement. The fuel loading of each 15-mm-long pellet is tested to +-10% on 100% of the plant throughput. By summing the response over length, the total fissile material content of the fuel rod is measured to better than 0.5%. An on-line computer for data processing allows the instrument to measure about 150 rods per hour with a single operator. The same activation concept is used with a 25-μg californium source in a Small Sample Assay System (SSAS) which measures the fissile content of fuel pellet sized samples with a precision of 0.5%

  10. Building the Virtual Reference Desk in a 24/7 World. OCLC/Library of Congress Symposium at ALA Midwinter 2001 (Washington, DC, January 12, 2001). Tape 1 [and] Tape 2. [Videotapes].

    Science.gov (United States)

    Library of Congress, Washington, DC.

    With the emergence of Web help services, libraries are no longer the lone providers of information. Today's researchers need to find quickly information that is usable, relevant, authoritative, and verifiable. To meet that need, libraries must adapt traditional strengths of acquiring, describing, and serving information to an environment that is…

  11. Missense mutations in PBP2A Affecting ceftaroline susceptibility detected in epidemic hospital-acquired methicillin-resistant Staphylococcus aureus clonotypes ST228 and ST247 in Western Switzerland archived since 1998

    OpenAIRE

    Kelley, William; Jousselin, Ambre; Barras, Christine; Lelong, Emmanuelle; Renzoni, Adriana Maria

    2015-01-01

    The development and maintenance of an arsenal of antibiotics is a major health care challenge. Ceftaroline is a new cephalosporin with activity against methicillin-resistant Staphylococcus aureus (MRSA); however, no reports concerning MRSA ceftaroline susceptibility have been reported in Switzerland. We tested the in vitro activity of ceftaroline against an archived set of 60 MRSA strains from the University Hospital of Geneva collected from 1994 to 2003. Our results surprisingly revealed cef...

  12. Application of PGNAA to preincineration assay of combustible waste for chlorine

    Energy Technology Data Exchange (ETDEWEB)

    Gehrke, R.J.; Pawelko, R.J.; Greenwood, R.C. [Idaho National Engineering Lab., Idaho Falls, ID (United States)

    1995-12-31

    A prompt gamma neutron activation analysis method is being developed for on-stream pre-incineration assay of low level radioactive combustible waste for it`s chlorine content. The assay system consists of three californium 252 sources and a germanium or scintillation gamma-ray spectrometer.

  13. Magnetic measurements of the transuranium elements. Progress report, January 1, 1984-December 31, 1984

    International Nuclear Information System (INIS)

    Measurements of the magnetic properties of dhcp californium-249 metal indicated the presence of three regions of differing magnetic character. Additional measurements are also reported. Magnetic moments and valence states of terbium in TbF3, BaTbO3, and TbO18 are discussed. Progress on high-field operation of the micro-magnetic susceptometer is reported

  14. Source storage and transfer cask: Users Guide

    International Nuclear Information System (INIS)

    The storage and shield cask for the dual californium source is designed to shield and transport up to 3.7 mg (2 Ci) of 252Cf. the cask meets Department of Transportation (DOT) license requirements for Type A materials (DOT-7A). The cask is designed to transfer sources to and from the Flourinel and Fuel Storage (FAST) facility delayed-neutron interrogator. Californium sources placed in the cask must be encapsulated in the SR-CF-100 package and attached to Teleflex cables. The cask contains two source locations. Each location contains a gear box that allows a Teleflex cable to be remotely moved by a hand crank into and out of the cask. This transfer procedure permits sources to be easily removed and inserted into the delayed-neutron interrogator and reduces personnel radiation exposure during transfer. The radiation dose rate with the maximum allowable quantity of californium (3.7 mg) in the cask is 30 mR/h at the surface and less than 2 mR/h 1 m from the cask surface. This manual contains information about the cask, californium sources, describes the method to ship the cask, and how to insert and remove sources from the cask. 28 figs

  15. Discovery of Isotopes of the Transuranium Elements with 93 <= Z <= 98

    OpenAIRE

    Fry, C; Thoennessen, M

    2012-01-01

    One hundred and five isotopes of the transuranium elements neptunium, plutonium, americium, curium, berkelium and californium have so far been observed; the discovery of these isotopes is discussed. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  16. Learning by bidding: evidence from a large-scale natural experiment

    Czech Academy of Sciences Publication Activity Database

    Hanousek, Jan; Kočenda, Evžen

    -, č. 247 (2005), s. 1-33. ISSN 1211-3298 Institutional research plan: CEZ:AV0Z70850503 Keywords : learning * natural experiment * auction Subject RIV: AH - Economics http://www.cerge-ei.cz/pdf/wp/Wp247.pdf

  17. Oxidation of microquantities of transplutonium elements to tetravalent state in mineral acid solutions and their stability

    International Nuclear Information System (INIS)

    Kinetics of americium(3) microquantity oxidation and stability of forming americium(4), as well as possibility of curium and californium oxidation to tetravalent state in solutions of sulfuric and nitric acids depending on the concentration of mineral acid, potassium tungstophosphate and ammonium persulfate are studied by the extraction method. It is shown that curium(3) and californium(3) in solutions of 0.05-2.5 mol/l H2SO4 and HNO3 containing 10-3 mol/l potassium tungstophosphate is not practically oxidized by the mixture of silver nitrate and ammonium persulfate. Americium(3) is oxidized to the utmost to Am(4) for 2-3 min at room temperature, but stability of Am(4) depends on the concentration of sulfuric acid and potassium tungstophosphate

  18. Characterization of berkelium(III) dipicolinate and borate compounds in solution and the solid state.

    Science.gov (United States)

    Silver, Mark A; Cary, Samantha K; Johnson, Jason A; Baumbach, Ryan E; Arico, Alexandra A; Luckey, Morgan; Urban, Matthew; Wang, Jamie C; Polinski, Matthew J; Chemey, Alexander; Liu, Guokui; Chen, Kuan-Wen; Van Cleve, Shelley M; Marsh, Matthew L; Eaton, Teresa M; van de Burgt, Lambertus J; Gray, Ashley L; Hobart, David E; Hanson, Kenneth; Maron, Laurent; Gendron, Frédéric; Autschbach, Jochen; Speldrich, Manfred; Kögerler, Paul; Yang, Ping; Braley, Jenifer; Albrecht-Schmitt, Thomas E

    2016-08-26

    Berkelium is positioned at a crucial location in the actinide series between the inherently stable half-filled 5f(7) configuration of curium and the abrupt transition in chemical behavior created by the onset of a metastable divalent state that starts at californium. However, the mere 320-day half-life of berkelium's only available isotope, (249)Bk, has hindered in-depth studies of the element's coordination chemistry. Herein, we report the synthesis and detailed solid-state and solution-phase characterization of a berkelium coordination complex, Bk(III)tris(dipicolinate), as well as a chemically distinct Bk(III) borate material for comparison. We demonstrate that berkelium's complexation is analogous to that of californium. However, from a range of spectroscopic techniques and quantum mechanical calculations, it is clear that spin-orbit coupling contributes significantly to berkelium's multiconfigurational ground state. PMID:27563098

  19. Neutron activation determination of gold in technogenic raw materials with different mineral composition

    OpenAIRE

    Yudakov Aleksandr A.; Ivannikov Sergey I.; Zheleznov Veniamin V.; Taskin Andrei V.; Tsybulskaya Oksana N.

    2015-01-01

    The methods used to determine the gold content in the technogenic objects of gold mining were analyzed regarding their non-homogeneity and complexity of chemical and mineral compositions. A possible application of the neutron activation analysis with the use of the californium source of neutrons for determining the content of fine-grained and extra-fine-grained gold in the technogenic objects, including the bottom-ash waste of energy providers, is considere...

  20. Jak bylo objeveno spontánní štěpení

    Czech Academy of Sciences Publication Activity Database

    Vobecký, Miloslav

    Praha: Spektroskopická společnost J.M. Marci, 2010 - (Vobecký, M.), s. 5-10 ISBN 978-80-904539-0-6. [Seminář Radioanalytické metody IAA 10. Praha (CZ), 30.06.2010-01.07.2010] Institutional research plan: CEZ:AV0Z40310501 Keywords : spontaneous fission * fission -track dating method * californium 252 neutron source Subject RIV: CB - Analytical Chemistry, Separation

  1. Study of heavy particle decay from superheavy elements by SK model

    International Nuclear Information System (INIS)

    Heavy nuclei usually decay by alpha decay or spontaneous fission. These two decay modes are generally the most probable competing processes. Another less probable decay process is cluster radioactivity in which nuclei from carbon to silicon are emitted from Radium to Californium leading to the most stable daughter nucleus, lead. This work reports such a study using the cubic plus Yukawa plus exponential model of Shanmugam and Kamalaharan (SK)

  2. Measurement of the energy spectra of fission fragments using nuclear track detectors and digital image processing

    International Nuclear Information System (INIS)

    Energy spectra of fission fragments were determined using a Nuclear Track Methodology (NTM) supported by digital image analysis and numerical data processing using a standard personal computer. The analysis of a californium (252Cf) spectrum with this approach shows improvement compared with the values reported previously using the standard procedure, in terms of resolution and accuracy. This new method adds full automation to the technical advantages and cost effectiveness of an NTM.

  3. Heavy ion tests on programmable VLSI

    International Nuclear Information System (INIS)

    The radiation from space environment induces operation damages in onboard computers systems. The definition of a strategy, for the Very Large Scale Integrated Circuitry (VLSI) qualification and choice, is needed. The 'upset' phenomena is known to be the most critical integrated circuit radiation effect. The strategies for testing integrated circuits are reviewed. A method and a test device were developed and applied to space applications candidate circuits. Cyclotron, synchrotron and Californium source experiments were carried out

  4. Properties of neutron sources

    International Nuclear Information System (INIS)

    The Conference presentations were divided into sessions devoted to the following topics: white neutron sources, primarily pulsed (6 papers); fast neutron fields (5 papers); Californium-252 prompt fission neutron spectra (14 papers); monoenergetic sources and filtered beams (11 papers); 14 MeV neutron sources (10 papers); selected special application (one paper); and a general interest session (4 papers). Individual abstracts were prepared separately for the papers

  5. Neutron multiplicities for the transplutonium nuclides

    International Nuclear Information System (INIS)

    This paper continues, with respect to the transplutonium nuclides, earlier efforts to collate and evaluate data from the scientific literature on the prompt neutron multiplicity distribution from fission and its first moment = ΣnuPnu. The isotopes considered here for which P/sub nu/ and or data (or both) were found in the literature are of americium (Am), curium (Cm), berkelium (Bk), californium (Cf), einsteinium (Es), fermium (Fm), and nobelium (No)

  6. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFC247 (Link to dictyBase) - - - Contig-U16444-1 VFC247P (Link... to Original site) VFC247F 353 VFC247Z 590 VFC247P 943 - - Show VFC247 Library VF (Link to library) Clone ID VFC247 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16444-1 Original site URL http://dict...ences producing significant alignments: (bits) Value N AC116978 |AC116978.1 Dicty...ostelium discoideum chromosome 2 map 4846697-4874480 strain AX4, *** SEQUENCING IN PROGRESS ***. 1049 0.0 3 AC117076 |AC117076.2 Dict

  7. Antonio Maria Baggio (ed.), Adriana Cossedu, Paolo Giusta, Rodrigo Mardones Z. y Antonio Márquez Prieto, Caino e i suoi fratelli. Il fondamento relazionale nella politica e nel diritto, Città Nuova, Roma, 2012, 247 págs.

    OpenAIRE

    María Salas Porras

    2013-01-01

    Los estudios recogidos en este volumen intentan reinterpretar los fundamentos de la Política y del Derecho, enmarcados en el horizonte relacional que la fraternidad les abre. Desde esta perspectiva, la fraternidad asume una relevancia política y jurídica en la medida en que se la entienda sustancialmente ligada a la libertad y a la igualdad. Cada una de las tres categorías, en la medida en que sean consideradas conjuntamente, llegan a adquirir su propio significado a través de la relación con...

  8. Antonio Maria Baggio (ed., Adriana Cossedu, Paolo Giusta, Rodrigo Mardones Z. y Antonio Márquez Prieto, Caino e i suoi fratelli. Il fondamento relazionale nella politica e nel diritto, Città Nuova, Roma, 2012, 247 págs.

    Directory of Open Access Journals (Sweden)

    María Salas Porras

    2013-03-01

    Full Text Available Los estudios recogidos en este volumen intentan reinterpretar los fundamentos de la Política y del Derecho, enmarcados en el horizonte relacional que la fraternidad les abre. Desde esta perspectiva, la fraternidad asume una relevancia política y jurídica en la medida en que se la entienda sustancialmente ligada a la libertad y a la igualdad. Cada una de las tres categorías, en la medida en que sean consideradas conjuntamente, llegan a adquirir su propio significado a través de la relación con las otras. El redescubrimiento de la fraternidad significa por tanto volver a proponer el "tríptico" entero, para recuperar, a través del mismo, el proyecto humanísitico de la modernidad, y liberarnos del destino del conflicto radical al que nuestro tiempo parece condenado: Caín no sólo ha matado a su hermano, sino que también ha fundado la primera ciudad, es decir, el lugar donde la violencia se ve confinada por el gobierno y por las leyes. Abrir el Derecho al horizonte de la fraternidad significa, hoy, llevar la racionalidad jurídica más allá de la mera racionalidad técnica; permitir renovar la relación jurídica, volver a encontrar sus fundamentos humanísticos, redescubriendo una justicia que reconcilia y reconstruye, fortificando el vínculo social. Considerar la fraternidad una categoría política significa poder emitir juicios políticos, capaces de producir un pensamiento político a través de la óptica de la fraternidad; se abandonan así las lógicas de la ideología, para intentar construir una forma de pensamiento en disposición de pasar, de una idea intuitiva de fraternidad, a una definición que la haga operativa, "operacionalizable". Es una tarea que no corresponde hoy a una sola disciplina, sino que interesa a todo el conjunto de los ya numerosos estudiosos que se han enrolado en este frente, interactuando entre sí de manera interdisiciplinar y abriendo un camino en el cual resulte posible, a todos los que han abrazado un humanismo y un ideal político, encontrar las mejores razones de su esperanza.

  9. ‘A dialogue about the art of portraiture’ Originally published as ‘Gespräch von der Bildniskunst’, Österreichische Rundschau, Volume 6, 1906, 502—516, and republished: Julius Schlosser, Präludien Vorträge und Aufsätze, Berlin: Bard 1927, 227—247. Translated with an introduction by Karl Johns

    Directory of Open Access Journals (Sweden)

    Julius Schlosser

    2011-12-01

    Full Text Available In an unusually popular and readable dialogue form, Schlosser alludes to the classical education he takes for granted in any reader approaching his favourite ‘thorny’ questions from aesthetics and history. These involve the problems of naturalism, impressionism, portrait likeness, psychology of perception and numerous others being bandied around academic circles at the turn of the century. It is of further interest in directly referring critically to his recently deceased friend (Alois Riegl, and being written just at a moment in his career when Schlosser had been casting around the ideas of Ernst Brücke, Konrad Lange, even Henri Bergson, but had discovered the recent contribution of Benedetto Croce, which would colour his approach with an increasing intensity for the remainder of his life. He became what might be seen as the archetypical art historical theorist, but continues to distinguish himself from his successors by his greater consistency.

  10. ‘A dialogue about the art of portraiture’ Originally published as ‘Gespräch von der Bildniskunst’, Österreichische Rundschau, Volume 6, 1906, 502—516, and republished: Julius Schlosser, Präludien Vorträge und Aufsätze, Berlin: Bard 1927, 227—247. Translated with an introduction by Karl Johns

    OpenAIRE

    Julius Schlosser

    2011-01-01

    In an unusually popular and readable dialogue form, Schlosser alludes to the classical education he takes for granted in any reader approaching his favourite ‘thorny’ questions from aesthetics and history. These involve the problems of naturalism, impressionism, portrait likeness, psychology of perception and numerous others being bandied around academic circles at the turn of the century. It is of further interest in directly referring critically to his recently deceased friend (Alois Riegl)...

  11. Dependence of metal partition coefficients in D2EHPA capacity on extraction from acid solutions

    International Nuclear Information System (INIS)

    In devising solvent-extraction schemes for extracting the transplutonium elements (TPE), one usually employs the partition coefficients K/sub p/ for trace amounts; when the results are transferred to weighable amounts of the elements, there are difficulties because one lacks capacity characteristics for the extractants under the conditions used. They have determined the capacity of D2EHPA over a wide range in acidity (0.001-2 mole/liter) in relation to dysprosium (the analog of californium) in the system formed by D2EHPA with nitric acid by saturating a set volume of the extractant with dysprosium in nitric acid containing the necessary amount of free acid

  12. TOWARD AN IMPROVED UNDERSTANDING OF STRUCTURE AND MAGNETISM IN NEPTUNIUM AND PLUTONIUM PHOSPHONATES AND SULFONATES

    Energy Technology Data Exchange (ETDEWEB)

    Albrecht-Schmitt, Thomas

    2012-03-01

    This grant supported the exploratory synthesis of new actinide materials with all of the actinides from thorium to californium with the exceptions of protactinium and berkelium. We developed detailed structure-property relationships that allowed for the identification of novel materials with selective ion-exchange, selective oxidation, and long-range magnetic ordering. We found novel bonding motifs and identified periodic trends across the actinide series. We identified structural building units that would lead to desired structural features and novel topologies. We also characterized many different spectroscopic trends across the actinide series. The grant support the preparation of approximately 1200 new compounds all of which were structurally characterized.

