WorldWideScience

Sample records for californium 247

  1. Californium-252

    International Nuclear Information System (INIS)

    1975-01-01

    This meeting constituted the third phase of a project initiated by the Dosimetry Section of the IAEA in 1973. The first step, early in 1973, consisted of the development of a programme for the loan of Cf-252 sources to the Member States in support of education, training and some limited research. To date, 14 institutions in 13 Member States have participated in this loan programme. In August last year, the Agency published an instructional syllabus and laboratory manual authored by Professors Eric J. Hall and Harald H. Rossi of Columbia University (Californium-252 in Teaching and Research, Technical Reports Series No. 159). The appearance of this publication, including guidance on the design and construction of a storage and use facility, was the second phase of this programme aimed at providing some support to potential users in the fields of radiation biology and dosimetry. The objective of the programme's third phase - the convening of an Educational Seminar - was to provide a forum to bring together participants in the Agency's loan programme and experts in various scientific fields. Specifically, the Seminar consisted of a series of expert presentations in spectrometry, activation and prompt gamma analyses, on-stream analysis, dosimetry, health physics, radiology and radiotherapy. (author)

  2. Magnetism in californium

    International Nuclear Information System (INIS)

    Moore, J.R.

    1988-03-01

    A SQUID-based magnetic susceptometer has been constructed for studying small radioactive samples at temperatures below 350 K and in magnetic fields up to 50 kilogauss. The device has been used to study californium (element 98) in a number of solid-state forms: the dhcp metal, several oxides (Cf 2 O 3 in both the bcc and monoclinic structures, Cf 7 O 12 , CfO 2 and BaCfO 3 ), several monopnictides (CfN, CfAs and CfSb) and the trichloride (in both the hexagonal and orthorhombic structures). All of these materials were studied in polycrystalline form, and hexagonal CfCl 3 was studied in single-crystal form as well. The susceptometer has the sensitivity to measure samples containing less than 10 micrograms of californium. The magnetic susceptibilities of all of the californium materials at temperatures above about 100 K are described well by the Curie-Weiss relationship. This behavior is consistent with the assumption that the magnetic 5f electrons are localized and that the paramagnetic behavior can be interpreted in terms of the properties of the free ion. The measured values of the effective paramagnetic moment, μ/sub eff/, for all the californium materials that were studied are reasonably consistent with theoretical values based on intermediate coupling models. All of the californium materials showed some indications of cooperative magnetic effects. The dhcp metal was observed to order ferromagnetically at 52 K, and all of the californium compounds studied showed signs of antiferromagnetic ordering, mostly at temperatures below 25 K. 91 refs., 50 figs., 19 tabs

  3. Medical applications of californium-252

    International Nuclear Information System (INIS)

    Oliver, G.D. Jr.

    1975-01-01

    Primarily, californium-252 sources have been utilized in medicine for the treatment of neoplastic lesions. For five years, a coordinated effort between several cancer research institutions and national laboratories has developed the necessary physics, radiobiology, and engineering skills to establish an evaluation program for californium. Several more years of combined effort are required before it is known whether californium therapy is as good as or better than conventional therapy with sources like radium. Recently, development of diagnostic applications of californium in medicine has received attention. Studies comparing neutron decay activation analysis versus prompt capture gamma ray analysis are in progress. A hopeful application of prompt analysis with reasonable quantities (200 μg) of californium is the elemental analysis of bone in the human body. (U.S.)

  4. Californium loan programme

    International Nuclear Information System (INIS)

    1974-01-01

    The offer of the United States to loan Californium-252 sources to the IAEA was made by Dr. Glenn T. Seaborg, then chairman of the USAEC, in his opening statement at the 15th. General Conference of the IAEA held in Vienna in 1971. The purpose of this loan was to make neutron emitting sources available to universities in the Member States for use in educational programmes. The sources, in the form of small needles designed for medical use in radiation therapy, were judged highly suitable for didactic applications due to their small size, limited activity and well documented radiological parameters. Subsequently, in May 1973, the Director General announced the availability of the Californium sources to the Member States. To date, numerous sources have been loaned to universities in Czechoslovakia, Costa Rica, the Federal Republic of Germany, Ghana, India, Iran, Israel, Japan, South Africa, Switzerland, the United Kingdom and Uruguay; additional applications for loans are being processed. It is anticipated that the loan programme will be terminated in 1975 once all the available sources have been distributed. n order to provide guidance for the Member States on the safe exploitation of these sources, a prototype use and storage facility was designed by IAEA staff of the Dosimetry Section of the Division of Life Sciences, and constructed at the IAEA laboratory in Seibersdorf, Austria. Figures 2-5 illustrate some of the details of this container, which is being given to the Ghana Nuclear Centre in support of a training programme for students at the university in Accra. Further advice to users of these sources will be provided by the publication of an instructional syllabus, a laboratory manual for experiments and the safety precautions inherent in the proper handling of neutron emitting radionuclides, authored by Professors Erich J. Hall and Harald H. Rossi of Columbia University. The syllabus and manual will be published as part of the IAEA Technical Series in September

  5. Californium source transfer

    International Nuclear Information System (INIS)

    Wallace, C.R.

    1995-01-01

    In early 1995, the receipt of four sealed californium-252 sources from Oak Ridge National Lab was successfully accomplished by a team comprised of Radiological Engineering, Radiological Operations and Health Physics Instrumentation personnel. A procedure was developed and walked-down by the participants during a Dry Run Evolution. Several special tools were developed during the pre-planning phases of the project which reduced individual and job dose to minimal levels. These included a mobile lifting device for attachment of a transfer ball valve assembly to the undercarriage of the Cannonball Carrier, a transfer tube elbow to ensure proper angle of the source transfer tube, and several tools used during emergency response for remote retrieval and handling of an unshielded source. Lessons were learned in the areas of contamination control, emergency preparedness, and benefits of thorough pre-planning, effectiveness of locally creating and designing special tools to reduce worker dose, and methods of successfully accomplishing source receipt evolutions during extreme or inclement weather

  6. Californium-252 progress, report No. 7, April 1971

    Energy Technology Data Exchange (ETDEWEB)

    1971-12-31

    This report contains discusses of the following topics on Californium-252: First sales of californium-252; encapsulation services discussed; three new participants in market evaluation program; summer training programs to use californium; Californium-252 shipping casks available; Californium-252 questions and answers, radiotherapy; neutron radiography; natural resources exploration; nuclear safeguards; process control; dosimetry; neutron radiography; neutron shielding; and nuclear safeguards.

  7. Uranium standards for Californium Shuffler

    International Nuclear Information System (INIS)

    Gibbs, A.; Boynton, S.P.

    1978-10-01

    The Laboratories Department analyzed pieces of a U-Al log which were to be canned and used as a set of standards for the nondestructive Californium Shuffler instrument. Evaluation of this instrument is part of an on-going Safeguards Program and is a joint project between LASL and SRP. A U-Al casting of a nominal 30% to 70% composition was made with enriched uranium (56 wt % 235 U). The log was 6 in. in diameter and approximately 2 ft long. A 1/4-in. slice was made before and after each 1-in. slice taken for use as a standard. The 1-in. slices were scanned nondestructively by collimated gamma pulse height analysis. The 1/4-in. slices were divided into quadrants and one quadrant for each slice was destructively analyzed. Results from these tests showed an approximate 1.5% relative variation in uranium concentration from the high to the low point. Successive pieces showed less than 1% relative difference. The 1-in. pieces have been canned and shipped to LASL for testing and will be returned with the Californium Shuffler. The remaining 1/4-in. slices have been sent to NBL and LASL for destructive analysis

  8. Radiography using californium-252 neutron sources

    International Nuclear Information System (INIS)

    Ray, J.W.

    1975-01-01

    The current status in the technology of neutron radiography using californium-252 neutron sources is summarized. Major emphasis is on thermal neutron radiography since it has the widest potential applicability at the present time. Attention is given to four major factors which affect the quality and useability of thermal neutron radiography: source neutron thermalization, neutron beam extraction geometry, neutron collimator dimensions, and neutron imaging methods. Each of these factors has a major effect on the quality of the radiographs which are obtained from a californium source neutron radiography system and the exposure times required to obtain the radiographs; radiograph quality and exposure time in turn affect the practicality of neutron radiography for specific nondestructive inspection applications. A brief discussion of fast neutron radiography using californium-252 neutron sources is also included. (U.S.)

  9. Californium-252 radiotherapy sources for interstitial afterloading

    International Nuclear Information System (INIS)

    Permar, P.H.; Walker, V.W.

    1976-01-01

    Californium-252 neutron sources for interstitial afterloading were developed to investigate the value of this radionuclide in cancer therapy. Californium-252 seed assemblies contain essentially point sources of 252 Cf permanently sealed on 1-cm centers within a flexible plastic tube. The seed assemblies are fabricated with remotely operated, specially designed machines. The fabrication process involves the production of a Pt-10 percent Ir-clad wire with a 252 Cf 2 O 3 -Pd cermet core. The wire is swaged and drawn to size, cut to length, and welded in a Pt-10 percent Ir capsule 0.8 mm in diameter and 6 mm long. Each seed capsule contains approximately 0.5 microgram of 252 Cf. Because the effective half-life of 252 Cf is 2.6 years, the seed assemblies are not disposable and must be reused until their activities have decreased to unsuitable levels. The flexible plastic components must therefore have sufficient resistance to radiation damage to survive the neutron-plus-gamma radiation from 252 Cf. On the basis of accelerated irradiation tests with a large 252 Cf source, a recently developed fluoropolymer, ''Tefzel'' (trademark of E. I. du Pont de Nemours and Company) has adequate radiation resistance for this application. Californium-252 seed assembly systems are loaned by the United States Energy Research and Development Administration for clinical investigations under a protocol of the Radiation Therapy Oncology Group, U.S. National Cancer Institute

  10. Historical review of californium-252 discovery and development

    International Nuclear Information System (INIS)

    Stoddard, D.H.

    1985-01-01

    This paper discusses the discovery and history of californium 252. This isotope may be synthesized by irradiating plutonium 239, plutonium 242, americium 243, or curium 244 with neutrons in a nuclear reactor. Various experiments and inventions involving 252 Cf conducted at the Savannah River Plant are discussed. The evolution of radiotherapy using californium 252 is reviewed

  11. Californium-252: a remarkable versatile radioisotope

    International Nuclear Information System (INIS)

    Osborne-Lee, I.W.; Alexander, C.W.

    1995-01-01

    A product of the nuclear age, Californium-252 ( 252 Cf) has found many applications in medicine, scientific research, industry, and nuclear science education. Californium-252 is unique as a neutron source in that it provides a highly concentrated flux and extremely reliable neutron spectrum from a very small assembly. During the past 40 years, 252 Cf has been applied with great success to cancer therapy, neutron radiography of objects ranging from flowers to entire aircraft, startup sources for nuclear reactors, fission activation for quality analysis of all commercial nuclear fuel, and many other beneficial uses, some of which are now ready for further growth. Californium-252 is produced in the High Flux Isotope Reactor (HFIR) and processed in the Radiochemical Engineering Development Center (REDC), both of which are located at the Oak Ridge National Laboratory (ORNL) in Oak Ridge, Tennessee. The REDC/HFIR facility is virtually the sole supplier of 252 Cf in the western world and is the major supplier worldwide. Extensive exploitation of this product was made possible through the 252 Cf Market Evaluation Program, sponsored by the United States Department of Energy (DOE) [then the Atomic Energy Commission (AEC) and later the Energy Research and Development Administration (ERDA)]. This program included training series, demonstration centers, seminars, and a liberal loan policy for fabricated sources. The Market Evaluation Program was instituted, in part, to determine if large-quantity production capability was required at the Savannah River Laboratory (SRL). Because of the nature of the product and the means by which it is produced, 252 Cf can be produced only in government-owned facilities. It is evident at this time that the Oak Ridge research facility can meet present and projected near-term requirements. The production, shipment, and sales history of 252 Cf from ORNL is summarized herein

  12. Californium-252: a remarkable versatile radioisotope

    Energy Technology Data Exchange (ETDEWEB)

    Osborne-Lee, I.W.; Alexander, C.W.

    1995-10-10

    A product of the nuclear age, Californium-252 ({sup 252}Cf) has found many applications in medicine, scientific research, industry, and nuclear science education. Californium-252 is unique as a neutron source in that it provides a highly concentrated flux and extremely reliable neutron spectrum from a very small assembly. During the past 40 years, {sup 252}Cf has been applied with great success to cancer therapy, neutron radiography of objects ranging from flowers to entire aircraft, startup sources for nuclear reactors, fission activation for quality analysis of all commercial nuclear fuel, and many other beneficial uses, some of which are now ready for further growth. Californium-252 is produced in the High Flux Isotope Reactor (HFIR) and processed in the Radiochemical Engineering Development Center (REDC), both of which are located at the Oak Ridge National Laboratory (ORNL) in Oak Ridge, Tennessee. The REDC/HFIR facility is virtually the sole supplier of {sup 252}Cf in the western world and is the major supplier worldwide. Extensive exploitation of this product was made possible through the {sup 252}Cf Market Evaluation Program, sponsored by the United States Department of Energy (DOE) [then the Atomic Energy Commission (AEC) and later the Energy Research and Development Administration (ERDA)]. This program included training series, demonstration centers, seminars, and a liberal loan policy for fabricated sources. The Market Evaluation Program was instituted, in part, to determine if large-quantity production capability was required at the Savannah River Laboratory (SRL). Because of the nature of the product and the means by which it is produced, {sup 252}Cf can be produced only in government-owned facilities. It is evident at this time that the Oak Ridge research facility can meet present and projected near-term requirements. The production, shipment, and sales history of {sup 252}Cf from ORNL is summarized herein.

  13. Californium-252 sales and loans at Oak Ridge National Laboratory

    International Nuclear Information System (INIS)

    King, L.J.

    1987-01-01

    The production and distribution in the United States of 252 Cf has recently been consolidated at the Oak Ridge National Laboratory (ORNL). The 252 Cf Industrial Sales/Loan Program and the 252 Cf University Load Program, which were formerly located at the Savannah River Plant (SRP), have been combined with the californium production and distribution activities of the Transuranium Element Production Program at ORNL. Californium-252 is sold to commercial users in the form of bulk californium oxide, palladium-californium alloy pellets, or alloy wires. Neutron source capsules, which are fabricated for loans to DOE or other US government agencies, are still available in all forms previously available. The consolidation of all 252 Cf distribution activities at the production site is expected to result in better service to users. In particular, customers for neutrons sources will be ale to select from a wider range of neutron source forms, including custom designs, through a single contact point

  14. Calibration of a Modified Californium Shuffler

    International Nuclear Information System (INIS)

    Sadowski, E.T.; Armstrong, F.; Oldham, R.; Ceo, R.; Williams, N.

    1995-01-01

    A californium shuffler originally designed to assay hollow cylindrical pieces of UA1 has been modified to assay solid cylinders. Calibration standards were characterized via chemical analysis of the molten UA1 taken during casting of the standards. The melt samples yielded much more reliable characterization data than drill samples taken from standards after the standards had solidified. By normalizing one well-characterized calibration curve to several standards at different enrichments, a relatively small number of standards was required to develop an enrichment-dependent calibration. The precision of this shuffler is 0.65%, and the typical random and systematic uncertainties are 0.53% and 0.73%, respectively, for a six minute assay of an ingot containing approximately 700 grams of 235 U. This paper will discuss (1) the discrepancies encountered when UA1 standards were characterized via melt samples versus drill samples, (2) a calibration methodology employing a small number of standards, and (3) a comparison of results from a previously unused shuffler with an existing shuffler. A small number of UA1 standards have been characterized using samples from the homogeneous molten state and have yielded enrichment-dependent and enrichment-independent calibration curves on two different shufflers

  15. Californium production at the transuranium processing plant

    International Nuclear Information System (INIS)

    King, L.J.

    1976-01-01

    The Transuranium Processing Plant (TRU) at ORNL, which is the production, storage, and distribution center for the ERDA heavy element research program, is described. About 0.5 percent of 252 Cf is currently being produced. TRU is a hot-cell, chemical processing facility of advanced design. New concepts have been incorporated into the facility for absolute containment, remote operation, remote equipment installation, and remote maintenance. The facilities include a battery of nine heavily shielded process cells served by master-slave manipulators and eight laboratories, four on each of two floors. Processing includes chemical dissolution of the targets followed by a series of solvent extraction, ion exchange, and precipitation steps to separate and purify the transuranium elements. The transcurium elements Bk, Cf, Es, and Fm are distributed to users. Remote techniques are used to fabricate the Am and Cm into target rods for reirradiation in the HFIR. Californium-252 that is in excess of the needs of the heavy element research program and the Cf sales program is stored at TRU and processed repeatedly to recover the daughter product 248 Cm, which is a highly desirable research material

  16. Fabrication of californium-252 sources in the United Kingdom

    International Nuclear Information System (INIS)

    Ainsworth, A.; Brady, M.W.; Thornett, W.H.

    1975-01-01

    The advent of californium-252 in weighable quantities and at a reasonable price has caused some rethinking among neutron source suppliers. To explore this market the Radiochemical Center Ltd. has purchased 2 mg of californium-252, and subdivided this into a wide range of sources. To take advantage of its high specific neutron emission, a small double welded stainless steel capsule 7.8mm diameter x 10mm high was chosen for stock sources and this entailed the use of a microdispensing technique which had to be specially developed. The apparatus and procedure for subdividing milligram amounts of californium-252 are described. Some details of our experience in processing these one milligram shipments are given. 100 sources with activities from 200 microgram to 0.01 microgram have been produced. Losses have been small. Measurement of neutron spectra gamma spectra and dose rates from encapsulated sources has confirmed published data. Though it is early days, little industrial interest in californium-252 sources has been detected, most of the sources have so far been required for research into activation analysis and two examples of this are given. (U.S.)

  17. Californium Multiplier. Part I. Design for neutron radiography

    International Nuclear Information System (INIS)

    Crosbie, K.L.; Preskitt, C.A.; John, J.; Hastings, J.D.

    1982-01-01

    The Californium Multiplier (CFX) is a subcritical assembly of enriched uranium surrounding a californium-252 neutron source. The function of the CFX is to multiply the neutrons emitted by the source to a number sufficient for neutron radiography. The CFX is designed to provide a collimated beam of thermal neutrons from which the gamma radiation is filtered, and the scattered neutrons are reduced to make it suitable for high resolution radiography. The entire system has inherent safety features, which provide for system and personnel safety, and it operates at moderate cost. In Part I, the CFX and the theory of its operation are described in detail. Part II covers the performance of the Mound Facility CFX

  18. Production, Distribution, and Applications of Californium-252 Neutron Sources

    International Nuclear Information System (INIS)

    Balo, P.A.; Knauer, J.B.; Martin, R.C.

    1999-01-01

    The radioisotope 252 Cf is routinely encapsulated into compact, portable, intense neutron sources with a 2.6-year half-life. A source the size of a person's little finger can emit up to 10 11 neutrons/s. Californium-252 is used commercially as a reliable, cost-effective neutron source for prompt gamma neutron activation analysis (PGNAA) of coal, cement, and minerals, as well as for detection and identification of explosives, laud mines, and unexploded military ordnance. Other uses are neutron radiography, nuclear waste assays, reactor start-up sources, calibration standards, and cancer therapy. The inherent safety of source encapsulations is demonstrated by 30 years of experience and by U.S. Bureau of Mines tests of source survivability during explosions. The production and distribution center for the U. S Department of Energy (DOE) Californium Program is the Radiochemical Engineering Development Center (REDC) at Oak Ridge National Laboratory (ORNL). DOE sells 252 Cf to commercial reencapsulators domestically and internationally. Sealed 252 Cf sources are also available for loan to agencies and subcontractors of the U.S. government and to universities for educational, research, and medical applications. The REDC has established the Californium User Facility (CUF) for Neutron Science to make its large inventory of 252 Cf sources available to researchers for irradiations inside uncontaminated hot cells. Experiments at the CUF include a land mine detection system, neutron damage testing of solid-state detectors, irradiation of human cancer cells for boron neutron capture therapy experiments, and irradiation of rice to induce genetic mutations

  19. Prompt neutron spectrum of the spontaneous fission of californium-252

    International Nuclear Information System (INIS)

    Zamyatnin, Yu.S.; Kroshkin, N.I.; Korostylev, V.A.; Nefedov, V.N.; Ryazanov, D.K.; Starostov, B.I.; Semenov, A.F.

    1976-01-01

    The californium-252 spontaneous fission neutron spectrum was measured in the energy range of 0.01 to 10 MeV by the time-of-flight technique using various neutron detectors. The measurements of 252 Cf neutron spectrum at energies of 0.01 to 5 MeV were performed as a function of fission fragment kinetic energy. The mean neutron spectrum energy in the range of 0.7 to 10 MeV was found from the results of measurements. The irregularity in the 252 Cf neutron spectrum in the neutron energy range of less than 0.7 MeV compared to theoretical values is discussed. The mechanism of 252 Cf neutron emission is also discussed on the basis of neutron yield angle measurements. 12 references

  20. A californium-252 source for radiobiological studies at Hiroshima University

    International Nuclear Information System (INIS)

    Kato, Kazuo; Takeoka, Seiji; Kuroda, Tokue; Tsujimura, Tomotaka; Kawami, Masaharu; Hoshi, Masaharu; Sawada, Shozo

    1987-01-01

    A 1.93 Ci (3.6 mg) californium-252 source was installed in the radiation facility of the Research Institute for Nuclear Medicine and Biology, Hiroshima University. This source produces fission neutrons (8.7 x 10 9 n/s at the time of its installation), which are similar to neutron spectrum of the atomic bombs. It is useful for studying biological effects of fission neutrons and neutron dosimetry. An apparatus was dosigned to accomodate this source and to apply it to such studies. It has resulted in profitable fission neutron exposures, while suppressing scattered neutrons and secondary gamma rays. This apparatus incorporates many safety systems, including one which interlocks with all of doors and an elevator serving the exposure room, so as to prevent accidents involving users. (author)

  1. Application of californium-252 neutron sources for analytical chemistry

    International Nuclear Information System (INIS)

    Ishii, Daido

    1976-01-01

    The researches made for the application of Cf-252 neutron sources to analytical chemistry during the period from 1970 to 1974 including partly 1975 are reviewed. The first part is the introduction to the above. The second part deals with general review of symposia, publications and the like. Attention is directed to ERDA publishing the periodical ''Californium-252 Progress'' and to a study group of Cf-252 utilization held by Japanese Radioisotope Association in 1974. The third part deals with its application for radio activation analysis. The automated absolute activation analysis (AAAA) of Savannha River is briefly explained. The joint experiment of Savannha River operation office with New Brunswick laboratory is mentioned. Cf-252 radiation source was used for the non-destructive analysis of elements in river water. East neutrons of Cf-252 were used for the quantitative analysis of lead in paints. Many applications for industrial control processes have been reported. Attention is drawn to the application of Cf-252 neutron sources for the field search of neutral resources. For example, a logging sonde for searching uranium resources was developed. the fourth part deals with the application of the analysis with gamma ray by capturing neutrons. For example, a bore hole sonde and the process control analysis of sulfur in fuel utilized capture gamma ray. The prompt gamma ray by capturing neutrons may be used for the nondestructive analysis of enrivonment. (Iwakiri, K.)

  2. Teratogenic effect of Californium-252 irradiation in rats

    International Nuclear Information System (INIS)

    Satow, Yukio; Lee, Juing-Yi; Hori, Hiroshi; Okuda, Hiroe; Tsuchimoto, Shigeo; Sawada, Shozo; Yokoro, Kenjiro

    1989-01-01

    The teratogenicity of Californium-252 (Cf-252) irradiation which generates approximately 70% 2.3 MeV fast neutron and 30% gamma rays was evaluated. A single whole body exposure of Cf-252 at various doses was given to pregnant rats on day 8 or 9 of pregnancy, followed by microscopic autopsy of the fetuses at the terminal stage of pregnancy to search for external and internal malformations. For comparison, pregnant rats were irradiated with various doses of Cobalt-60 (Co-60) standard gamma rays at the same dose rate (1 rad/min.). The doses were 20-120 rad of Cf-252 and 80-220 rad of Co-60. Using frequency of radiation induced malformations observed on day 8 of pregnancy as an index, relative biological effectiveness (RBE) of 2.3-2.7 was obtained from the straight line obtained by modifying by the least squares method the frequency curves of malformed fetuses in total implants and in surviving fetuses. The types of malformations induced by Cf-252 and Co-60 irradiation were alike. Using fetal LD 50 as an index, 2.4 was obtained as RBE when irradiated on day 8 of pregnancy and 3.1 as that when irradiated on day 9. The results showed that Cf-252 had stronger a teratogenic effect than Co-60 gamma rays. (author)

  3. Experimental studies on californium bioavailability to marine benthic invertebrates

    International Nuclear Information System (INIS)

    Fowler, S.W.; Carvalho, F.P.; Aston, S.R.

    1986-01-01

    252 Cf is readily taken up by benthic invertebrates from sea water, reaching whole-body concentration factors of 763 in the polychaete Hermione hystrix, 220 in the shrimp Lysmata seticaudata, 665 in the crab Pilumnus hirtellus and 78 in the bivalve mollusc Venerupis decussata after 3 weeks exposure. Surface sorption plays a predominant role in the uptake process. Depuration in clean sea water was a relatively slow process. The shrimp Lysmata eliminated 252 Cf very rapidly due to moulting. Absorption coefficients for ingested 252 Cf were high, approx. 23% in crabs and approx. 97% in brittlestars. The absorbed fraction was excreted twice as fast from crabs as brittlestars. Exposure of organisms to labelled sediment resulted in low transfer factors that were species dependent. There is some evidence to suggest that uptake from sediments is primarily due to 252 Cf transfer from the pore water. Comparison of these results with published experimental data on other transuranic nuclides in the same or similar species suggests that californium bioavailability is roughly equivalent to that of plutonium and americium. (author)

  4. Biomedical neutron research at the Californium User Facility for Neutron Science

    International Nuclear Information System (INIS)

    Martin, R.C.; Byrne, T.E.; Miller, L.F.