  13. NONDESTRUCTIVE IDENTIFICATION OF CHEMICAL WARFARE AGENTS AND EXPLOSIVES BY NEUTRON GENERATOR-DRIVEN PGNAA

    International Nuclear Information System (INIS)

    Prompt gamma-ray neutron activation analysis (PGNAA) is now a proven method for the identification of chemical warfare agents and explosives in military projectiles and storage containers. Idaho National Laboratory is developing a next-generation PGNAA instrument based on the new Ortec Detective mechanically-cooled HPGe detector and a neutron generator. In this paper we review PGNAA analysis of suspect chemical warfare munitions, and we discuss the advantages and disadvantages of replacing the californium-252 radioisotopic neutron source with a compact accelerator neutron generator

  14. NONDESTRUCTIVE IDENTIFICATION OF CHEMICAL WARFARE AGENTS AND EXPLOSIVES BY NEUTRON GENERATOR-DRIVEN PGNAA

    Energy Technology Data Exchange (ETDEWEB)

    T. R. Twomey; A. J. Caffrey; D. L. Chichester

    2007-02-01

    Prompt gamma-ray neutron activation analysis (PGNAA) is now a proven method for the identification of chemical warfare agents and explosives in military projectiles and storage containers. Idaho National Laboratory is developing a next-generation PGNAA instrument based on the new Ortec Detective mechanically-cooled HPGe detector and a neutron generator. In this paper we review PGNAA analysis of suspect chemical warfare munitions, and we discuss the advantages and disadvantages of replacing the californium-252 radioisotopic neutron source with a compact accelerator neutron generator.

  15. Composition containing transuranic elements for use in the homeopathic treatment of aids

    International Nuclear Information System (INIS)

    A homeopathic remedy consisting of a composition containing one or more transuranic elements, particularly plutonium, for preventing and treating acquired immunodeficiency syndrome (AIDS) in humans, as well as seropositivity for human immunodeficiency virus (HIV). Said composition is characterized in that it uses any chemical or isotopic form of one or more transuranic elements (neptunium, plutonium, americium, curium, berkelium, californium or einsteinium), particularly plutonium, said form being diluted and dynamized according to conventional homeopathic methods, particularly the so-called Hahnemann and Korsakov methods, and provided preferably but not exclusively in the form of lactose and/or saccharose globules or granules impregnated with the active principle of said composition. (author)

  16. Neutron nondestructive essay of the plutonium metal parts

    International Nuclear Information System (INIS)

    Based on the principle of neutron multiplicity and data unfolding mathematics, this paper developed the software which can execute the neutron multiplicity analysis, neutron attenuation analysis, parameter calibration, Pu mass solution with the neutron pulse sequence acquisition method. The measurement system consisted of detector,nuclear electronic apparatus, pulsed sequence acquisition and analysis software was tested and calibrated by californium source. Three mental plutonium components with different mass were used for experimental assay and validation, which showed that the assay bias was within 15% against the nominal value of the samples. (authors)

  17. Physical-chemical studies of transuranium elements. Progress report, April 1, 1982-March 31, 1983

    International Nuclear Information System (INIS)

    Progress is reported on the following topics: electrochemical and spectroscopic studies of less-stable higher oxidation states of transuranium elements in complexing aqueous media; spectroscopic and electrochemical studies of selected lanthanides and actinides in molten dimethyl sulfone; spectroelectronchemical studies of the Ce(IV)/Ce(III) couple in aqueous carbonate solutions; characterization of actinide orthophosphates by Raman and absorption spectrophotometries and by x-ray diffraction; relativistic multiple scattering calculations on transuranium element compounds; Raman spectroscopic studies of natural minerals containing the uranyl ion; and solution calorimetry of californium metal

  18. Transuranium element production. II. Chemical processing of targets

    International Nuclear Information System (INIS)

    The chemical processing described concerns small experimental targets irradiated in OSIRIS or EL-III and industrial targets irradiated in the CELESTIN reactors. In view of the difficulties encountered when processing highly irradiated targets (760MWd.kg-1) by liquid-liquid extraction (interface sludges leading to stable emulsion) the new processes developed are based on inverse phase chromatography. This technique applied to targets of americium 241, plutonium 239 and a plutonium mixture rich in isotope 242 has given tens of milligrams of curium 242, grams of americium 243 and curium 244 and micrograms of californium 252

  19. Detection of rare earth elements in Powder River Basin sub-bituminous coal ash using laser-induced breakdown spectroscopy (LIBS)

    Energy Technology Data Exchange (ETDEWEB)

    Tran, Phuoc [National Energy Technology Lab. (NETL), Pittsburgh, PA, (United State; Mcintyre, Dustin [National Energy Technology Lab. (NETL), Pittsburgh, PA, (United State

    2015-10-01

    We reported our preliminary results on the use of laser-induced breakdown spectroscopy to analyze the rare earth elements contained in ash samples from Powder River Basin sub-bituminous coal (PRB-coal). We have identified many elements in the lanthanide series (cerium, europium, holmium, lanthanum, lutetium, praseodymium, promethium, samarium, terbium, ytterbium) and some elements in the actinide series (actinium, thorium, uranium, plutonium, berkelium, californium) in the ash samples. In addition, various metals were also seen to present in the ash samples

  20. Radiation protection data sheet. Radiation protection data sheets for the use of radionuclides in unsealed sources

    International Nuclear Information System (INIS)

    These radiation protection data sheet are devoted to responsible persons and employees of various laboratories or medical, pharmaceutical, university and industrial departments where radionuclides are handled as well as all the persons who attend to satisfy in this field. They contain the essential radiation protection data for the use of unsealed sources: physical characteristics, risk assessment, administrative procedures, recommendations, regulations and bibliography. This new series includes the following radionuclides: californium 252, curium 244, gallium 67, indium 113m, plutonium 238, plutonium 239, polonium 210, potassium 42, radium 226, thorium 232, uranium 238 and zinc 65. (O.M.)

  1. Study by thermochromatography of fluorides of transuranium elements

    International Nuclear Information System (INIS)

    Thermochromatography was made suitable for fluoride study. So, an investigation of actinide tetrafluorides was accomplished from uranium to californium. Pentavalent and hexavalent fluorospecies of uranium, neptunium, plutonium and ruthenium were studied. Some new compounds have been identified in gaseous phase, whose: PuF5, PuOF3 and PaOF3. Furthermore, some presomptions as for the existence in gaseous phase of EsF4 and of an heptavalent fluorospecies of plutonium have been established. An important analogy between plutonium and ruthenium behaviour with fluorine have been shown, these results could explain the difficulties encountered in the fluoride-volatility processes

  2. PROCEEDINGS OF THE SYMPOSIUM COMMEMORATING THE 25th ANNIVERSARY OF ELEMENTS 97 and 98 HELD ON JAN. 20, 1975

    Energy Technology Data Exchange (ETDEWEB)

    Seaborg, Glenn T.; Street Jr., Kenneth; Thompson, Stanley G.; Ghiorso, Albert

    1976-07-01

    This volume includes the talks given on January 20, 1975, at a symposium in Berkeley on the occasion of the celebration of the 25th anniversary of the discovery of berkelium and californium. Talks were given at this symposium by the four people involved in the discovery of these elements and by a number of people who have made significant contributions in the intervening years to the investigation of their nuclear and chemical properties. The papers are being published here, without editing, in the form in which they were submitted by the authors in the months following the anniversary symposium, and they reflect rather faithfully the remarks made on that occasion.

  3. Method for measuring multiple scattering corrections between liquid scintillators

    Science.gov (United States)

    Verbeke, J. M.; Glenn, A. M.; Keefer, G. J.; Wurtz, R. E.

    2016-07-01

    A time-of-flight method is proposed to experimentally quantify the fractions of neutrons scattering between scintillators. An array of scintillators is characterized in terms of crosstalk with this method by measuring a californium source, for different neutron energy thresholds. The spectral information recorded by the scintillators can be used to estimate the fractions of neutrons multiple scattering. With the help of a correction to Feynman's point model theory to account for multiple scattering, these fractions can in turn improve the mass reconstruction of fissile materials under investigation.

  4. Surface fission tracks in diamond

    International Nuclear Information System (INIS)

    Scanning Probe Microscope (SPM) images reveal important fingerprint features of latent tracks induced in diamond by fission fragments from a californium source. Collimated fission fragments with a binary distribution of the predominant energies of 79.4 and 103.8 MeV, are assumed. Cavities, reticular formations around these cavities, and black spots of graphite were found. A brief discussion on the possible track formation mechanism is given on the basis of the explosion spike theory; an attempt to determine latent track core and halo parameters is included

  5. Use of trioctylphosphine oxide for transplutonium element extraction and purification

    International Nuclear Information System (INIS)

    Investigated was extraction of tri-valent curium, berkelium, californium, einsteinium as well as cerium and europium with trioctylphosphin oxide from lactic acid solutions, containing DTPA and aluminium nitrate depending on the aluminium nitrate and TOPO concentrations and nitric acid solutions of variable concentration as well. Under optimum conditions of extraction chromatography of berkelium studied was the distribution of cobalt, nickel, chromium, iron, aluminium, titanium, zirconium and niobium ions, and the coefficients of berkelium purification from cations investigated were determined. The effect of weight quantities of cation impurities on extraction chromatographic yield of berkelium has been investigated. Examples of practice application of the extraction chromatography with the use of TOPO are given

  6. Cultural Economy, Capitalism and the Logic of the Public Sphere

    DEFF Research Database (Denmark)

    Schwarzkopf, Stefan

    2015-01-01

    Review essay: Promotional Cultures: The Rise and Spread of Advertising, Public Relations, Marketing and Branding/ by Aeron Davis. (Polity, 2013, ISBN 978-0-7456-3983-3, 247 + xi pp.......Review essay: Promotional Cultures: The Rise and Spread of Advertising, Public Relations, Marketing and Branding/ by Aeron Davis. (Polity, 2013, ISBN 978-0-7456-3983-3, 247 + xi pp....

  7. 77 FR 3742 - India Infrastructure Business Development Mission-Clarification and Amendment

    Science.gov (United States)

    2012-01-25

    ... Mission, 76 FR, No. 247, December 23, 2011, to amend the Notice to revise the dates of the application... Infrastructure Business Development Mission, 76 FR, No. 247, December 23, 2011, is amended to read as follows... International Trade Administration India Infrastructure Business Development Mission--Clarification...

  8. 24 CFR 886.128 - Termination of tenancy.

    Science.gov (United States)

    2010-04-01

    ... violence, dating violence, or stalking is involved or claimed to be involved, the provisions of 24 CFR part... this title (24 CFR part 247) applies to the termination of tenancy and eviction of a family assisted... citizenship or eligible immigration status, the procedures of 24 CFR parts 247 and 5 shall apply. For...

  9. Production of Aspergillus niger β-mannosidase in Pichia pastoris

    Czech Academy of Sciences Publication Activity Database

    Fliedrová, Barbora; Weignerová, Lenka; Křen, Vladimír

    2012-01-01

    Roč. 279, č. 1 (2012), s. 247-247. ISSN 1742-464X. [IUBMB Congress /22./ and FEBS Congress /37./. 04.09.2012-09.09.2012, Seville] R&D Projects: GA ČR GD305/09/H008; GA ČR GAP207/10/0321 Institutional support: RVO:61388971 Keywords : NAG-thiazoline

  10. 78 FR 52562 - Outer Continental Shelf (OCS), Gulf of Mexico (GOM), Oil and Gas Lease Sales, Central Planning...

    Science.gov (United States)

    2013-08-23

    ... Bureau of Ocean Energy Management Outer Continental Shelf (OCS), Gulf of Mexico (GOM), Oil and Gas Lease Sales, Central Planning Area (CPA) Lease Sales 235, 241, and 247 AGENCY: Bureau of Ocean Energy... EIS for proposed Central Planning Area (CPA) Lease Sales 235, 241 and 247 in the Gulf of Mexico...

  11. Monte Carlo aided enhanced design of an neutron scatterometer

    International Nuclear Information System (INIS)

    This paper will present a particular example for the use of the Monte Carlo Method to enhance the performance of a neutron scatterometer, currently employed to detect the void fraction in fast-transient high-pressure water-vapour flow in a rod-bundle channel. The scatterometer relies on measuring the slowing-down of californium-252 neutrons by the hydrogen in the water to determine the liquid, hence vapour (void) content. However, californium-252 is a relatively fast-decaying source and alternative isotopic sources are typically too energetic to provide sufficient moderation given the small amount of liquid in the channel. Monte Carlo simulation were utilized to examine various design enhancement possibilities, including: filtering out unthermalized fast neutrons, amplifying by a fissionable material the amount of detected thermal neutrons, adding a dissolvable contrast material to the liquid phase, or relying on the scattering of fast neutrons by oxygen in water. In addition, methods to determine the distribution of the pattern of liquid-vapour phase in the channel are devised

  12. Retinitis Pigmentosa Mutations in Bad Response to Refrigeration 2 (Brr2) Impair ATPase and Helicase Activity.

    Science.gov (United States)

    Ledoux, Sarah; Guthrie, Christine

    2016-06-01

    Brr2 is an RNA-dependent ATPase required to unwind the U4/U6 snRNA duplex during spliceosome assembly. Mutations within the ratchet helix of the Brr2 RNA binding channel result in a form of degenerative human blindness known as retinitis pigmentosa (RP). The biochemical consequences of these mutations on Brr2's RNA binding, helicase, and ATPase activity have not yet been characterized. Therefore, we identified the largest construct of Brr2 that is soluble in vitro, which truncates the first 247 amino acids of the N terminus (Δ247-Brr2), to characterize the effects of the RP mutations on Brr2 activity. The Δ247-Brr2 RP mutants exhibit a gradient of severity of weakened RNA binding, reduced helicase activity, and reduced ATPase activity compared with wild type Δ247-Brr2. The globular C-terminal Jab1/Mpn1-like domain of Prp8 increases the ability of Δ247-Brr2 to bind the U4/U6 snRNA duplex at high pH and increases Δ247-Brr2's RNA-dependent ATPase activity and the extent of RNA unwinding. However, this domain of Prp8 does not differentially affect the Δ247-Brr2 RP mutants compared with the wild type Δ247-Brr2. When stimulated by Prp8, wild type Δ247-Brr2 is able to unwind long stable duplexes in vitro, and even the RP mutants capable of binding RNA with tight affinity are incapable of fully unwinding short duplex RNAs. Our data suggest that the RP mutations within the ratchet helix impair Brr2 translocation through RNA helices. PMID:27072132

  13. Dicty_cDB: Contig-U04879-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available length 5062330 Start point 2616612 End point 2616050 Strand (PLUS/MINUS) MINUS Nu...ig-U04879-1Q.Seq.d Length = 562 Score = 490 bits (247), Expect = e-139 Identities = 247/247 (100%) Strand = ...||| Sbjct: 346 ccaacaa 352 Score = 289 bits (146), Expect = 2e-78 Identities = 146/146 (100%) Strand = Plus ...||||||||||||||| Sbjct: 537 aatagagcaaacaagtgtaatgataa 562 Score = 30.2 bits (15), Expect = 2.4 Identities = 15/15 (100%) Strand... = 521 Score = 42.1 bits (21), Expect = 6e-04 Identities = 21/21 (100%) Strand = Plus / Plus Query: 332 taat

  14. CHLOROPHYLL A, growth rate and graze rate (or grazing rate) site samples data collected in the Gulf of Alaska on the ALPHA HELIX cruises HX242, HX244 and others as part of the NEP project from 2001-04-18 to 2003-08-10 (NODC Accession 0114241)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NODC Accession 0114241 includes site samples and biological data collected aboard the ALPHA HELIX during cruises HX242, HX244, HX247, HX271 and HX275 in the Gulf of...

  15. 78 FR 24758 - Government-Owned Inventions; Availability for Licensing

    Science.gov (United States)

    2013-04-26

    ... STAT3 and STAT5. Nat Immunol. 2011 Mar;12(3):247-54. 2. Yamane A, et al. Deep-sequencing identification... Opportunity: The National Institute of Allergy and Infectious Diseases is seeking statements of capability...