    1998-01-01

    The Californium User Facility for Neutron Science has been established at Oak Ridge National Laboratory (ORNL). The Californium User Facility (CUF) is a part of the larger Californium Facility, which fabricates and stores compact 252 Cf neutron sources for worldwide distribution. The CUF can provide a cost-effective option for research with 252 Cf sources. Three projects at the CUF that demonstrate the versatility of 252 Cf for biological and biomedical neutron-based research are described: future establishment of a 252 Cf-based neutron activation analysis system, ongoing work to produce miniature high-intensity, remotely afterloaded 252 Cf sources for tumor therapy, and a recent experiment that irradiated living human lung cancer cells impregnated with experimental boron compounds to test their effectiveness for boron neutron capture therapy. (author)

  5. Proposed Californium-252 User Facility for Neutron Science at Oak Ridge National Laboratory

    International Nuclear Information System (INIS)

    Martin, R.C.; Laxson, R.R.; Knauer, J.B.

    1996-01-01

    The Radiochemical Engineering Development Center (REDC) at ORNL has petitioned to establish a Californium-252 User Facility for Neutron Science for academic, industrial, and governmental researchers. The REDC Californium Facility (CF) stores the national inventory of sealed 252 Cf neutron source for university and research loans. Within the CF, the 252 Cf storage pool and two uncontaminated hot cells currently in service for the Californium Program will form the physical basis for the User Facility. Relevant applications include dosimetry and experiments for neutron tumor therapy; fast and thermal neutron activation analysis of materials; experimental configurations for prompt gamma neutron activation analysis; neutron shielding and material damage studies; and hardness testing of radiation detectors, cameras, and electronics. A formal User Facility simplifies working arrangements and agreements between US DOE facilities, academia, and commercial interests

  6. Biomedical neutron research at the Californium User Facility for neutron science

    International Nuclear Information System (INIS)

    Martin, R.C.; Byrne, T.E.; Miller, L.F.

    1997-01-01

    The Californium User Facility for Neutron Science has been established at Oak Ridge National Laboratory (ORNL). The Californium User Facility (CUF) is a part of the larger Californium Facility, which fabricates and stores compact 252 Cf neutron sources for worldwide distribution. The CUF can provide a cost-effective option for research with 252 Cf sources. Three projects at the CUF that demonstrate the versatility of 252 Cf for biological and biomedical neutron-based research are described: future establishment of a 252 Cf-based neutron activation analysis system, ongoing work to produce miniature high-intensity, remotely afterloaded 252 Cf sources for tumor therapy, and a recent experiment that irradiated living human lung cancer cells impregnated with experimental boron compounds to test their effectiveness for boron neutron capture therapy

  7. X-ray-diffraction study of californium metal to 16 GPa

    International Nuclear Information System (INIS)

    Peterson, J.R.; Benedict, U.; Dufour, C.; Birkel, I.; Haire, R.G.

    1983-01-01

    The first series of measurements to determine the structural behavior of californium (Cf) metal under pressure has been carried out. The initial dhcp structure transformed sluggishly with increasing pressure to a fcc structure. A bulk modulus of 50(5) GPa was derived for dhcp Cf metal from the relative volume (V/V 0 ) data to 10 GPa

  8. Study of the shielding for spontaneous fission sources of Californium-252

    International Nuclear Information System (INIS)

    Davila R, I.

    1991-06-01

    A shielding study is made to attenuate, until maximum permissible levels, the neutrons radiation and photons emitted by spontaneous fission coming from a source of Californium-252. The compound package by a database (Library DLC-23) and the ANISNW code is used, in it version for personal computer. (Author)

  9. Assessment of the neutron component in a neutron-gamma field of a californium-252 source

    International Nuclear Information System (INIS)

    Tetteh, G.K.

    1978-12-01

    Experiments have been performed to determine the percentages of the different components in the radiation field of californium-252 which has now some clinical applications. Using Rossi Chambers in conjunction with absorption investigations involving lead and aluminium thimbles, it is observed that the dose rates due to the different components are: neutrons 54%; gammas 30%; betas 16%

  10. 7 CFR 247.27 - Financial management.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Financial management. 247.27 Section 247.27... AGRICULTURE CHILD NUTRITION PROGRAMS COMMODITY SUPPLEMENTAL FOOD PROGRAM § 247.27 Financial management. (a) What are the Federal requirements for State and local agencies with regard to financial management...

  11. 43 CFR 24.7 - Exemptions.

    Science.gov (United States)

    2010-10-01

    ... 43 Public Lands: Interior 1 2010-10-01 2010-10-01 false Exemptions. 24.7 Section 24.7 Public Lands...-FEDERAL RELATIONSHIPS § 24.7 Exemptions. (a) Exempted from this policy are the following: (1) The control and regulation by the United States, in the area in which an international convention or treaty...

  12. 7 CFR 247.18 - Nutrition education.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Nutrition education. 247.18 Section 247.18 Agriculture... CHILD NUTRITION PROGRAMS COMMODITY SUPPLEMENTAL FOOD PROGRAM § 247.18 Nutrition education. (a) What are the State agency's responsibilities in ensuring that nutrition education is provided? The State agency...

  13. Local Structure in Americium and Californium Hexa-cyanoferrates - Comparison with Their Lanthanide Analogues

    International Nuclear Information System (INIS)

    Dupouy, G.; Bonhoure, I.; Dumas, Th.; Moisy, Ph.; Petit, S.; Den Auwer, Ch.; Conradson, St.D.; Hennig, Ch.; Scheinost, A.C.; Le Naour, C.; Simoni, E.

    2011-01-01

    Metal hexa-cyanoferrates are well known molecular solids for a large variety of cations, although very little has been described for actinide adducts. Two new members of actinide(III) hexa-cyanoferrates were synthesized with the cations americium and californium. They were structurally characterized by infrared and X-ray absorption spectroscopy. Combined EXAFS data at the iron K edge and actinide L 3 edge provide evidence for a three-dimensional model for these two new compounds. Structural data in terms of bond lengths were compared to those reported for the parent lanthanide(III) compounds, neodymium and gadolinium hexa-cyanoferrates, respectively: the americium compound with (KNd(III)Fe(II)-Fe-III(CN) 6 .4H 2 O and the californium compound with (KGd(III)Fe(II)(CN) . 3.5H 2 O and (KGd(III)Fe(II)(CN) 6 .3H 2 O. This comparison between actinide and lanthanide homologues has been carried out on the basis of ionic radii considerations. The americium and neodymium environments appear to be very similar and are arranged in a tri-capped trigonal prism polyhedron of coordination number 9 (CN: 9), in which the americium atom is bonded to six nitrogen atoms and to three water molecules. For the californium adduct, a similar comparison and bond length and angle values derived from EXAFS studies suggest that the californium cation sits in a bi-capped trigonal prism (CN: 8) as in (KGd(III)Fe(II)(CN) 6 . 3H 2 O. This arrangement differs from that in the structure of (KGd(III)Fe(II)(CN) 6 .3.5H 2 O, in which the gadolinium atom is surrounded by 9 atoms. This is one of the rare pieces of information revealed by EXAFS spectroscopy for americium and californium in comparison to lanthanide atoms in molecular solid compounds. A discussion on the decrease in bond length and coordination number from americium to californium is also provided, on the basis of crystallographic results reported in the literature for actinide(III) and lanthanide(III) hydrate series. (authors)

  14. ISA 247: trans-ISA 247, trans-R 1524, ISA(TX)247, ISAtx 247, ISATx247, LX 211, LX211, R 1524, R-1524.

    Science.gov (United States)

    2007-01-01

    Isotechnika is developing the immunosuppressive drug ISA 247, a calcineurin inhibitor that is undergoing clinical development for the treatment of psoriasis (phase III) and prevention of organ rejection after transplantation (phase II). Preclinical development for uveitis is also underway. Other autoimmune disease indications that could be explored include arthritis, type I diabetes and Crohn's disease. ISA 247 was being co-developed as R 1524 by Isotechnika and Roche. However, Roche is no longer involved in the development of this compound. Based on analysis of previously collected data, the trans-ISA 247 isomer was found to be more bioavailable and it is expected that this isomer can be administered at a lower dose compared with the previous formulation that consisted of an equivalent mixture of the two geometric isomers (cis and trans). Preclinical observations indicate that ISA 247 has the potential to be more potent and less toxic than other marketed immunosuppressants in its class used for the prevention of transplant rejection. Experiments to date suggest that ISA 247 is about three times as potent as ciclosporin, while genotoxicity studies in animals have shown that the compound has a significantly reduced tendency to cause renal toxicity. The combination of reduced toxicity and improved potency would give ISA 247 a therapeutic benefit over existing calcineurin-based treatments. Isotechnika and Roche entered into a co-development and commercialisation agreement in April 2002, with Roche gaining the exclusive worldwide marketing rights for ISA 247; Isotechnika received milestone payments of $US4 million and $CAN21.9 million in September 2002 and May 2003, respectively. The agreement was restructured in April 2004, under which Isotechnika will now solely manage and fund the clinical development of trans-ISA 247. Upon successful completion of these trials, Isotechnika will conduct at its own expense a phase IIb study in renal transplantation and phase III

  15. Atlantic Richfield Hanford Company californium multiplier/delayed neutron counter safety analysis

    International Nuclear Information System (INIS)

    Zimmer, W.H.

    1976-08-01

    The Californium Multiplier (CFX) is a subcritical assembly of uranium surrounding 252 Cf spontaneously fissioning neutron sources; its function is to multiply the neutron flux to a level useful for activation analysis. This document summarizes the safety analysis aspects of the CFX, DNC, pneumatic transfer system, and instrumentation and to detail all the aspects of the total facility as a starting point for the ARHCO Safety Analysis Review. Recognized hazards and steps already taken to neutralize them are itemized

  16. Instrumental neutron activation determination of gold in mineral raw materials using a californium neutron source

    International Nuclear Information System (INIS)

    Shilo, N.A.; Ippolitov, E.G.; Ivanenko, V.V.; Kustov, B.N.; Zheleznov, V.V.; Aristov, G.N.; Kovalenko, V.V.; Kondrat'ev, N.B.

    1983-01-01

    A facility using a californium neutron source and a method for the neutron activation analysis of gold were developed. The sensitivity of the determination is 0.1 g/t. The causes of random and systematic errors have been studied. It is concluded that in prospection and evaluation of gold ore deposists, the traditional test tube analysis for gold may be replaced with the developed method. (author)

  17. Safety Analysis Report for Packaging (SARP) of the Oak Ridge National Laboratory TRU Californium Shipping Container

    International Nuclear Information System (INIS)

    Box, W.D.; Shappert, L.B.; Seagren, R.D.; Klima, B.B.; Jurgensen, M.C.; Hammond, C.R.; Watson, C.D.

    1980-01-01

    An analytical evaluation of the Oak Ridge National Laboratory TRU Californium Shipping Container was made in order to demonstrate its compliance with the regulations governing off-site shipment of packages that contain radioactive material. The evaluation encompassed five primary categories: structural integrity, thermal resistance, radiation shielding, nuclear criticality safety, and quality assurance. The results of this evaluation demonstrate that the container complies with the applicable regulations

  18. Spectroscopic and redox properties of curium and californium ions in concentrated aqueous carbonate-bicarbonate media

    International Nuclear Information System (INIS)

    Hobart, D.E.; Varlashkin, P.G.; Samhoun, K.; Haire, R.G.; Peterson, J.R.

    1983-01-01

    Multimilligram quantities of trivalent curium-248 and californium-249 were investigated by absorption spectroscopy, cyclic voltammetry, and bulk solution electrolysis in concentrated aqueous carbonate-bicarbonate solution. Actinide concentrations between 10 -4 and 10 -2 M were studied in 2 M sodium carbonate and 5.5 M potassium carbonate solutions at pH values from 8 to 14. The solution absorption spectra of Cm(III) and Cf(III) in carbonate media are presented for the first time and compared to literature spectra of these species in noncomplexing aqueous solution. It was anticipated that carbonate complexation of the actinide ions could provide a sufficient negative shift in the formal potentials of the M(IV)/M(III) couples of Cm and Cf to permit the generation and stabilization of their tetravalent states in aqueous carbonate-bicarbonate medium. No conclusive evidence was found in the present work to indicate the existence of any higher oxidation states of curium or californium in carbonate solution. Some possible reasons for our inability to generate and detect oxidized species of curium and californium in this medium are discussed

  19. Convenient method of simultaneously analyzing aluminum and magnesium in pharmaceutical dosage forms using californium-252 thermal neutron activation

    International Nuclear Information System (INIS)

    Landolt, R.R.; Hem, S.L.

    1983-01-01

    A commercial antacid suspension containing aluminum hydroxide and magnesium hydroxide products was used as a model sample to study the use of a californium-252 thermal neutron activation as a method for quantifying aluminum content as well as for the simultaneous assay of aluminum and magnesium. A 3.5-micrograms californium-252 source was used for the activation, and the induced aluminum-28 and magnesium-27 activity was simultaneously measured by sodium iodide crystal gamma-ray spectrometry using dual single-channel analyzers and scalers. The antacid suspension was contained in a chamber designed with the unique capability of serving as the container for counting the induced radioactivity in addition to being the irradiation chamber itself. This pilot study demonstrated that use of more intense californium-252 sources, which are commonly available, would provide a method that is competitive with the ethylenediaminetetraacetic acid titration method in precision and in other aspects as well

  20. 40 CFR 247.13 - Transportation products.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Transportation products. 247.13 Section 247.13 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES... Transportation products. (a) Traffic barricades and traffic cones used in controlling or restricting vehicular...

  1. Erythroderma: analysis of 247 cases

    Directory of Open Access Journals (Sweden)

    Cidia Vasconcellos

    1995-06-01

    Full Text Available The profile of 247 patients with erythroderma during a 23 year period from January, 1962 through March, 1985, with a follow-up period ranging from 1 to 26 years were analysed. The patients presented with diffuse erythema, scaling and pruritus of more than 2 months' duration, and the age ranged from 16 to 60 years. Psoriasis was the most frequent underlying disease with an estimated frequency of 44.9%, the reaction to the use of drugs appeared in 7.3% of total cases and association with reticulosis showed a frequency of 4.1%. The cause of the erythroderma could not be determined in 29.2% of the cases. Sex differences in terms of underlying diseases were not observed. One or more skin biopsies along with the clinical findings were diagnostic or suggestive of the underlying disease in 63.6% of the cases. Repeated skin biopsies are recommended as the best method for etiologic diagnosis of erythroderma. At P=0.05 significance level, masculine/feminine ratio of 2 : 1 was found. The question arises wether causal agent of erythroderma may not be somehow related to different exposure by sex to environmental antigens.

  2. Erythroderma: analysis of 247 cases

    Directory of Open Access Journals (Sweden)

    Vasconcellos Cidia

    1995-01-01

    Full Text Available The profile of 247 patients with erythroderma during a 23 year period from January, 1962 through March, 1985, with a follow-up period ranging from 1 to 26 years were analysed. The patients presented with diffuse erythema, scaling and pruritus of more than 2 months' duration, and the age ranged from 16 to 60 years. Psoriasis was the most frequent underlying disease with an estimated frequency of 44.9%, the reaction to the use of drugs appeared in 7.3% of total cases and association with reticulosis showed a frequency of 4.1%. The cause of the erythroderma could not be determined in 29.2% of the cases. Sex differences in terms of underlying diseases were not observed. One or more skin biopsies along with the clinical findings were diagnostic or suggestive of the underlying disease in 63.6% of the cases. Repeated skin biopsies are recommended as the best method for etiologic diagnosis of erythroderma. At P=0.05 significance level, masculine/feminine ratio of 2 : 1 was found. The question arises wether causal agent of erythroderma may not be somehow related to different exposure by sex to environmental antigens.

  3. 24/7 SM slavery.

    Science.gov (United States)

    Dancer, Peter L; Kleinplatz, Peggy J; Moser, Charles

    2006-01-01

    This study describes the nature of 24/7 SM slavery as practiced within the SM (sadomasochistic) community. These SM participants, who attempt to live full-time in owner-slave roles, represent a small proportion of those with SM interests. SM slaves have not been studied systematically to determine if and how they differ from other SM practitioners. An online questionnaire was used to obtain responses from individuals who self-identified as slaves. A total of 146 respondents participated, 53% female and 47% male, ranging in age from 18 to 72. We explored the depth of their relationships, how well they approximated "slavery," and how their relationships were structured to maintain distinct roles. Data showed that in long-term SM slave relationships, a power differential exists which extends beyond time-limited SM or sexual interactions. Owners and slaves often use common, daily life experiences or situations, such as the completion of household chores, money management, and morning or evening routines, to distinguish and maintain their respective roles. In addition, contrary to the perception of total submission, results revealed that slaves exercise free will when it is in their best interests to do so. These relationships were long-lasting and satisfying to the respondents.

  4. Dicty_cDB: SLH247 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLH247 (Link to dictyBase) - - - Contig-U16280-1 SLH247Z (Link... to Original site) - - SLH247Z 632 - - - - Show SLH247 Library SL (Link to library) Clone ID SLH247 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLH2-B/SLH247Q.Seq.d/ Representative seq. ID SLH24...7Z (Link to Original site) Representative DNA sequence >SLH247 (SLH247Q) /CSM/SL/SLH2-B/SLH247Q.Seq.d/ XXXXX...ant alignments: (bits) Value SLH247 (SLH247Q) /CSM/SL/SLH2-B/SLH247Q.Seq.d/ 1253 0.0 SLA487 (SLA487Q) /CSM/S

  5. Measurement of californium-252 gamma photons depth dose distribution in tissue equivalent material. Vol. 4

    Energy Technology Data Exchange (ETDEWEB)

    Fadel, M A; El-Fiki, M A; Eissa, H M; Abdel-Hafez, A; Naguib, S H [National Institute of Standards, Cairo (Egypt)

    1996-03-01

    Phantom of tissue equivalent material with and without bone was used measuring depth dose distribution of gamma-rays from californium-252 source. The source was positioned at center of perspex walled phantom. Depth dose measurements were recorded for X, Y and Z planes at different distances from source. TLD 700 was used for measuring the dose distribution. Results indicate that implantation of bone in tissue equivalent medium cause changes in the gamma depth dose distribution which varies according to variation in bone geometry. 9 figs.

  6. Measurements of integral cross sections in the californium-252 fission neutron spectrum

    International Nuclear Information System (INIS)

    Alberts, W.G.; Guenther, E.; Matzke, M.; Rassl, G.

    1977-01-01

    In a low-scattering arrangement cross sections averaged over the californium-252 spontaneous fission neutron spectrum were measured. The reactions 27 Al(n,α) 46 Ti, 47 Ti, 48 Ti(n,p), 54 Fe, 56 Fe(n,p), 58 Ni(n,p), 64 Zn(n,p), 115 In(n,n') were studied in order to obtain a consistent set of threshold detectors used in fast neutron flux density measurements. Overall uncertainties between 2 and 2.5% could be achieved; corrections due to neutron scattering in source and samples are discussed

  7. Neutron emission in fission of highly excited californium nuclei (E*=76 MeV)

    International Nuclear Information System (INIS)

    Blinov, M.V.; Bordyug, V.M.; Kozulin, Eh.M.; Mozhaev, A.N.; Levitovich, M.; Muzychka, Yu.A.; Penionzhkevich, Yu.Eh.; Pustyl'nik, B.I.

    1990-01-01

    The differential cross sections for neutron production in the fission of highly excited californium nuclei formed in the 238 U+ 12 C (105 MeV) reaction have been measured. From the analysis of the experimental data is follows that the number of pre-fission neutrons substantially exceeds the value obtained in the framework of the standard statistical model. The saddle-to-scission time of the excited nucleus is estimated on the basis of the neutron multiplicity. The dependences of the neutron number and neutron average energies upon the fragment mass are determined

  8. Neutron emission in fission of highly excited californium nuclei (E* = 76 MeV)

    International Nuclear Information System (INIS)

    Blinov, M.V.; Bordyug, V.M.; Kozulin, E.M.; Levitovich, M.; Mozhaev, A.N.; Muzychka, Yu.A.; Penionzhkevich, Yu.E.; Pustyl'nik, B.I.

    1990-01-01

    Differential cross sections for neutron production have been measured in fission of excited californium nuclei produced in the reaction 238 U + 12 C (105 MeV). It follows from analysis of the experimental results that the number of neutrons emitted before fission considerably exceeds the number obtained in the framework of the standard statistical model. On the basis of the multiplicity of neutrons they authors have estimated the time of fission of the excited nucleus. The dependence of the number of neutrons and their average energies on the mass of the fragments is determined

  9. Californium oxygen system for 1.50 < O/Cf < 1.72

    International Nuclear Information System (INIS)

    Turcotte, R.P.; Haire, R.G.

    1975-01-01

    The californium-oxygen system was studied as a function of temperature, oxygen pressure, and stoichiometry by manometric and x-ray diffraction methods. The results establish rhombohedral Cf 7 O 12 as the stable compound obtained by heating Cf 2 O 3 in air. The isobaric oxidation-reduction cycles Cf 2 O 3 → Cf 7 O 12 → Cf 2 O 3 , observed in constant rate of heating (cooling) experiments, occur with large hysteresis. A close parallel to other fluorite related lanthanide and actinide oxide systems is established. (auth)

  10. Possible stabilization of the tetravalent oxidation state of berkelium and californium in acetonitrile with triphenylarsine oxide

    International Nuclear Information System (INIS)

    Payne, G.F.; Peterson, J.R.

    1987-01-01

    It appears that we may have prepared Bk(IV) nitrate.nTPAs0 and Bk(IV) perchlorate.nTPAs0 complexes which formed the corresponding Cf(IV) complexes through the beta decay of Bk-249. Definitive proof should come from similar experiments with quantities of Bk-249 large enough to allow spectrophotometric detection of the characteristic f→f transitions in these berkelium and californium species. It is clear, however, that TPAs0 and acetonitrile can play a pivotal role in the stabilization of lanact(IV) species

  11. Erythroderma: analysis of 247 cases

    Directory of Open Access Journals (Sweden)

    Cidia Vasconcellos

    1995-06-01

    Full Text Available The profile of 247 patients with erythroderma during a 23 year period from January, 1962 through March, 1985, with a follow-up period ranging from 1 to 26 years were analysed. The patients presented with diffuse erythema, scaling and pruritus of more than 2 months' duration, and the age ranged from 16 to 60 years. Psoriasis was the most frequent underlying disease with an estimated frequency of 44.9%, the reaction to the use of drugs appeared in 7.3% of total cases and association with reticulosis showed a frequency of 4.1%. The cause of the erythroderma could not be determined in 29.2% of the cases. Sex differences in terms of underlying diseases were not observed. One or more skin biopsies along with the clinical findings were diagnostic or suggestive of the underlying disease in 63.6% of the cases. Repeated skin biopsies are recommended as the best method for etiologic diagnosis of erythroderma. At P=0.05 significance level, masculine/feminine ratio of 2 : 1 was found. The question arises wether causal agent of erythroderma may not be somehow related to different exposure by sex to environmental antigens.Foi analisado o perfil de 247 doentes com eritrodermia em um período de 23 anos, de Janeiro de 1962 a março de 1985, com o período de seguimento variando de 1 a 26 anos. Os doentes se apresentavam com eritema universal, descamação e prurido com mais de 2 meses de duração e a idade variava de 16 a 60 anos. A psoríase foi a doença associada mais freqüente, com uma proporção estimada de 44,9%, as reações cutâneas ao uso de drogas contribuíram com 7,3% do total de casos e a associação com reticuloses mostrou uma proporção de 4,1%. A eritrodermia permaneceu como de causa desconhecida em 29,2% dos casos. Não foram observadas diferenças entre os sexos no que diz respeito à doença associada. Um ou mais resultados anátomo patológicos das biópsias de pele, em conjunto com o quadro clínico, foi diagnóstico ou sugestivo do

  12. Comparison of the Savannah River Site billet active well coincidence counter and two Californium Shufflers

    International Nuclear Information System (INIS)

    Sadowski, E.T.; Griffin, J.C.; Rinard, P.M.

    1991-01-01

    A Scrap Californium Shuffler at the Savannah River Site (SRS) was calibrated to assay the U-Al cores of billets (an intermediate step in the SRS reactor fuel fabrication cycle.) The precision of the Scrap Shuffler over several years has been approximately 0.50%. A typical total uncertainty for the assay of a core on the Scrap Shuffler is approximately 0.33% for a twelve minute assay. The precision over several months and a typical total uncertainty for the Billet Active Well (neutron) Coincidence Counter (BAWCC) are approximately 1.0% and 1.9%, respectively, for a fifteen minute assay. A new Billet Californium Shuffler specifically designed for assaying SRS billets has yielded precision (over one month) and total uncertainty results of 0.40% and 0.69%, respectively, for an eight minute assay. The introduction of a measurement point into the fuel fabrication cycle to replace estimates based upon material weight will greatly enhance material and process control in the Reactor Materials area of SRS. The use of all three instruments provides a comparison of the relative merits of Active Well (neutron) Coincidence Counters (AWCCs) and shufflers for assay of homogeneous and geometrically simple material containing 235 U. The measurement precisions, systematic and random uncertainties, as well as the procurement and operation of each instrument will be compared. 3 refs., 5 figs., 1 tab

  13. Spectral investigation of neutron radiation in three-sectional concrete labyrinth from a californium-252 source

    International Nuclear Information System (INIS)

    Belogorlov, E.A.; Britvich, G.I.; Getmanov, V.B.