  16. The Shape stability of reinforcing Steel truss support in shotcrete in Tunnelling

    Czech Academy of Sciences Publication Activity Database

    Šňupárek, Richard; Horyl, P.

    Ljubljana : Univerza Ljubljana, 1998, s. 239-247. ISBN 961-6047-09-4. [Mednarodno posvetovanje o gradnji predorov in podzemnih prostorov/4./. Ljubljana (SI), 23.09.1998-25.09.1998] Subject RIV: DC - Siesmology, Volcanology, Earth Structure

  17. Cypripediquinone A, a new phenanthraquinone from Cypripedium macranthum (Orchidaceae)

    Institute of Scientific and Technical Information of China (English)

    2000-01-01

    A new phenanthraquinone, cypripediquinone A, was isolated from the rhizome of Cypripedium macranthum ( Orchidaceae ) and its structure was established as 2,4,7-trimethoxy-9, 10- phenanthraquinone mainly by spectroscopic analysis.

  18. Nitrogen oxide air pollution: atmospheric chemistry. 1964-1978 (citations from the NTIS data base). Report for 1964-78

    Energy Technology Data Exchange (ETDEWEB)

    Cavagnaro, D.M.

    1980-10-01

    Research reports on photochemical air pollution models, smog chemistry and reactivity, and SSt exhaust effects are cited in the bibliography. Auroral and upper atmospheric in chemistry, and photochemistry of naturally occurring nitrogen oxides are excluded. (Contains 247 citations)

  19. Descend towards unimodality: butterfly loss in Czechia changes a major macroecological pattern

    Czech Academy of Sciences Publication Activity Database

    Konvička, Martin; Fric, Zdeněk; Beneš, Jiří; Čížek, Oldřich; Zámečník, J.

    Sofia : Pensoft, 2005 - (Kühn, E.; Feldmann, R.; Thomas, J.; Settele, J.), s. 88-88 ISBN 954-642-247-9 Institutional research plan: CEZ:AV0Z50070508 Keywords : butterfly Subject RIV: EH - Ecology, Behaviour

  20. Dicty_cDB: Contig-U14449-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available xlsnnnnnkknnnnnnnkeknn nkkrv*shlkiphqdlxnqih*mevvn*enqkvlkkvimxii*milifq...d = Plus / Plus Query: 187 gaaaagagtataatctcatctaaaaattcctcaccaagatctttanaat...taaaaattcctcaccaagatctttanaatcaaattcatta 246 Query: 247 aatggaagtagtaaattgagaaaatcaaaaggttttaaaaaaggtgattatgana...atcaaaaggttttaaaaaaggtgattatganaataat 306 Query: 307 atagatgatattgatattccaacttcat...ttgaagttgatcaacaaagattagataatganatt 120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct:

  1. On a periodic boundary value problem for second-order linear functional differential equations

    Czech Academy of Sciences Publication Activity Database

    Mukhigulashvili, Sulkhan

    2005-01-01

    Roč. 3, - (2005), s. 247-261. ISSN 1687-2762 Institutional research plan: CEZ:AV0Z10190503 Keywords : second order linear functional differential equation * periodic boundary value problem * unique solvability Subject RIV: BA - General Mathematics

  2. Communication, timing, and common learning

    Czech Academy of Sciences Publication Activity Database

    Steiner, Jakub; Stewart, C.

    2011-01-01

    Roč. 146, č. 1 (2011), s. 230-247. ISSN 0022-0531 Institutional research plan: CEZ:AV0Z70850503 Keywords : common knowledge * learning * communication Subject RIV: AH - Economics Impact factor: 1.235, year: 2011

  3. Český knižní trh 2012: kvalitní díla i honba za penězi

    Czech Academy of Sciences Publication Activity Database

    Janáček, Pavel; Palán, A.; Weiss, T.; Růžička, L.; Mandys, P; Matoušek, P.; Trávníček, Jiří; Kopáč, R.

    2012-01-01

    Roč. 56, č. 247 (2012), s. 12-13. ISSN 0862-9587 Institutional support: RVO:68378068 Keywords : Czech prose * Czech poetry * comics * e-books * book publishing Subject RIV: AJ - Letters, Mass-media, Audiovision

  4. Shrews I: red toothed shrews (Soricinae)

    Czech Academy of Sciences Publication Activity Database

    Zima, Jan

    Farmington Hills : Gale, 2003 - (Kleiman, D.; Geist, V.; Hutchins, M.; McDade, M.), s. 247-264 ISBN 0-7876-6573-8 Institutional research plan: CEZ:AV0Z6093917 Keywords : shrews Subject RIV: EG - Zoology

  5. Sociální poznávání

    Czech Academy of Sciences Publication Activity Database

    Baumgartner, František

    Praha: Grada Publishing, 2008, s. 181-198 ISBN 978-80-247-1428-8 Institutional research plan: CEZ:AV0Z70250504 Keywords : social cognition * interpersonal perception * attribution Subject RIV: AN - Psychology

  6. Gclust Server: 154498 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available 154498 SCE_YMR247W-A Cluster Sequences - 47 Identified by expression profiling and mass spectrometry...annotation Identified by expression profiling and mass spectrometry Number of Seq

  7. 32 CFR 246.1 - Purpose.

    Science.gov (United States)

    2010-07-01

    ... Commands consistent with 32 CFR part 372. (b) Supersedes policies and procedures in 32 CFR part 247 about... Forces Information Service (AFIS), designated Unified Commands, and the S&S. (e) Authorizes the...

  8. Historie a současný stav urychlovačů částic v českých zemích. II. Kruhové urychlovače

    Czech Academy of Sciences Publication Activity Database

    Janovský, I.; Šimáně, Čestmír

    2012-01-01

    Roč. 62, č. 4 (2012), s. 239-247. ISSN 0009-0700 Institutional support: RVO:61389005 Keywords : accelerator history * cyclic accelerator s Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders

  9. delta-Thiolactones as Prodrugs of Thiol-Based Glutamate Carboxypeptidase II (GCPII) Inhibitors

    Czech Academy of Sciences Publication Activity Database

    Ferraris, D. V.; Majer, Pavel; Ni, C.; Slusher, C. E.; Rais, R.; Wu, Y.; Wozniak, K. M.; Alt, J.; Rojas, C.; Slusher, B. S.; Tsukamoto, T.

    2014-01-01

    Roč. 57, č. 1 (2014), s. 243-247. ISSN 0022-2623 Institutional support: RVO:61388963 Keywords : pharmacokinetics * discovery * disorders * diagnosis * pain Subject RIV: CC - Organic Chemistry Impact factor: 5.447, year: 2014

  10. Pediatric Palliative Care: A Personal Story

    Medline Plus

    Full Text Available ... count__/__total__ Find out why Close Pediatric Palliative Care: A Personal Story NINRnews Subscribe Subscribed Unsubscribe 247 ... and her family. The story demonstrates how palliative care can positively influence a patient's and family's experience ...

  11. Drug: D01953 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available sts Therapeutic category of drugs in Japan [BR:br08301] 2 Agents affecting individual organs 24 Hormones 247...monal Agents, Stimulant/Replacement/Modifying (Sex Hormones/Modifiers) Estrogens

  12. Drug: D00105 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available 8301] 2 Agents affecting individual organs 24 Hormones 247 Estrogen and progesterone preparations 2473 Estra...(JAN/USP/INN) USP drug classification [BR:br08302] Hormonal Agents, Stimulant/Replacement/Modifying (Sex Hormones

  13. Drug: D04070 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available BR:br08301] 2 Agents affecting individual organs 24 Hormones 247 Estrogen and progesterone preparations 2479...ted (USP) USP drug classification [BR:br08302] Hormonal Agents, Stimulant/Replacement/Modifying (Sex Hormones

  14. Drug: D00189 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available ng individual organs 24 Hormones 247 Estrogen and progesterone preparations 2479 Others D00189 Pregnanediol ...e as: C05484 Therapeutic category: 2479 Therapeutic category of drugs in Japan [BR:br08301] 2 Agents affecti

  15. Proceedings of the Second Environmental Physics Conference (EPC-2006)

    International Nuclear Information System (INIS)

    The publication has been set up as proceedings of the environmental physics conference. the conference consistes of atmospere and climate; the ecosystem; radiation and radioactivity; activity review; environmental issues. This conference consistes of 247p., figs., tabs., refs

  16. Achados Ultra-Sonográficos em Pacientes com Ameaça de Abortamento no Primeiro Trimestre da Gestação Ultrasound Findings in First-trimester Threatened Abortion

    Directory of Open Access Journals (Sweden)

    Luiz Carlos Watanabe

    2000-06-01

    Full Text Available Objetivo: avaliar os achados ultra-sonográficos nas gestantes com ameaça de abortamento no primeiro trimestre da gestação. Métodos: exames de ultra-som obstétrico transabdominal e transvaginal foram realizados nas pacientes com sangramento vaginal e teste de gravidez positivo. Foram incluídas as gestantes entre 6 a 14 semanas de gestação pela data da última menstruação ou pelo exame ultra-sonográfico, que apresentavam colo do útero impérvio ao exame clínico. Foram excluídas as gestações múltiplas ou aquelas que realizaram tentativa de abortamento por meio de drogas ou manipulação. Resultados: em 132 dos 247 casos (53.4% foi diagnosticada gestação viável e em 46.6% (115/247, gestação inviável. Abortamento incompleto foi identificado em 19% (47/247, abortamento completo em 8,5% (21/247, abortamento retido em 7,7% (19/247, gestação anembrionada em 6,1% (15/247, gestação ectópica em 4,5% (11/247 e mola hidatiforme em 0,8% (2/247. Conclusão: aproximadamente metade (46,6% das gestações com ameaça de abortamento no primeiro trimestre apresentaram diagnóstico de inviabilidade da gestação. O exame ultra-sonográfico pode ajudar a definir esta condição e a conduta obstétrica.Objective: to evaluate ultrasound findings in pregnant women with threatened abortion in the first trimester of pregnancy. Methods: transabdominal and transvaginal ultrasound scans were performed in patients with vaginal bleeding with previous positive pregnancy test. Patients with 6-14-week gestation (by the last menstrual period or ultrasound scan, with closed cervix on clinical evaluation were included. Multiple pregnancies and those patients who have tried abortion by using abortive drugs or manipulation were excluded. Results: in 132 of 247 (53.4% the pregnancy was viable and in 46.6% (115/247 the pregnancy was nonviable. Incomplete miscarriage was found in 19% (47/247, complete miscarriage in 8.5% (21/247, missed abortion in 7.7% (19/247

  17. Bezradnost metodologie kosmologie?

    Czech Academy of Sciences Publication Activity Database

    Havlík, Vladimír

    2015-01-01

    Roč. 63, č. 2 (2015), s. 247-266. ISSN 0015-1831 Institutional support: RVO:67985955 Keywords : methodology of science * anomalies * dark energy * dark matter * I. Lakatos * T. Kuhn Subject RIV: AA - Philosophy ; Religion

  18. Fylogenetický vývoj imunity obratlovců

    Czech Academy of Sciences Publication Activity Database

    Šíma, Petr

    Praha: Grada Publishing, a.s, 2009, s. 127-128. ISBN 978-80-247-2464-5 Institutional research plan: CEZ:AV0Z50200510 Keywords : fylogenetic evolution * immunity * vertebrate Subject RIV: EC - Immunology

  19. Towards a methodology for educational modelling: a case in educational assessment

    OpenAIRE

    Giesbers, Bas; Van Bruggen, Jan; Hermans, Henry; Joosten-ten Brinke, Desirée; Burgers, Jan; Koper, Rob; Latour, Ignace

    2005-01-01

    Giesbers, B., van Bruggen, J., Hermans, H., Joosten-ten Brinke, D., Burgers, J., Koper, R., & Latour, I. (2007). Towards a methodology for educational modelling: a case in educational assessment. Educational Technology & Society, 10 (1), 237-247.

  20. Miroslav Masák

    Czech Academy of Sciences Publication Activity Database

    Švácha, Rostislav

    [Řevnice]: Arbor vitae, 2012 - (Švácha, R.), s. 244-247 ISBN 978-80-87164-87-7 Institutional support: RVO:68378033 Keywords : architecture * postwar architecture * Liberec Subject RIV: AL - Art, Architecture, Cultural Heritage

  1. Ilmus väärt artiklikogumik / Arvo Tering

    Index Scriptorium Estoniae

    Tering, Arvo, 1949-

    2008-01-01

    Arvustus: Ajalookirjutaja aeg = Aetas historicum / Eesti Rahvusraamatukogu ; koost. Piret Lotman. - Tallinn, 2008. - 247 lk. - (Eesti Rahvusraamatukogu toimetised. A, Raamat ja aeg, 1736-6984 ; nr. 1) ; (Eesti Rahvusraamatukogu toimetised ; 11)

  2. Rheumatic heart disease

    Institute of Scientific and Technical Information of China (English)

    1992-01-01

    920657 The relationship between atrialnatriuretic factor and hemodynamics inrheumatic mitral stenosis. XU Zhimin(须志敏), et al. Dept Cardiol, Affil Hosp, Shand-ong Med Univ, Jinan. 25000 Chin Cir J1992; 7(3): 247-250.

  3. AcEST: BP918403 [AcEST

    Lifescience Database Archive (English)

    Full Text Available B1FK40|B1FK40_9BURK Xanthine permease OS=Burkholderia ambifar... 33 7.0 tr|B0LK19|B0LK19_CUCSA Zinc finger-homeodoma....4 tr|B1Z247|B1Z247_BURA4 Xanthine permease OS=Burkholderia ambifar... 33 7.0 tr|...3 9.0 tr|Q0BA61|Q0BA61_BURCM Uracil-xanthine permease OS=Burkholderia ... 33 9.2 tr|B7KJZ7|B7KJZ7_9CHRO Putative uncharacter...ized protein OS=Cyano... 33 9.2 tr|B1T3B3|B1T3B3_9BURK Xanthine permease OS=Burkholder...+ + H Sbjct: 92 NTTGLAAVMSRLNTTGLSAVRSCLNTTGLAAVSSKHN---RPCSCQVSSKH 139 >tr|B1Z247|B1Z247_BURA4 Xanthine permease OS=Burkholder

  4. 48 CFR 1652.000 - Applicable clauses.

    Science.gov (United States)

    2010-10-01

    ...-5Covenant Against Contingent Fees. 52.203-7Anti-Kickback Procedures. 52.203-12Limitation on Payments to... Items and Commercial Components. 52.246-25Limitation of Liability—Services. 52.247-63Preference for...

  5. QTL Information Table: 241 [Q-TARO

    Lifescience Database Archive (English)

    Full Text Available d F2 Basmati 370 ASD16 RM247 pha Govindaraj, P., Arumugachamy, S., and Maheswaran, M. (2005). Bulked segregant an...qCGB Physiological trait Eating quality cooked grain breadth Mixture d)Co-segregate

  6. Design, synthesis and characterization of bioinspired nanomaterials for engineering and biomedicine

    OpenAIRE

    Ceylan, Hakan

    2014-01-01

    Ankara : The Materials Science and Nanotechnology Program and the Graduate School of Engineering and Science of Bilkent University, 2014. Thesis (Ph. D.) -- Bilkent University, 2014. Includes bibliographical references leaves 227-247. Ceylan, Hakan Ph. D.

  7. Právnický elektronický slovník (PES)

    Czech Academy of Sciences Publication Activity Database

    Cvrček, František

    2015-01-01

    Roč. 154, č. 3 (2015), s. 247-260. ISSN 0231-6625 Institutional support: RVO:68378122 Keywords : legal language * legal dictionaries * linguistic analysis of legal texts Subject RIV: AG - Legal Sciences

  8. Sociální inteligence, sociální kompetence

    Czech Academy of Sciences Publication Activity Database

    Baumgartner, František; Orosová, O.; Výrost, J.

    Praha : Grada Publishing, 2008, s. 199-215 ISBN 978-80-247-1428-8 Institutional research plan: CEZ:AV0Z70250504 Keywords : social intelligence * social competence * emotional intelligence Subject RIV: AN - Psychology

  9. SALINITY, WATER TEMPERATURE, FLUORESCENCE, PHOTOSYNTHETIC ACTIVE RADIATION (PAR) and other profile data collected in the Gulf of Alaska on the ALPHA HELIX cruises HX242, HX244 and others as part of the NEP project from 2001-04-18 to 2003-08-11 (NODC Accession 0115255)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NODC Accession 0115255 includes profile, biological and physical data collected aboard the ALPHA HELIX during cruises HX242, HX244, HX247, HX271 and HX275 in the...