    1985-01-01

    Construction of labyrinths in points of communication output from the storage-ring under construction is accompanied by numerous difficulties due to a considerable number of gas and cryogenic pipelines, which require large cross sections at the minimal length of the pipelines proper for their location. It results in unfavourable for radiation attenuation ratios between cross section and length of the labyrinth separate sections. Neutron spectra in a model concrete labyrinth, at the entrance to which a neutron source with fission spectrum (californium-252) and the same source in a polyethylene moderator are located, are measured. On the basis of the spectra obtained the formation of fluence and equivalent dose along the labyrinth geometric axis is analyzed. Conditions permitting actually to reduce radiation dose in the labyrinth (dead end provision, the use of cover materials, construction of diaphragms and shielding plates) are simulated

  14. Transport calculations of. gamma. -ray flux density and dose rate about implantable californium-252 sources

    Energy Technology Data Exchange (ETDEWEB)

    Shapiro, A; Lin, B I [Cincinnati Univ., Ohio (USA). Dept. of Chemical and Nuclear Engineering; Windham, J P; Kereiakes, J G

    1976-07-01

    ..gamma.. flux density and dose rate distributions have been calculated about implantable californium-252 sources for an infinite tissue medium. Point source flux densities as a function of energy and position were obtained from a discrete-ordinates calculation, and the flux densities were multiplied by their corresponding kerma factors and added to obtain point source dose rates. The point dose rates were integrated over the line source to obtain line dose rates. Container attenuation was accounted for by evaluating the point dose rate as a function of platinum thickness. Both primary and secondary flux densities and dose rates are presented. The agreement with an independent Monte Carlo calculation was excellent. The data presented should be useful for the design of new source configurations.

  15. 32 CFR 247.1 - Purpose.

    Science.gov (United States)

    2010-07-01

    ... DEFENSE NEWSPAPERS, MAGAZINES AND CIVILIAN ENTERPRISE PUBLICATIONS § 247.1 Purpose. This part implements DoD Directive 5122.10 1 and implements policy, assigns responsibilities, and prescribes procedures concerning authorized DoD Appropriated Funded (APF) newspapers and magazines, and Civilian Enterprise (CE...

  16. 7 CFR 247.6 - State Plan.

    Science.gov (United States)

    2010-01-01

    ... serving women, infants, and children, program outreach, and nutrition education. (Collaboration with the... CHILD NUTRITION PROGRAMS COMMODITY SUPPLEMENTAL FOOD PROGRAM § 247.6 State Plan. (a) What is the State... women, infants, and children, and the options to be used relating to income or other eligibility...

  17. 48 CFR 52.247-2 - Permits, Authorities, or Franchises.

    Science.gov (United States)

    2010-10-01

    ... Franchises. 52.247-2 Section 52.247-2 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION....247-2 Permits, Authorities, or Franchises. As prescribed in 47.207-1(a), insert the following clause: Permits, Authorities, or Franchises (JAN 1997) (a) The offeror does □, does not □, hold authorization from...

  18. 25 CFR 247.18 - What are the sanitation prohibitions?

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false What are the sanitation prohibitions? 247.18 Section 247.18 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR FISH AND WILDLIFE USE OF COLUMBIA RIVER TREATY FISHING ACCESS SITES § 247.18 What are the sanitation prohibitions? (a) You cannot deposit...

  19. 48 CFR 52.247-60 - Guaranteed Shipping Characteristics.

    Science.gov (United States)

    2010-10-01

    ... Characteristics. 52.247-60 Section 52.247-60 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION....247-60 Guaranteed Shipping Characteristics. As prescribed in 47.305-16(b)(1), insert the following clause: Guaranteed Shipping Characteristics (DEC 1989) (a) The offeror is requested to complete...

  20. 43 CFR 2.47 - Records subject to Privacy Act.

    Science.gov (United States)

    2010-10-01

    ... 43 Public Lands: Interior 1 2010-10-01 2010-10-01 false Records subject to Privacy Act. 2.47 Section 2.47 Public Lands: Interior Office of the Secretary of the Interior RECORDS AND TESTIMONY; FREEDOM OF INFORMATION ACT Privacy Act § 2.47 Records subject to Privacy Act. The Privacy Act applies to all...

  1. Fast and efficient charge breeding of the Californium rare isotope breeder upgrade electron beam ion source

    International Nuclear Information System (INIS)

    Ostroumov, P. N.; Barcikowski, A.; Dickerson, C. A.; Perry, A.; Sharamentov, S. I.; Vondrasek, R. C.; Zinkann, G. P.; Pikin, A. I.

    2015-01-01

    The Electron Beam Ion Source (EBIS), developed to breed Californium Rare Isotope Breeder Upgrade (CARIBU) radioactive beams at Argonne Tandem Linac Accelerator System (ATLAS), is being tested off-line. A unique property of the EBIS is a combination of short breeding times, high repetition rates, and a large acceptance. Overall, we have implemented many innovative features during the design and construction of the CARIBU EBIS as compared to the existing EBIS breeders. The off-line charge breeding tests are being performed using a surface ionization source that produces singly charged cesium ions. The main goal of the off-line commissioning is to demonstrate stable operation of the EBIS at a 10 Hz repetition rate and a breeding efficiency into single charge state higher than 15%. These goals have been successfully achieved and exceeded. We have measured (20% ± 0.7%) breeding efficiency into the single charge state of 28+ cesium ions with the breeding time of 28 ms. In general, the current CARIBU EBIS operational parameters can provide charge breeding of any ions in the full mass range of periodic table with high efficiency, short breeding times, and sufficiently low charge-to-mass ratio, 1/6.3 for the heaviest masses, for further acceleration in ATLAS. In this paper, we discuss the parameters of the EBIS and the charge breeding results in a pulsed injection mode with repetition rates up to 10 Hz

  2. Manganese determination om minerals by activation analysis, using the californium-252 as a neutron source

    International Nuclear Information System (INIS)

    Cardoso, Antonio

    1976-01-01

    Neutron Activation Analysis, using a Californium-252 neutron source, has been applied for the determination of manganese in ores such as pyrolusite, rodonite (manganese silicate)' and blending used in dry-batteries The favorable nuclear properties of manganese, such as high thermal neutron cross-section for the reaction 55 Mn (n.gamma) 56 Mn, high concentration of manganese in the matrix and short half - life of 56 Mn, are an ideal combination for non-destructive analysis of manganese in ores. Samples and standards of manganese dioxide were irradiated for about 20 minutes, followed by a 4 to 15 minutes decay and counted in a single channel pulse-height discrimination using a NaI(Tl) scintillation detector. Counting time was equal to 10 minutes. The interference of nuclear reactions 56 Fe(n,p) 56 Mn and 59 Co (n, α) 56 were studied, as well as problems in connection with neutron shadowing during irradiation, gamma-rays attenuation during counting and influence of granulometry of samples. One sample,was also analysed by wet-chemical method (sodium bismuthate) in order to compare results. As a whole, i t was shown that the analytical method of neutron activation for manganese in ores and blending, is a method simple, rapid and with good precision and accuracy. (author)

  3. Long-term effects of an intracavitary treatment with californium-252 on normal tissue

    International Nuclear Information System (INIS)

    Sullivan, M.F.; Beamer, J.L.; Mahony, T.D.; Cross, F.T.; Lund, J.E.; Endres, G.W.R.

    1976-01-01

    About one hundred fifty swine were exposed to either radium-226 or californium-252 sources in the uterine cervix to determine an RBE for both acute and long-term effects. That value for early changes in the tissues at risk in the treatment of cervical cancer was between 6.2 and 6.8. The incidence of complications increased with time after exposure, especially among animals treated with 252 Cf. Analysis of rectal injury showed that ulceration occurred frequently within a year postexposure at doses between 1600 and 2400 rad calculated at 2 cm lateral to the source midline. Fat necrosis and smooth muscle atrophy, resulting in a local rectal stricture, were delayed changes observed in some animals. The lower ureter was the site for a greater frequency of complications than the GI tract. Ureteral stricture often occurred at doses of 1200 rad from 252 Cf and 7000 rad from 226 Ra. Observation of delayed effects in the uterine-cervix in animals held up to 4 years postexposure indicate that the RBE for 252 Cf may be increased to a value as high as 18, while repair may have even decreased it to about 5.6 in the rectum. Fifty swine are still being observed for long-term effects after doses above 800 rad from 252 Cf and 5000 rad from 226 Ra

  4. Neutron activation analysis at the Californium User Facility for Neutron Science

    International Nuclear Information System (INIS)

    Martin, R.C.; Smith, E.H.; Glasgow, D.C.; Jerde, E.A.; Marsh, D.L.; Zhao, L.

    1997-12-01

    The Californium User Facility (CUF) for Neutron Science has been established to provide 252 Cf-based neutron irradiation services and research capabilities including neutron activation analysis (NAA). A major advantage of the CUF is its accessibility and controlled experimental conditions compared with those of a reactor environment The CUF maintains the world's largest inventory of compact 252 Cf neutron sources. Neutron source intensities of ≤ 10 11 neutrons/s are available for irradiations within a contamination-free hot cell, capable of providing thermal and fast neutron fluxes exceeding 10 8 cm -2 s -1 at the sample. Total flux of ≥10 9 cm -2 s -1 is feasible for large-volume irradiation rabbits within the 252 Cf storage pool. Neutron and gamma transport calculations have been performed using the Monte Carlo transport code MCNP to estimate irradiation fluxes available for sample activation within the hot cell and storage pool and to design and optimize a prompt gamma NAA (PGNAA) configuration for large sample volumes. Confirmatory NAA irradiations have been performed within the pool. Gamma spectroscopy capabilities including PGNAA are being established within the CUF for sample analysis

  5. 78 FR 73824 - Subzones 247A and 247B, Authorization of Production Activity, GE Transportation, (Locomotives...

    Science.gov (United States)

    2013-12-09

    ... of Production Activity, GE Transportation, (Locomotives, Off-Highway Vehicles and Motors/Engines), Lawrence Park and Grove City, Pennsylvania On July 18, 2013, GE Transportation submitted a notification of proposed production activity to the Foreign-Trade Zones (FTZ) Board for its facilities within Subzones 247A...

  6. Feasibility and market potential of protein determination of wheat using californium-252

    International Nuclear Information System (INIS)

    Roberts, T.C. Jr.; Eckhoff, N.D.; Clack, R.W.; Roberts, T.C. Sr.

    1976-01-01

    To evaluate the feasibility of protein determination by capture gamma-ray analysis using californium-252 neutrons, an in-situ protein analysis system for use by grain handlers has been examined. Three 227 kilogram (approximately) lots of wheat were used to determine the amount of nitrogen present. Protein analyses by the Kjeldahl method were obtained from samples taken before and after the capture gamma-ray analyses. The 5.267-MeV gamma-ray was selected for use in this study as a compromise between efficiency and interference from other elements. The associated counting equipment was a multichannel analyzer with pulse shaping electronic and analysis computing equipment. A linear regression program was used to compare the regions of interest to the Kjeldahl protein averages. The counts composing each peak were summed and normalized using the total count of the hydrogen peak. The normalized nitrogen percentages indicate a significant correlation between the spectral regions and the Kjeldahl analyses. To a first approximation, the value of wheat is the wheat protein. At the present time, protein testing of wheat is destructive, cumbersome, and time-consuming as compared to the potential for capture gamma-ray analysis testing. Assuming that such a protein analysis unit can analyze 42 tonne of wheat per hour, over 120 units would be needed to monitor one-half the U.S. annual wheat production. A 0.5% improvement in processor realizations and grain throughput value of $167.00 per tonne will result in a projected savings of $150,000 per year per unit

  7. Creep Behaviour of Modified Mar-247 Superalloy

    Directory of Open Access Journals (Sweden)

    Cieśla M.

    2016-06-01

    Full Text Available The paper presents the results of analysis of creep behaviour in short term creep tests of cast MAR-247 nickel-based superalloy samples made using various modification techniques and heat treatment. The accelerated creep tests were performed under temperature of 982 °C and the axial stresses of σ = 150 MPa (variant I and 200 MPa (variant II. The creep behaviour was analysed based on: creep durability (creep rupture life, steady-state creep rate and morphological parameters of macro- and microstructure. It was observed that the grain size determines the creep durability in case of test conditions used in variant I, durability of coarse-grained samples was significantly higher.

  8. Neutron reflector design with Californium 252 neutron for Boron neutron chapter therapy facility using MCNP5 simulation method

    International Nuclear Information System (INIS)

    Muhammad Fakhrurreza; Kusminanto; Y Sardjono

    2014-01-01

    In this research has made a reflector design to provide beams of Neutron for BNCT with Californium-252 radioactive source. This collimator is useful to obtain optimum epithermal neutron flux with the smallest impurity radiation (thermal neutron, fast neutron, and gamma). The design process is done using Monte Carlo N-Particle simulation version 5 (MCNP5) code to calculate the neutron flux tally form. The chosen reflector design is the reflectors which use material such as BeO ceramic with 13 cm thick. Moderator use sulfur material with the slope angle of the cone is 30°. From the calculation result, it is obtained that Reflector with 1 gram Californium-252 source can produce a neutron output thermal which has thermal neutron specification 2.23189 x 10 9 n/s.cm 2 , epithermal neutron 3.51548 x 10 9 n/s.cm 2 , and fast neutron 4.82241 x 10 9 n/s.cm 2 From the result, it needs additional collimator because the BNCT requirement. (author)

  9. Hypoxic versus normoxic external-beam irradiation of cervical carcinoma combined with californium-252 neutron brachytherapy. Comparative treatment results of a 5-year randomized study

    Czech Academy of Sciences Publication Activity Database

    Tačev, T.; Vacek, Antonín; Ptáčková, B.; Strnad, V.

    2005-01-01

    Roč. 181, č. 5 (2005), s. 273-284 ISSN 0179-7158 Institutional research plan: CEZ:AV0Z50040507 Keywords : cervical carcinoma * hypoxyradiotherapy * californium-252 Subject RIV: BO - Biophysics Impact factor: 3.490, year: 2005

  10. Study of the shielding for spontaneous fission sources of Californium-252; Estudio de blindaje para fuentes de fision espontanea de Californio-252

    Energy Technology Data Exchange (ETDEWEB)

    Davila R, I

    1991-06-15

    A shielding study is made to attenuate, until maximum permissible levels, the neutrons radiation and photons emitted by spontaneous fission coming from a source of Californium-252. The compound package by a database (Library DLC-23) and the ANISNW code is used, in it version for personal computer. (Author)

  11. 48 CFR 3452.247-70 - Foreign travel.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 7 2010-10-01 2010-10-01 false Foreign travel. 3452.247-70 Section 3452.247-70 Federal Acquisition Regulations System DEPARTMENT OF EDUCATION ACQUISITION... travel” means travel outside the fifty States comprising the United States, the District of Columbia, and...

  12. 48 CFR 452.247-70 - Delivery Location.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Delivery Location. 452.247-70 Section 452.247-70 Federal Acquisition Regulations System DEPARTMENT OF AGRICULTURE CLAUSES AND... Location. As prescribed in 447.302, insert a clause substantially as follows: Delivery Location (FEB 1988...

  13. Formation and characterization of Y : 247 film through spray ...

    Indian Academy of Sciences (India)

    Unknown

    gions (< 50 Å) of minority Y : 124 phase and stacking faults capable of ... critical current density (Jc) for Y : 247 films is ~ 103 A/cm2, and with silver ..... biphasic. As a result of decomposition, Y : 247 may be partially converted into Y : 124.

  14. 48 CFR 952.247-70 - Foreign travel.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Foreign travel. 952.247-70... SOLICITATION PROVISIONS AND CONTRACT CLAUSES Text of Provisions and Clauses 952.247-70 Foreign travel. As prescribed in 947.7002, insert the following clause: Foreign Travel (JUN 2010) Contractor foreign travel...

  15. 47 CFR 24.247 - Triggering a reimbursement obligation.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 2 2010-10-01 2010-10-01 false Triggering a reimbursement obligation. 24.247... Mhz Band § 24.247 Triggering a reimbursement obligation. (a) Licensed PCS. The clearinghouse will... the Proximity Threshold test indicates that a reimbursement obligation exists, the clearinghouse will...

  16. 40 CFR 247.10 - Paper and paper products.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Paper and paper products. 247.10... COMPREHENSIVE PROCUREMENT GUIDELINE FOR PRODUCTS CONTAINING RECOVERED MATERIALS Item Designations § 247.10 Paper and paper products. Paper and paper products, excluding building and construction paper grades. ...

  17. 48 CFR 52.247-7 - Freight Excluded.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Freight Excluded. 52.247-7... AND FORMS SOLICITATION PROVISIONS AND CONTRACT CLAUSES Text of Provisions and Clauses 52.247-7 Freight... contracts for transportation or for transportation-related services when any commodities or types of...

  18. Simulation and design of an electron beam ion source charge breeder for the californium rare isotope breeder upgrade

    Directory of Open Access Journals (Sweden)

    Clayton Dickerson

    2013-02-01

    Full Text Available An electron beam ion source (EBIS will be constructed and used to charge breed ions from the californium rare isotope breeder upgrade (CARIBU for postacceleration into the Argonne tandem linear accelerator system (ATLAS. Simulations of the EBIS charge breeder performance and the related ion transport systems are reported. Propagation of the electron beam through the EBIS was verified, and the anticipated incident power density within the electron collector was identified. The full normalized acceptance of the charge breeder with a 2 A electron beam, 0.024π  mm mrad for nominal operating parameters, was determined by simulating ion injection into the EBIS. The optics of the ion transport lines were carefully optimized to achieve well-matched ion injection, to minimize emittance growth of the injected and extracted ion beams, and to enable adequate testing of the charge bred ions prior to installation in ATLAS.

  19. Neutron activation analysis of the calcium content in vivo, using a 50μg source of californium 252

    International Nuclear Information System (INIS)

    Guey, A.; Zech, P.Y.; Meary, M.F.; Leitienne, P.

    1975-01-01

    Owing to the recent commercialisation of californium 252 it is now possible to obtain neutron fluxes strong enough for precise activation of the calcium content of biological targets. After the preliminary measurements necessary to establish the most suitable conditions for irradiating 3 to 5cm thick targets, two parallel sets of experiments were developed. In the first the medium-term total calcium variation was studied in 20 rats, 16 suffering from chronic kidney deficiency. In the second the precision expected as a function of the calcium content of the irradiated target was examined, using 3 sets of tissue equivalent standards of calcium contents 5, 20 and 50g respectively. The first results obtained on calcium 49 in vivo show that a calcium content variation can be followed with a sensitivity threshold below that obtained by conventional methods [fr

  20. Extraction of Trivalent Actinides and Lanthanides from Californium Campaign Rework Solution Using TODGA-based Solvent Extraction System

    Energy Technology Data Exchange (ETDEWEB)

    Benker, Dennis [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Delmau, Laetitia Helene [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Dryman, Joshua Cory [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States)

    2017-07-01

    This report presents the studies carried out to demonstrate the possibility of quantitatively extracting trivalent actinides and lanthanides from highly acidic solutions using a neutral ligand-based solvent extraction system. These studies stemmed from the perceived advantage of such systems over cationexchange- based solvent extraction systems that require an extensive feed adjustment to make a low-acid feed. The targeted feed solutions are highly acidic aqueous phases obtained after the dissolution of curium targets during a californium (Cf) campaign. Results obtained with actual Cf campaign solutions, but highly diluted to be manageable in a glove box, are presented, followed by results of tests run in the hot cells with Cf campaign rework solutions. It was demonstrated that a solvent extraction system based on the tetraoctyl diglycolamide molecule is capable of quantitatively extracting trivalent actinides from highly acidic solutions. This system was validated using actual feeds from a Cf campaign.

  1. Californium-252 Brachytherapy Combined With External-Beam Radiotherapy for Cervical Cancer: Long-Term Treatment Results

    International Nuclear Information System (INIS)

    Lei Xin; Qian Chengyuan; Qing Yi; Zhao Kewei; Yang Zhengzhou; Dai Nan; Zhong Zhaoyang; Tang Cheng; Li Zheng; Gu Xianqing; Zhou Qian; Feng Yan; Xiong Yanli; Shan Jinlu; Wang Dong

    2011-01-01

    Purpose: To observe, by retrospective analysis, the curative effects and complications due to californium-252 ( 252 Cf) neutron intracavitary brachytherapy (ICBT) combined with external-beam radiotherapy (EBRT) in the treatment of cervical cancer. Methods and Materials: From February 1999 to December 2007, 696 patients with cervical cancer (Stages IB to IIIB) were treated with 252 Cf-ICBT in combination of EBRT. Of all, 31 patients were at Stage IB, 104 at IIA, 363 at IIB, 64 at IIIA, and 134 at IIIB. Californium-252 ICBT was delivered at 7–12 Gy per insertion per week, with a total dose of 29–45 Gy to reference point A in three to five insertions. The whole pelvic cavity was treated with 8-MV X-ray external irradiation at 2 Gy per fraction, four times per week. After 16–38 Gy of external irradiation, the center of the whole pelvic field was blocked with a 4-cm-wide lead shield, with a total external irradiation dose of 44–56 Gy. The total treatment course was 5 to 6 weeks. Results: Overall survival rate at 3 and 5 years for all patients was 76.0% and 64.9%, respectively. Disease-free 3- and 5-year survival rates of patients were 71.2% and 58.4%, respectively. Late complications included vaginal contracture and adhesion, radiation proctitis, radiation cystitis, and inflammatory bowel, which accounted for 5.8%, 7.1%, 6.2%, and 4.9%, respectively. Univariate analysis results showed significant correlation of stage, age, histopathologic grade, and lymph node status with overall survival. Cox multiple regression analysis showed that the independent variables were stage, histopathologic grade, tumor size, and lymphatic metastasis in all patients. Conclusion: Results of this series suggest that the combined use of 252 Cf-ICBT with EBRT is an effective method for treatment of cervical cancer.

  2. Beyond Californium-A Neutron Generator Alternative for Dosimetry and Instrument Calibration in the U.S.

    Science.gov (United States)

    Piper, Roman K; Mozhayev, Andrey V; Murphy, Mark K; Thompson, Alan K

    2017-09-01

    Evaluations of neutron survey instruments, area monitors, and personal dosimeters rely on reference neutron radiations, which have evolved from the heavy reliance on (α,n) sources to a shared reliance on (α,n) and the spontaneous fission neutrons of californium-252 (Cf). Capable of producing high dose equivalent rates from an almost point source geometry, the characteristics of Cf are generally more favorable when compared to the use of (α,n) and (γ,n) sources or reactor-produced reference neutron radiations. Californium-252 is typically used in two standardized configurations: unmoderated, to yield a fission energy spectrum; or with the capsule placed within a heavy-water moderating sphere to produce a softened spectrum that is generally considered more appropriate for evaluating devices used in nuclear power plant work environments. The U.S. Department of Energy Cf Loan/Lease Program, a longtime origin of affordable Cf sources for research, testing and calibration, was terminated in 2009. Since then, high-activity sources have become increasingly cost-prohibitive for laboratories that formerly benefited from that program. Neutron generators, based on the D-T and D-D fusion reactions, have become economically competitive with Cf and are recognized internationally as important calibration and test standards. Researchers from the National Institute of Standards and Technology and the Pacific Northwest National Laboratory are jointly considering the practicality and technical challenges of implementing neutron generators as calibration standards in the U.S. This article reviews the characteristics of isotope-based neutron sources, possible isotope alternatives to Cf, and the rationale behind the increasing favor of electronically generated neutron options. The evaluation of a D-T system at PNNL has revealed characteristics that must be considered in adapting generators to the task of calibration and testing where accurate determination of a dosimetric quantity is

  3. Dicty_cDB: SHH247 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SH (Link to library) SHH247 (Link to dictyBase) - - - Contig-U15693-1 - (Link to Or...iginal site) - - SHH247Z 601 - - - - Show SHH247 Library SH (Link to library) Clone ID SHH247 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15693-1 Original site URL http://dictycdb.b...pdate 2002.12. 6 Homology vs DNA Score E Sequences producing significant alignments: (bits) Value N AF188717 |AF188717.1 Dict...ogaster SD01519 fu... 56 6e-07 DQ353802_1( DQ353802 |pid:none) Ictalurus punctatu

  4. Use of californium-252 neutron irradiator for in-vivo analysis of the bone calcium content of the hand

    International Nuclear Information System (INIS)

    Guey, A.; Leitienne, P.; Zech, P.Y.; Traeger, J.; Doyen, J.B.; Breton, J.P.