  10. Sociologické aspekty

    Czech Academy of Sciences Publication Activity Database

    Linková, Marcela

    Praha: Grada Publishing, 2002, s. 118-122 ISBN 80-247-0333-5 Institutional research plan: CEZ:AV0Z7028912 Keywords : transgenderism * gender roles * performativy Subject RIV: AO - Sociology, Demography

  11. Taxonomy and distribution of benthic foraminifera from the sediments of Palk Strait, Tamil Nadu, east coast of India

    Digital Repository Service at National Institute of Oceanography (India)

    Gandhi, S.; Rajamanickam, G.V.; Nigam, R.

    Institute Nacional de Investigacion de las Ciencias Naturates. ?Bernardino Rivadavia> (Sea Geologicas), 3 : 247-300. Brady, II.B. 1879. Notes on some Retieularian Rhizopoda of the 'Challenger' expedition. Part II. Additions to the knowledge of porcellanous...

  12. Report on progress of researches by common utilization of JAERI nuclear facilities, for fiscal 1992

    International Nuclear Information System (INIS)

    The results of the joint researches by utilizing the facilities of JAERI in 1992 fiscal year were summarized. The number of research themes in 1992 was 247 cases. In this book, 166 reports are collected. (J.P.N.)

  13. Study of the effect of moisture content and bending rate on the fracture toughness of rocks

    Czech Academy of Sciences Publication Activity Database

    Vavro, Leona; Souček, Kamil

    2013-01-01

    Roč. 10, č. 2 (2013), s. 247-253. ISSN 1214-9705 R&D Projects: GA MŠk ED2.1.00/03.0082 Institutional support: RVO:68145535 Keywords : fracture toughness * bending rate * tensile strength Subject RIV: DB - Geology ; Mineralogy Impact factor: 0.667, year: 2013 http://www.irsm.cas.cz/materialy/acta_content/2013_02/acta_170_14_Vavro_Soucek_247-253.pdf

  14. Preparation of geneticaly modified flax for heavy metal remediation

    Czech Academy of Sciences Publication Activity Database

    Najmanová, Jitka; Kotrba, P.; Macková, M.; Macek, Tomáš

    Chania: Technical University of Crete, 2008 - (Kalogerakis, N.; Fava, F.; Banwart, S.). s. 247-247 ISBN 978-960-8475-12-0. [European Bioremediation Conference /4./. 03.09.2008-06.09.2008, Chania] R&D Projects: GA MŠk 1M06030 Institutional research plan: CEZ:AV0Z40550506 Keywords : phytoremediation * heavy metals * transgenic flax Subject RIV: EI - Biotechnology ; Bionics

  15. Alpha1a-Adrenoceptor Genetic Variant Triggers Vascular Smooth Muscle Cell Hyperproliferation and Agonist Induced Hypertrophy via EGFR Transactivation Pathway.

    Directory of Open Access Journals (Sweden)

    Irina Gradinaru

    Full Text Available α1a Adrenergic receptors (α1aARs are the predominant AR subtype in human vascular smooth muscle cells (SMCs. α1aARs in resistance vessels are crucial in the control of blood pressure, yet the impact of naturally occurring human α1aAR genetic variants in cardiovascular disorders remains poorly understood. To this end, we present novel findings demonstrating that 3D cultures of vascular SMCs expressing human α1aAR-247R (247R genetic variant demonstrate significantly increased SMC contractility compared with cells expressing the α1aAR-WT (WT receptor. Stable expression of 247R genetic variant also triggers MMP/EGFR-transactivation dependent serum- and agonist-independent (constitutive hyperproliferation and agonist-dependent hypertrophy of SMCs. Agonist stimulation reduces contractility Using pathway-specific inhibitors we determined that the observed hyperproliferation of 247R-expressing cells is triggered via β-arrestin1/Src/MMP-2/EGFR/ERK-dependent mechanism. MMP-2-specific siRNA inhibited 247R-triggered hyperproliferation indicating MMP-2 involvement in 247R-triggered hyperproliferation in SMCs. β-arrestin1-specific shRNA also inhibited 247R-triggered hyperproliferation but did not affect hypertrophy in 247R-expressing SMCs, indicating that agonist-dependent hypertrophy is independent of β-arrestin1. Our data reveal that in different cardiovascular cells the same human receptor genetic variant can activate alternative modulators of the same signaling pathway. Thus, our findings in SMCs demonstrate that depending on the type of cells expressing the same receptor (or receptor variant, different target-specific inhibitors could be used to modulate aberrant hyperproliferative or hypertrophic pathways in order to restore normal phenotype.

  16. Infusorial concentration in rumen fluid of red deer, fallow deer, roe deer and moufflon

    Czech Academy of Sciences Publication Activity Database

    Kamler, Jiří

    1999-01-01

    Roč. 68, č. 4 (1999), s. 247-252. ISSN 0001-7213 R&D Projects: GA ČR GA206/97/0172; GA AV ČR KSK2005601 Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 0.227, year: 1999 http://vfu-www.vfu.cz/acta-vet/vol68/pdf/68_247.pdf

  17. Optimization of magnetic perturbation spectra for the COMPASS tokamak

    Czech Academy of Sciences Publication Activity Database

    Cahyna, Pavel

    Geneva : International Atomic Energy Agency, 2008. s. 247-247. ISBN N. [IAEA Fusion Energy Conference/22nd./. 13.10.2008-18.10.2008, Geneva] Institutional research plan: CEZ:AV0Z20430508 Keywords : resonant magnetic perturbations * ELM control * magnetic islands * saddle coils * COMPASS tokamak Subject RIV: BL - Plasma and Gas Discharge Physics http://www-pub.iaea.org/MTCD/Meetings/PDFplus/2008/cn165/cn165_BookOfAbstracts.pdf

  18. Circulating cell-free DNA and its integrity as a prognostic marker for breast cancer

    OpenAIRE

    Iqbal, Sobuhi; Vishnubhatla, Sreenivas; Raina, Vinod; Sharma, Surabhi; Gogia, Ajay; Suryanarayana S.V. Deo; Mathur, Sandeep; Shukla, Nutan Kumar

    2015-01-01

    The aim of our study was to look for alternative predictive biomarkers for breast cancer management in limited resource setup. A comprehensive analysis of circulating cell-free DNA (CCFD) in serum at baseline was performed to assess its prognostic potential. Quantitative polymerase chain reaction (qPCR) of ALU sequences using ALU115 and ALU247 primers was carried out in patients (N: baseline 148, postoperative 47) and 51 healthy controls. Mean serum DNA integrity, levels of ALU 247 and levels...

  19. Sediment distribution coefficients and concentration factors for biota in the marine environment

    International Nuclear Information System (INIS)

    In 1985 the IAEA published Technical Reports Series No. 247 (TRS 247), Sediment Kds and Concentration Factors for Radionuclides in the Marine Environment, which provided sediment distribution coefficients (Kds) and concentration factor (CF) data for marine biological material that could be used in models simulating the dispersion of radioactive waste that had been disposed of in the sea. TRS 247 described an approach for calculating sediment or water Kds using stable element geochemical data developed by J.M. Bewers, even though the use of field derived data was emphasized whenever possible. Over the years, TRS 247 has proved to be a valuable reference for radioecologists, marine modellers and other scientists involved in assessing the impact of radionuclides in the marine environment. In 2000 the IAEA initiated a revision of TRS 247 to take account of the new sets of data obtained since 1985.The outcome of this work is this report, which contains revised sediment Kds for the open ocean and ocean margins and CFs for marine biota. CFs for deep ocean ferromanganese nodules. In addition, this report contains CFs for a limited number of elements for marine mammals not included in TRS 247. This revision was carried out at three IAEA Consultants Meetings held in Monaco and Vienna between April 2000 and December 2002

  20. Neutron radiography for nondestructive testing

    International Nuclear Information System (INIS)

    Neutron radiography is similar to X-ray inspection in that both depend upon use of radiation that penetrates some materials and is absorbed by others to provide a contrast image of conditions not readily available for visual inspection. X-rays are absorbed by dense materials, such as metals, whereas neutrons readily penetrate metals, but are absorbed by materials containing hydrogen. The neutron radiography has been successfully applied to a number of inspection situations. These include the inspection of explosives, advanced composites, adhesively bonded structures and a number of aircraft engine components. With the availability of Californium-252, it has become feasible to construct mobile neutron radiography systems suitable for field use. Such systems have been used for in-situ inspection of flight line aircraft, particularly to locate and measure hidden corrosion

  1. Preparation of actinide targets by electrodeposition

    Science.gov (United States)

    Trautmann, N.; Folger, H.

    1989-10-01

    Actinide targets with varying thicknesses on different substrates have been prepared by electrodeposition either from aqueous solutions or from solutions of their nitrates in isopropyl alcohol. With these techniques the actinides can be deposited almost quantitatively on various backing materials within 15 to 30 min. Targets of thorium, uranium, neptunium, plutonium, americium, curium and californium with areal densities from almost carrier-free up to 1.4 mg/cm 2 on thin beryllium, carbon, titanium, tantalum and platinum foils have been prepared. In most cases, prior to the deposition, the actinides had to be purified chemically and for some of them, due to the limited amount of material available, recycling procedures were required. Applications of actinide targets in heavy-ion reactions are briefly discussed.

  2. An atomic beam source for actinide elements: concept and realization

    International Nuclear Information System (INIS)

    For ultratrace analysis of actinide elements and studies of their atomic properties with resonance ionization mass spectroscopy (RIMS), efficient and stable sources of actinide atomic beams are required. The thermodynamics and kinetics of the evaporation of actinide elements and oxides from a variety of metals were considered, including diffusion, desorption, and associative desorption. On this basis various sandwich-type filaments were studied. The most promising system was found to consist of tantalum as the backing material, an electrolytically deposited actinide hydroxide as the source of the element, and a titanium covering layer for its reduction to the metal. Such sandwich sources were experimentally proven to be well suited for the production of atomic beams of plutonium, curium, berkelium and californium at relatively low operating temperatures and with high and reproducible yields. (orig.)

  3. Environmental assessment of the thermal neutron activation explosive detection system for concourse use at US airports

    International Nuclear Information System (INIS)

    This document is an environmental assessment of a system designed to detect the presence of explosives in checked airline baggage or cargo. The system is meant to be installed at the concourse or lobby ticketing areas of US commercial airports and uses a sealed radioactive source of californium-252 to irradiate baggage items. The major impact of the use of this system arises from direct exposure of the public to scattered or leakage radiation from the source and to induced radioactivity in baggage items. Under normal operation and the most likely accident scenarios, the environmental impacts that would be created by the proposed licensing action would not be significant. 44 refs., 19 figs., 18 tabs

  4. A comparative study of bulk etch rate measurement methods in polycarbonate detectors

    International Nuclear Information System (INIS)

    The response of a plastic detector to an incoming charged particle is given by the ratio of track etch rate vt to bulk etch rate vg along its path. Although the accurate determination of vt offers no difficulty as cone length can be comfortably measured, there seems to be a certain ambiguity as how to measure vg. Several LEXAN and TUFFAK polycarbonate plates have been exposed to normally incident Californium-252 fission fragments, etched in a stirred aqueous NaOH solution saturated with etch products and with a 0.05% of Dowfax surfactant, for different etching times, concentrations and temperatures. We have used three methods to measure vg and we obtain consistent results in agreement with those published in the literature. Surface quality and, consequently, ellipses neatness, are far superior in TUFFAK than in LEXAN. (author)

  5. A Novel Approach to β-delayed Neutron Spectroscopy Using the Beta-decay Paul Trap

    International Nuclear Information System (INIS)

    A new approach to β-delayed neutron spectroscopy has been demonstrated that circumvents the many limitations associated with neutron detection by instead inferring the decay branching ratios and energy spectra of the emitted neutrons by studying the nuclear recoil. Using the Beta-decay Paul Trap, fission-product ions were trapped and confined to within a 1-mm3 volume under vacuum using only electric fields. Results from recent measurements of 137I+ and plans for development of a dedicated ion trap for future experiments using the intense fission fragment beams from the Californium Rare Isotope Breeder Upgrade (CARIBU) facility at Argonne National Laboratory are summarized. The improved nuclear data that can be collected is needed in many fields of basic and applied science such as nuclear energy, nuclear astrophysics, and stockpile stewardship

  6. Devices for rapid protein determination in grain products and mixed feeds by the neutron method

    International Nuclear Information System (INIS)

    Protein determination should be carried out using rapid techniques so that each truckful of grain can be checked for protein while mixed feeds can be checked for protein directly in the product flow lines with automatic correction of their work. The existing methods of protein determination do not meet the above requirements. In this connection, the Azot analyzer has beem developed based on the reaction of capture of thermal neutrons by the nuclei of the nitrogen present in the analyzed product and the registration of the resulting gamma-quanta emission of 10.8 Mev. Readings of the nitrogen will be converted to those of protein with the help of standard conversion coefficients. Alongside with protein content, the Azot can measure the test weight of the grain by absorbing californium 252 neutrons

  7. Probe for the exploration of deposits

    International Nuclear Information System (INIS)

    The exploration probes work by means of a prompt (n,γ) analysis, activation analysis or X-ray fluorescence analysis. The neutrons or gamma radiation are provided by a californium-252 source or a cobalt-57 source which are placed in the probe. The probe is in the form of a pipe consisting of single modules. Each module contains a part of the whole radiation producing, shielding, detector, detector cooling and detector electronic system. They can be screwed onto one another and can be exchanged for other parts. A melt cryostatat or a compressor is used as cooling device, a germanium-(Li) detector as detector, and bismuth and heavy water as shielding. All measuring process can thus be carried out in situ in a relatively short measuring time. (DG)

  8. Robotics and remote systems applications

    International Nuclear Information System (INIS)

    This article is a review of numerous remote inspection techniques in use at the Savannah River (and other) facilities. These include: (1) reactor tank inspection robot, (2) californium waste removal robot, (3) fuel rod lubrication robot, (4) cesium source manipulation robot, (5) tank 13 survey and decontamination robots, (6) hot gang valve corridor decontamination and junction box removal robots, (7) lead removal from deionizer vessels robot, (8) HB line cleanup robot, (9) remote operation of a front end loader at WIPP, (10) remote overhead video extendible robot, (11) semi-intelligent mobile observing navigator, (12) remote camera systems in the SRS canyons, (13) cameras and borescope for the DWPF, (14) Hanford waste tank camera system, (15) in-tank precipitation camera system, (16) F-area retention basin pipe crawler, (17) waste tank wall crawler and annulus camera, (18) duct inspection, and (19) deionizer resin sampling

  9. Utilization of radiation facilities at TNRC for shielding researches and related topics

    International Nuclear Information System (INIS)

    This paper presents the running shielding research activities at Tajura Nuclear research center. The main area of researches are concentrated on the investigation of different types of concrete made from local materials such as conventional concrete, Magnetite-Limonite concrete, and heat resistant concrete. The measuring techniques used were neutron-gamma spectrometry, and activation foils. The measurements were performed using collimated beam of reactor neutrons emitted from one of the horizontal channels, as well as from californium-252 neutron source. The transmitted neutron spectra through concrete barriers of different thicknesses were measured by a scintillation spectrometer with NE-213 liquid organic scintillator. A non-destructive testing of some reactor materials were also carried out using neutron and gamma ray computerized tomography technique (CT). Some experiments were also carried out related to measurements of neutron depth dose distributions inside tissue equivalent materials. 10 figs

  10. Nuclear fission and the transuranium elements

    International Nuclear Information System (INIS)

    Many of the transuranium elements are produced and isolated in large quantities through the use of neutrons furnished by nuclear fission reactions: plutonium (atomic number 94) in ton quantities; neptunium (93), americium (95), and curium (96) in kilogram quantities; berkelium (97) in 100 milligram quantities; californium (98) in gram quantities; and einsteinium (99) in milligram quantities. Transuranium isotopes have found many practical applications---as nuclear fuel for the large-scale generation of electricity, as compact, long-lived power sources for use in space exploration, as means for diagnosis and treatment in the medical area, and as tools in numerous industrial processes. Of particular interest is the unusual chemistry and impact of these heaviest elements on the periodic table. This account will feature these aspects. 9 refs., 5 figs

  11. Potential nuclear safeguards applications for neutron generators

    International Nuclear Information System (INIS)

    Many nuclear safeguards inspection instruments use neutron sources to interrogate the fissile material (commonly 235U and 239Pu) to be measured. The neutron sources currently used in these instruments are isotopics such as Californium-252, Americium-Lithium, etc. It is becoming increasingly more difficult to transport isotopic sources from one measurement location to another. This represents a significant problem for the International Atomic Energy Agency (IAEA) safeguards inspectors because they must take their safeguards instruments with them to each nuclear installation to make an independent measurement. Purpose of this paper is to review the possibility of replacing isotopic neutron sources now used in IAEA safeguards instruments with electric neutron sources such as deuterium-tritium (D-T, 14-MeV neutrons) or deuterium-deuterium (D-D, 2-MeV neutrons). The potential for neutron generators to interrogate spent-light water reactor fuel assemblies in storage pools is also reviewed

  12. Reliability of semiconductor and gas-filled diodes for over-voltage protection exposed to ionizing radiation

    Directory of Open Access Journals (Sweden)

    Stanković Koviljka

    2009-01-01

    Full Text Available The wide-spread use of semiconductor and gas-filled diodes for non-linear over-voltage protection results in a variety of possible working conditions. It is therefore essential to have a thorough insight into their reliability in exploitation environments which imply exposure to ionizing radiation. The aim of this paper is to investigate the influence of irradiation on over-voltage diode characteristics by exposing the diodes to californium-252 combined neutron/gamma radiation field. The irradiation of semiconductor over-voltage diodes causes severe degradation of their protection characteristics. On the other hand, gas-filled over-voltage diodes exhibit a temporal improvement of performance. The results are presented with the accompanying theoretical interpretations of the observed changes in over-voltage diode behaviour, based on the interaction of radiation with materials constituting the diodes.

  13. Measurements of the neutron capture cross sections and incineration potentials of minor-actinides in high thermal neutron fluxes: Impact on the transmutation of nuclear wastes

    International Nuclear Information System (INIS)

    This thesis comes within the framework of minor-actinide nuclear transmutation studies. First of all, we have evaluated the impact of minor actinide nuclear data uncertainties within the cases of 241Am and 237Np incineration in three different reactor spectra: EFR (fast), GT-MHR (epithermal) and HI-HWR (thermal). The nuclear parameters which give the highest uncertainties were thus highlighted. As a result of fact, we have tried to reduce data uncertainties, in the thermal energy region, for one part of them through experimental campaigns in the moderated high intensity neutron fluxes of ILL reactor (Grenoble). These measurements were focused onto the incineration and transmutation of the americium-241, the curium-244 and the californium-249 isotopes. Finally, the values of 12 different cross sections and the 241Am isomeric branching ratio were precisely measured at thermal energy point. (author)

  14. Multi-purpose neutron radiography system

    International Nuclear Information System (INIS)

    A conceptual design is given for a low cost, multipurpose radiography system suited for the needs of the Los Alamos National Laboratory (LANL). The proposed neutron source is californium-252. One purpose is to provide an in-house capability for occasional, reactor quality, neutron radiography thus replacing the recently closed Omega-West Reactor. A second purpose is to provide a highly reliable standby transportable neutron radiography system. A third purpose is to provide for transportable neutron probe gamma spectroscopy techniques. The cost is minimized by shared use of an existing x-ray facility, and by use of an existing transport cask. The achievable neutron radiography and radioscopy performance characteristics have been verified. The demonstrated image qualities range from high resolution gadolinium - SR film, with L:D = 100:1, to radioscopy using a LIXI image with L:D = 30:1 and neutron fluence 3.4 x 105 n/cm2

  15. Measurements of the neutron capture cross sections and incineration potentials of minor-actinides in high thermal neutron fluxes: Impact on the transmutation of nuclear wastes; Mesures des sections efficaces de capture et potentiels d'incineration des actinides mineurs dans les hauts flux de neutrons: Impact sur la transmutation des dechets

    Energy Technology Data Exchange (ETDEWEB)

    Bringer, O

    2007-10-15

    This thesis comes within the framework of minor-actinide nuclear transmutation studies. First of all, we have evaluated the impact of minor actinide nuclear data uncertainties within the cases of {sup 241}Am and {sup 237}Np incineration in three different reactor spectra: EFR (fast), GT-MHR (epithermal) and HI-HWR (thermal). The nuclear parameters which give the highest uncertainties were thus highlighted. As a result of fact, we have tried to reduce data uncertainties, in the thermal energy region, for one part of them through experimental campaigns in the moderated high intensity neutron fluxes of ILL reactor (Grenoble). These measurements were focused onto the incineration and transmutation of the americium-241, the curium-244 and the californium-249 isotopes. Finally, the values of 12 different cross sections and the {sup 241}Am isomeric branching ratio were precisely measured at thermal energy point. (author)

  16. Triton and alpha-particle contribution from LiF converter for neutron dosimeter

    CERN Document Server

    Camacho, M E; Balcazar, M

    1999-01-01

    A personnel neutron dosimeter prototype based on chemical and electrochemical etched CR-39 detector, combined with LiF converter, has been calibrated using an ICRP-like phantom, under a heavy-water moderated Californium source neutron spectra; A conversion factor of 1.052+-126 spots cm sup - sup 2 mSv sup - sup 1 was obtained. The sealing properties of the detector holder showed a ten-fold reduction in radon background when it was tested in a high radon atmosphere. A convenient mechanical shock resistance was achieved in LiF converters by sintering to 11 tons pressure LiF powder at 650 deg. C, during one hour.

  17. Nuclear fission and the transuranium elements

    Energy Technology Data Exchange (ETDEWEB)

    Seaborg, G.T.

    1989-02-01

    Many of the transuranium elements are produced and isolated in large quantities through the use of neutrons furnished by nuclear fission reactions: plutonium (atomic number 94) in ton quantities; neptunium (93), americium (95), and curium (96) in kilogram quantities; berkelium (97) in 100 milligram quantities; californium (98) in gram quantities; and einsteinium (99) in milligram quantities. Transuranium isotopes have found many practical applications---as nuclear fuel for the large-scale generation of electricity, as compact, long-lived power sources for use in space exploration, as means for diagnosis and treatment in the medical area, and as tools in numerous industrial processes. Of particular interest is the unusual chemistry and impact of these heaviest elements on the periodic table. This account will feature these aspects. 9 refs., 5 figs.

  18. General purpose nuclear irradiation chamber

    International Nuclear Information System (INIS)

    Nuclear technology has found a great need for use in medicine, industry, and research. Smoke detectors in our homes, medical treatments and new varieties of plants by irradiating its seeds are just a few examples of the benefits of nuclear technology. Portable neutron source such as Californium-252, available at Industrial Technology Division (BTI/ PAT), Malaysian Nuclear Agency, has a 2.645 year half-life. However, 252Cf is known to emit gamma radiation from the source. Thus, this chamber aims to provide a proper gamma shielding for samples to distinguish the use of mixed neutron with gamma-rays or pure neutron radiation. The chamber is compatible to be used with other portable neutron sources such as 241Am-Be as well as the reactor TRIGA PUSPATI for higher neutron dose. This chamber was designed through a collaborative effort of Kulliyyah Engineering, IIUM with the Industrial Technology Division (BTI) team, Malaysian Nuclear Agency. (Author)

  19. Experimental survey of the potential energy surfaces associated with fission

    International Nuclear Information System (INIS)

    Progress in the experimental determination of the properties of the potential energy surface associated with fission is reviewed. The importance of nuclear symmetry effects on the calculation of fission widths is demonstrated. Evidence is presented for the fragmentation of the mass-asymmetric second barrier in the thorium region and the axial asymmetric first barrier in the californium region. Detailed analyses of experimental data suggest the presence of two parallel second barriers; the normal mass-asymmetric, axial-symmetric barrier and a slightly higher mass-symmetric, axial-asymmetric barrier. Experimental barrier parameters are determined systematically and compared with calculations from various theoretical models. Techniques for expanding fission probability measurements to higher energies are discussed. (author)

  20. Separation of 248Cm (III) from 252Cf (III) and its use in time resolved fluorescence spectroscopic (TRFS) studies

    International Nuclear Information System (INIS)

    The present report gives a description of the methodology for the separation of 248Cm(III) from decayed 252Cf (III) waste solution. The waste solution was first assayed for 252Cf content by neutron counting using a neutron well coincidence counter. The sample was subjected to the chemical separation of 248Cm (III) from 252Cf (III) following anion and cation exchange chromatography. The alpha spectrum of the separated curium fraction showed peaks due to 246Cm and 248Cm while the corresponding alpha spectrum of californium fraction showed 249,250,251,252Cf. The gamma ray abundances of 249Cf were determined with respect to its gamma rays of 387 keV and the data agreed well with that in literature. Separated Cm(III) was further characterized by recording its time resolved fluorescence spectrum (TRFS) in aqueous medium. (author)

  1. Effects of 252Cf neutrons, transmitted through an iron block on human lymphocyte chromosome

    International Nuclear Information System (INIS)

    Chromosome aberration of human peripheral blood lymphocytes exposed to californium-252 (252Cf) neutrons transmitted through a 15 cm thick iron block was analysed. The spectrum of the filtered neutrons ranged from 0.1 to 2MeV with a peak at 0.7 MeV, simulating the Hiroshima atomic bomb neutron spectrum as shown in the Dosimetry System 1986 (DS86). Chromosome aberration frequencies after exposure to filtered and unfiltered 252Cf radiation were compared. Acentric ring chromosomes were significantly increased (p 0.1). The relative biological effectiveness (RBE) of the neutrons with respect to the formation of dicentrics and centric rings was 10.9 and 12.3 in the filtered and unfiltered conditions respectively, but the difference was not statistically significant. These results provide useful information for the re-evaluation of the biological effect of the Hiroshima atomic bomb radiations. (Author)

  2. Test and evaluation results of the 252Cf shuffler at the Savannah River Plant

    International Nuclear Information System (INIS)

    The 252Cf Shuffler, a nondestructive assay instrument employing californium neutron source irradiation and delayed-neutron counting, was developed for measuring 235U content of scrap and waste items generated at the Savannah River Plant (SRP) reactor fuel fabrication facility. The scrap and waste items include high-purity uranium-aluminum alloy ingots as well as pieces of castings, saw and lathe chips from machining operations, low-purity items such as oxides of uranium or uranium intermixed with flux materials found in recovery operations, and materials not recoverable at SRP such as floor sweepings or residues from the uranium scrap recovery operation. The uranium contains about 60% 235U with the remaining isotopes being 236U, 238U, and 234U in descending order. The test and evaluation at SRP concluded that the accuracy, safety, reliability, and ease of use made the 252Cf Shuffler a suitable instrument for routine use in an industrial, production-oriented plant

  3. Highly charged ions for atomic clocks and search for variation of the fine structure constant

    CERN Document Server

    Dzuba, V A

    2015-01-01

    We review a number of highly charged ions which have optical transitions suitable for building extremely accurate atomic clocks. This includes ions from Hf$^{12+}$ to U$^{34+}$, which have the $4f^{12}$ configuration of valence electrons, the Ir$^{17+}$ ion, which has a hole in almost filled $4f$ subshell, the Ho$^{14+}$, Cf$^{15+}$, Es$^{17+}$ and Es$^{16+}$ ions. Clock transitions in most of these ions are sensitive to variation of the fine structure constant, $\\alpha$ ($\\alpha = e^2/\\hbar c$). E.g., californium and einsteinium ions have largest known sensitivity to $\\alpha$-variation while holmium ion looks as the most suitable ion for experimental study. We study the spectra of the ions and their features relevant to the use as frequency standards.

  4. The CARIBU EBIS control and synchronization system

    Science.gov (United States)

    Dickerson, Clayton; Peters, Christopher

    2015-01-01

    The Californium Rare Isotope Breeder Upgrade (CARIBU) Electron Beam Ion Source (EBIS) charge breeder has been built and tested. The bases of the CARIBU EBIS electrical system are four voltage platforms on which both DC and pulsed high voltage outputs are controlled. The high voltage output pulses are created with either a combination of a function generator and a high voltage amplifier, or two high voltage DC power supplies and a high voltage solid state switch. Proper synchronization of the pulsed voltages, fundamental to optimizing the charge breeding performance, is achieved with triggering from a digital delay pulse generator. The control system is based on National Instruments realtime controllers and LabVIEW software implementing Functional Global Variables (FGV) to store and access instrument parameters. Fiber optic converters enable network communication and triggering across the platforms.

  5. Neutrons in cancer therapy

    Science.gov (United States)

    Allen, Barry J.

    1995-03-01

    The role of neutrons in the management of cancer has a long history. However, it is only in recent years that neutrons are beginning to find an accepted place as an efficacious radiation modality. Fast neutron therapy is already well established for the treatment of certain cancers, and clinical trials are ongoing. Californium neutron sources are being used in brachytherapy. Boron neutron capture therapy has been well tested with thermal neutrons and epithermal neutron dose escalation studies are about to commence in the USA and Europe. Possibilities of neutron induced auger electron therapy are also discussed. With respect to chemotherapy, prompt neutron capture analysis is being used to study the dose optimization of chemotherapy in the management of breast cancer. The rationales behind these applications of neutrons in the management of cancer are examined.

  6. К вопросу об объекте нарушения правил обращения экологически опасных веществ и отходов (ст. 247 УК)

    OpenAIRE

    ИВАНЦОВА НАТАЛЬЯ ВЛАДИМИРОВНА; ТОЛСТОВ П.В.

    2015-01-01

    Статья посвящена вопросам определения понятия и сущности объекта нарушения правил обращения экологически опасных веществ и отходов, а также места этого посягательства в системе экологических преступлений. В ходе исследования автор приходит к выводу о том, что данное преступление является однообъектным и его непосредственным объектом выступают отношения в сфере экологической безопасности, обеспечивающие соблюдение порядка обращения экологически опасных веществ и отходов....

  7. Study of reproducibility of measurements with the spectrometer of Bonner multispheres

    Energy Technology Data Exchange (ETDEWEB)

    Azevedo, G.A.; Pereira, W.W.; Patrao, K.C.S.; Fonseca, E.S., E-mail: geisadeazevedo@gmail.com, E-mail: walsan@ird.gov.br, E-mail: karla@ird.gov.br, E-mail: evaldo@ird.gov.br [Instituto de Radionprotecao e Dosimetria (IRD/CNEN-RJ), Rio de Janeiro, RJ (Brazil)

    2013-07-01

    This work aims to study the metrological behavior of the Bonner Multisphere Spectrometer (BMS) of the LN / LNMRI / IRD - Laboratorio Metrologia de Neutrons / Laboratorio Nacional de Metrologia e Radiacao Ionizante / Instituto de Radioprotecao e Dosimetria, for measurements in repeatability and reproducibility conditions. Initially, a simulation was done by applying the Monte Carlo method, using the MCNP code and respecting the ISO 8529-1 (2001), using the sources of Californium ({sup 252} Cf), Americium-Beryllium ({sup 241} AmBe) and californium in heavy water (Cf + D{sub 2}O), all located at a distance of 100 cm from the neutron detector ({sup 6}Li (Eu) - crystal scintillator). In this program, the counting of neutrons that are captured by the detector was made. The source is located in the center of a sphere of radius 300 cm. Analyzes the impact of these neutrons in a point of the sphere wall, which in this case acted as a neutron detector and from there, it is estimated the number of neutrons that collide in the whole sphere. The purpose is to obtain the neutron count for different energy bands in a solid field of neutrons, since they have a spectrum ranging from a low to a high energy that can also vary within a particular environment. Wishes to obtain new fields with different sources and moderators materials to be used as new reference fields. Measurements are being conducted for these fields, with the aim of analyzing the variability conditions of the measurement (repeatability and reproducibility) in LEN - Laboratorio de Espectrometria de Neutrons of the LN/LMNRI/IRD. Thus, the spectrometer will be used to improve both the knowledge of the spectrum as the standard of neutrons of the lab, proving that a spectrometry is essential for correct measurement.

  8. Improvement of Soil Carbon Determination using laser-induced breakdown spectroscopy

    Science.gov (United States)

    Moon, S. J.