    1979-01-01

    With californium-252 it is easy to obtain a high neutron flux of the order of 10 9 n/s. The mean energy of this radiation, which is close on 2 MeV, activates calcium very well. The authors describe a storage and irradiator unit with a 100 μg californium source, with which it will henceforth be possible to develop this technique of measuring the calcium of the hand in a hospital. The test programme has three distinct phases: (1) irradiation of the biological target for 10 min; (2) after a transfer period of 30 s, detection of the radiation emitted by the 49 Ca for 600 s; (3) processing of the numerical data received, which are transmitted on line to a T 1600 calculator. The weight is found by comparing the activity induced in the unknown calcium mass with that induced in a phantom chosen as the activity standard. The reproducibility of the method is of the order of 3% (5% at the worst). The gross standardized result is edited automatically. For physical and clinical reasons, the hand is chosen as the reference part of the body in 70 control subjects. The local irradiation dose is less than 2 rem. The bone calcium content is 14.3+-1.9 g in men and 10.1+-1.3 g in women. In clinical application of the technique it is necessary to differentiate between the normal calcium content and the calcium content found with a pathological state. This makes it necessary to express the measurement in the form of a volume mass (rho). The volume of the hand skeleton (V in cm 3 ) is calculated from the corresponding bone surface (S in cm 2 ) measured by planimetry with the relationship V=8.925 exp 0.0205.S, found after studying 80 hand skeletons. In our control subjects the calcium bone volume mass was 0.288 g/cm 3 in men and 0.282 g/cm 3 in women. There is a very significant difference (p<0.001) in a population of 88 subjects with chronic renal insufficiencies at the terminal stage: rho=0.233 in men and 0.235 in women

  5. Long-term effects of an intracavitary treatment with californium-252 on normal tissue. [Swine, /sup 226/Ra

    Energy Technology Data Exchange (ETDEWEB)

    Sullivan, M.F.; Beamer, J.L.; Mahony, T.D.; Cross, F.T.; Lund, J.E.; Endres, G.W.R.

    1976-01-01

    About one hundred fifty swine were exposed to either radium-226 or californium-252 sources in the uterine cervix to determine an RBE for both acute and long-term effects. That value for early changes in the tissues at risk in the treatment of cervical cancer was between 6.2 and 6.8. The incidence of complications increased with time after exposure, especially among animals treated with /sup 252/Cf. Analysis of rectal injury showed that ulceration occurred frequently within a year postexposure at doses between 1600 and 2400 rad calculated at 2 cm lateral to the source midline. Fat necrosis and smooth muscle atrophy, resulting in a local rectal stricture, were delayed changes observed in some animals. The lower ureter was the site for a greater frequency of complications than the GI tract. Ureteral stricture often occurred at doses of 1200 rad from /sup 252/Cf and 7000 rad from /sup 226/Ra. Observation of delayed effects in the uterine-cervix in animals held up to 4 years postexposure indicate that the RBE for /sup 252/Cf may be increased to a value as high as 18, while repair may have even decreased it to about 5.6 in the rectum. Fifty swine are still being observed for long-term effects after doses above 800 rad from /sup 252/Cf and 5000 rad from /sup 226/Ra.

  6. Neutron flux characterization of californium-252 Neutron Research Facility at the University of Texas - Pan American by nuclear analytical technique

    Science.gov (United States)

    Wahid, Kareem; Sanchez, Patrick; Hannan, Mohammad

    2014-03-01

    In the field of nuclear science, neutron flux is an intrinsic property of nuclear reaction facilities that is the basis for experimental irradiation calculations and analysis. In the Rio Grande Valley (Texas), the UTPA Neutron Research Facility (NRF) is currently the only neutron facility available for experimental research purposes. The facility is comprised of a 20-microgram californium-252 neutron source surrounded by a shielding cascade containing different irradiation cavities. Thermal and fast neutron flux values for the UTPA NRF have yet to be fully investigated and may be of particular interest to biomedical studies in low neutron dose applications. Though a variety of techniques exist for the characterization of neutron flux, neutron activation analysis (NAA) of metal and nonmetal foils is a commonly utilized experimental method because of its detection sensitivity and availability. The aim of our current investigation is to employ foil activation in the determination of neutron flux values for the UTPA NSRF for further research purposes. Neutron spectrum unfolding of the acquired experimental data via specialized software and subsequent comparison for consistency with computational models lends confidence to the results.

  7. Is the chain of galaxies near NGC 247 anomalous

    International Nuclear Information System (INIS)

    Balkowski, C.; Chamaraux, P.

    1975-01-01

    Neutral hydrogen 21-cm observations of the chain of galaxies near NGC 247 are reported on. From HI and optical data, the chain's distance is found to be 62sub(-25)+- 41 Mpc, in agreement with the redshift. This result rules out Arp's assumption of a physical association between NGC 247 and the chain at a confidence level of better than 3.9 times the r.m.s. dispersion. The HI content of the chain is quite normal, and it is likely to be dynamically stable: these results would argue against the proposal made by Burbridge et al. that the chain was formed recently. (orig.) [de

  8. 40 CFR 247.16 - Non-paper office products.

    Science.gov (United States)

    2010-07-01

    ... pressboard binders containing recovered paper; and solid plastic binders containing recovered plastic. (e... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Non-paper office products. 247.16...-paper office products. (a) Office recycling containers and office waste receptacles. (b) Plastic desktop...

  9. 48 CFR 52.247-6 - Financial Statement.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Financial Statement. 52....247-6 Financial Statement. As prescribed in 47.207-1(e), insert the following provision in... furnish financial statements: Financial Statement (APR 1984) The offeror shall, upon request, promptly...

  10. 14 CFR 135.247 - Pilot qualifications: Recent experience.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Pilot qualifications: Recent experience... Flight Crewmember Requirements § 135.247 Pilot qualifications: Recent experience. (a) No certificate holder may use any person, nor may any person serve, as pilot in command of an aircraft carrying...

  11. 48 CFR 52.247-28 - Contractor's Invoices.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Contractor's Invoices. 52....247-28 Contractor's Invoices. As prescribed in 47.207-9(c), insert the following clause in... services: Contractor's Invoices (APR 1984) The Contractor shall submit itemized invoices as instructed by...

  12. CDC 24/7: Saving Lives, Protecting People

    Centers for Disease Control (CDC) Podcasts

    2012-06-04

    24/7, CDC provides health information, responds to public health emergencies and natural disasters, and monitors disease.  Created: 6/4/2012 by Office of the Associate Director of Communciation (OADC).   Date Released: 6/4/2012.

  13. 48 CFR 52.247-51 - Evaluation of Export Offers.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Evaluation of Export....247-51 Evaluation of Export Offers. As prescribed in 47.305-6(e), insert the following provision: Evaluation of Export Offers (JAN 2001) (a) Port handling and ocean charges—other than DOD water terminals...

  14. Ab initio full-potential study of mechanical properties and magnetic phase stability of californium monopnictides (CfN and CfP)

    Energy Technology Data Exchange (ETDEWEB)

    Amari, S., E-mail: siham_amari@yahoo.fr [Faculté des Sciences de la Nature et de la Vie, Université Hassiba Benbouali, Chlef, 02000 (Algeria); Bouhafs, B. [Laboratoire de Modélisation et Simulation en Sciences des Matériaux, Université Djillali Liabès de Sidi Bel-Abbés, Sidi Bel-Abbés, 22000 (Algeria)

    2016-09-15

    Based on the first-principles methods, the structural, elastic, electronic, properties and magnetic ordering of californium monopnictides CfX (X = P) have been studied using the full-potential augmented plane wave plus local orbitals (FP-L/APW + lo) method within the framework of density functional theory (DFT). The electronic exchange correlation energy is described by generalized gradient approximation GGA and GGA+U (U is the Hubbard correction). The GGA+U method is applied to the rare-earth 5f states. We have calculated the lattice parameters, bulk modulii and the first pressure derivatives of the bulk modulii. The elastic properties of the studied compounds are only investigated in the most stable calculated phase. In order to gain further information, we have calculated Young’s modulus, shear modulus, anisotropy factor and Kleinman parameter by the aid of the calculated elastic constants. The results mainly show that californium monopnictides CfX (X = P) have an antiferromagnetic spin ordering. Density of states (DOS) and charge densities for both compounds are also computed in the NaCl (B1) structure.

  15. Use of polyethylene pellets in the design and construction of a storage safe, a transport vessel and a portable shield for californium-252

    International Nuclear Information System (INIS)

    Sharma, S.

    1986-01-01

    A storage and shielding facility for 300 μg of Californium-252 sources was designed and constructed. Though the safe was in a permanent location, the fact that it consisted of a lead bucket surrounded by polyethylene pellets made it simple, movable and inexpensive. If need be, more quantities of Cf-252 could be added without altering the basic design and sacrificing the radiation protection guidelines. The measured radiation levels from 300 μg of stored Cf-252 in and around the storage vault were lower than the expected dose rates by a factor of 5. The measured radiation levels around the occupied environs of the facility were below the maximum permissible yearly dose of 500mrem for non-occupational workers. A transport vessel was designed and constructed to carry up to 50 μg of Californium-252 sources. It consisted of a standard 55 gallon steel drum on casters containing cylindrical lead shield surrounded by polyethylene pellets. The measured maximum surface dose rates on the drum and at one meter away were within the radiation protection guidelines and were less than the expected dose rates. A portable shield was designed and constructed to protect the body in afterloading operations and handling of the sources. It consisted of polyethylene pellets in an aluminum box and an attached 10 cm thick plexiglass eye shield. The simple design, with the ease of using polyethylene pellets can be extended to construct bedside shields

  16. 48 CFR 247.370 - DD Form 1384, Transportation Control and Movement Document.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false DD Form 1384, Transportation Control and Movement Document. 247.370 Section 247.370 Federal Acquisition Regulations System... Transportation in Supply Contracts 247.370 DD Form 1384, Transportation Control and Movement Document. The...

  17. 48 CFR 52.247-67 - Submission of Transportation Documents for Audit.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Submission of Transportation Documents for Audit. 52.247-67 Section 52.247-67 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION (CONTINUED) CLAUSES AND FORMS SOLICITATION PROVISIONS AND CONTRACT CLAUSES Text of Provisions and Clauses 52.247-67 Submission...

  18. 24/7 pediatric radiology attending coverage: times are changing

    Energy Technology Data Exchange (ETDEWEB)

    Donaldson, James S. [Feinberg School of Medicine at Northwestern University, Department of Medical Imaging, Ann and Robert H. Lurie Children' s Hospital of Chicago, IL (United States); Thakrar, Kiran H. [University of Chicago Pritzker School of Medicine, Body Imaging, NorthShore University HealthSystem, Chicago, IL (United States)

    2017-06-15

    The job of the pediatric radiologist long ago ceased to be an 8-to-5 role. Many practices have adopted evening shifts of in-house attending radiologists to cover the busy evening activity. With the ever-increasing role of imaging in clinical decisions and patient management, there is a need - if not a demand - to further extend attending pediatric radiology coverage. In this article, we discuss the needs and justification for extending pediatric radiology coverage at a tertiary-care children's hospital. We also describe the approach we took toward implementing 24/7 attending in-house coverage of pediatric radiology. (orig.)

  19. Towards 24/7 continuous heart rate monitoring.

    Science.gov (United States)

    Tarniceriu, Adrian; Parak, Jakub; Renevey, Philippe; Nurmi, Marko; Bertschi, Mattia; Delgado-Gonzalo, Ricard; Korhonen, Ilkka

    2016-08-01

    Heart rate (HR) and HR variability (HRV) carry rich information about physical activity, mental and physical load, physiological status, and health of an individual. When combined with activity monitoring and personalized physiological modelling, HR/HRV monitoring may be used for monitoring of complex behaviors and impact of behaviors and external factors on the current physiological status of an individual. Optical HR monitoring (OHR) from wrist provides a comfortable and unobtrusive method for HR/HRV monitoring and is better adhered by users than traditional ECG electrodes or chest straps. However, OHR power consumption is significantly higher than that for ECG based methods due to the measurement principle based on optical illumination of the tissue. We developed an algorithmic approach to reduce power consumption of the OHR in 24/7 HR trending. We use continuous activity monitoring and a fast converging frequency domain algorithm to derive a reliable HR estimate in 7.1s (during outdoor sports, in average) to 10.0s (during daily life). The method allows >80% reduction in power consumption in 24/7 OHR monitoring when average HR monitoring is targeted, without significant reduction in tracking accuracy.

  20. 32 CFR Appendix E to Part 247 - DoD Command Newspaper and Magazine Review System

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false DoD Command Newspaper and Magazine Review System... OF DEFENSE (CONTINUED) MISCELLANEOUS DEPARTMENT OF DEFENSE NEWSPAPERS, MAGAZINES AND CIVILIAN ENTERPRISE PUBLICATIONS Pt. 247, App. E Appendix E to Part 247—DoD Command Newspaper and Magazine Review...

  1. Californium interrogation prompt neutron (CIPN) instrument for non-destructive assay of spent nuclear fuel—Design concept and experimental demonstration

    Energy Technology Data Exchange (ETDEWEB)

    Henzlova, D., E-mail: henzlova@lanl.gov [Los Alamos National Laboratory, Los Alamos, NM 87545 (United States); Menlove, H.O.; Rael, C.D.; Trellue, H.R.; Tobin, S.J. [Los Alamos National Laboratory, Los Alamos, NM 87545 (United States); Park, Se-Hwan; Oh, Jong-Myeong; Lee, Seung-Kyu; Ahn, Seong-Kyu; Kwon, In-Chan; Kim, Ho-Dong [Korea Atomic Energy Research Institute, Daejeong (Korea, Republic of)

    2016-01-11

    This paper presents results of the first experimental demonstration of the Californium Interrogation Prompt Neutron (CIPN) instrument developed within a multi-year effort launched by the Next Generation Safeguards Initiative Spent Fuel Project of the United States Department of Energy. The goals of this project focused on developing viable non-destructive assay techniques with capabilities to improve an independent verification of spent fuel assembly characteristics. For this purpose, the CIPN instrument combines active and passive neutron interrogation, along with passive gamma-ray measurements, to provide three independent observables. This paper describes the initial feasibility demonstration of the CIPN instrument, which involved measurements of four pressurized-water-reactor spent fuel assemblies with different levels of burnup and two initial enrichments. The measurements were performed at the Post-Irradiation Examination Facility at the Korea Atomic Energy Institute in the Republic of Korea. The key aim of the demonstration was to evaluate CIPN instrument performance under realistic deployment conditions, with the focus on a detailed assessment of systematic uncertainties that are best evaluated experimentally. The measurements revealed good positioning reproducibility, as well as a high degree of insensitivity of the CIPN instrument's response to irregularities in a radial burnup profile. Systematic uncertainty of individual CIPN instrument signals due to assembly rotation was found to be <4.5%, even for assemblies with fairly extreme gradients in the radial burnup profile. These features suggest that the CIPN instrument is capable of providing a good representation of assembly average characteristics, independent of assembly orientation in the instrument.

  2. Californium interrogation prompt neutron (CIPN) instrument for non-destructive assay of spent nuclear fuel—Design concept and experimental demonstration

    International Nuclear Information System (INIS)

    Henzlova, D.; Menlove, H.O.; Rael, C.D.; Trellue, H.R.; Tobin, S.J.; Park, Se-Hwan; Oh, Jong-Myeong; Lee, Seung-Kyu; Ahn, Seong-Kyu; Kwon, In-Chan; Kim, Ho-Dong

    2016-01-01

    This paper presents results of the first experimental demonstration of the Californium Interrogation Prompt Neutron (CIPN) instrument developed within a multi-year effort launched by the Next Generation Safeguards Initiative Spent Fuel Project of the United States Department of Energy. The goals of this project focused on developing viable non-destructive assay techniques with capabilities to improve an independent verification of spent fuel assembly characteristics. For this purpose, the CIPN instrument combines active and passive neutron interrogation, along with passive gamma-ray measurements, to provide three independent observables. This paper describes the initial feasibility demonstration of the CIPN instrument, which involved measurements of four pressurized-water-reactor spent fuel assemblies with different levels of burnup and two initial enrichments. The measurements were performed at the Post-Irradiation Examination Facility at the Korea Atomic Energy Institute in the Republic of Korea. The key aim of the demonstration was to evaluate CIPN instrument performance under realistic deployment conditions, with the focus on a detailed assessment of systematic uncertainties that are best evaluated experimentally. The measurements revealed good positioning reproducibility, as well as a high degree of insensitivity of the CIPN instrument's response to irregularities in a radial burnup profile. Systematic uncertainty of individual CIPN instrument signals due to assembly rotation was found to be <4.5%, even for assemblies with fairly extreme gradients in the radial burnup profile. These features suggest that the CIPN instrument is capable of providing a good representation of assembly average characteristics, independent of assembly orientation in the instrument.

  3. Radiology 24/7 In-House Attending Coverage: Do Benefits Outweigh Cost?

    Science.gov (United States)

    Coleman, Stephanie; Holalkere, Nagaraj Setty; O׳Malley, Julie; Doherty, Gemma; Norbash, Alexander; Kadom, Nadja

    2016-01-01

    Many radiology practices, including academic centers, are moving to in-house 24/7 attending coverage. This could be costly and may not be easily accepted by radiology trainees and attending radiologists. In this article, we evaluated the effects of 24/7 in-house attending coverage on patient care, costs, and qualitative aspects such as trainee education. We retrospectively collected report turnaround times (TAT) and work relative value units (wRVU). We compared these parameters between the years before and after the implementation of 24/7 in-house attending coverage. The cost to provide additional attending coverage was estimated from departmental financial reports. A qualitative survey of radiology residents and faculty was performed to study perceived effects on trainee education. There were decreases in report TAT following 24/7 attending implementation: 69% reduction in computed tomography, 43% reduction in diagnostic radiography, 7% reduction in magnetic resonance imaging, and 43% reduction in ultrasound. There was an average daytime wRVU decrease of 9%, although this was compounded by a decrease in total RVUs of the 2013 calendar year. The financial investment by the institution was estimated at $850,000. Qualitative data demonstrated overall positive feedback from trainees and faculty in radiology, although loss of independence was reported as a negative effect. TAT and wRVU metrics changed with implementation of 24/7 attending coverage, although these metrics do not directly relate to patient outcomes. Additional clinical benefits may include fewer discrepancies between preliminary and final reports that may improve emergency and inpatient department workflows and liability exposure. Radiologists reported the impression that clinicians appreciated 24/7 in-house attending coverage, particularly surgical specialists. Loss of trainee independence on call was a perceived disadvantage of 24/7 attending coverage and raised a concern that residency education

  4. Switching Investigations on a SiC MOSFET in a TO-247 Package

    DEFF Research Database (Denmark)

    Anthon, Alexander; Hernandez Botella, Juan Carlos; Zhang, Zhe

    2014-01-01

    This paper deals with the switching behavior of a SiC MOSFET in a TO-247 package. Based on simulations, critical parasitic inductances in the circuit layout are analyzed and their effect on the switching losses highlighted. Especially the common source inductance, a critical parameter in a TO-247...... package, has a major influence on the switching energy. Crucial design guidelines for an improved double pulse test circuit are introduced which are used for practical investigations on the switching behavior. Switching energies of a SiC MOSFET in a TO-247 package is measured depending on varying gate...... resistance and loop inductances. With total switching energy of 340.24 μJ, the SiC MOSFET has more than six times lower switching losses than a regular Si IGBT. Implementing the SiC switches in a 3 kW T-Type inverter topology, efficiency improvements of 0.8 % are achieved and maximum efficiency of 97...

  5. Rotational emission-line spectrum of Orion A between 247 and 263 GHZ

    International Nuclear Information System (INIS)

    Blake, G.A.; Sutton, E.C.; Masson, C.R.; Phillips, T.G.

    1986-01-01

    Results are presented from a molecular line survey of the core of the Orion molecular cloud between 247 and 263 GHz. The spectrum contains a total of 243 resolvable lines from 23 different chemical species. When combined with the earlier survey of Orion from 215 to 247 GHz by Sutton et al (1985), the complete data set includes over 780 emission features from 29 distinct molecules. Of the 23 molecules detected in this survey, only NO, CCH, and HCO + were identified not in the lower frequency data

  6. 7 CFR 247.24 - Recovery and redistribution of caseload and administrative funds.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Recovery and redistribution of caseload and...) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS COMMODITY SUPPLEMENTAL FOOD PROGRAM § 247.24 Recovery and redistribution of caseload and administrative funds. (a) May FNS...

  7. 7 CFR 247.23 - State provision of administrative funds to local agencies.

    Science.gov (United States)

    2010-01-01

    ... funds will be used to achieve program objectives. (Approved by the Office of Management and Budget under... 7 Agriculture 4 2010-01-01 2010-01-01 false State provision of administrative funds to local... PROGRAM § 247.23 State provision of administrative funds to local agencies. (a) How much of the...

  8. 7 CFR 247.13 - Provisions for non-English or limited-English speakers.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Provisions for non-English or limited-English speakers... § 247.13 Provisions for non-English or limited-English speakers. (a) What must State and local agencies do to ensure that non-English or limited-English speaking persons are aware of their rights and...

  9. 48 CFR 247.371 - DD Form 1653, Transportation Data for Solicitations.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false DD Form 1653... Supply Contracts 247.371 DD Form 1653, Transportation Data for Solicitations. The transportation specialist prepares the DD Form 1653 to accompany requirements for the acquisition of supplies. The completed...

  10. 48 CFR 247.372 - DD Form 1654, Evaluation of Transportation Cost Factors.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false DD Form 1654, Evaluation... Transportation in Supply Contracts 247.372 DD Form 1654, Evaluation of Transportation Cost Factors. Contracting personnel may use the DD Form 1654 to furnish information to the transportation office for development of...

  11. 75 FR 62333 - Airworthiness Directives; Hamilton Sundstrand Propellers Model 247F Propellers

    Science.gov (United States)

    2010-10-08

    ...., Monday through Friday, except Federal holidays. The AD docket contains this proposed AD, the regulatory... that the 247F propeller blades, P/N 817370-1, S/Ns FR2449 to FR2958 inclusive, FR20010710 to FR20010722 inclusive, and FR20010723RT to FR20020127RT inclusive, manufactured since January 1999, might also have...

  12. Serving culturally diverse learners in the 24/7 management classroom

    NARCIS (Netherlands)

    van de Bunt-Kokhuis, S.G.M.; Weir, D.

    2013-01-01

    Purpose: The purpose of this paper is to highlight how future teaching in business schools will probably take place in an online (here called 24/7) classroom, where culturally diverse e-learners around the globe meet. Technologies such as iPhone, iPad and a variety of social media, to mention but a

  13. Prevalence of Plasmodium vivax VK210 and VK247 subtype in Myanmar

    Directory of Open Access Journals (Sweden)

    Kang Yoon-Joong

    2010-07-01

    Full Text Available Abstract Background Plasmodium vivax is divided into two subtypes, a dominant form, VK210 and a variant form, VK247. This division is dependent on the amino acid composition of the circumsporozoite (CS protein. In this study, the prevalence of the VK247 variant form of P. vivax was investigated in Myanmar. Methods The existence of malaria parasites in blood samples was determined by microscopic examination, polymerase chain reaction (PCR and DNA hybridization assays. To test for antibodies against P. vivax and Plasmodium falciparum in blood samples, an indirect immunofluorescence antibody test (IFAT was performed using asexual blood antigens. An enzyme-linked immunosorbent assay with synthetic VK210 and VK247 antigens was carried out to discriminate between the P. vivax subtypes. Results By thick smear examination, 73 (n = 100 patients were single infected with P. vivax, one with P. falciparum and 13 with both species. By thin smear, 53 patients were single infected with P. vivax, eight with only P. falciparum and 16 with both. Most of the collected blood samples were shown to be P. vivax positive (n = 95 by PCR. All cases that were positive for P. falciparum by PCR (n = 43 were also positive for P. vivax. However, 52 cases were single infected with P. vivax. IFAT showed antibody titres from 1:32 to 1:4,096. Additionally, using specific antibodies for VK210 and VK247, ELISA showed that 12 patients had antibodies for only the VK210 subtype, 4 patients had only VK247 subtype antibodies and 21 patients had antibodies for both subtypes. Using a DNA hybridization test, 47 patients were infected with the VK210 type, one patient was infected with VK247 and 23 patients were infected with both subtypes. Conclusions The proportion of the VK247 subtype in Myanmar was 43.1% (n = 25 among 58 positive cases by serodiagnosis and 25.6% (n = 24 among 94 positive cases by genetic diagnosis. In both diagnostic methods, the infection status of malaria patients is

  14. 48 CFR 252.247-7026 - Evaluation Preference for Use of Domestic Shipyards-Applicable to Acquisition of Carriage by...

    Science.gov (United States)

    2010-10-01

    ... AND CONTRACT CLAUSES Text of Provisions And Clauses 252.247-7026 Evaluation Preference for Use of... Noncontiguous Trade. As prescribed in 247.574(e), use the following provision: Evaluation Preference For Use of... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Evaluation Preference for...

  15. 17 CFR 247.700 - Defined terms relating to the networking exception from the definition of “broker.”

    Science.gov (United States)

    2010-04-01

    ... the average of the minimum and maximum hourly wage established by the bank for the current or prior... networking exception from the definition of âbroker.â 247.700 Section 247.700 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION (CONTINUED) REGULATION R-EXEMPTIONS AND DEFINITIONS RELATED TO...

  16. Microstructural studies of carbides in MAR-M247 nickel-based superalloy

    Science.gov (United States)

    Szczotok, A.; Rodak, K.

    2012-05-01

    Carbides play an important role in the strengthening of microstructures of nickel-based superalloys. Grain boundary carbides prevent or retard grain-boundary sliding and make the grain boundary stronger. Carbides can also tie up certain elements that would otherwise promote phase instability during service. Various types of carbides are possible in the microstructure of nickel-based superalloys, depending on the superalloy composition and processing. In this paper, scanning electron and scanning transmission electron microscopy studies of carbides occurring in the microstructure of polycrystalline MAR-M247 nickel-based superalloy were carried out. In the present work, MC and M23C6 carbides in the MAR-M247 microstructure were examined.

  17. Californium-252 Program Equipment Evaluation

    Energy Technology Data Exchange (ETDEWEB)

    Chattin, Fred Rhea [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Wilson, Kenton [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Ezold, Julie G. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States)

    2017-12-01

    To successfully continue the 252Cf production and meet the needs of the customers, a comprehensive evaluation of the Building 7920 processing equipment was requested to identify equipment critical to the operational continuity of the program.

  18. Californium Recovery from Palladium Wire

    Energy Technology Data Exchange (ETDEWEB)

    Burns, Jon D. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States)

    2014-08-01

    The recovery of 252Cf from palladium-252Cf cermet wires was investigated to determine the feasibility of implementing it into the cermet wire production operation at Oak Ridge National Laboratory’s Radiochemical Engineering Development Center. The dissolution of Pd wire in 8 M HNO3 and trace amounts of HCl was studied at both ambient and elevated temperatures. These studies showed that it took days to dissolve the wire at ambient temperature and only 2 hours at 60°C. Adjusting the ratio of the volume of solvent to the mass of the wire segment showed little change in the kinetics of dissolution, which ranged from 0.176 mL/mg down to 0.019 mL/mg. A successful chromatographic separation of 153Gd, a surrogate for 252Cf, from Pd was demonstrated using AG 50x8 cation exchange resin with a bed volume of 0.5 mL and an internal diameter of 0.8 cm.

  19. Evaluation of Cm-247 neutron cross sections in the resonance region

    International Nuclear Information System (INIS)

    Martinelli, T.; Menapace, E.; Motta, M.; Vaccari, M.

    1980-01-01

    The neutron cross sections of Cm-247 are evaluated in the resonance (resolved and unresolved) region up to 10 keV. Average resonance parameters (i.e. spacing D, fission and radiative widths, neutron strength functions) are determined for unresolved region calculations. Moreover for a better comparison with the experimental data, fission cross section is calculated up to 10 MeV. In addition, the average number of neutrons emitted per fission as a function of energy is estimated

  20. The energy and monetary implications of the '24/7 'always on' society

    International Nuclear Information System (INIS)

    Loveday, Dennis L.; Bhamra, T.; Tang, T.; Haines, V.J.A.; Holmes, M.J.; Green, R.J.

    2008-01-01

    This paper reviews the trends in society, technology and energy demand of the past 30 years, together with the growth of the 'on-demand' culture. The '24/7' or 'always on' society can be defined as one where people demand - and generally receive - what they want 'now'. It has grown up in parallel with developments in information technology, which have produced the services needed to meet that demand. Larger numbers of appliances, resulting from greater affluence and disposable income, have increased energy use, despite energy efficiencies in other areas. While monetary factors suggest that changes brought about by the 24/7 society will generally be self-correcting at the macro-economic level, there will nevertheless be effects for individuals, such as potentially severe impacts on the fuel poor as electricity prices rise. We conclude with a view of future directions. As the 24/7 culture continues to grow, there is scope for designers and for information technology to manage and reduce energy consumption. This includes buildings, their services systems, and the mix of new technologies that will be deployed over the next 20 years or so, including the possibilities for data exchange and control at the interface between energy suppliers and consumers, coupled with greater understanding of the behaviour of the consumers themselves. (author)

  1. Genetic Association of CD247 (CD3ζ) with SLE in a Large-Scale Multiethnic Study

    OpenAIRE

    Martins, Madalena; Williams, Adrienne H.; Comeau, Mary; Marion, Miranda; Ziegler, Julie T.; Freedman, Barry I.; Merrill, Joan T.; Glenn, Stuart B.; Kelly, Jennifer A.; Sivils, Kathy M.; James, Judith A.; Guthridge, Joel M.; Alarcón-Riquelme, Marta E.; Bae, Sang-Cheol; Kim, Jae-Hoon

    2015-01-01

    A classic T-cell phenotype in systemic lupus erythematosus (SLE) is the downregulation and replacement of the CD3ζ chain that alters T-cell receptor signaling. However, genetic associations with SLE in the human CD247 locus that encodes CD3ζ are not well established and require replication in independent cohorts. Our aim was therefore to examine, localize and validate CD247-SLE association in a large multiethnic population. We typed 44 contiguous CD247 single-nucleotide polymorphisms (SNPs) i...

  2. Investigation of neutron resonances of 247Cm in the 0.5-20 eV energy range

    International Nuclear Information System (INIS)

    Belanova, T.S.; Kolesov, A.G.; Klinov, A.V.; Nikol'skij, S.N.; Poruchikov, V.A.; Nefedov, V.N.; Artamonov, V.S.; Ivanov, R.N.; Kalebin, S.M.

    1979-01-01

    The neutron resonance parameters of 247 Cm were calculated from the transmission of a curium sample measured by the time-of-flight method. The neutron resonance parameters were calculated by the shape method using the single-level Breit-Wigner formula. Since the neutron resonance parameters of 244 Cm, 245 Cm, 246 Cm, 248 Cm, 243 Am and 240 Pu are well known, it was possible to identify the neutron resonances of 247 Cm from the measured transmission and calculate their parameters. We identified only five neutron resonances of 247 Cm with high values of 2gGAMMAsub(n). This is due to the fact that the 247 Cm content of the sample is low (1.7mg) and the resonances of this isotope are identified against the background of a large number of resonances of 244 Cm, 245 Cm, 246 Cm, 248 Cm, 243 Am and 240 Pu situated in the energy range in question

  3. Extending Pickering Fuel Channel Life to 247,000 EFPH (2020)

    International Nuclear Information System (INIS)

    Malek, I.

    2013-01-01

    This presentation is about extending the life of PNGS Pressure tubes from 210,000 EFPH (Effective Full Power Hours) to 247,000 EFPH. The l license renewal is in 2013 (R & D defined in 2009). The unknowns are the extent of degradation in some key areas. There are regulatory requirements for fuel channel extended life. It is necessary to integrate inspection capability and do-ability in outages. This would result in safe operation and demonstrated margin to extend life with operation to 2020.

  4. 24/7 security system: 60-FPS color EMCCD camera with integral human recognition

    Science.gov (United States)

    Vogelsong, T. L.; Boult, T. E.; Gardner, D. W.; Woodworth, R.; Johnson, R. C.; Heflin, B.

    2007-04-01

    An advanced surveillance/security system is being developed for unattended 24/7 image acquisition and automated detection, discrimination, and tracking of humans and vehicles. The low-light video camera incorporates an electron multiplying CCD sensor with a programmable on-chip gain of up to 1000:1, providing effective noise levels of less than 1 electron. The EMCCD camera operates in full color mode under sunlit and moonlit conditions, and monochrome under quarter-moonlight to overcast starlight illumination. Sixty frame per second operation and progressive scanning minimizes motion artifacts. The acquired image sequences are processed with FPGA-compatible real-time algorithms, to detect/localize/track targets and reject non-targets due to clutter under a broad range of illumination conditions and viewing angles. The object detectors that are used are trained from actual image data. Detectors have been developed and demonstrated for faces, upright humans, crawling humans, large animals, cars and trucks. Detection and tracking of targets too small for template-based detection is achieved. For face and vehicle targets the results of the detection are passed to secondary processing to extract recognition templates, which are then compared with a database for identification. When combined with pan-tilt-zoom (PTZ) optics, the resulting system provides a reliable wide-area 24/7 surveillance system that avoids the high life-cycle cost of infrared cameras and image intensifiers.

  5. Manganese determination om minerals by activation analysis, using the californium-252 as a neutron source; Determinacao de manganes em minerios, por analise por ativacao, usando californio-252 como fonte de neutrons

    Energy Technology Data Exchange (ETDEWEB)

    Cardoso, Antonio

    1976-07-01

    Neutron Activation Analysis, using a Californium-252 neutron source, has been applied for the determination of manganese in ores such as pyrolusite, rodonite (manganese silicate)' and blending used in dry-batteries The favorable nuclear properties of manganese, such as high thermal neutron cross-section for the reaction {sup 55}Mn (n.gamma){sup 56} Mn, high concentration of manganese in the matrix and short half - life of {sup 56}Mn, are an ideal combination for non-destructive analysis of manganese in ores. Samples and standards of manganese dioxide were irradiated for about 20 minutes, followed by a 4 to 15 minutes decay and counted in a single channel pulse-height discrimination using a NaI(Tl) scintillation detector. Counting time was equal to 10 minutes. The interference of nuclear reactions {sup 56}Fe(n,p){sup 56}Mn and {sup 59} Co (n, {alpha}){sup 56} were studied, as well as problems in connection with neutron shadowing during irradiation, gamma-rays attenuation during counting and influence of granulometry of samples. One sample,was also analysed by wet-chemical method (sodium bismuthate) in order to compare results. As a whole, i t was shown that the analytical method of neutron activation for manganese in ores and blending, is a method simple, rapid and with good precision and accuracy. (author)

  6. Design of a homogeneous subcritical nuclear reactor based on thorium with a source of californium 252; Diseno de un reactor nuclear subcritico homogeneo a base de Torio con una fuente de Californio 252

    Energy Technology Data Exchange (ETDEWEB)

    Delgado H, C. E.; Vega C, H. R. [Universidad Autonoma de Zacatecas, Unidad Academica de Estudios Nucleares, Cipres No. 10, Fracc. La Penuela, 98068 Zacatecas, Zac. (Mexico); Sajo B, L., E-mail: ce_delgado89@hotmail.com [Universidad Simon Bolivar, Laboratorio de Fisica Nuclear, Apdo. 89000, 1080A Caracas (Venezuela, Bolivarian Republic of)

    2015-10-15

    Full text: One of the energy alternatives to fossil fuels which do not produce greenhouse gases is the nuclear energy. One of the drawbacks of this alternative is the generation of radioactive wastes of long half-life and its relation to the generation of nuclear materials to produce weapons of mass destruction. An option to these drawbacks of nuclear energy is to use Thorium as part of the nuclear fuel which it becomes in U{sup 233} when capturing neutrons, that is a fissile material. In this paper Monte Carlo methods were used to design a homogeneous subcritical reactor based on thorium. As neutron reflector graphite was used. The reactor core is homogeneous and is formed of 70% light water as moderator, 12% of enriched uranium UO{sub 2}(NO{sub 3}){sub 4} and 18% of thorium Th(NO{sub 3}){sub 4} as fuel. To start the nuclear fission chain reaction an isotopic source of californium 252 was used with an intensity of 4.6 x 10{sup 7} s{sup -1}. In the design the value of the effective multiplication factor, whose value turned out k{sub eff} <1 was calculated. Also, the neutron spectra at different distances from the source and the total fluence were calculated, as well as the values of the ambient dose equivalent in the periphery of the reactor. (Author)

  7. Manganese determination om minerals by activation analysis, using the californium-252 as a neutron source; Determinacao de manganes em minerios, por analise por ativacao, usando californio-252 como fonte de neutrons

    Energy Technology Data Exchange (ETDEWEB)

    Cardoso, Antonio

    1976-07-01

    Neutron Activation Analysis, using a Californium-252 neutron source, has been applied for the determination of manganese in ores such as pyrolusite, rodonite (manganese silicate)' and blending used in dry-batteries The favorable nuclear properties of manganese, such as high thermal neutron cross-section for the reaction {sup 55}Mn (n.gamma){sup 56} Mn, high concentration of manganese in the matrix and short half - life of {sup 56}Mn, are an ideal combination for non-destructive analysis of manganese in ores. Samples and standards of manganese dioxide were irradiated for about 20 minutes, followed by a 4 to 15 minutes decay and counted in a single channel pulse-height discrimination using a NaI(Tl) scintillation detector. Counting time was equal to 10 minutes. The interference of nuclear reactions {sup 56}Fe(n,p){sup 56}Mn and {sup 59} Co (n, {alpha}){sup 56} were studied, as well as problems in connection with neutron shadowing during irradiation, gamma-rays attenuation during counting and influence of granulometry of samples. One sample,was also analysed by wet-chemical method (sodium bismuthate) in order to compare results. As a whole, i t was shown that the analytical method of neutron activation for manganese in ores and blending, is a method simple, rapid and with good precision and accuracy. (author)

  8. High temperature creep properties of directionally solidified CM-247LC Ni-based superalloy

    Energy Technology Data Exchange (ETDEWEB)

    Chiou, Mau-Sheng [Department of Materials Science and Engineering, I-Shou University, Kaohsiung 840, Taiwan (China); Jian, Sheng-Rui, E-mail: srjian@gmail.com [Department of Materials Science and Engineering, I-Shou University, Kaohsiung 840, Taiwan (China); Yeh, An-Chou [Department of Materials Science and Engineering, National Tsing Hua University, Hsinchu 300, Taiwan (China); Kuo, Chen-Ming [Department of Mechanical and Automation Engineering, I-Shou University, Kaohsiung 840, Taiwan (China); Juang, Jenh-Yih [Department of Electrophysics, National Chiao Tung University, Hsinchu 300, Taiwan (China)

    2016-02-08

    This study explores the effects of cooling rate after solution heat treatment on the high temperature/low stress (982 °C/200 MPa) creep properties of CM-247LC Nickel base superalloy. Cooling rate was controlled by blowing argon gas, air cooling, and furnace cooling, which, in turn, gave rise to corresponding cooling rates (from 1260 °C to 800 °C) of 18.7, 7.4, and 0.19 °C/s, respectively. The results indicated that higher cooling rate from the solution heat treatment temperature led to finer γ′ precipitates and much improved tertiary creep as well as rupture life time in high-temperature creep test. The microstructural analyses using both scanning electron microscopy (SEM) and transmission electron microscopy (TEM) revealed that finer γ′ precipitates and narrower γ channel width could result in denser rafting structure which might have hindered the climb of dislocations across the precipitates rafts.

  9. Safe2Tell® : an anonymous, 24/7 reporting system for preventing school violence.

    Science.gov (United States)

    Payne, Susan R T; Elliott, Delbert S

    2011-01-01

    There is widespread agreement that many school shootings could be prevented if authorities were informed that a student was planning or preparing to carry out an attack. A universal problem is that young people are highly reluctant to report on their peers. This code of silence represents a major barrier to prevention efforts. In response to the Columbine shooting, the state of Colorado established the Safe2Tell® anonymous, 24/7 reporting system for receiving and forwarding threats of violence, bullying, and other concerns. This article describes how the program has grown to the point that it now receives more than 100 calls per month. A series of case examples illustrates its success in responding to threatening situations, including twenty-eight potential school attacks. Copyright © 2011 Wiley Periodicals, Inc., A Wiley Company.

  10. Help at 3:00 AM! Providing 24/7 Timely Support to Online Students via a Virtual Assistant

    Science.gov (United States)

    Vu, Phu; Fredrickson, Scott; Meyer, Richard

    2016-01-01

    With a dearth of research on human-robot interaction in education and relatively high non-completion rates of online students, this study was conducted to determine the feasibility of using a virtual assistant (VA) to respond to questions and concerns of students and provide 24/7 online course content support. During a 16 week-long academic…

  11. 40 CFR 174.524 - Glyphosate Oxidoreductase GOX or GOXv247 in all plants; exemption from the requirement of a...

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 23 2010-07-01 2010-07-01 false Glyphosate Oxidoreductase GOX or... REQUIREMENTS FOR PLANT-INCORPORATED PROTECTANTS Tolerances and Tolerance Exemptions § 174.524 Glyphosate... Glyphosate Oxidoreductase GOX or GOXv247 enzyme in all plants are exempt from the requirement of a tolerance...

  12. 32 CFR Appendix C to Part 247 - Mailing of DoD Newspapers, Magazines, CE Guides, and Installation Maps; Sales and Distribution of...

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false Mailing of DoD Newspapers, Magazines, CE Guides...) MISCELLANEOUS DEPARTMENT OF DEFENSE NEWSPAPERS, MAGAZINES AND CIVILIAN ENTERPRISE PUBLICATIONS Pt. 247, App. C Appendix C to Part 247—Mailing of DoD Newspapers, Magazines, CE Guides, and Installation Maps; Sales and...

  13. PHL 6625: A Minor Merger-associated QSO Behind NGC 247

    Energy Technology Data Exchange (ETDEWEB)

    Tao, Lian; Feng, Hua [Department of Engineering Physics, Tsinghua University, Beijing 100084 (China); Shen, Yue; Liu, Xin [Department of Astronomy, University of Illinois at Urbana-Champaign, Urbana, IL 61801 (United States); Ho, Luis C. [Kavli Institute for Astronomy and Astrophysics, Peking University, Beijing 100087 (China); Ge, Junqiang [National Astronomical Observatories, Chinese Academy of Sciences, 20A Datun Road, Chaoyang District, Beijing 100012 (China); Kaaret, Philip [Department of Physics and Astronomy, University of Iowa, Iowa City, IA 52242 (United States); Mao, Shude [Center for Astrophysics, Tsinghua University, Beijing 100084 (China)

    2017-06-01

    PHL 6625 is a luminous quasi-stellar object (QSO) at z = 0.3954 located behind the nearby galaxy NGC 247 ( z = 0.0005). Hubble Space Telescope observations revealed an arc structure associated with it. We report on spectroscopic observations with the Very Large Telescope and multiwavelength observations from the radio to the X-ray band for the system, suggesting that PHL 6625 and the arc are a close pair of merging galaxies, instead of a strong gravitational lens system. The QSO host galaxy is estimated to be (4–28) × 10{sup 10} M {sub ☉} and the mass of the companion galaxy is estimated to be M {sub *} = (6.8 ± 2.4) × 10{sup 9} M {sub ☉}, suggesting that this is a minor merger system. The QSO displays typical broad emission lines, from which a black hole mass of about (2–5) × 10{sup 8} M {sub ☉} and an Eddington ratio of about 0.01–0.05 can be inferred. The system represents an interesting and rare case where a QSO is associated with an ongoing minor merger, analogous to Arp 142.

  14. THE DEVELOPMENT OF BIOCHEMICAL OXYGEN DEMAND SENSOR USING LOCAL YEAST: Candida fukuyamaensis, UICC Y-247

    Directory of Open Access Journals (Sweden)

    Endang Saepudin

    2011-04-01

    Full Text Available In order to shorten the measurement time of biochemical oxygen demand (BOD, a BOD sensor based on yeastmetabolism was developed. Local yeast, Indonesian Origin, Candida fukuyamaensis UICC Y-247, was used as atransducer. The yeast was immobilized as a thin film in agarose matrix with the auxiliary of Nafion® acting as themembrane for ion exchange process. The film was then attached to gold-modified glassy carbons and used as transduceron the working electrodes. The measurements were conducted by observing the depletion of glucose concentrationusing multipulse amperometric method and then converted to BOD values. Optimum condition was observed in awaiting measurement time of 30 min at an applied potential of 450 mV (vs. Ag/AgCl. Linearity was shown in glucoseconcentration range of 0.1–0.5 mM, which was equivalent to BOD concentration range of 10–50 mg/L. A detectionlimit of 1.13 mg/L BOD could be achieved. Good repeatability was shown by a relative standard deviation (RSD of2.7% (n = 15. However, decreasing current response of ~50% was found after 3 days. Comparing to the conventionalBOD measurement, this BOD sensor can be used as an alternative method for BOD measurements.

  15. LCF- and LCF/HCF-behaviour of the superalloy MAR-M247LC

    Energy Technology Data Exchange (ETDEWEB)

    Gelmedin, Domnin; Lang, Karl-Heinz [Karlsruhe Institute of Technology (KIT), Karlsruhe (Germany). Inst. fuer Werkstoffkunde I

    2010-07-01

    The fatigue behaviour of the Nickel-base superalloy Mar-M247LC was investigated at 650 C in air environment under total strain control. Pure low cycle fatigue (LCF) loading, pure high cycle fatigue (HCF) loading and superimposed LCF/HCF loading were realised. In LCF tests with a strain ratio of zero and a hold time of 60 seconds the cyclic deformation and the lifetime behaviour was investigated. The dependence of the fatigue limit on the mean strain was estimated in HCF tests at a frequency of 60 Hz using an ultimate number of cycles of ten million. Finally the influence of superimposed HCF and LCF loadings was examined. At high total strain ranges of the HCF loading the lifetime of the superalloy as reduced about more than one magnitude compared to the lifetime under pure LCF loading. With decreasing HCF loadings the reduction of the lifetime decreases. This life time reduction can be explained by the interaction of the LCF and the superimposed HCF loading. Crack initiation and first crack propagation is predominantly induced by the LCF loading. After reaching an adequate long fatigue crack length the superimposed HCF loading contributes considerably to the crack growth. This contribution can be determined evaluating the distance between the LCF marking lines which form on the fracture surface. The higher the superimposed HCF loading was the longer the distance between the LCF marking lines and the lower the crack length were when first LCF marking lines could be recognized. On the basis of this cognition the life time under superimposed LCF/HCF loading was modelled using a model basing on fracture mechanics. (orig.)

  16. Missed surgical intensive care unit billing: potential financial impact of 24/7 faculty presence.

    Science.gov (United States)

    Hendershot, Kimberly M; Bollins, John P; Armen, Scott B; Thomas, Yalaunda M; Steinberg, Steven M; Cook, Charles H

    2009-07-01

    To efficiently capture evaluation and management (E&M) and procedural billing in our surgical intensive care unit (SICU), we have developed an electronic billing system that links to the electronic medical record (EMR). In this system, only notes electronically signed and coded by an attending generate billing charges. We hypothesized that capture of missed billing during nighttime and weekends might be sufficient to subsidize 24/7 in-house attending coverage. A retrospective chart EMR review was performed of the EMRs for all SICU patients during a 2-month period. Note type, date, time, attending signature, and coding were analyzed. Notes without attending signature, diagnosis, or current procedural terminology (CPT) code were considered incomplete and identified as "missed billing." Four hundred and forty-three patients had 465 admissions generating 2,896 notes. Overall, 76% of notes were signed and coded by an attending and billed. Incomplete (not billed) notes represented an overall missed billing opportunity of $159,138 for the 2-month time period (approximately $954,000 annually). Unbilled E&M encounters during weekdays totaled $54,758, whereas unbilled E&M and procedures from weeknights and weekends totaled $88,408 ($44,566 and $43,842, respectively). Missed billing after-hours thus represents approximately $530K annually, extrapolating to approximately $220K in collections from our payer mix. Surprisingly, missed E&M and procedural billing during weekdays totaled $70,730 (approximately $425K billing, approximately $170K collections annually), and typically represented patients seen, but transferred from the SICU before attending documentation was completed. Capture of nighttime and weekend ICU collections alone may be insufficient to add faculty or incentivize in-house coverage, but could certainly complement other in-house derived revenues to such ends. In addition, missed daytime billing in busy modern ICUs can be substantial, and use of an EMR to identify

  17. MOLECULAR CLUMPS AND INFRARED CLUSTERS IN THE S247, S252, AND BFS52 REGIONS

    Energy Technology Data Exchange (ETDEWEB)

    Shimoikura, Tomomi; Dobashi, Kazuhito [Department of Astronomy and Earth Sciences, Tokyo Gakugei University, Koganei, Tokyo 184-8501 (Japan); Saito, Hiro; Nakamura, Fumitaka [National Astronomical Observatory of Japan, Mitaka, Tokyo 181-8588 (Japan); Matsumoto, Tomoaki [Hosei University, Fujimi, Chiyoda-ku, Tokyo 102-8160 (Japan); Nishimura, Atsushi; Kimura, Kimihiro; Onishi, Toshikazu; Ogawa, Hideo, E-mail: ikura@u-gakugei.ac.jp [Department of Physical Science, Osaka Prefecture University, Sakai, Osaka 599-8531 (Japan)

    2013-05-01

    We present results of the observations carried out toward the S247, S252, and BFS52 H II regions with various molecular lines using the 1.85 m radio telescope and the 45 m telescope at Nobeyama Radio Observatory. There are at least 11 young infrared clusters (IR clusters) within the observed region. We found that there are two velocity components in {sup 12}CO (J = 2-1), and also that their spatial distributions show an anti-correlation. The IR clusters are located at their interfaces, suggesting that two distinct clouds with different velocities are colliding with each other, which may have induced the cluster formation. Based on {sup 13}CO (J = 1-0) and C{sup 18}O (J = 1-0) observations, we identified 16 clumps in and around the three H II regions. Eleven of the clumps are associated with the IR clusters and the other five clumps are not associated with any known young stellar objects. We investigated variations in the velocity dispersions of the 16 clumps as a function of the distance from the center of the clusters or the clumps. Clumps with clusters tend to have velocity dispersions that increase with distance from the cluster center, while clumps without clusters show a flat velocity dispersion over the clump extents. A {sup 12}CO outflow has been found in some of the clumps with IR clusters but not in the other clumps, supporting a strong relation of these clumps to the broader velocity dispersion region. We also estimated a mean star formation efficiency of {approx}30% for the clumps with IR clusters in the three H II regions.

  18. Prediction of maximum casting defect size in MAR-M-247 alloy processed by hot isostatic pressing

    Czech Academy of Sciences Publication Activity Database

    Šmíd, Miroslav; Fintová, Stanislava; Kunz, Ludvík; Hutař, Pavel; Hrbáček, K.

    2015-01-01

    Roč. 22, č. 1 (2015), s. 25-32 ISSN 1335-0803 R&D Projects: GA MPO FR-TI4/030; GA MŠk(CZ) EE2.3.20.0214 Institutional support: RVO:68081723 Keywords : MAR-M 247 * Superalloys * Fatigue * Casting defects * Elevated temperatures Subject RIV: JL - Materials Fatigue, Friction Mechanics http://ojs.mateng.sk/index.php/Mateng/article/view/160/249

  19. Selective Cathepsin S Inhibition with MIV-247 Attenuates Mechanical Allodynia and Enhances the Antiallodynic Effects of Gabapentin and Pregabalin in a Mouse Model of Neuropathic Pain.