    2014-12-01

    The increase of atmospheric greenhouse gases such as CO2 has caused noticeable climate change. Since increased CO2 may contribute to carbon storage in terrestrial ecosystems through the CO2 cycle between the atmosphere and vegetation, it is necessary to improve methods for measuring C in soil. In this study, we determined the total carbon concentrations of soils using a laser-induced breakdown spectroscopy (LIBS). The LIBS is a minimally destructive measurement technique that uses an ultra-short laser pulse to create plasma on the sample surface via the process of laser ablation. Compared with the traditional C measurements methods techniques such as wet oxidation and dry combustion, LIBS is known as a potentially elegant and promising solution for measuring C in soils. Although previous studies suggested the advantages of LIBS for measuring the C in soils, there are still challenging obstacles to be solved in measuring C. Previous studies have shown that the C in soil can be detected at wavelengths of 193.03 and 247.86 nm. The C line at 247.86 nm shows strong interference with Fe lines at 247.86 nm and 247.95 nm due to overlapping or self-absorption. To dismiss the problem of measuring the C line at 247.86 nm, the C line at 193.03 nm has been used to observe C emission. The C line at 193.03 nm can be quantified without interference from other elements, however, the ratio of Al line (198.90 nm) and Si line (212.40 nm) were used as standardizing factors to develop a significant calibration curve for soils. Although the wavelengths of both 193.03 and 247.86 nm presented the potential to measure C in soils, there has still been a lack of studies comparing the accuracy and effectiveness between the 193.03- and 247.8-nm C lines to analyze soil samples with different chemical and textural characteristics. In this study, we conducted extensive measurements of the C lines at 193.03 and 247.86 nm using LIBS to evaluate the C concentrations of Korean soils with different

  9. Percutaneous vertebroplasty - the role of osseous phlebography; Die perkutane Vertebroplastie - Rolle der ossaeren Phlebographie

    Energy Technology Data Exchange (ETDEWEB)

    Hierholzer, J.; Fuchs, H.; Westphalen, K.; Venz, S. [Diagnostische und Interventionelle Radiologie, Klinikum Ernst-von-Bergmann gGmbH, Potsdam (Germany); Pappert, D. [Klinik fuer Anaesthesiologie und Intensivtherapie, Klinikum Ernst-von-Bergmann gGmbH, Potsdam (Germany); Depriester, C. [Clinique DuBois, Lille (France)

    2005-03-01

    Purpose: To evaluate the usefulness of osseous phlebography preceding percutaneous vertebroplasty. Materials and Methods: Seventy-five patients with painful osteoporotic (57) or malignant (18) vertebral fractures were treated by percutaneous vertebroplasty under fluoroscopic control. Prior to cement injection, osseous phlebography was performed, with 247 phlebographic studies included in the retrospective correlation with radiographic and CT images. Clinical results were assessed by standardized questionnaire. Results: In 69/75 (92%) patients, pain and mobility improved and medication needed for pain control decreased significantly after vertebroplasty. Two clinically apparent complications occurred. The results of osseous phlebography prompted correction of the needle position in 34/247 (14%) of the procedures and cancellation of the cement injection in 19/247 (8%). No complications occurred related to osseous phlebography. CT was superior to conventional radiography in detecting extra-osseous cement leakage (106/247 by CT vs. 63/247 by conventional radiography). The cement leakage was asymptomatic in 104/106 (98%) cases for the duration of follow-up. Discussion: Osseous phlebography prior to percutaneous vertebroplasty had a significant impact on the procedure in our retrospective study and was able to predict the cement distribution in the majority of cases. However, phlebography was unable to foresee and therefore prevent 2 clinically relevant complications. Complications related to phlebography did not occur. (orig.)

  10. Single crystal growth of YBa2Cu4O8 and Y2Ba4Cu7O15 under high oxygen pressure

    International Nuclear Information System (INIS)

    In this paper, the authors investigate the crystal growth of YBa2Cu4O8 (124) and Y2Ba4Cu7O15 (247) in Al2O3 crucibles at an oxygen partial pressure of 10 MPa employing an O2-HIP apparatus in a mixed gas environment of Ar-20% O2. Various melts compositions, rich in Ba and Cu, are explored to optimize crystal growth of 124. Large 124 single crystals up to a size of 1 x 0.5 x 0.05 mm3 are obtained from compositions with about 65 ∼ 67% CuO. 247 crystals having a maximum size of 3 x 1.5 x 0.05 mm3 are grown from the same composition of melts. 124 crystals exhibit superconductivity at 75K. 247 crystals show Tc of 20K

  11. Origin of uranium isotope variations in early solar nebula condensates

    CERN Document Server

    Tissot, Francois L H; Grossman, Lawrence

    2016-01-01

    High temperature condensates found in meteorites display uranium isotopic variations (235U/238U) that complicate dating of the formation of the Solar System and whose origin remains mysterious. It is possible that these variations are due to decay of the short-lived radionuclide 247Cm (t1/2=15.6 Myr) into 235U but they could also be due to uranium kinetic isotopic fractionation during condensation. We report uranium isotope measurements of meteoritic refractory inclusions that reveal excesses of 235U reaching ~+6 % relative to average solar system composition, which can only be due to decay of 247Cm. This allows us to constrain the 247Cm/235U ratio at Solar System formation to (1.1 +- 0.3) x 10-4. This value provides new clues on the universality of nucleosynthetic r-process of rapid neutron capture.

  12. Origin of uranium isotope variations in early solar nebula condensates.

    Science.gov (United States)

    Tissot, François L H; Dauphas, Nicolas; Grossman, Lawrence

    2016-03-01

    High-temperature condensates found in meteorites display uranium isotopic variations ((235)U/(238)U), which complicate dating the solar system's formation and whose origin remains mysterious. It is possible that these variations are due to the decay of the short-lived radionuclide (247)Cm (t 1/2 = 15.6 My) into (235)U, but they could also be due to uranium kinetic isotopic fractionation during condensation. We report uranium isotope measurements of meteoritic refractory inclusions that reveal excesses of (235)U reaching ~+6% relative to average solar system composition, which can only be due to the decay of (247)Cm. This allows us to constrain the (247)Cm/(235)U ratio at solar system formation to (1.1 ± 0.3) × 10(-4). This value provides new clues on the universality of the nucleosynthetic r-process of rapid neutron capture. PMID:26973874

  13. Comparative efficacy of different post-emergence herbicides in wheat (triticum aestivum L.)

    International Nuclear Information System (INIS)

    A field experiment was carried out to study the efficacy of different post-emergence herbicides for controlling weeds in wheat during a Rabi season 2008-09. Experiment comprised of six treatments, i.e. weed-infested control, pyroxasulfone at 50 g a.i ha/sup -1/, metribuzin at 250 g a.i ha/sup -1/, isoproturon at 1080 g a.i ha/sup -1/, clodinafop propargyl at 240 g a.i ha/sup -1/ and as post-emergence herbicides. Results revealed that Post-emergence application of bromoxynil + MCPA at 247+247 g a.i ha/sup -1/ isoproturon (1080 g a.i ha) proved to be best for obtaining maximum grain plus straw yield up to the level of weed-free -1 -1 control. Bromoxynil + MCPA (247+247 g a.i ha) and clodinafop propargyl (240 g a.i ha/sup -1/) also gave maximum spike bearing tillers, number of grains spike and 1000-grain weight. Isoproturon (1080 g a.i ha/sup -1/) strictly reduced the weeds population as well as biomass as compared to weed-infested control. Poor weed control was achieved by using pyroxasulfone and metribuzin treatments. Hence, post-emergence Isoproturon (1080 g a.i ha/sup -1/) followed by bromoxynil + MCPA (247+247 g a.i ha/sup -1/ ) was provide to be the most effective herbicide against weeds and resulted in maximum wheat yield. (author)

  14. Comparative efficacy of different post-emergence herbicides in wheat (triticum aestivum l.)

    International Nuclear Information System (INIS)

    A field experiment was carried out to study the efficacy of different post-emergence herbicides for controlling weeds in wheat during a Rabi season 2008-09. Experiment comprised of six treatments, i.e. weed-infested control, pyroxasulfone at 50 g a.i ha/sup -1/, metribuzin at 250 g a.i ha/sup -1/, isoproturon at 1080 g a.i ha/sup -1/, clodinafop propargyl at 240 g a.i ha/sup -1/ and bromoxynil+MCPA at 247+247 g a.i ha/sup -1/ as post-emergence herbicides. Results revealed that Post-emergence application of isoproturon (1080 g a.i ha-1) proved to be best for obtaining maximum grain plus straw yield up to the level of weed-free control. Bromoxynil+MCPA (247+247 g a.i ha/sup -1/) and clodinafop propargyl (240 g a.i ha-1) also gave maximum spike bearing tillers, number of grains spike-1 and 1000-grain weight. Isoproturon (1080 g a.i ha/sup -1/) strictly reduced the weeds population as well as biomass as compared to weed-infested control. Poor weed control was achieved by using pyroxasulfone and metribuzin treatments. Hence, post-emergence Isoproturon (1080 g a.i ha/sup -1/) followed by bromoxynil + MCPA (247+247 g a.i ha/sup -1/) was provide to be the most effective herbicide against weeds and resulted in maximum wheat yield. (author)

  15. Thermomechanical and isothermal fatigue behavior of bare and coated superalloys

    International Nuclear Information System (INIS)

    Thermomechanical fatigue (TMF) and isothermal fatigue (IF) experiments were performed on bare Mar-M246 as well as bare and coated Mar-M247 nickel based superalloys at strain ranges from 0.335 to 1 percent. The experiments were conducted in air, through a temperature range of 500 to 1,038 C at a constant strain rate of 5.0 x 10-5 s-1. Due to the coarse-grained structure of Mar-M246, TMF lives scattered considerably under low strain range conditions. Electron microscopy studies show that significant surface oxidation and gamma prime, γ', depleted zones occur for Mar-M246 under these conditions. In the surface grain, where the change in γ' morphology is most pronounced, γ' rafted along axes ∼±45 deg from the loading axis. The influence of a protective coating on the IF and TMF lives of Mar-M247 was also examined. Results indicate that the coating does not significantly affect the fatigue lives of Mar-M247. The oxidation behavior of bare and coating Mar-M247 was investigated via X-ray microprobe and Auger Spectroscopy. Through these analyses, it is evident that the coating was completely degraded when exposed to the test environment for a long time. In both Mar-M246 and Mar-M247, in-phase thermomechanical fatigue (TMF IP) loading resulted in intergranular cracking. TMF IP loading promoted multiple cracks at the coating/substrate interface of coating Mar-M247. Finally, Eshelby techniques were used to calculate stress distributions in the vicinity of a surface oxide and second-phase particle at the coating/substrate interface

  16. Antigen dose escalation study of a VEGF-based therapeutic cancer vaccine in non human primates.

    Science.gov (United States)

    Morera, Yanelys; Bequet-Romero, Mónica; Ayala, Marta; Pérez, Pedro Puente; Castro, Jorge; Sánchez, Javier; Alba, José Suárez; Ancízar, Julio; Cosme, Karelia; Gavilondo, Jorge V

    2012-01-01

    CIGB-247 is a cancer therapeutic, based on recombinant modified human vascular endothelial growth factor (VEGF) as antigen, in combination with the oil free adjuvant VSSP (very small sized proteoliposomes of Neisseria meningitidis outer membrane). Our previous experimental studies in mice with CIGB-247 have shown that the vaccine has both anti-tumoral and anti-metastatic activity, and produces both antibodies that block VEGF-VEGF receptor interaction, and a specific T-cell cytotoxic response against tumor cells. CIGB-247, with an antigen dose of 100 μg, has been characterized by an excellent safety profile in mice, rats, rabbits, and non human primates. In this article we extend the immunogenicity and safety studies of CIGB-247 in non human primates, scaling the antigen dose from 100 μg to 200 and 400 μg/vaccination. Our results indicate that such dose escalation did not affect animal behavior, clinical status, and blood parameters and biochemistry. Also, vaccination did not interfere with skin deep skin wound healing. Anti-VEGF IgG antibodies and specific T-cell mediated responses were documented at all three studied doses. Antigen dose apparently did not determine differences in maximum antibody titer during the 8 weekly immunization induction phase, or the subsequent increase in antibodies seen for monthly boosters delivered afterwards. Higher antigen doses had a positive influence in antibody titer maintenance, after cessation of immunizations. Boosters were important to achieve maximum antibody VEGF blocking activity, and specific T-cell responses in all individuals. Purified IgG from CIGB-247 immunized monkey sera was able to impair proliferation and formation of capillary-like structures in Matrigel, for HMEC cells in culture. Altogether, these results support the further clinical development of the CIGB-247 therapeutic cancer vaccine, and inform on the potential mechanisms involved in its effect. PMID:22075086

  17. Hydrographic characterization of southeast Arabian Sea during the wane of southwest monsoon and spring intermonsoon

    Digital Repository Service at National Institute of Oceanography (India)

    VimalKumar, K.G.; DineshKumar, P.K.; Smitha, B.R.; Rahman, H.H.; Jacob, J.; Muraleedharan, K.R.; Sanjeevan, V.N.; Achuthankutty, C.T.

    Ocean, is bounded by the Asian land mass and Africa to the north and west and by the Indian subcontinent to the east. The AS is distinct Environ Monit Assess (2008) 140:231–247 DOI 10.1007/s10661-007-9863-3 K. G. Vimal Kumar : P. K. Dinesh Kumar (*) : B... Environ Monit Assess (2008) 140:231–247 appropriate in earlier investigations of coastal regions (Prell and Streeter 1982; Shetye et al. 1985). Water samples from standard depths (0, 10, 20, 30, 50, 75, 100 and 150) were analysed for nitrate and phosphate...

  18. AcEST: BP916105 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000083_B12 455 Adiantum capillus-veneris mRNA. clone: YMU001_000083_B12. BP916105 CL2842C ... LRAGFRPAKLSKQIVKDGKEIVKERYHKDFVID 557 Query: 182 DDSKW MLLGWKGRIMEGLSAWK 247 +D+ WM GWKGR++ +S WK Sbjct: 5 ... LRAGFKPATISKQIMKEAKEIVRKRYHRDFVID 576 Query: 182 DDSKW MLLGWKGRIMEGLSAWK 247 D+ WML GWKGR++ S WK Sbjct: 57 ... MRSGLVQVPFDPSIMKTSLHKVHTFYHKDFVID 691 Query: 182 DDSKW MLLGWKGRIMEGLSAWKRSS 256 D++W+L GWKGR + LS WK S Sbj ... RAGFRQIPLEKELVQKLKLMVESGYKPKEFDV 669 Query: 179 DDDSKW MLLGWKGRIMEGLSAW 244 D D W+L GWKGRI+ G S W Sbjct: 6 ...

  19. AcEST: DK956912 [AcEST

    Lifescience Database Archive (English)

    Full Text Available TST39A01NGRL0026_P19 565 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0026_P19. 5' end seq ... (53%), Gaps = 7/45 (15%) Frame = +1 Query: 247 FNGIPSG LHTSGFFAG-------ITSYQRTHAEEAPFSAPLLQGL 360 F GIPSG + ... S FF +T +++ AE+ PF L++ L Sbjct: 27 FRGIPSG IENSNFFLTTTRGEYVLTIFEKLTAEQLPFYLDLMRHL 71 >sp|Q0BAN ... (53%), Gaps = 7/45 (15%) Frame = +1 Query: 247 FNGIPSG LHTSGFFAG-------ITSYQRTHAEEAPFSAPLLQGL 360 F GIPSG + ... S FF +T +++ AE+ PF L++ L Sbjct: 27 FRGIPSG IENSNFFLTTTRGEYVLTIFEKLTAEQLPFYLDLMRHL 71 >sp|Q8WZ7 ...

  20. Mothers’ non-standard working and childcare-related challenges : A comparison between lone and coupled mothers

    OpenAIRE

    Moilanen, Sanna; May, Vanessa; Räikkönen, Eija; Sevón, Eija; Laakso, Marja-Leena

    2016-01-01

    Purpose – The purpose of this paper is to particularly focus on lone-mother families, comparing the childcare-related challenges experienced by working lone mothers and coupled mothers in three European countries in the context of a 24/7 economy and non-standard working hours (e.g. evening, night and weekend work). Design/methodology/approach – This study utilises survey data from Finnish, Dutch and British working mothers (n=1,106) collected as part of the “Families 24/7” research ...

  1. Structure-Based Engineering of Methionine Residues in the Catalytic Cores of Alkaline Amylase from Alkalimonas amylolytica for Improved Oxidative Stability

    OpenAIRE

    Yang, Haiquan; Liu, Long; Wang, Mingxing; Li, Jianghua; Wang, Nam Sun; Du, Guocheng; Chen, Jian

    2012-01-01

    This work aims to improve the oxidative stability of alkaline amylase from Alkalimonas amylolytica through structure-based site-directed mutagenesis. Based on an analysis of the tertiary structure, five methionines (Met 145, Met 214, Met 229, Met 247, and Met 317) were selected as the mutation sites and individually replaced with leucine. In the presence of 500 mM H2O2 at 35°C for 5 h, the wild-type enzyme and the M145L, M214L, M229L, M247L, and M317L mutants retained 10%, 28%, 46%, 28%, 72%,...

  2. Carbon isotope systematics of individual hydrocarbons in hydrothermal petroleum from Escanaba Trough, Northeastern Pacific Ocean

    Science.gov (United States)

    Simoneit, B.R.T.; Schoell, M.; Kvenvolden, K.A.

    1997-01-01

    We submitted individual aliphatic and polycyclic aromatic hydrocarbons in samples of hydrothermal petroleum from Escanaba trough to compound specific isotope analysis to trace their origins. The carbon isotope compositions of the alkanes and polycyclic aromatic hydrocarbons (means -27.5 and -24.7%, respectively) reflect a primarily terrestrial organic matter source.We submitted individual aliphatic and polycyclic aromatic hydrocarbons in samples of hydrothermal petroleum from Escanaba Trough to compound specific isotope analysis to trace their origins. The carbon isotope compositions of the alkanes and polycyclic aromatic hydrocarbons (means -27.5 and -24.7 per mill, respectively) reflect a primarily terrestrial organic matter source.