    Science.gov (United States)

    Hewitt, Ellen; Pitcher, Thomas; Rizoska, Biljana; Tunblad, Karin; Henderson, Ian; Sahlberg, Britt-Louise; Grabowska, Urszula; Classon, Björn; Edenius, Charlotte; Malcangio, Marzia; Lindström, Erik

    2016-09-01

    Cathepsin S inhibitors attenuate mechanical allodynia in preclinical neuropathic pain models. The current study evaluated the effects when combining the selective cathepsin S inhibitor MIV-247 with gabapentin or pregabalin in a mouse model of neuropathic pain. Mice were rendered neuropathic by partial sciatic nerve ligation. MIV-247, gabapentin, or pregabalin were administered alone or in combination via oral gavage. Mechanical allodynia was assessed using von Frey hairs. Neurobehavioral side effects were evaluated by assessing beam walking. MIV-247, gabapentin, and pregabalin concentrations in various tissues were measured. Oral administration of MIV-247 (100-200 µmol/kg) dose-dependently attenuated mechanical allodynia by up to approximately 50% reversal when given as a single dose or when given twice daily for 5 days. No behavioral deficits were observed at any dose of MIV-247 tested. Gabapentin (58-350 µmol/kg) and pregabalin (63-377 µmol/kg) also inhibited mechanical allodynia with virtually complete reversal at the highest doses tested. The minimum effective dose of MIV-247 (100 µmol/kg) in combination with the minimum effective dose of pregabalin (75 µmol/kg) or gabapentin (146 µmol/kg) resulted in enhanced antiallodynic efficacy without augmenting side effects. A subeffective dose of MIV-247 (50 µmol/kg) in combination with a subeffective dose of pregabalin (38 µmol/kg) or gabapentin (73 µmol/kg) also resulted in substantial efficacy. Plasma levels of MIV-247, gabapentin, and pregabalin were similar when given in combination as to when given alone. Cathepsin S inhibition with MIV-247 exerts significant antiallodynic efficacy alone, and also enhances the effect of gabapentin and pregabalin without increasing side effects or inducing pharmacokinetic interactions. Copyright © 2016 by The American Society for Pharmacology and Experimental Therapeutics.

  20. The energy and monetary implications of the '24/7 'always on' society

    Energy Technology Data Exchange (ETDEWEB)

    Loveday, Dennis L. [Department of Civil and Building Engineering, Loughborough University, Loughborough, Leicestershire LE11 3TU (United Kingdom); Bhamra, T.; Tang, T. [Department of Design and Technology, Loughborough University, Loughborough, Leicestershire LE11 3TU (United Kingdom); Haines, V.J.A. [Ergonomics and Safety Research Institute (ESRI), Loughborough University, Loughborough, Leicestershire LE11 3TU (United Kingdom); Holmes, M.J. [ARUP, 13, Fitzroy Street, London W1T 4BR (United Kingdom); Green, R.J. [Institute for Energy Research and Policy, University of Birmingham, Edgbaston, Birmingham B15 2TT (United Kingdom)

    2008-12-15

    This paper reviews the trends in society, technology and energy demand of the past 30 years, together with the growth of the 'on-demand' culture. The '24/7' or 'always on' society can be defined as one where people demand - and generally receive - what they want 'now'. It has grown up in parallel with developments in information technology, which have produced the services needed to meet that demand. Larger numbers of appliances, resulting from greater affluence and disposable income, have increased energy use, despite energy efficiencies in other areas. While monetary factors suggest that changes brought about by the 24/7 society will generally be self-correcting at the macro-economic level, there will nevertheless be effects for individuals, such as potentially severe impacts on the fuel poor as electricity prices rise. We conclude with a view of future directions. As the 24/7 culture continues to grow, there is scope for designers and for information technology to manage and reduce energy consumption. This includes buildings, their services systems, and the mix of new technologies that will be deployed over the next 20 years or so, including the possibilities for data exchange and control at the interface between energy suppliers and consumers, coupled with greater understanding of the behaviour of the consumers themselves. (author)

  1. The energy and monetary implications of the '24/7' 'always on' society

    Energy Technology Data Exchange (ETDEWEB)

    Loveday, Dennis L. [Department of Civil and Building Engineering, Loughborough University, Loughborough, Leicestershire LE11 3TU (United Kingdom)], E-mail: d.l.loveday@lboro.ac.uk; Bhamra, T.; Tang, T. [Department of Design and Technology, Loughborough University, Loughborough, Leicestershire LE11 3TU (United Kingdom); Haines, V.J.A. [Ergonomics and Safety Research Institute (ESRI), Loughborough University, Loughborough, Leicestershire LE11 3TU (United Kingdom); Holmes, M.J. [ARUP, 13, Fitzroy Street, London W1T 4BR (United Kingdom); Green, R.J. [Institute for Energy Research and Policy, University of Birmingham, Edgbaston, Birmingham B15 2TT (United Kingdom)

    2008-12-15

    This paper reviews the trends in society, technology and energy demand of the past 30 years, together with the growth of the 'on-demand' culture. The '24/7' or 'always on' society can be defined as one where people demand-and generally receive-what they want 'now'. It has grown up in parallel with developments in information technology, which have produced the services needed to meet that demand. Larger numbers of appliances, resulting from greater affluence and disposable income, have increased energy use, despite energy efficiencies in other areas. While monetary factors suggest that changes brought about by the 24/7 society will generally be self-correcting at the macro-economic level, there will nevertheless be effects for individuals, such as potentially severe impacts on the fuel poor as electricity prices rise. We conclude with a view of future directions. As the 24/7 culture continues to grow, there is scope for designers and for information technology to manage and reduce energy consumption. This includes buildings, their services systems, and the mix of new technologies that will be deployed over the next 20 years or so, including the possibilities for data exchange and control at the interface between energy suppliers and consumers, coupled with greater understanding of the behaviour of the consumers themselves.

  2. 17 CFR 247.781 - Exemption from the definition of “broker” for banks for a limited period of time.

    Science.gov (United States)

    2010-04-01

    ... “broker” for banks for a limited period of time. A bank is exempt from the definition of the term “broker... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Exemption from the definition of âbrokerâ for banks for a limited period of time. 247.781 Section 247.781 Commodity and Securities...

  3. Preparation and study of elemental californium-249

    International Nuclear Information System (INIS)

    Noe, M.; Peterson, J.R.

    1975-01-01

    Bulk samples of 249 Cf metal were prepared on the 10 μg scale via the Li metal vapor reduction of 249 CfF 3 . Above about 725 0 C elemental Cf exhibits a face-centered cubic (fcc) structure with an average, room-temperature lattice parameter of 5.75(1)A. Between about 600 0 C and 725 0 C, the stable form of Cf metal is another fcc structure with an average, room-temperature lattice parameter of 4.94(1)A. Below 600 0 C metallic Cf exhibits a double hexagonal closest packed (dhcp) structure with average, room temperature lattice parameters of a 0 = 3.39(1)A and c 0 = 11.01(5)A. By comparison of the metallic radii calculated for these three forms with those of the receding transuranium elements, it is suggested that the two, lower temperature modifications represent Cf with a metallic valence of three, while the highest temperature form represents a metallic valence of two. Although the data reported here are from the most complete study to date of elemental Cf, the limitations accompanying such microscale research are duly noted. (U.S.)

  4. Californium Cf-252 for pelvic radiotherapy

    Energy Technology Data Exchange (ETDEWEB)

    Maruyama, Y; Feola, J M; Tai, D; Wilson, L C; Van Nagell, J R; Yoneda, J

    1978-01-01

    Clinical data about therapy concerning tumors of the female gynecological cancers of the cervix, vagina and uterus are reviewed. Dosimetric, laboratory and radiobiological research data form the basis for an approach to such tumors using Cf-252 as a form of boost brachytherapy. Extreme personnel hazards are a real and important consideration and indicate that maximal containment and isolation procedures should be exercised in its use.

  5. Effect of Process Variables on the Inertia Friction Welding of Superalloys LSHR and Mar-M247

    Science.gov (United States)

    Mahaffey, D. W.; Senkov, O. N.; Shivpuri, R.; Semiatin, S. L.

    2016-08-01

    The effect of inertia friction welding process parameters on microstructure evolution, weld plane quality, and the tensile behavior of welds between dissimilar nickel-base superalloys was established. For this purpose, the fine-grain, powder metallurgy alloy LSHR was joined to coarse-grain cast Mar-M247 using a fixed level of initial kinetic energy, but different combinations of the flywheel moment of inertia and initial rotation speed. It was found that welds made with the largest moment of inertia resulted in a sound bond with the best microstructure and room-temperature tensile strength equal to or greater than that of the parent materials. A relationship between the moment of inertia and weld process efficiency was established. The post-weld tensile behavior was interpreted in the context of observed microstructure gradients and weld-line defects.

  6. Synthesis of the enantiomers of [3-{sup 3}H]-2-[[4-[(7-chloro-4-quinolinyl)-amino]pentyl]ethylamino]eth anol, [3-{sup 3}H]-hydroxychloroquine

    Energy Technology Data Exchange (ETDEWEB)

    Ellames, G.J.; Herbert, J.M.; Peace, J.E.; Smith, D.J.; Wedge, K.J. [Sterling Winthrop Research Centre, Alnwick (United Kingdom). Pharmaceuticals Research Div.

    1995-01-01

    The enantiomers of [3-{sup 3}H]-2-[[4-[(7-chloro-4-quinolinyl)amino] pentyl]ethylamino]ethanol, [3-{sup 3}H]-hydroxychloroquine, (R)-8 and (S)-8, have been prepared in two steps from the known precursors 4,7-dichloro-3-iodoquinoline, and the enantiomers of 2-[(4-aminopentyl) ethyl-amino]ethanol, (R)-2 and (S)-2, by formation of the enantiomers of 2-[[4-[(7-chloro-3-iodo-4-quinolinyl)amino]pentyl]ethylamino] ethanol, (R)-3 and (S)-3, and subsequent reductive deiodination with tritium gas over 10% palladium on charcoal. (Author).

  7. Synthesis of the enantiomers of [3-3H]-2-[[4-[(7-chloro-4-quinolinyl)-amino]pentyl]ethylamino]eth anol, [3-3H]-hydroxychloroquine

    International Nuclear Information System (INIS)

    Ellames, G.J.; Herbert, J.M.; Peace, J.E.; Smith, D.J.; Wedge, K.J.

    1995-01-01

    The enantiomers of [3- 3 H]-2-[[4-[(7-chloro-4-quinolinyl)amino] pentyl]ethylamino]ethanol, [3- 3 H]-hydroxychloroquine, (R)-8 and (S)-8, have been prepared in two steps from the known precursors 4,7-dichloro-3-iodoquinoline, and the enantiomers of 2-[(4-aminopentyl) ethyl-amino]ethanol, (R)-2 and (S)-2, by formation of the enantiomers of 2-[[4-[(7-chloro-3-iodo-4-quinolinyl)amino]pentyl]ethylamino] ethanol, (R)-3 and (S)-3, and subsequent reductive deiodination with tritium gas over 10% palladium on charcoal. (Author)

  8. High cycle fatigue behavior of the IN718/M247 hybrid element fabricated by friction welding at elevated temperatures

    Directory of Open Access Journals (Sweden)

    Tran Hung Tra

    2016-12-01

    Full Text Available A hybrid element has been fabricated by friction welding, joining two superalloys Inconel 718 and Mar-M247. The high cycle fatigue behavior of this welded element was investigated at 500 °C and 700 °C. The fabrication could obtain excellent fatigue strength in which the fracture is located in the base metal Mar-M247 side and takes place outside the welded zone. The behavior of the joint under loadings is discussed through a simulation by the numerical finite element method.

  9. Development and Pilot Testing of 24/7 In-Ambulance Telemedicine for Acute Stroke : Prehospital Stroke Study at the Universitair Ziekenhuis Brussel-Project

    NARCIS (Netherlands)

    Espinoza, Alexis Valenzuela; Van Hooff, Robbert-Jan; De Smedt, Ann; Moens, Maarten; Yperzeele, Laetitia; Nieboer, Koenraad; Hubloue, Ives; de Keyser, Jacques; Convents, Andre; Tellez, Helio Fernandez; Dupont, Alain; Putman, Koen; Brouns, Raf

    2016-01-01

    Background: In-ambulance telemedicine is a recently developed and a promising approach to improve emergency care. We implemented the first ever 24/7 in-ambulance telemedicine service for acute stroke. We report on our experiences with the development and pilot testing of the Prehospital Stroke Study

  10. A Gene Encoding a DUF247 Domain Protein Cosegregates with the S Self-Incompatibility Locus in Perennial Ryegrass

    DEFF Research Database (Denmark)

    Manzanares, Chloe; Barth, Susanne; Thorogood, Daniel

    2016-01-01

    genes cosegregating with the S-locus, a highly polymorphic gene encoding for a protein containing a DUF247 was fully predictive of known S-locus genotypes at the amino acid level in the seven mapping populations. Strikingly, this gene showed a frameshift mutation in self-compatible darnel (Lolium...

  11. Development and Pilot Testing of 24/7 In-Ambulance Telemedicine for Acute Stroke: Prehospital Stroke Study at the Universitair Ziekenhuis Brussel-Project.

    Science.gov (United States)

    Valenzuela Espinoza, Alexis; Van Hooff, Robbert-Jan; De Smedt, Ann; Moens, Maarten; Yperzeele, Laetitia; Nieboer, Koenraad; Hubloue, Ives; de Keyser, Jacques; Convents, Andre; Fernandez Tellez, Helio; Dupont, Alain; Putman, Koen; Brouns, Raf

    2016-01-01

    In-ambulance telemedicine is a recently developed and a promising approach to improve emergency care. We implemented the first ever 24/7 in-ambulance telemedicine service for acute stroke. We report on our experiences with the development and pilot testing of the Prehospital Stroke Study at the Universitair Ziekenhuis Brussel (PreSSUB) to facilitate a wider spread of the knowledge regarding this technique. Successful execution of the project involved the development and validation of a novel stroke scale, design and creation of specific hardware and software solutions, execution of field tests for mobile internet connectivity, design of new care processes and information flows, recurrent training of all professional caregivers involved in acute stroke management, extensive testing on healthy volunteers, organisation of a 24/7 teleconsultation service by trained stroke experts and 24/7 technical support, and resolution of several legal issues. In all, it took 41 months of research and development to confirm the safety, technical feasibility, reliability, and user acceptance of the PreSSUB approach. Stroke-specific key information can be collected safely and reliably before and during ambulance transportation and can adequately be communicated with the inhospital team awaiting the patient. This paper portrays the key steps required and the lessons learned for successful implementation of a 24/7 expert telemedicine service supporting patients with acute stroke during ambulance transportation to the hospital. © 2016 S. Karger AG, Basel.

  12. Spatially conserved regulatory elements identified within human and mouse Cd247 gene using high-throughput sequencing data from the ENCODE project

    DEFF Research Database (Denmark)

    Pundhir, Sachin; Hannibal, Tine Dahlbæk; Bang-Berthelsen, Claus Heiner

    2014-01-01

    . In this study, we have utilized the wealth of high-throughput sequencing data produced during the Encyclopedia of DNA Elements (ENCODE) project to identify spatially conserved regulatory elements within the Cd247 gene from human and mouse. We show the presence of two transcription factor binding sites...

  13. 24/7 in-house intensivist coverage and fellowship education: a cross-sectional survey of academic medical centers in the United States.

    Science.gov (United States)

    Diaz-Guzman, Enrique; Colbert, Colleen Y; Mannino, David M; Davenport, Daniel L; Arroliga, Alejandro C

    2012-04-01

    The objectives of this study were to determine the current staffing models of practice and the frequency of 24/7 coverage in academic medical centers in the United States and to assess the perceptions of critical care trainees and program directors toward these models. A cross-sectional national survey was conducted using an Internet-based survey platform. The survey was distributed to fellows and program directors of 374 critical care training programs in US academic medical centers. We received 518 responses: 138 from program directors (PDs) (37% of 374 programs) and 380 fellow responses. Coverage by a board-certified or board-eligible intensivist physician 24/7 was reported by 33% of PD respondents and was more common among pediatric and surgical critical care programs. Mandatory in-house call for critical care trainees was reported by 48% of the PDs. Mandatory call was also more common among pediatric-critical care programs compared with the rest (P 24/7 coverage would be associated with better patient care in the ICU and improved education for the fellows, although 65% of them believed this model would have a negative impact on trainees' autonomy. Intensivist coverage 24/7 was not commonly used in US academic centers responding to our survey. Significant differences in coverage models among critical care medicine specialties appear to exist. Program director and trainee respondents believed that 24/7 coverage was associated with better outcomes and education but also expressed concerns about the impact of this model on fellows' autonomy.

  14. Expression of the benign HEXA mutations, Arg247Trp and Arg249Trp, associated with beta-hexosaminidase A pseudodeficiency

    Energy Technology Data Exchange (ETDEWEB)

    Cao, Z.; Petroulakis, E.; Salo, T. [Univ. of Manitoba (Canada)] [and others

    1994-09-01

    {beta}-Hexosaminidase (Hex A) is a heterodimer of {alpha} and {beta} subunits encoded by the HEXA and HEXB genes, respectively. Mutations in the HEXA gene typically cause Tay-Sachs disease or less severe forms of G{sub M2} gangliosidosis. However, two benign mutations (Arg247Trp and Arg249Trp) in the {alpha}-subunit of Hex A account for Hex A deficiency in {approximately}36% of non-Jewish enzyme-defined Tay-Sachs disease carriers. These mutations do not result in any apparent clinical phenotype in individuals who are genetic compounds with a second disease-causing mutation. We expressed the {alpha}-subunit harboring each of the benign mutations separately to study activity toward the synthetic substrate, 4-MUGS, for comparison to activity from enzymes containing mutations associated with other forms of G{sub M2} gangliosidosis. The C739T (Arg247Trp;benign), C745T (Arg 249Trp; benign), G805A (Gly269Ser; adult-onset), G749A (Gly250Asp; juvenile), and C508T (Arg170Trp; infantile) mutations were introduced into the {alpha}-subunit cDNA. These were transfected alone, or with the {beta}-subunit cDNA, to generate Hex S ({alpha}{alpha}) or Hex A ({alpha}{beta}), respectively. The activities were monitored using 4-MUGS, and the levels of {alpha}-subunit protein were assessed by Western blotting. Repeated experiments show that the benign mutations produce approximately 35% of normal Hex S and 40% of normal Hex A activity. This level is much higher than that of Hex A harbouring the Gly169Ser adult-onset mutation (12%). A sequential decrease in expressed Hex A activity is observed as mutations associated with more severe phenotypes are expressed. The benign mutations also result in lower levels of mature {alpha}-subunit protein compared to normal, and slightly reduced levels of {alpha}-subunit precursor protein. The Hex A deficiency resulting from benign mutations is not as great as that associated with disease-causing mutations.

  15. Microstructure of selective laser melted CM247LC nickel-based superalloy and its evolution through heat treatment

    Energy Technology Data Exchange (ETDEWEB)

    Divya, V.D., E-mail: dv272@cam.ac.uk [Department of Materials Science and Metallurgy, University of Cambridge, 27 Charles Babbage Road, Cambridge CB3 0FS (United Kingdom); Muñoz-Moreno, R.; Messé, O.M.D.M.; Barnard, J.S. [Department of Materials Science and Metallurgy, University of Cambridge, 27 Charles Babbage Road, Cambridge CB3 0FS (United Kingdom); Baker, S.; Illston, T. [Materials Solutions, Unit 8, Great Western Business Park, McKenzie Way, Worcester WR4 9GN (United Kingdom); Stone, H.J. [Department of Materials Science and Metallurgy, University of Cambridge, 27 Charles Babbage Road, Cambridge CB3 0FS (United Kingdom)

    2016-04-15

    The selective laser melting of high temperature alloys is of great interest to the aerospace industry as it offers the prospect of producing more complex geometries than can be achieved with other manufacturing methods. In this study, the microstructure of the nickel-based superalloy, CM247LC, has been characterised following selective laser melting and after a post deposition heat treatment below the γ′ solvus temperature. In the as-deposited state, scanning electron microscopy with electron backscatter diffraction revealed a fine, cellular microstructure with preferential alignment of 〈001〉 along the build direction. A high dislocation density was seen at the periphery of the cells, indicating substantial localised deformation of the material. Fine primary MC carbides were also observed in the inter-cellular regions. High-resolution transmission electron microscopy identified the occurrence of very fine γ′ precipitates, approximately 5 nm in diameter, dispersed within the gamma phase. After heat treatment, the elongated cell colonies were observed to partially coalesce, accompanied by a decrease in dislocation density, producing columnar grains along the build direction. Cuboidal γ′ precipitates approximately 500 nm in diameter were observed to form in the recrystallised grains, accompanied by larger γ′ precipitates on the grain boundaries.

  16. Microstructure of selective laser melted CM247LC nickel-based superalloy and its evolution through heat treatment

    International Nuclear Information System (INIS)

    Divya, V.D.; Muñoz-Moreno, R.; Messé, O.M.D.M.; Barnard, J.S.; Baker, S.; Illston, T.; Stone, H.J.

    2016-01-01

    The selective laser melting of high temperature alloys is of great interest to the aerospace industry as it offers the prospect of producing more complex geometries than can be achieved with other manufacturing methods. In this study, the microstructure of the nickel-based superalloy, CM247LC, has been characterised following selective laser melting and after a post deposition heat treatment below the γ′ solvus temperature. In the as-deposited state, scanning electron microscopy with electron backscatter diffraction revealed a fine, cellular microstructure with preferential alignment of 〈001〉 along the build direction. A high dislocation density was seen at the periphery of the cells, indicating substantial localised deformation of the material. Fine primary MC carbides were also observed in the inter-cellular regions. High-resolution transmission electron microscopy identified the occurrence of very fine γ′ precipitates, approximately 5 nm in diameter, dispersed within the gamma phase. After heat treatment, the elongated cell colonies were observed to partially coalesce, accompanied by a decrease in dislocation density, producing columnar grains along the build direction. Cuboidal γ′ precipitates approximately 500 nm in diameter were observed to form in the recrystallised grains, accompanied by larger γ′ precipitates on the grain boundaries.

  17. Importance of the (n,gamma) Cm-247 Evaluation on Neutron Emission in Fast Reactor Fuel Cycle Analysis

    International Nuclear Information System (INIS)

    Benoit Forget; Mehdi Asgari; Rodolfo M. Ferrer

    2007-01-01

    As part of the GNEP program, it is envisioned to build a fast reactor for the transmutation of minor actinides. The spent nuclear fuel from the current fleet of light water reactors would be recycled, the current baseline is the UREX+1a process, and would act as a feed for the fast reactor. As the fuel is irradiated in a fast reactor a certain quantity of minor actinides would thus build up in the fuel stream creating possible concerns with the neutron emission of these minor actinides for fuel transportation, handling and fabrication. Past neutronic analyses had not tracked minor actinides above Cm-246 in the transmutation chain, because of the small influence on the overall reactor performance and cycle parameters. However, when trying to quantify the neutron emission from the recycled fuel with high minor actinide content, these higher isotopes play an essential role and should be included in the analysis. In this paper, the influence of tracking these minor actinides on the calculated neutron emission is presented. Also presented is the particular influence of choosing a different evaluated cross section data set to represent the minor actinides above Cm-246. The first representation uses the cross-sections provided by MC2-2 for all isotopes, while the second representation uses infinitely diluted ENDF/BVII.0 cross-sections for Cm-247 to Cf-252 and MC2-2 for all other isotopes

  18. Perceptions of 24/7 In-house Attending Coverage on Fellow Education and Autonomy in a Pediatric Cardiothoracic Intensive Care Unit.

    Science.gov (United States)

    Owens, Sonal T; Owens, Gabe E; Rajput, Shaili H; Charpie, John R; Kidwell, Kelley M; Mullan, Patricia B

    2015-01-01

    The 24/7 in-house attending coverage is emerging as the standard of care in intensive care units. Implementation costs, workforce feasibility, and patient outcomes resulting from changes in physician staffing are widely debated topics. Understanding the impact of staffing models on the learning environment for medical trainees and faculty is equally warranted, particularly with respect to trainee education and autonomy. This study aims to elicit the perceptions of pediatric cardiology fellows and attendings toward 24/7 in-house attending coverage and its effect on fellow education and autonomy. We surveyed pediatric cardiology fellows and attendings practicing in the pediatric cardiothoracic intensive care unit (PCTU) of a large, university-affiliated medical center, using structured Likert response items and open-ended questions, prior to and following the transition to 24/7 in-house attending coverage. All (100%) trainees and faculty completed all surveys. Both prior to and following transition to 24/7 in-house attending coverage, all fellows, and the majority of attendings agreed that the overnight call experience benefited fellow education. At baseline, trainees identified limited circumstances in which on-site attending coverage would be critical. Preimplementation concerns that 24/7 in-house attending coverage would negatively affect the education of fellows were not reflected following actual implementation of the new staffing policy. However, based upon open-ended questions, fellow autonomy was affected by the new paradigm, with fellows and attendings reporting decreased "appropriateness" of autonomy after implementation. Our prospective study, showing initial concerns about limiting the learning environment in transitioning to 24/7 in-house attending coverage did not result in diminished perceptions of the educational experience for our fellows but revealed an expected decrease in fellow autonomy. The study indirectly facilitated open discussions about

  19. HPLC MS/MS method for quantification of meprobamate in human plasma: application to 24/7 clinical toxicology.

    Science.gov (United States)

    Delavenne, Xavier; Gay-Montchamp, Jean Pierre; Basset, Thierry

    2011-01-15

    We described the development and full validation of rapid and accurate liquid chromatography method, coupled with tandem mass spectrometry detection, for quantification of meprobamate in human plasma with [(13)C-(2)H(3)]-meprobamate as internal standard. Plasma pretreatment involved a one-step protein precipitation with acetonitrile. Separation was performed by reversed-phase chromatography on a Luna MercuryMS C18 (20 mm×4 mm×3 μm) column using a gradient elution mode. The mobile phase was a mix of distilled water containing 0.1% formic acid and acetonitrile containing 0.1% formic acid. The selected reaction monitoring transitions, in electrospray positive ionization, used for quantification were 219.2→158.2 m/z and 223.1→161.1m/z for meprobamate and internal standard, respectively. Qualification transitions were 219.2→97.0 and 223.1→101.1 m/z for meprobamate and internal standard, respectively. The method was linear over the concentration range of 1-300 mg/L. The intra- and inter-day precision values were below 6.4% and accuracy was within 95.3% and 103.6% for all QC levels (5, 75 and 200 mg/L). The lower limit of quantification was 1 mg/L. Total analysis time was reduced to 6 min including sample preparation. The present method is successfully applied to 24/7 clinical toxicology and demonstrated its usefulness to detect meprobamate poisoning. Copyright © 2010 Elsevier B.V. All rights reserved.

  20. Development and pilot testing of 24/7 in-ambulance telemedicine for acute stroke : prehospital stroke study at the Universitair Ziekenhuis Brussel-project

    OpenAIRE

    Espinoza, Alexis Valenzuela; Van Hooff, Robbert-Jan; De Smedt, Ann; Moens, Maarten; Yperzeele, Laetitia; Nieboer, Koenraad; Hubloue, Ives; de Keyser, Jacques; Convents, Andre; Tellez, Helio Fernandez; Dupont, Alain; Putman, Koen; Brouns, Raf

    2016-01-01

    Abstract: Background: In-ambulance telemedicine is a recently developed and a promising approach to improve emergency care. We implemented the first ever 24/7 in-ambulance telemedicine service for acute stroke. We report on our experiences with the development and pilot testing of the Prehospital Stroke Study at the Universitair Ziekenhuis Brussel (PreSSUB) to facilitate a wider spread of the knowledge regarding this technique. Methods: Successful execution of the project involved the develop...

  1. Development and Pilot Testing of 24/7 In-Ambulance Telemedicine for Acute Stroke: Prehospital Stroke Study at the Universitair Ziekenhuis Brussel-Project

    OpenAIRE

    Espinoza, Alexis Valenzuela; Van Hooff, Robbert-Jan; De Smedt, Ann; Moens, Maarten; Yperzeele, Laetitia; Nieboer, Koenraad; Hubloue, Ives; de Keyser, Jacques; Convents, Andre; Tellez, Helio Fernandez; Dupont, Alain; Putman, Koen; Brouns, Raf

    2016-01-01

    Background: In-ambulance telemedicine is a recently developed and a promising approach to improve emergency care. We implemented the first ever 24/7 in-ambulance telemedicine service for acute stroke. We report on our experiences with the development and pilot testing of the Prehospital Stroke Study at the Universitair Ziekenhuis Brussel (PreSSUB) to facilitate a wider spread of the knowledge regarding this technique. Methods: Successful execution of the project involved the development and v...

  2. The role of continuous monitoring in a 24/7 telecardiology consultation service--a feasibility study.

    Science.gov (United States)

    Nikus, Kjell; Lähteenmäki, Jaakko; Lehto, Pasi; Eskola, Markku

    2009-01-01

    for speeding up the diagnostic and therapeutic processes in the hospital, although the study was limited in that the telecardiologist played a passive role and did not acutely impact patient care. In the future, the system could be expanded to surveillance of smaller hospitals. Telemedicine has the potential to aid in solving the conflict between aging of population, rise in the demand for critical care services, and shortage of professional personnel. This might, however, require a more active remote surveillance than the one tested in this study. Privacy- and security-related aspects are major components of building trust and confidence in telemedicine systems. In telecardiology, the real-time interactive telemedicine model with 24/7 service has potential superior performance compared with a store-and-forward telemedicine model.

  3. Nursing staffs self-perceived outcome from a rehabilitation 24/7 educational programme - a mixed-methods study in stroke care.

    Science.gov (United States)

    Loft, M I; Esbensen, B A; Kirk, K; Pedersen, L; Martinsen, B; Iversen, H; Mathiesen, L L; Poulsen, I

    2018-01-01

    During the past two decades, attempts have been made to describe nurses' contributions to the rehabilitation of inpatients following stroke. There is currently a lack of interventions that integrate the diversity of nurses' role and functions in stroke rehabilitation and explore their effect on patient outcomes. Using a systematic evidence- and theory-based design, we developed an educational programme, Rehabilitation 24/7, for nursing staff working in stroke rehabilitation aiming at two target behaviours; working systematically with a rehabilitative approach in all aspects of patient care and working deliberately and systematically with patients' goals. The aim of this study was to assess nursing staff members' self-perceived outcome related to their capability, opportunity and motivation to work with a rehabilitative approach after participating in the stroke Rehabilitation 24/7 educational programme. A convergent mixed-method design was applied consisting of a survey and semi-structured interviews. Data collection was undertaken between February and June 2016. Data from the questionnaires ( N  = 33) distributed before and after the intervention were analysed using descriptive statistics and Wilcoxon sign rank test. The interviews ( N  = 10) were analysed using deductive content analysis. After analysing questionnaires and interviews separately, the results were merged in a side by side comparison presented in the discussion. The results from both the quantitative and qualitative analyses indicate that the educational programme shaped the target behaviours that we aimed to change by addressing the nursing staff's capability, opportunity and motivation and hence could strengthen the nursing staff's contribution to inpatient stroke rehabilitation. A number of behaviours changed significantly, and the qualitative results indicated that the staff experienced increased focus on their role and functions in rehabilitation practice. Our study provides an

  4. 24/7 Connectedness and its Potential Impact on Today’s Physics Students: Technology Use, Multitasking, and GenMe

    OpenAIRE

    Teresa L. Larkin; Benjamin R. Hein

    2018-01-01

    There is no question that the digital age is upon us. For many of us, the trans-formation to the digital age has been gradual; and, most often, welcomed. In the classroom, we have developed many useful and innovative applications technolo-gy-based pedagogies. Outside of the classroom, we use routinely rely on tech-nology to communicate with our students. However, not all of us grew up with 24/7 access to information that the internet and today’s technologies provide. Perhaps the impact o...

  5. LA SENTENCIA DEL TRIBUNAL CONSTITUCIONAL 247/2007 Y EL SISTEMA CONSTITUCIONAL DE DISTRIBUCIÓN DE COMPETENCIAS ENTRE EL ESTADO Y LAS COMUNIDADES AUTÓNOMAS

    Directory of Open Access Journals (Sweden)

    Joaquín Tornos Mas

    2008-10-01

    Full Text Available The aim of this study is to examine articles 7 to 10 of ruling 247/2007 of theConstitutional Court, in which the role of the Statutes of Autonomy in thedivision of jurisdictions between the Central Government and the AutonomousCommunities is analysed, and the impact that the ruling in this case may haveon the future ruling on the Catalan Statute. To link ruling 247/2007 withthe future ruling on the Catalan Statute, on one side the appellant parties –the Partido Popular and the ombudsman, and the Parliement of Catalonia,on the other, the Constitutional Court makes its arguments regarding theextent to which the Statutes of Autonomy limit its jurisdiction. Public knowledgeof the appellants’ arguments and the Constitutional Court’s decisionregarding this case, which are included in a ruling from previous appealsthat pronounces on many of the issues covered in the mentioned appeals,allows the study to close with a series of considerations about the future rulingof the Constitutional Court on the part of the Catalan Statute relatingto the new model for distribution of jurisdictions.

  6. 24/7 Connectedness and its Potential Impact on Today’s Physics Students: Technology Use, Multitasking, and GenMe

    Directory of Open Access Journals (Sweden)

    Teresa L. Larkin

    2018-05-01

    Full Text Available There is no question that the digital age is upon us. For many of us, the trans-formation to the digital age has been gradual; and, most often, welcomed. In the classroom, we have developed many useful and innovative applications technolo-gy-based pedagogies. Outside of the classroom, we use routinely rely on tech-nology to communicate with our students. However, not all of us grew up with 24/7 access to information that the internet and today’s technologies provide. Perhaps the impact of technology on those of us that teach is a bit different from the impact on our students. Many of our students today are members of the mil-lennial generation, which is sometimes referred to as Generation Me (GenMe. Members of GenMe have literally grown up with technology and the instantane-ous availability of information right at their fingertips. Computers, smart phones, iPads, and other technologies offer their users immediate access to information. Might these technologies be seen as a significant distraction to whatever the task at hand might be? Could these distractions be to blame for the perception of many in GenMe that they must multitask in order to get everything done? Might instant access to information be casting a cloud on student learning? If so, does this cloud have a silver lining? This paper addresses these and other questions through the use of a survey given to students in a second-level physics course in spring 2016. Results reveal that nearly all students feel the need to maintain this 24/7 connection using their smart phones. The impact that this level of connect-edness may have on our students will be discussed.

  7. The multifaceted effects of agmatine on functional recovery after spinal cord injury through Modulations of BMP-2/4/7 expressions in neurons and glial cells.

    Directory of Open Access Journals (Sweden)

    Yu Mi Park

    Full Text Available Presently, few treatments for spinal cord injury (SCI are available and none have facilitated neural regeneration and/or significant functional improvement. Agmatine (Agm, a guanidinium compound formed from decarboxylation of L-arginine by arginine decarboxylase, is a neurotransmitter/neuromodulator and been reported to exert neuroprotective effects in central nervous system injury models including SCI. The purpose of this study was to demonstrate the multifaceted effects of Agm on functional recovery and remyelinating events following SCI. Compression SCI in mice was produced by placing a 15 g/mm(2 weight for 1 min at thoracic vertebra (Th 9 segment. Mice that received an intraperitoneal (i.p. injection of Agm (100 mg/kg/day within 1 hour after SCI until 35 days showed improvement in locomotor recovery and bladder function. Emphasis was made on the analysis of remyelination events, neuronal cell preservation and ablation of glial scar area following SCI. Agm treatment significantly inhibited the demyelination events, neuronal loss and glial scar around the lesion site. In light of recent findings that expressions of bone morphogenetic proteins (BMPs are modulated in the neuronal and glial cell population after SCI, we hypothesized whether Agm could modulate BMP- 2/4/7 expressions in neurons, astrocytes, oligodendrocytes and play key role in promoting the neuronal and glial cell survival in the injured spinal cord. The results from computer assisted stereological toolbox analysis (CAST demonstrate that Agm treatment dramatically increased BMP- 2/7 expressions in neurons and oligodendrocytes. On the other hand, BMP- 4 expressions were significantly decreased in astrocytes and oligodendrocytes around the lesion site. Together, our results reveal that Agm treatment improved neurological and histological outcomes, induced oligodendrogenesis, protected neurons, and decreased glial scar formation through modulating the BMP- 2/4/7 expressions following

  8. The Multifaceted Effects of Agmatine on Functional Recovery after Spinal Cord Injury through Modulations of BMP-2/4/7 Expressions in Neurons and Glial Cells

    Science.gov (United States)

    Park, Yu Mi; Lee, Won Taek; Bokara, Kiran Kumar; Seo, Su Kyoung; Park, Seung Hwa; Kim, Jae Hwan; Yenari, Midori A.; Park, Kyung Ah; Lee, Jong Eun

    2013-01-01

    Presently, few treatments for spinal cord injury (SCI) are available and none have facilitated neural regeneration and/or significant functional improvement. Agmatine (Agm), a guanidinium compound formed from decarboxylation of L-arginine by arginine decarboxylase, is a neurotransmitter/neuromodulator and been reported to exert neuroprotective effects in central nervous system injury models including SCI. The purpose of this study was to demonstrate the multifaceted effects of Agm on functional recovery and remyelinating events following SCI. Compression SCI in mice was produced by placing a 15 g/mm2 weight for 1 min at thoracic vertebra (Th) 9 segment. Mice that received an intraperitoneal (i.p.) injection of Agm (100 mg/kg/day) within 1 hour after SCI until 35 days showed improvement in locomotor recovery and bladder function. Emphasis was made on the analysis of remyelination events, neuronal cell preservation and ablation of glial scar area following SCI. Agm treatment significantly inhibited the demyelination events, neuronal loss and glial scar around the lesion site. In light of recent findings that expressions of bone morphogenetic proteins (BMPs) are modulated in the neuronal and glial cell population after SCI, we hypothesized whether Agm could modulate BMP- 2/4/7 expressions in neurons, astrocytes, oligodendrocytes and play key role in promoting the neuronal and glial cell survival in the injured spinal cord. The results from computer assisted stereological toolbox analysis (CAST) demonstrate that Agm treatment dramatically increased BMP- 2/7 expressions in neurons and oligodendrocytes. On the other hand, BMP- 4 expressions were significantly decreased in astrocytes and oligodendrocytes around the lesion site. Together, our results reveal that Agm treatment improved neurological and histological outcomes, induced oligodendrogenesis, protected neurons, and decreased glial scar formation through modulating the BMP- 2/4/7 expressions following SCI. PMID

  9. Savannah River Plant californium-252 Shuffler electronics manual

    International Nuclear Information System (INIS)

    Bourret, S.C.; Crane, T.W.; Eccleston, G.W.; Gallegos, E.A.; Garcia, D.L.

    1980-03-01

    Detailed information is presented in this report, an electronics manual for the Savannah River Plant Shuffler, about the electronics associated with the various control and data acquisition functions of the Shuffler subsystems. Circuit diagrams, interconnection information, and details about computer control and programming are included

  10. Survey of potential markets for devices using Californium-252

    International Nuclear Information System (INIS)

    Permar, P.H.

    1975-01-01

    Potential applications for devices or systems containing 252 Cf in the years from 1975 to 1980 are estimated. The estimated number of devices and associated business value were derived from a survey of 46 industrial, educational and governmental organizations conducted from Jan. to May, 1975. Applications for devices and systems based on 252 Cf are expected to increase by a factor of 7 in the 6-y period from 1975 to 1980. The annual business value of 252 Cf devices should increase from 1.5 million dollars in 1975 to 10.8 million dollars in 1980. The potential European market should be several times as large as the US market, based on actual sales of 252 Cf, which have been two to four times greater in Europe than in the US

  11. The protective cell petrus for the production of californium 252

    International Nuclear Information System (INIS)

    Sontag, R.; Berger, R.

    1967-01-01

    The alpha, beta, gamma, neutron cell which is described in the present paper is devoted to the transplutonium element production and study. It is located at the CEN in Fontenay-aux-Roses (France). The 4 feet ordinary concrete shielding made of stacked blocs allows the manipulation of radioactive sources as high as 1000 curies of 1 MeV gamma rays and with a fast neutrons flux of 10 9 n.cm -2 .s -1 . The airtight alpha containment box is equipped with two transfer systems, one consists of a parallelepiped shaped airtight box located in a turntable, the other uses standard cylindrical containers made of polyethylene. The general equipment and the main setting up are also described. (authors) [fr

  12. Automated absolute activation analysis with californium-252 sources

    International Nuclear Information System (INIS)

    MacMurdo, K.W.; Bowman, W.W.

    1978-09-01

    A 100-mg 252 Cf neutron activation analysis facility is used routinely at the Savannah River Laboratory for multielement analysis of many solid and liquid samples. An absolute analysis technique converts counting data directly to elemental concentration without the use of classical comparative standards and flux monitors. With the totally automated pneumatic sample transfer system, cyclic irradiation-decay-count regimes can be pre-selected for up to 40 samples, and samples can be analyzed with the facility unattended. An automatic data control system starts and stops a high-resolution gamma-ray spectrometer and/or a delayed-neutron detector; the system also stores data and controls output modes. Gamma ray data are reduced by three main programs in the IBM 360/195 computer: the 4096-channel spectrum and pertinent experimental timing, counting, and sample data are stored on magnetic tape; the spectrum is then reduced to a list of significant photopeak energies, integrated areas, and their associated statistical errors; and the third program assigns gamma ray photopeaks to the appropriate neutron activation product(s) by comparing photopeak energies to tabulated gamma ray energies. Photopeak areas are then converted to elemental concentration by using experimental timing and sample data, calculated elemental neutron capture rates, absolute detector efficiencies, and absolute spectroscopic decay data. Calculational procedures have been developed so that fissile material can be analyzed by cyclic neutron activation and delayed-neutron counting procedures. These calculations are based on a 6 half-life group model of delayed neutron emission; calculations include corrections for delayed neutron interference from 17 O. Detection sensitivities of 239 Pu were demonstrated with 15-g samples at a throughput of up to 140 per day. Over 40 elements can be detected at the sub-ppM level

  13. Savannah River Plant Californium-252 Shuffler software manual

    International Nuclear Information System (INIS)

    Johnson, S.S.; Crane, T.W.; Eccleston, G.W.

    1979-03-01

    A software manual for operating the Savannah River Plant Shuffler nondestructive assay instrument is presented. The procedures for starting up the instrument, making assays, calibrating, and checking the performance of the hardware units are described. A list of the error messages with an explanation of the circumstances prompting the message and possible corrective measures is given. A summary of the software package is included showing the names and contents of the files and subroutines. The procedure for modifying the software package is outlined

  14. Californium-252 interstitial implants in carcinoma of the tongue

    International Nuclear Information System (INIS)

    Vtyurin, B.M.; Ivanov, V.N.; Medvedev, V.S.; Galantseva, G.F.; Abdulkadyrov, S.A.; Ivanova, L.F.; Petrovskaya, G.A.; Plichko, V.I.

    1985-01-01

    A clinical study using 252 Cf sources in brachytherapy of tumors began in the Research Institute of Medical Radiology of the Academy of Medical Sciences of the USSR in 1973. 252 Cf afterloading cells were utilized by the method of simple afterloading. Dosimetry and radiation protection of medical personnel were developed. To substantiate optimal therapeutic doses of 252 Cf neutrons, a correlation of dose, time, and treatment volume factors with clinical results of 252 Cf interstitial implants in carcinoma of the tongue for 47 patients with a minimum follow-up period of 1 year was studied. Forty-nine interstitial implants have been performed. Seventeen patients received 252 Cf implants alone (Group I), 17 other patients received 252 Cf implants in combination with external radiation (Group II), and 15 patients were treated with interstitial implants for recurrent or residual tumors (Groups III). Complete regression of carcinoma of the tongue was obtained in 48 patients (98%). Thirteen patients (27%) developed radiation necrosis. The therapeutic dose of neutron radiation from 252 Cf sources in interstitial radiotherapy of primary tongue carcinomas (Group I) was found to be 7 to 9 Gy. Optimal therapeutic neutron dose in combined interstitial and external radiotherapy of primary tumors (Group II) was 5 to 6 Gy with an external radiation dose of 40 Gy. For recurrent and residual tumors (Group III), favorable results were obtained with tumor doses of 6.5 to 7 Gy

  15. Undergraduate experiments using the neutron radiation from californium-252

    International Nuclear Information System (INIS)

    Rossel, J.; Golecki, I.

    1976-01-01

    Three experiments designed to demonstrate and measure several properties of the neutron radiation emitted by a 3μg 252 Cf source are described. The experiments constitute a special project carried out by a third-year undergraduate student at the Institute of Physics of the University of Neuchatel. The 252 Cf source is enclosed in a shield which allows a pencil of fast neutrons to pass through a central tube, while reducing the ambient radiation below the tolerance level. The shield consists of layers of borated paraffin wax, iron and cadmium. The first experiment uses an air-alcohol diffusion cloud chamber for the demonstration of tracks of recoil protons produced by the neutrons. Semi-quantitative measurements of track lengths give the correct order of magnitude of the proton energies. In the second experiment a liquid scintillator detector is used to scan the beam profile across the radiation shield enclosing the source. A pulse-shape-discrimination system discriminates between neutrons and gamma photons. The third experiment makes use of the nuclear emulsion technique to study the neutron energy distribution of 252 Cf. Preliminary results are compared with published values. (author)

  16. Structural Benchmark Creep Testing for Microcast MarM-247 Advanced Stirling Convertor E2 Heater Head Test Article SN18

    Science.gov (United States)

    Krause, David L.; Brewer, Ethan J.; Pawlik, Ralph

    2013-01-01

    This report provides test methodology details and qualitative results for the first structural benchmark creep test of an Advanced Stirling Convertor (ASC) heater head of ASC-E2 design heritage. The test article was recovered from a flight-like Microcast MarM-247 heater head specimen previously used in helium permeability testing. The test article was utilized for benchmark creep test rig preparation, wall thickness and diametral laser scan hardware metrological developments, and induction heater custom coil experiments. In addition, a benchmark creep test was performed, terminated after one week when through-thickness cracks propagated at thermocouple weld locations. Following this, it was used to develop a unique temperature measurement methodology using contact thermocouples, thereby enabling future benchmark testing to be performed without the use of conventional welded thermocouples, proven problematic for the alloy. This report includes an overview of heater head structural benchmark creep testing, the origin of this particular test article, test configuration developments accomplished using the test article, creep predictions for its benchmark creep test, qualitative structural benchmark creep test results, and a short summary.

  17. Live birth sex ratio after in vitro fertilization and embryo transfer in China--an analysis of 121,247 babies from 18 centers.

    Science.gov (United States)

    Bu, Zhiqin; Chen, Zi-Jiang; Huang, Guoning; Zhang, Hanwang; Wu, Qiongfang; Ma, Yanping; Shi, Juanzi; Xu, Yanwen; Zhang, Songying; Zhang, Cuilian; Zhao, Xiaoming; Zhang, Bo; Huang, Yuanhua; Sun, Zhengyi; Kang, Yuefan; Wu, Riran; Wu, Xueqing; Sun, Haixiang; Sun, Yingpu

    2014-01-01

    In order to study the impact of procedures of IVF/ICSI technology on sex ratio in China, we conducted this multi-center retrospective study including 121,247 babies born to 93,895 women in China. There were 62,700 male babies and 58,477 female babies, making the sex ratio being 51.8% (Male: Female  = 107:100). In univariate logistic regression analysis, sex ratio was imbalance toward females of 50.3% when ICSI was preformed compared to 47.7% when IVF was used (Pratio in IVF/ICSI babies was significantly higher toward males in transfers of blastocyst (54.9%) and thawed embryo (52.4%) when compared with transfers of cleavage stage embryo (51.4%) and fresh embryo (51.5%), respectively. Multiple delivery was not associated with sex ratio. However, in multivariable logistic regression analysis after controlling for related factors, only ICSI (adjusted OR =  .90, 95%CI: 0.88-0.93; Pratio in IVF/ICSI babies. In conclusion, the live birth sex ratio in IVF/ICSI babies was influenced by the use of ICSI, which may decrease the percentage of male offspring, or the use of blastocyst transfer, which may increase the percentage of male offspring.

  18. Effect of heat treatment on the microstructure, texture and elastic anisotropy of the nickel-based superalloy CM247LC processed by selective laser melting

    International Nuclear Information System (INIS)

    Muñoz-Moreno, R.; Divya, V.D.; Driver, S.L.; Messé, O.M.D.M.; Illston, T.; Baker, S.; Carpenter, M.A.; Stone, H.J.

    2016-01-01

    Selective laser melting (SLM) of nickel-based superalloys is of great interest for the aerospace industry due to its capability for producing components with complex geometries. However, an improved understanding of the effect of SLM and subsequent post deposition heat treatments on the microstructure and mechanical properties is required to ensure that components with good structural integrity are produced. In this study, the microstructure, texture and elastic anisotropy of the nickel-based superalloy, CM247LC, in the as-SLM and heat-treated states have been analysed. The as-SLM microstructure showed fine elongated cells with a preferential alignment of <001> along the build direction and a significant intercellular misorientation. Heat treatments at temperatures below 1230 °C resulted in a progressive recovery of the microstructure, whilst heat treatments above this temperature gave rise to a recrystallised microstructure. The extent to which nucleation and growth of the γ′ precipitates and secondary particles were affected by increasing the heat treatment temperature was also characterised. The bulk elastic anisotropy of all samples was measured by resonant ultrasound spectroscopy (RUS) and was found to be consistent with the local textures obtained by electron backscatter diffraction (EBSD). It was observed that the initially strong elastic anisotropy exhibited by the as-SLM material was significantly reduced in the recrystallised samples, although some anisotropy was retained as a result of their elongated grain microstructures.

  19. Effect of heat treatment on the microstructure, texture and elastic anisotropy of the nickel-based superalloy CM247LC processed by selective laser melting

    Energy Technology Data Exchange (ETDEWEB)

    Muñoz-Moreno, R., E-mail: rociomunozmoreno@gmail.com [Department of Materials Science and Metallurgy, University of Cambridge, 27 Charles Babbage Road, Cambridge CB3 0FS (United Kingdom); Divya, V.D. [Department of Materials Science and Metallurgy, University of Cambridge, 27 Charles Babbage Road, Cambridge CB3 0FS (United Kingdom); Driver, S.L. [Department of Materials Science and Metallurgy, University of Cambridge, 27 Charles Babbage Road, Cambridge CB3 0FS (United Kingdom); Department of Earth Sciences, University of Cambridge, Downing Street, Cambridge CB2 3EQ (United Kingdom); Messé, O.M.D.M. [Department of Materials Science and Metallurgy, University of Cambridge, 27 Charles Babbage Road, Cambridge CB3 0FS (United Kingdom); Illston, T.; Baker, S. [Materials Solutions, Unit 8, Great Western Business Park, McKenzie Way, Worcester WR4 9GN (United Kingdom); Carpenter, M.A. [Department of Earth Sciences, University of Cambridge, Downing Street, Cambridge CB2 3EQ (United Kingdom); Stone, H.J. [Department of Materials Science and Metallurgy, University of Cambridge, 27 Charles Babbage Road, Cambridge CB3 0FS (United Kingdom)

    2016-09-30

    Selective laser melting (SLM) of nickel-based superalloys is of great interest for the aerospace industry due to its capability for producing components with complex geometries. However, an improved understanding of the effect of SLM and subsequent post deposition heat treatments on the microstructure and mechanical properties is required to ensure that components with good structural integrity are produced. In this study, the microstructure, texture and elastic anisotropy of the nickel-based superalloy, CM247LC, in the as-SLM and heat-treated states have been analysed. The as-SLM microstructure showed fine elongated cells with a preferential alignment of <001> along the build direction and a significant intercellular misorientation. Heat treatments at temperatures below 1230 °C resulted in a progressive recovery of the microstructure, whilst heat treatments above this temperature gave rise to a recrystallised microstructure. The extent to which nucleation and growth of the γ′ precipitates and secondary particles were affected by increasing the heat treatment temperature was also characterised. The bulk elastic anisotropy of all samples was measured by resonant ultrasound spectroscopy (RUS) and was found to be consistent with the local textures obtained by electron backscatter diffraction (EBSD). It was observed that the initially strong elastic anisotropy exhibited by the as-SLM material was significantly reduced in the recrystallised samples, although some anisotropy was retained as a result of their elongated grain microstructures.