  3. New Antioxidative Secondary Metabolites from the Fruits of a Beibu Gulf Mangrove, Avicennia marina

    Directory of Open Access Journals (Sweden)

    Cheng-Hai Gao

    2014-07-01

    Full Text Available Further chemical investigation of the fruits of the mangrove, Avicennia marina, afforded three new phenylethyl glycosides, marinoids J–L (1–3, and a new cinnamoyl glycoside, marinoid M (4. The structures of isolates were elucidated on the basis of extensive spectroscopic analysis and by comparison of the data with those of related secondary metabolites. The antioxidant activity of the isolates was evaluated using the cellular antioxidant assay (CAA, and compounds 1–4 showed antioxidant activities, with EC50 values ranging from 23.0 ± 0.71 μM to 247.8 ± 2.47 μM.

  4. AcEST: BP916147 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000083_F11 432 Adiantum capillus-veneris mRNA. clone: YMU001_000083_F11. BP916147 - Show ... VDLFCRSGHLKDAHEFINQMPIKPNTVIWR 348 Query: 250 TMLASCRN LGNVEFGTEVFQHVMCLE 173 T+L +C GNVE G EV + + L+ Sbjc ... IDLFSRSGRLEEAMRFINGMPFPPDAIGWTT 545 Query: 247 MLASCRN LGNVEFG 206 +L++CRN ... GN+E G Sbjct: 546 LLSACRN KGNLEI ... VDMLTRAGLLSRAKEFIQEMPIKPDALVWRT 866 Query: 247 MLASCRN LGNVEFGTEVFQHVMCLESRST*LFCLCS 140 +L++C N+E G H++ L ... VDLLGRAGLLEDAHNLMKNMPFEPDAAIWG 582 Query: 250 TMLASCRN LGNVEFGTEVFQHVMCLESRST*LFCLCSLVSNL*RSSAQ 107 T+L + ...

  5. Cell Persistence of Allogeneic Keratinocytes and Fibroblasts Applied in a Fibrin Matrix to Acute, Full Thickness Wounds

    OpenAIRE

    Dickerson, Jaime E; Planz, John V.; Reece, Barry T.; Weedon, Kathy A.; Kirkpatrick, Sandy D.; Slade, Herbert B

    2012-01-01

    HP802-247 is a living cell suspension of cultured allogeneic growth-arrested human male keratinocytes and fibroblasts (1:9 ratio), intended for spray application to chronic wounds. In this study, a small wound was created on the arms of 28 healthy female volunteers (3-mm punch), followed by a single application of HP802-247. At each subsequent week for 8 weeks, a punch excision of the wounds was performed on a cohort of three subjects. Excised specimens were analyzed for allogeneic fibroblast...

  6. TET2 mutations in secondary acute myeloid leukemias: a French retrospective study

    OpenAIRE

    Kosmider, Olivier; Delabesse, Eric; Mas, Véronique Mansat-De; Cornillet-Lefebvre, Pascale; Blanchet, Odile; Delmer, Alain; Recher, Christian; Raynaud, Sophie; Bouscary, Didier; Viguié, Franck; Lacombe, Catherine; Bernard, Olivier A.; Ifrah, Norbert; Dreyfus, François; Fontenay, Michaëla

    2011-01-01

    Ten-eleven translocation 2 (TET2) mutations have been involved in myeloid malignancies. This retrospective study aims at evaluating the frequency and impact of TET2 mutations in 247 secondary acute myeloid leukemia cases referred to as myelodysplasia-related changes (n=201) or therapy-related (n=46) leukemias. Mutation of at least one copy of the TET2 gene was detected in 49 of 247 (19.8%) patients who presented with older age, higher hemoglobin level, higher neutrophil and monocyte counts, a...

  7. A new type-B cask design for transporting 252Cf

    International Nuclear Information System (INIS)

    A project to design, certify, and build a new US Department of Energy (DOE) Type B container for transporting >5 mg of 252Cf is more than halfway to completion. This project was necessitated by the fact that the existing Oak Ridge National Laboratory (ORNL) Type B containers were designed and built many years ago and thus do not have the records and supporting data that current regulations require. Once the new cask is available, it will replace the existing Type B containers. The cask design is driven by the unique properties of 252Cf, which is a very intense spontaneous fission neutron source and necessitates a large amount of neutron shielding. The cask is designed to contain up to 60 mg of 252Cf in the form of californium oxide or californium oxysulfate, in pellet, wire, or sintered material forms that are sealed inside small special-form capsules. The new cask will be capable of all modes of transport (land, sea, and air). The ORNL team, composed of technical and purchasing personnel and using rigorous selection criteria, chose NAC, International (NAC), as the subcontractor for the project. In January 1997, NAC started work on developing the conceptual design and performing the analyses. The original design concept was for a tungsten alloy gamma shield surrounded by two concentric shells of NS-4-FR neutron shield material. A visit to US Nuclear Regulatory Commission (NRC) regulators in November 1997 to present the conceptual design for their comments resulted in a design modification when the question of potential straight-line cracking in the NS-4-FR neutron shield material arose. NAC's modified design includes offset, wedgelike segments of the neutron shield material. The new geometry eliminates concerns about straight-line cracking but increases the weight of the packaging and makes the fabrication more complex. NAC has now completed the cask design and performed the analyses (shielding, structural, thermal, etc.) necessary to certify the cask. The cask

  8. The Development of Neutron Radiography and Tomography on a SLOWPOKE-2 Reactor

    Science.gov (United States)

    Bennett, L. G. I.; Lewis, W. J.; Hungler, P. C.

    Development of neutron radiography at the Royal Military College of Canada (RMC) started by trying to interest the Royal Canadian Air Force (RCAF) in this new non-destructive testing (NDT) technique. A Californium-252 based device was ordered and then installed at RMC for development of applicable techniques for aircraft by the first author. A second and transportable device was then designed, modified and used in trials at RCAF Bases and other locations for one year. This activity was the only foreign loan of the U.S. Californium Loan Program. Around this time, SLOWPOKE-2 reactors were being installed at four Canadian universities, while a new science and engineering building was being built at RMC. A reactor pool was incorporated and efforts to procure a reactor succeeded a decade later with a SLOWPOKE-2 reactor being installed at RMC. The only modification by the vendor for RMC was a thermal column replacing an irradiation site inside the reactor container for a later installation of a neutron beam tube (NBT). Development of a working NBT took several years, starting with the second author. A demonstration of the actual worth of neutron radiography took place with a CF-18 Hornet aircraft being neutron and X-radiographed at McClellan Air Force Base, Sacramento, CA. This inspection was followed by one of the rudders that had indications of water ingress being radiographed successfully at RMC just after the NBT became functional. The next step was to develop a neutron radioscopy system (NRS), initially employing film and then digital imaging, and is in use today for all flight control surfaces (FCS). With the third author, a technique capable of removing water from affected FCS was developed at RMC. Heating equipment and a vacuum system were utilized to carefully remove the water. This technique was proven using a sequence of near real time neutron images obtained during the drying process. The results of the drying process were correlated with a relative humidity

  9. Sustainable management of church property

    Czech Academy of Sciences Publication Activity Database

    Nedvědová, Klára; Schneiderová Heralová, R.

    Prague: Grada, 2013 - (Hájek, P.; Tywoniak, J.; Lupíšek, A.; Sojková, K.), s. 741-744 ISBN 978-80-247-5015-6. [CESB13 - Central Europe towards sustainable building 2013. Praha (CZ), 26.06.2013-28.06.2013] Institutional support: RVO:68378297 Keywords : management * church property * valuation Subject RIV: AL - Art, Architecture, Cultural Heritage

  10. Institutional Discharges and Subsequent Shelter Use among Unaccompanied Adults in New York City

    Science.gov (United States)

    Metraux, Stephen; Byrne, Thomas; Culhane, Dennis P.

    2010-01-01

    This study empirically examines the link between homelessness and discharges from other institutions. An administrative record match was undertaken to determine rates of discharge from institutional care for 9,247 unaccompanied adult shelter users in New York City. Cluster analysis and multinomial logistic regression analysis was then used to…

  11. 48 CFR 3447.7000 - Foreign travel clause.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 7 2010-10-01 2010-10-01 false Foreign travel clause... REGULATION CONTRACT MANAGEMENT TRANSPORTATION Foreign Travel 3447.7000 Foreign travel clause. The contracting officer shall insert the clause in 3452.247-70, Foreign Travel, in all solicitations and resultant...

  12. ENVIRONMENTAL TECHNOLOGY VERIFICATION, TEST REPORT OF CONTROL OF BIOAEROSOLS IN HVAC SYSTEMS, AIRFLOW PRODUCTS AFP30

    Science.gov (United States)

    The Environmental Technology Verification report discusses the technology and performance of the AFP30 air filter for dust and bioaerosol filtration manufactured by Airflow Products. The pressure drop across the filter was 62 Pa clean and 247 Pa dust loaded. The filtration effici...

  13. Field-theoretic calculation of kinetic helicity flux

    Indian Academy of Sciences (India)

    V Avinash; Mahendra K Verma; Amar K Chandra

    2006-02-01

    In this paper we apply perturbative field-theoretic technique to helical turbulence. In the inertial range the kinetic helicity flux is found to be constant and forward. The universal constant H appearing in the spectrum of kinetic helicity was found to be 2.47.

  14. 48 CFR 747.507 - Contract clauses.

    Science.gov (United States)

    2010-10-01

    ... (48 CFR) FAR 52.247-64 as prescribed in (48 CFR) FAR 27.507(a) in other situations. ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Contract clauses. 747.507 Section 747.507 Federal Acquisition Regulations System AGENCY FOR INTERNATIONAL DEVELOPMENT...

  15. Progressive rod-cone degeneration (PRCD) in selected dog breeds and variability in its phenotypic expression

    Czech Academy of Sciences Publication Activity Database

    Dostál, Jaromír; Hrdlicová, Anna; Horák, Pavel

    2011-01-01

    Roč. 56, č. 5 (2011), s. 243-247. ISSN 0375-8427 Institutional research plan: CEZ:AV0Z50450515 Keywords : canine * retinitis pigmentosa * autosomal Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 0.748, year: 2011

  16. Preservice Teachers' Internet Addiction in Terms of Gender, Internet Access, Loneliness and Life Satisfaction

    Science.gov (United States)

    Demirer, Veysel; Bozoglan, Bahadir; Sahin, Ismail

    2013-01-01

    The aim of this study is to investigate pre-service teachers' Internet addiction in terms of gender, Internet accessibility, loneliness and life satisfaction. Statistical analyses were completed on the data by the 247 preservice teachers that filled the surveys completely. According to findings, pre-service teachers' level of loneliness and…

  17. Kosmopolitizace společnosti a transkulturní obrat

    Czech Academy of Sciences Publication Activity Database

    Kreuzzieger, Milan

    PrahaBratislava: Filosofia, 2014 - (Dinuš, P.; Hohoš, L.; Hrubec, M.), s. 236-247 ISBN 978-80-7007-413-8; ISBN 978-80-224-1371-8 Institutional support: RVO:67985955 Keywords : critical cosmopolitanism * cosmopolitization * cross-cultural turn * U. Beck Subject RIV: AA - Philosophy ; Religion

  18. Relationship between the concave integrals and the pan-integrals on finite spaces

    Czech Academy of Sciences Publication Activity Database

    Ouyang, Y.; Li, J.; Mesiar, Radko

    2015-01-01

    Roč. 424, č. 2 (2015), s. 975-987. ISSN 0022-247X Institutional support: RVO:67985556 Keywords : Monotone measure Minimal atom * Concave integral * Pan-integral * Minimal atom Subject RIV: BA - General Mathematics Impact factor: 1.120, year: 2014 http://library.utia.cas.cz/separaty/2015/E/mesiar-0441980.pdf

  19. Effect of soil invertebrates on the formation of humic substances under laboratory conditions

    Czech Academy of Sciences Publication Activity Database

    Frouz, Jan; Li, X.; Brune, A.; Pižl, Václav; Abakumov, E.V.

    2011-01-01

    Roč. 44, č. 8 (2011), s. 893-896. ISSN 1064-2293 R&D Projects: GA ČR GA526/01/1055; GA MŠk 2B08023 Institutional research plan: CEZ:AV0Z60660521 Keywords : mineralization * transformation * protein Subject RIV: EH - Ecology, Behaviour Impact factor: 0.247, year: 2011

  20. An Eigenvalue Inequality for Schrodinger Operators with delta- and delta '-interactions Supported on Hypersurfaces

    Czech Academy of Sciences Publication Activity Database

    Lotoreichik, Vladimir; Rohleder, J.

    Vol. 247. Basel: Birkhauser Verlag AG, 2015, s. 173-184. ISBN 978-3-319-18181-3. ISSN 0255-0156. [24th International Workshop on Operator Theory and Its Applications (IWOTA). Bangalore (IN), 16.12.2013-20.12.2013] Institutional support: RVO:61389005 Keywords : delta- and delta' - interactions on a hypersurface * discrete spectrum * eigenvalue Subject RIV: BE - Theoretical Physics

  1. A theoretical study of FeNC in the 6delta electronic ground state

    Czech Academy of Sciences Publication Activity Database

    Hirano, T.; Okuda, R.; Nagashima, U.; Špirko, Vladimír; Jensen, P.

    2006-01-01

    Roč. 236, č. 2 (2006), s. 234-247. ISSN 0022-2852 R&D Projects: GA AV ČR IAA400550511 Institutional research plan: CEZ:AV0Z40550506 Keywords : ab initio * rotation-vibration energies * structure Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 1.260, year: 2006

  2. Determinant of Mobile Devices Acceptance for Learning among Students in Developing Country

    Science.gov (United States)

    Tajudeen, Shittu Ahmed; Basha, Madarsha Kamal; Michael, Fakomogbon O.; Mukthar, Alhaji Liman

    2013-01-01

    This study was conducted to understand the determinant of mobile devices for learning among students in the developing world. A sample of 247 undergraduate students from Malaysia and Nigeria were involved in the study. An adapted but modified survey instrument was used to gather the data of the study. The variable of the study are perceived…

  3. Human Right to Environment at the National Level: Only on Paper or Really Applied?

    Czech Academy of Sciences Publication Activity Database

    Müllerová, Hana

    Ljubljana: IUS Software, GV Založba, 2014 - (Sancin, V.; Kovič Dine, M.), s. 157-170 ISBN 978-961-247-280-1 R&D Projects: GA ČR(CZ) GA14-32244S Institutional support: RVO:68378122 Keywords : environmental rights * right to environment * national constitutions * Czech Republic Subject RIV: AG - Legal Sciences

  4. 7 CFR 2902.17 - Plastic insulating foam for residential and commercial construction.

    Science.gov (United States)

    2010-01-01

    ... Comprehensive Procurement Guideline, 40 CFR 247.12. EPA provides recovered materials content recommendations for... 7 Agriculture 15 2010-01-01 2010-01-01 false Plastic insulating foam for residential and... BIOBASED PRODUCTS FOR FEDERAL PROCUREMENT Designated Items § 2902.17 Plastic insulating foam...

  5. Drug: D04893 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D04893 Drug Mefenorex hydrochloride (USAN) C12H18ClN. HCl 247.0895 248.192 D04893.gif Anorexic A ... AND METABOLISM A08 ANTIOBESITY PREPARATIONS, EXCL. DIET ... PRODUCTS A08A ANTIOBESITY PREPARATIONS, EXCL. DIET ...

  6. 76 FR 3843 - Final Guidance for Federal Departments and Agencies on the Appropriate Use of Mitigation and...

    Science.gov (United States)

    2011-01-21

    ..., Establishing, Revising and Using Categorical Exclusions, 75 FR 75628, Dec. 6, 2010. In a Federal Register... Guidance for NEPA Mitigation and Monitoring, 75 FR 8046, Feb. 23, 2010. Mitigation Planning Some commenters... (NEPA), 42 U.S.C. 4344, and Executive Order No. 11,514, 35 FR 4,247 (Mar. 5, 1970), as amended...

  7. 24 CFR 290.7 - Occupancy requirements.

    Science.gov (United States)

    2010-04-01

    ... multifamily housing project is governed by 24 CFR part 247, subpart B. (c) Threat to health and safety. Whenever HUD determines that there is an immediate threat to the health and safety of the tenants, HUD may... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Occupancy requirements....

  8. Gender Differences in Academic Self-Efficacy: A Meta-Analysis

    Science.gov (United States)

    Huang, Chiungjung

    2013-01-01

    A meta-analysis of 187 studies containing 247 independent studies (N = 68,429) on gender differences in academic self-efficacy identified an overall effect size of 0.08, with a small difference favoring males. Moderator analysis demonstrated that content domain was a significant moderator in explaining effect size variation. Females displayed…

  9. National Runaway Safeline

    Science.gov (United States)

    ... compassionate person and build a plan together. OR Learn more about what to expect Email Open 24/7. Email us questions about what is ... will respond within two hours. Email Now Forum Open ... the Forum OR Learn more about what to expect Need to Talk? ...

  10. 48 CFR 2823.403 - Policy.

    Science.gov (United States)

    2010-10-01

    ... For Products Containing Recovered Materials (CPG) (40 CFR part 247). The recommended minimum recovered... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Policy. 2823.403 Section....403 Policy. It is the policy of DOJ that its contracting activities and contractors that procure...

  11. Work Design, Role Conflict, and Role Ambiguity: The Case of Elementary and Secondary Schools.

    Science.gov (United States)

    Bacharach, Samuel B.; And Others

    1990-01-01

    Work design outcomes (role conflict, role ambiguity, stress symptomatology, turnover, and militancy) were assessed in New York State. Out of 3,200 mailed surveys, 2,247 teacher questionnaires were returned and analyzed. Managerial and educational policy implications of the findings for elementary school and secondary schools are discussed. (SLD)

  12. "You Cannot Talk with All of the Strangers in a Pub": A Longitudinal Case Study of International Postgraduate Students' Social Ties at a British University

    Science.gov (United States)

    Schartner, Alina

    2015-01-01

    The formation of social ties is a major factor in the international student experience (Ramsay et al. in High Educ 54(2):247-265, 2007), influencing student wellbeing and adjustment to the new academic and sociocultural environment (Ward et al. in The psychology of culture shock. Routledge, Hove, 2001). Although a significant body of research in…

  13. Evaluating Career Success of African American Males: It's What You Know and Who You Are that Matters

    Science.gov (United States)

    Johnson, C. Douglas; Eby, Lillian T.

    2011-01-01

    The objectives of the present study were to identify the factors related to career success of college educated, African American men and to explore the relative importance of human capital, social capital, individual differences, and demographic attributes in predicting career success. Using a sample of 247 African American males, we found some…

  14. Surface modification of cyclic olefin copolymers for osteochondral defect repair can increase pro-destructive potential of human chondrocytes in vitro

    Czech Academy of Sciences Publication Activity Database

    Polanská, M.; Hulejová, H.; Petrtýl, M.; Bastl, Zdeněk; Spirovová, Ilona; Kruliš, Zdeněk; Horák, Zdeněk; Veigl, D.; Šenolt, L.

    2010-01-01

    Roč. 59, č. 2 (2010), s. 247-253. ISSN 0862-8408 R&D Projects: GA ČR GA106/06/0761 Institutional research plan: CEZ:AV0Z40400503; CEZ:AV0Z40500505 Keywords : osteochondral defects * cycloolefin copolymer * chondrocytes * biocompatibility Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 1.646, year: 2010

  15. The Mars Pathfinder atmospheric structure investigation/meteorology (ASI/MET) experiment

    DEFF Research Database (Denmark)

    Schofield, J.T.; Barnes, J.R.; Crisp, D.;

    1997-01-01

    The Mars Pathfinder atmospheric structure investigation/meteorology (ASI/MET) experiment measured the vertical density, pressure, and temperature structure of the martian atmosphere from the surface to 160 km, and monitored surface meteorology and climate for 83 sols (1 sol = 1 martian day = 24.7...

  16. Ethnic Microaggressions and the Depressive and Somatic Symptoms of Latino and Asian American Adolescents

    Science.gov (United States)

    Huynh, Virginia W.

    2012-01-01

    Ethnic microaggressions are a form of everyday, interpersonal discrimination that are ambiguous and difficult to recognize as discrimination. This study examined the frequency and impact of microaggressions among Latino (n = 247) and Asian American (n = 113) adolescents (M[subscript age] = 17.18, SD = 0.75; 57% girls). Latino adolescents reported…

  17. The role of meta-topolins on the photosynthetic pigment profiles and foliar structures of micropropagated 'Williams' bananas

    Czech Academy of Sciences Publication Activity Database

    Aremu, A.O.; Bairu, M. W.; Szüčová, Lucie; Finnie, J.F.; van Staden, J.

    2012-01-01

    Roč. 169, č. 15 (2012), s. 1530-1541. ISSN 0176-1617 R&D Projects: GA MZe QI92A247 Grant ostatní: GA MŠk(CZ) ED0007/01/01 Institutional research plan: CEZ:AV0Z50380511 Keywords : carotenoids * chlorophylls * cytokinins Subject RIV: GK - Forestry Impact factor: 2.699, year: 2012

  18. The 1855 Visp (Switzerland) earthquake: a milestone in macroseismic methodology?

    Czech Academy of Sciences Publication Activity Database

    Gisler, M.; Kozák, Jan; Vaněk, Jiří

    Dordrecht: Springer, 2008 - (Fréchet, J.; Meghraoui, M.; Stucchi, M.), s. 231-247. (Modern approaches in solid earth sciences). ISBN 978-1-4020-8221-4 Institutional research plan: CEZ:AV0Z30120515 Keywords : history of seismology * 1855 Visp earth quake * macroseismology Subject RIV: DC - Siesmology, Volcanology, Earth Structure

  19. Heutige Villen, 1989-2009

    Czech Academy of Sciences Publication Activity Database

    Švácha, Rostislav

    Praha : Foibos, 2011 - (Švácha, R.), s. 247-250 ISBN 978-80-87073-31-5 Institutional research plan: CEZ:AV0Z80330511 Keywords : villa * private ownership * building type Subject RIV: AL - Art, Architecture, Cultural Heritage

  20. Phylogeny of the Neotropical cichlid fish tribe Cichlasomatini (Teleostei: Cichlidae) based on morphological and molecular data, with the description of a new genus

    Czech Academy of Sciences Publication Activity Database

    Musilová, Zuzana; Říčan, Oldřich; Novák, J.

    2009-01-01

    Roč. 47, č. 3 (2009), s. 234-247. ISSN 0947-5745 R&D Projects: GA MŠk LC06073 Institutional research plan: CEZ:AV0Z50450515 Keywords : Cichlasomatini * Andinoacara * Aequidens Subject RIV: EH - Ecology, Behaviour Impact factor: 1.850, year: 2009

  1. Thinking Styles and Preferred Teacher Interpersonal Behavior among Hong Kong Students

    Science.gov (United States)

    Yu, Tak-ming; Chen, Chen

    2012-01-01

    This study investigated the relationship between thinking styles and preferred teacher interpersonal behavior based on the Model for Interpersonal Teacher Behavior (MITB, Wubbels, Creton, & Hooymayers, 1985) among 247 Hong Kong secondary school female students. The Thinking Style Inventory Revised (TSI-R, Sternberg, Wagner, & Zhang, 2003) and the…

  2. Moving the Law School into the Twenty-First Century--Embedding Technology into Teaching and Learning

    Science.gov (United States)

    Steventon, Beverley; Panesar, Sukhninder; Wood, Jane

    2014-01-01

    Over the past twenty years phenomenal developments in technology have changed the nature of education. Students now have access to a vast range of resources 24/7. This instant access has created a certain expectation on the part of the student and there must now be very few, if any, courses taught in higher education where the lecturer does not…

  3. Using Theory to Tell It Like It Is

    Science.gov (United States)

    Waterman, Stephanie J.

    2013-01-01

    In this article a graduate level diversity course, "Diversity & Equity in Higher Education" that is based on Johnson's (2005) "Privilege, Power, and Difference," and Critical Race Theory (CRT) (Tate in "Rev Res Educ" 22:195-247, 1997) is described. Johnson's concepts, such as paths of least resistance,…

  4. Reasoning about Family Honour among Two Generations of Hindu Indian-Americans

    Science.gov (United States)

    Kay, Adam

    2012-01-01

    To investigate reasoning about family honour, 128 first generation (mean age = 27.2 years) and second generation Hindu Indian-American adults (mean age = 24.7 years) were presented hypothetical scenarios in which male or female protagonists defied common Hindu customs (e.g., arranged marriage, intra-religion marriage and premarital sexual…

  5. The Teaching of the Code of Ethics and Standard Practices for Texas Educator Preparation Programs

    Science.gov (United States)

    Davenport, Marvin; Thompson, J. Ray; Templeton, Nathan R.

    2015-01-01

    The purpose of this descriptive quantitative research study was to answer three basic informational questions: (1) To what extent ethics training, as stipulated in Texas Administrative Code Chapter 247, was included in the EPP curriculum; (2) To what extent Texas public universities with approved EPP programs provided faculty opportunities for…

  6. Software News and Update MOLCAS 7: The Next Generation

    Czech Academy of Sciences Publication Activity Database

    Aquilante, F.; De Vico, L.; Ferré, N.; Ghigo, G.; Malmqvist, P. A.; Neogrady, P.; Pedersen, T. B.; Pitoňák, Michal; Reiher, M.; Roos, B. O.; Serrano-Andrés, L.; Urban, M.; Veryazov, V.; Lindh, R.

    2010-01-01

    Roč. 31, č. 1 (2010), s. 224-247. ISSN 0192-8651 R&D Projects: GA MŠk LC512 Institutional research plan: CEZ:AV0Z40550506 Keywords : MOLCAS * Cholesky decomposition * coupled cluster Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 4.050, year: 2010

  7. The Relation of Cumulative Demographic Risk to Mothers' Responsivity and Control: Examining the Role of Toddler Temperament

    Science.gov (United States)

    Popp, Tierney K.; Spinrad, Tracy L.; Smith, Cynthia L.

    2008-01-01

    The relations of cumulative demographic risk and children's temperament to mothers' parenting behaviors were examined when children were 18 (T1, n = 247) and 30 (T2, n = 216) months of age. Mothers, nonparental caregivers (e.g., child care providers), and observers reported on children's temperament to create a temperament composite, and mothers…

  8. Identification of the aeroelastic profile based on optical measurement

    Czech Academy of Sciences Publication Activity Database

    Chládek, Štěpán; Zolotarev, Igor

    Brno: Brno University of Technology , 2014 - (Fuis, V.), s. 244-247 ISBN 978-80-214-4871-1. ISSN 1805-8248. [Engineering Mechanics 2014 /20./. Svratka (CZ), 12.05.2014-15.05.2014] R&D Projects: GA ČR GA13-10527S Institutional support: RVO:61388998 Keywords : system identification * aeroelastic profile * optical measurement Subject RIV: BI - Acoustics

  9. Kdo byl Ferdinand Břetislav Mikovec?

    Czech Academy of Sciences Publication Activity Database

    Petrbok, Václav

    Praha : Institut umění - Divadelní ústav, 2010 - (Ludvová, J.; Pinkerová, H.), s. 5-53 ISBN 978-80-7008-247-8 Institutional research plan: CEZ:AV0Z90560517 Keywords : theatre history * Mikovec, Ferdinand Břetislav * theatre criticism * 19th century * Prague Subject RIV: AJ - Letters, Mass-media, Audiovision

  10. Search for doubly-charged Higgs bosons in like-sign dilepton final states at √s = 7 TeV with the ATLAS detector

    Czech Academy of Sciences Publication Activity Database

    Aad, G.; Abajyan, T.; Abbott, B.; Böhm, Jan; Chudoba, Jiří; Gallus, Petr; Gunther, Jaroslav; Jakoubek, Tomáš; Juránek, Vojtěch; Kepka, Oldřich; Kupčo, Alexander; Kůs, Vlastimil; Lokajíček, Miloš; Marčišovský, Michal; Mikeštíková, Marcela; Myška, Miroslav; Němeček, Stanislav; Růžička, Pavel; Schovancová, Jaroslava; Šícho, Petr; Staroba, Pavel; Svatoš, Michal; Taševský, Marek; Tic, Tomáš; Valenta, J.; Vrba, Václav; Zeman, Martin

    2012-01-01

    Roč. 72, č. 12 (2012), s. 1-18. ISSN 1434-6044 R&D Projects: GA MŠk LA08032 Institutional support: RVO:68378271 Keywords : ATLAS * CERN * charged particle * charge * Higgs particle * mass * lower limit * dilepton * same sign * scattering * channel cross section Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 5.247, year: 2012

  11. Disease: H00142 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available I: a 10-year follow-up study. J Neurol Sci 247:65-9 (2006) PMID:19568825 Caciotti A, Di Rocco M, Filocamo M...u RK, Ro LS, Chang HS First report of two Taiwanese siblings with sialidosis type

  12. 7 CFR 2902.19 - Composite panels.

    Science.gov (United States)

    2010-01-01

    .... The designation can be found in the Comprehensive Procurement Guideline, 40 CFR 247.12. EPA provides... 7 Agriculture 15 2010-01-01 2010-01-01 false Composite panels. 2902.19 Section 2902.19 Agriculture... Composite panels. (a) Definitions. (1) Plastic lumber composite panels. Engineered products suitable for...

  13. Corrigendum to “Cross-sections of solution funnels” [J. Math. Anal. Appl. 433 (2) (2016) 957–973

    Czech Academy of Sciences Publication Activity Database

    Hájek, Petr Pavel; Vivi, P.

    2016-01-01

    Roč. 435, č. 1 (2016), s. 1017. ISSN 0022-247X Institutional support: RVO:67985840 Keywords : polynomial algebra Subject RIV: BA - General Mathematics Impact factor: 1.120, year: 2014 http://www.sciencedirect.com/science/article/pii/S0022247X15010264

  14. X-band antiferromagnetic resonance measurements in KNiF3

    Science.gov (United States)

    Causa, M. T.; Passeggi, M. C. G.

    1985-09-01

    The antiferromagnetic resonance spectrum of KNiF3 has been studied at temperatures close to TN=247 K. Each spectrum consists of a very broad line and the line shape has been analyzed in terms of the Landau-Lifshitz phenomenological equations. The spectrum disappears at T~230 K, a fact which, we suggest, is caused by the reorientation of the antiferromagnetic domains.

  15. Underneath Hypercapitalism

    Science.gov (United States)

    Luke, Allan

    2007-01-01

    As Joel Spring's (2007/this issue) description of Singapore's Orchard Road suggests, Benetton, Zara, Nike, BMW, LG, and Microsoft dominate the visual and textual landscape where signage, advertising, packaging, labeling, and the environments of the connected underground malls and walkways merge into a wall-to-wall, 24/7 print and visual…

  16. 78 FR 803 - Revisions to Electric Reliability Organization Definition of Bulk Electric System and Rules of...

    Science.gov (United States)

    2013-01-04

    ... Procedure, Notice of Proposed Rulemaking, 77 FR 39857 (July 5, 2012) 139 FERC ] 61,247 (2012) (NOPR). I... the potential for the exercise of discretion and subjectivity to exclude such configurations from the... the potential for inconsistency and subjectivity. Further NERC explained that the exception process...

  17. The Relation between Different Facets of Creativity and the Dark Side of Personality

    Science.gov (United States)

    Dahmen-Wassenberg, Phoebe; Kämmerle, Monika; Unterrainer, Human-Friedrich; Fink, Andreas

    2016-01-01

    This study examined the relation between different facets of creativity and personality, focusing on the dark side of personality. In a sample of 247 students, psychometric measures for the assessment of the dark triad of personality (subclinical narcissism, Machiavellianism, subclinical psychopathy), personality organization (structural deficit:…

  18. Resolution of alpha/beta-amino acids by enantioselective penicillin G acylase from Achromobacter sp

    Czech Academy of Sciences Publication Activity Database

    Grulich, Michal; Brezovský, J.; Štěpánek, Václav; Palyzová, Andrea; Kyslíková, Eva; Kyslík, Pavel

    2015-01-01

    Roč. 122, DEC 2015 (2015), s. 240-247. ISSN 1381-1177 R&D Projects: GA MŠk(CZ) ED1.1.00/02.0109 Institutional support: RVO:61388971 Keywords : Penicillin G acylase * Enantioselectivity * Homologous model Subject RIV: CE - Biochemistry Impact factor: 2.128, year: 2014

  19. Speciallægen er ikke i front på de danske akutafdelinger (The use of consultants in the Emergency Department)

    DEFF Research Database (Denmark)

    Mackenhauer, Julie; Møller, Marianne Cecilie Markvard; Fjældstad, Alexander; Østervig1, Rebecca; Al ¤Kole1, Ayhan; Folkestad, Lars; Hallas, Peter; Brabrand, Mikkel; Moellekaer, Anders; Kirkegaard, Hans

    2013-01-01

    not staffed by consultants 24/7, 51% report difficulties in recruiting qualified personnel and 33% report problems connected to retaining them. 71% believe that a specialty in emergency medicine could help solve these problems. Danish EDs do not comply with the visions of the reorganisation plan....

  20. Discovery of a transient U-band dropout in a Lyman break survey : A tidally disrupted star at z=3.3?

    NARCIS (Netherlands)

    Stern, D; van Dokkum, PG; Nugent, P; Sand, DJ; Ellis, RS; Sullivan, M; Bloom, JS; Frail, DA; Kneib, JP; Koopmans, LVE; Treu, T

    2004-01-01

    We report the discovery of a transient source in the central regions of galaxy cluster A267. The object, which we call "PALS-1,'' was found in a survey aimed at identifying highly magnified Lyman break galaxies in the fields of intervening rich clusters. At discovery, the source had U(n)>24.7 (2 sig