  20. Critical and subcritical mass calculations of curium-243 to -247 based on JENDL-3.2 for revision of ANSI/ANS-8.15

    International Nuclear Information System (INIS)

    Okuno, Hiroshi

    2002-01-01

    Critical and subcritical masses were calculated for a sphere of five curium isotopes from 243 Cm to 247 Cm in metal and in metal-water mixtures considering three reflector conditions: bare, with a water reflector or a stainless steel reflector. The calculation were made mainly with a combination of a continuous energy Monte Carlo neutron transport calculation code, MCNP, and the Japanese Evaluated Nuclear Data Library, JENDL-3.2. Other evaluated nuclear data files, ENDF/B-VI and JEF-2.2, were also applied to find differences in calculation results of the neutron multiplication factor originated from different nuclear data files. A large dependence on the evaluated nuclear data files was found in the calculation results: more than 10%Δk/k relative differences in the neutron multiplication factor for a homogeneous mixture of 243 Cm metal and water when JENDL-3.2 was replaced with ENDF/B-VI and JEF-2.2, respectively; and a 44% reduction in the critical mass by changing from JENDL-3.2 to ENDF/B-VI for 246 Cm metal. The present study supplied basic information to the ANSI/ANS-8.15 Working Group for revision of the standard for nuclear criticality control of special actinide elements. The new or revised values of the subcritical mass limits for curium isotopes accepted by the ANSI/ANS-8.15 Working Group were finally summarized. (author)

  1. Critical and subcritical mass calculations of curium-243 to -247 based on JENDL-3.2 for revision of ANSI/ANS-8.15

    Energy Technology Data Exchange (ETDEWEB)

    Okuno, Hiroshi [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment; Kawasaki, Hiromitsu [CRC Solutions Corporation, Hitachinaka, Ibaraki (Japan)

    2002-10-01

    Critical and subcritical masses were calculated for a sphere of five curium isotopes from {sup 243}Cm to {sup 247}Cm in metal and in metal-water mixtures considering three reflector conditions: bare, with a water reflector or a stainless steel reflector. The calculation were made mainly with a combination of a continuous energy Monte Carlo neutron transport calculation code, MCNP, and the Japanese Evaluated Nuclear Data Library, JENDL-3.2. Other evaluated nuclear data files, ENDF/B-VI and JEF-2.2, were also applied to find differences in calculation results of the neutron multiplication factor originated from different nuclear data files. A large dependence on the evaluated nuclear data files was found in the calculation results: more than 10%{delta}k/k relative differences in the neutron multiplication factor for a homogeneous mixture of {sup 243}Cm metal and water when JENDL-3.2 was replaced with ENDF/B-VI and JEF-2.2, respectively; and a 44% reduction in the critical mass by changing from JENDL-3.2 to ENDF/B-VI for {sup 246}Cm metal. The present study supplied basic information to the ANSI/ANS-8.15 Working Group for revision of the standard for nuclear criticality control of special actinide elements. The new or revised values of the subcritical mass limits for curium isotopes accepted by the ANSI/ANS-8.15 Working Group were finally summarized. (author)

  2. 24/7 Presence of Medical Staff in the Labor Ward; No Day-Night Differences in Perinatal and Maternal Outcomes.

    Science.gov (United States)

    Tavares, Sara; Cavaco-Gomes, João; Moucho, Marina; Severo, Milton; Mateus, Mário; Ramalho, Carla; Visser, Gerard H A; Montenegro, Nuno

    2017-05-01

    Objective  The objective of this study was to assess possible day-night differences in perinatal and maternal labor outcomes in a hospital setting with no day-night differences in the presence of experienced medical staff. Design  This was a retrospective study conducted over 5 years between 2008 and 2012. Setting  This study was set at the obstetric delivery unit in a tertiary hospital. Population  A total of 9,143 singleton deliveries were assessed after 34 weeks of gestation and after exclusion of major congenital malformations, inductions of labor, and elective cesarean sections. Materials and Methods  Data were collected using the hospital electronic medical records. Time periods of 8 hours were defined (daytime between 8 am and 4 pm, evening time between 4 pm and 12 pm, and nighttime between 12 pm and 8 am). Differences between the three time periods were assessed using software R Core Team (2013). Main outcome measures were neonatal birth asphyxia, neonatal intensive care unit admission, and neonatal death. Results  There were no differences in perinatal and maternal outcomes in the course of the day, apart from a higher incidence of third- and fourth-degree tears during the evening. Neonatal outcome after obstetric emergencies (uterine rupture, partial placental abruption, and cord prolapse) also showed no day-night differences. Conclusion  Adverse nighttime-related outcomes may be avoided by the 24/7 presence of experienced medical staff. Thieme Medical Publishers 333 Seventh Avenue, New York, NY 10001, USA.

  3. Effects of MAR-M247 substrate (modified) composition on coating oxidation coating/substrate interdiffusion. M.S. Thesis. Final Report; [protective coatings for hot section components of gas turbine engines

    Science.gov (United States)

    Pilsner, B. H.

    1985-01-01

    The effects of gamma+gamma' Mar-M247 substrate composition on gamma+beta Ni-Cr-Al-Zr coating oxidation and coating/substrate interdiffusion were evaluated. These results were also compared to a prior study for a Ni-Cr-Al-Zr coated gamma Ni-Cr-Al substrate with equivalent Al and Cr atomic percentages. Cyclic oxidation behavior at 1130 C was investigated using change in weight curves. Concentration/distance profiles were measured for Al, Cr, Co, W, and Ta. The surface oxides were examined by X-ray diffraction and scanning electron microscopy. The results indicate that variations of Ta and C concentrations in the substrate do not affect oxidation resistance, while additions of grain boundary strengthening elements (Zr, Hf, B) increase oxidation resistance. In addition, the results indicate that oxidation phenomena in gamma+beta/gamma+gamma' Mar-M247 systems have similar characteristics to the l gamma+beta/gamma Ni-Cr-Al system.

  4. A 1550-nm all-optical VCSEL-to-VCSEL wavelength conversion of a 8.5-Gb/s data signal and transmission over a 24.7-km fibre

    Science.gov (United States)

    Boiyo, D. Kiboi; Isoe, G. M.; Gamatham, R. R. G.; Leitch, A. W. R.; Gibbon, T. B.

    2016-02-01

    For the first time, we demonstrate, VCSEL-to-VCSEL wavelength conversion within the low attenuation 1550 nm window, including transmission over fibre and bit error rate (BER) performance characterization. We experimentally demonstrate a low injection power optical wavelength conversion by injecting an optical beam from a signal carrier master vertical cavity surface-emitting laser (VCSEL) into the side-mode of the slave VCSEL. This technique solves the challenge of wavelength collisions and also provides wavelength re-use in typical wavelength division multiplexed (WDM) systems. This paper, for the first time, uses two 1550 nm VCSELs with tunability range of 3 nm for a 5-9.8 mA bias current. The master VCSEL is modulated with a non-return-to-zero (NRZ) pseudo-random binary sequence (PRBS_27-1) 8.5 Gb/s data. A data conversion penalty of 1.1 dB is realized when a 15 dBm injection beam is used. The transmission performance of the converted wavelength from the slave VCSEL is evaluated using BER measurement at a 10-9 threshold. A 0.5 dB transmission penalty of the converted wavelength data is realized in an 8.5 Gb/s transmission over 24.7 km. This work is vital for optical fibre systems that may require wavelength switching for transmission of data signals.

  5. Did CDM particles of mass 2.47 x 10(-3) eV interact with precursor biopolymers and nucleic acids to initiate and boost lifeforms on Earth?

    Science.gov (United States)

    Rosen, Gerald

    2011-06-01

    Recent observations and theoretical studies have shown that non-baryonic Cold Dark Matter (CDM), which constitutes about 84% of all matter in the Universe, may feature a complex-scalar-field that carries particles of mass ≅ 2.47 x 10(-3)eV with the associated Compton range m(-1) ≅8.02 x 10(-3) cm, a distance on the scale of extended bionucleic acids and living cells. Such a complex-scalar-field can enter a weak-isospin Lorentz-invariant interaction that generates the flow of right-handed electrons and induces a chirality-imbued quantum chemistry on the m (-1) scale. A phenomenological Volterra-type equation is proposed for the CDM-impacted time development of N, the number of base pairs in the most advanced organism at Earth-age t. The solution to this equation suggests that the boosts in N at t ≅ 1.1 Gyr (advent of the first living prokaryotic cells), at t ≅ 2.9 Gyr (advent of eukaryotic single-celled organisms) and finally at t ≅ 4.0 Gyr (the Cambrian explosion) may be associated with three multi-Myr-duration cosmic showers of the complex-scalar-field CDM particles. If so, the signature of the particles may be detectible in Cambrian rocks.

  6. The protective cell petrus for the production of californium 252; Cellule blindee petrus pour la production et l'etude du californium 252

    Energy Technology Data Exchange (ETDEWEB)

    Sontag, R; Berger, R [Commissariat a l' Energie Atomique, Fontenay-aux-Roses (France). Centre d' Etudes Nucleaires

    1967-07-01

    The alpha, beta, gamma, neutron cell which is described in the present paper is devoted to the transplutonium element production and study. It is located at the CEN in Fontenay-aux-Roses (France). The 4 feet ordinary concrete shielding made of stacked blocs allows the manipulation of radioactive sources as high as 1000 curies of 1 MeV gamma rays and with a fast neutrons flux of 10{sup 9} n.cm{sup -2}.s{sup -1}. The airtight alpha containment box is equipped with two transfer systems, one consists of a parallelepiped shaped airtight box located in a turntable, the other uses standard cylindrical containers made of polyethylene. The general equipment and the main setting up are also described. (authors) [French] La cellule alpha, beta, gamma, neutron, qui fait l'objet du present article, est destinee a la production et a l'etude des elements transplutoniens. Elle est construite au C.E.N. de Fontenay-aux-Roses (France). La protection biologique, calculee pour une activite de 1000 curies de rayonnement gamma d'energie 1 MeV accompagnee d'un flux de neutrons rapides de 10{sup 9}/cm{sup 2}s, est constituee par des parois en beton de 1,20 m d'epaisseur. L'enceinte alpha est une boite etanche qui comporte devx systemes de transferts: l'un consiste en une boite parallelepipedique etanche logee dans un barillet, l'autre fait appel a des recipients cylindriques standard en polyethylene. L'equipement general et les installations les plus importantes sont ensuite decrits. (auteurs)

  7. 40 CFR 247.2 - Applicability.

    Science.gov (United States)

    2010-07-01

    ... apply to purchases made by private party recipients (e.g., individuals, non-profit organizations) of... competition, considering such guidelines. Procuring agencies may decide not to procure such items if they are...; or are only available at an unreasonable price. [60 FR 21381, May 1, 1995, as amended at 62 FR 60973...

  8. 32 CFR 247.4 - Policy.

    Science.gov (United States)

    2010-07-01

    ... for purchase, use, or patronage without regard to race, color, religion, sex, national origin, age...) Alteration of official photographic and video imagery will comply with DoD Directive 5040.5. 7 7 See footnote...

  9. 48 CFR 247.572 - Policy.

    Science.gov (United States)

    2010-10-01

    ... a vessel for which the contractor submitted an offer in response to the solicitation for the contract; and (ii) Prior to the acceptance of the vessel by the Government. (2) The Secretary of Defense... Act for Fiscal Year 2007 (Public Law 109-364)— (1) When obtaining carriage requiring a covered vessel...

  10. Publications | Page 247 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    IDRC works with developing-country researchers and institutions to build local capacity through funding, knowledge sharing, and training. Through books, articles, research publications, and studies, we aim to widen the impact of our investment and advance development research. We share the results of our funded ...

  11. 40 CFR 247.15 - Landscaping products.

    Science.gov (United States)

    2010-07-01

    ... hydroseeding and as an over-spray for straw mulch in landscaping, erosion control, and soil reclamation. (b) Compost made from recovered organic materials. (c) Garden and soaker hoses containing recovered plastic or rubber. (d) Lawn and garden edging containing recovered plastic or rubber. (e) Plastic lumber landscaping...

  12. 40 CFR 247.3 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... thermophilic converted product with high humus content. Compost can be used as a soil amendment and can also be... be added to the water/seed mix for enhanced performance; Industrial drums are cylindrical containers... with applicable specifications, availability at a reasonable price, availability within a reasonable...

  13. 48 CFR 247.301-70 - Definition.

    Science.gov (United States)

    2010-10-01

    ... Definition. “Integrated logistics managers” or “third-party logistics providers” means providers of multiple logistics services. Some examples of logistics services are the management of transportation, demand...

  14. 32 CFR 247.6 - Procedures.

    Science.gov (United States)

    2010-07-01

    ... cohesiveness and effectiveness by providing a visual representation of the essence of the command itself. (G... defined purpose in support of the mission of the publishing DoD Component, and the purpose must justify...

  15. 32 CFR 247.3 - Definitions.

    Science.gov (United States)

    2010-07-01

    ...; commanders' comments; letters to the editor; editorials; commentaries; features; sports; entertainment items; morale, welfare, and recreation news and announcements; photography; line art; and installation and local...

  16. Toward a 24/7 Learning Community.

    Science.gov (United States)

    Revenaugh, Mickey

    2000-01-01

    Although nearly two-thirds of family households have computers and 46 percent have Internet connections, troubling income-related gaps persist. Parents want interactive connections with teachers, homework hotlines, and tutoring services more than school web sites. Web-quest models, laptops, and computer donation programs are promising…

  17. Alta disponibilidad 24/7 : el reto

    OpenAIRE

    López Grande, Carlos Edgardo; Guadrón Gutiérrez, Ricardo Salvador

    2015-01-01

    En la actualidad, las actividades diarias para los ne- gocios, instituciones, instituciones educativas o nivel de usuario común están directamente vinculadas a la red de redes, la Internet. Su desarrollo ha permitido a la mayoría de los servicios y aplicaciones, que hace años eran sólo para el modo cliente-servidor, ahora acceder desde cualquier lugar en cualquier dispositi- vo con conexión a Internet. Por lo tanto, ofrecer un ambiente que da conexiones y transacciones 7/24 es necesario para ...

  18. 40 CFR 61.247 - Reporting requirements.

    Science.gov (United States)

    2010-07-01

    ...) Method of compliance with the standard (for example, “monthly leak detection and repair” or “equipped...) NATIONAL EMISSION STANDARDS FOR HAZARDOUS AIR POLLUTANTS National Emission Standard for Equipment Leaks... identification. (ii) Type of equipment (for example, a pump or pipeline valve). (iii) Percent by weight VHAP in...

  19. 25 CFR 700.247 - Appeals.

    Science.gov (United States)

    2010-04-01

    ... envelope containing the notice of appeal and the face of the notice shall bear the legend “FREEDOM OF INFORMATION APPEAL”. The failure of an appeal to bear such a legend will not disqualify an appeal from...

  20. 7 CFR 247.34 - Management reviews.

    Science.gov (United States)

    2010-01-01

    ... administration on an ongoing basis by reviewing financial reports, audit reports, food orders, inventory reports... the State agency do to ensure that local agencies meet program requirements and objectives? The State..., and other agencies conducting program activities meet program requirements and objectives. As part of...

  1. 8 CFR 247.11 - Notice.

    Science.gov (United States)

    2010-01-01

    ... Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS ADJUSTMENT OF STATUS OF CERTAIN RESIDENT... and upon his request have an opportunity to appear in person, in support or in lieu of his written answer, before an immigration officer designated for that purpose. The person shall further be advised...

  2. 40 CFR 247.12 - Construction products.

    Science.gov (United States)

    2010-07-01

    ..., polyisocyanurate, polystyrene, phenolics, and composites; and (4) Spray-in-place insulation, including but not limited to foam-in-place polyurethane and polyisocyanurate, and spray-on cellulose. (b) Structural...

  3. Effectiveness of accelerated perioperative care and rehabilitation intervention compared to current intervention after hip and knee arthroplasty. A before-after trial of 247 patients with a 3-month follow-up

    Directory of Open Access Journals (Sweden)

    Hansen Torben B

    2008-04-01

    Full Text Available Abstract Background In Denmark, approximately 12,000 hip and knee arthroplasties were performed in 2006, and the hospital costs were close to US$ 110,000,000. In a randomized clinical trial, we have recently demonstrated the efficacy of accelerated perioperative care and rehabilitation intervention after hip and knee arthroplasty compared to current intervention under ideal circumstances. We do not, however, know whether these results could be reached under usual circumstances of healthcare practice. We therefore investigated whether length of stay after implementation of accelerated perioperative care and rehabilitation after hip and knee arthroplasty could be reduced in a normal healthcare setting, and how the achieved results matched those observed during the randomized clinical trial. Methods An effectiveness study as a before-after trial was undertaken in which all elective primary total hip and total knee arthroplasty patients were divided into a before-implementation group receiving the current perioperative procedure, and an after-implementation group receiving the new accelerated perioperative care and rehabilitation procedures as provided by a new multi-disciplinary organization. We used the Breakthrough Series Collaborative Model for implementation. The primary outcome measure was in hospital length of stay (LOS, and the secondary outcome measure was adverse effects within 3 months postoperatively. Results We included a total of 247 patients. Mean LOS was significantly (P Conclusion Accelerated perioperative care and rehabilitation intervention after hip and knee arthroplasty was successfully and effectively implemented. Results obtained during usual hospital circumstances matched the results achieved under ideal circumstances in this group of patients.

  4. Application of fission track detectors to californium-252 neutron dosimetry in tissue near the radiation source

    International Nuclear Information System (INIS)

    Oswald, R.A.; Lanzl, L.H.; Rozenfeld, M.

    1981-01-01

    Fission track detectors were applied to a unique problem in neutron dosimetry. Measurements of neutron doses were required at locations within a tumor of 1 cm diameter implanted on the back of a mouse and surrounded by a square array of four 252 Cf medical sources. Measurements made in a tissue-equivalent mouse phantom showed that the neutron dose rate to the center of the tumor was 2.18 rads mg -1 h -1 +- 8.4%. The spatial variation of neutron dose to the tumor ranged from 1.88 to 2.55 rads mg -1 h -1 . These measurements agree with calculated values of neutron dose to those locations in the phantom. Fission track detectors have been found to be a reliable tool for neutron dosimetry for geometries in which one wishes to know neutron dose values which may vary considerably over distances of 1 cm or less

  5. Application of fission track detectors to californium-252 neutron dosimetry in tissue near the radiation source

    International Nuclear Information System (INIS)

    Oswald, R.A.; Lanzl, L.H.; Rozenfeld, M.

    1981-01-01

    Fission track detectors were applied to a unique problem in neutron dosimetry. Measurements of neutron doses were required at locations within a tumor of 1 cm diameter implanted on the back of a mouse and surrounded by a square array of four 252 Cf medical sources. Measurements made in a tissue-equivalent mouse phantom showed that the neutron dose rate to the center of the tumor was 2.18 rads micrograms-1 h-1 +/- 8.4%. The spatial variation of neutron dose to the tumor ranged from 1.88 to 2.55 rads micrograms-1 h-1. These measurements agree with calculated values of neutron dose to those locations in the phantom. Fission track detectors have been found to be a reliable tool for neutron dosimetry for geometries in which one wishes to know neutron dose values which may vary considerably over distances of 1 cm or less

  6. Neutron Protection Factor Determination and Validation for a Vehicle Surrogate Using a Californium Fission Source

    Science.gov (United States)

    2017-06-01

    study the laws governing shock wave propagation, and evaluate the suitability of military operations after being subjected to their use. During...14]. MCNP6.1 then outputs a dose spectrum, instead of the standard fluence spectrum created from the “ f4 ” tally [14]. In order to produce the dose...manually, an unmodified fluence tally ( f4 ) was exported externally to a spreadsheet. The energy bins were summed and grouped to mimic the energy bin

  7. Californium-252 neutron activation analysis of high-level processed nuclear tank waste

    International Nuclear Information System (INIS)

    Troyer, G.L.; Purcell, M.A.

    2000-01-01

    The basis for production assessment of the vitrification of Hanford nuclear fuel reprocessing wastes will be high-precision measurements of the elemental sodium content. However, the chemical analysis of both radioactive and nonradioactive components in nuclear waste can be challenged by high radiation dose rates. The dose rates compromise many analytical techniques as well as pose personnel dosimetry risks. In many cases, reduction of dose rates through dilution compromises the precision and sensitivity for certain key components. The use of neutron activation analysis (NAA) provides a method of analysis that avoids the need for dilutions or extensive sample preparation. These waste materials also contain trace quantities of fissionable isotopes, which, through neutron activation, can be estimated by delayed neutron counting of fissioned fragments

  8. Multiplicity and correlated energy of gamma rays emitted in the spontaneous fission of Californium-252

    International Nuclear Information System (INIS)

    Brunson, G.S. Jr.

    1982-06-01

    An array of eight high-speed plastic scintillation detectors has been used to infer a mathematical model for the emission multipliciy of prompt gammas in the spontaneous fission of 252 Cf. Exceptional time resolution and coincidence capability permitted the separation of gammas from fast neutrons over a flight path of approximately 10 cm. About 20 different distribution models were tested. The average energy of the prompt gammas is inversely related to the number emitted; however, this inverse relationship is not strong and the total gamma energy does increase with increasing gamma number. An extension of the experiment incorporated a lithium-drifted germanium gamma spectrometer that resolved nearly 100 discrete gammas associated with fission. Of these gammas, some were preferentially associated with fission in which few gammas were emitted. Certain others were more frequent when many gammas were emitted. Results are presented

  9. Use of californium-252 sources in Hungary for teaching and research

    International Nuclear Information System (INIS)

    Csikai, J.

    1976-01-01

    An activation facility was designed to accommodate up to 50 mg of 252 Cf; it contains at present a 500 μg source. The absolute values of thermal, epithermal and fast neutron fluxes were determined by the foil activation method using In, Dy, Au, Al and Fe detectors. Cross-sections averaged for unmoderated 252 Cf neutrons were determined for 22 different reactions for elements with atomic weights lying between A=27 and 204. The sensitivity for determination of Al, Ti, Cu, As, Sr, Mo, In, Cd, Ba, Au, Hg and Pb was calculated for NaI(Tl) and Ge(Li) detectors. Average (n,2n) cross-sections for 252 Cf spectrum were calculated for 49 nuclei lying between A=14 and 204. Angular distributions and cross-sections for the fragments from 252 Cf neutron-induced fission of 232 Th and 238 U were measured. Titanium in bauxite and manganese in aluminium alloys were determined with a 252 Cf source. The applicability of solid-state track detectors for neutron dosimetry, radiography and for the determination of fuel burn-up were investigated using 252 Cf neutron and fragment sources. Characteristics of a jumping spark counter for counting fission fragments were studied with 252 Cf sources. (author)

  10. Chromatographic cation exchange separation of decigram quantities of californium and other transplutonium elements

    Energy Technology Data Exchange (ETDEWEB)

    Benker, D.E.; Chattin, F.R.; Collins, E.D.; Knauer, J.B.; Orr, P.B.; Ross, R.G.; Wiggins, J.T.

    1980-01-01

    Decigram quantities of highly radioactive transplutonium elements are routinely partitioned at TRU by chromatographic elution from cation resin using AHIB eluent. By using two high-pressure ion exchange columns, a small one for the initial loading of the feed and a large one for the elution, batch runs containing up to 200 mg of /sup 252/Cf can be made in about 5 hours (2 hours to load the feed and 3 hours for the elution). The number of effluent product fractions and the amount of actinides that must be collected in intermediate fractions are minimized by monitoring response from a flow-through alpha-detector. This process has been reliable and relatively easy to operate, and will continue to be used for partitioning transplutonium elements at TRU.

  11. Determination of the average number of neutrons per fission event for californium-252

    International Nuclear Information System (INIS)

    Aleksandrov, B.M.; Belov, L.M.; Drapchinskij, L.V.

    1982-01-01

    By means of a separate determination of neutron yields and fission event rates, the value of #betta#-bar( 252 Cf) has been measured for a series of new high-purity sources. The improved quality of the source active layers has reduced the error in determining the fission rate to 0.35%. The value obtained for #betta#-bar( 252 Cf) is 3.747+-0.036. A description is given of the design and the parameters of a spherical manganese bath in which the work on refining the value of #betta#-bar( 252 Cf) will be continued. (author)

  12. Remarkably High Stability of Late Actinide Dioxide Cations: Extending Chemistry to Pentavalent Berkelium and Californium.

    Science.gov (United States)

    Dau, Phuong D; Vasiliu, Monica; Peterson, Kirk A; Dixon, David A; Gibson, John K

    2017-12-06

    Actinyl chemistry is extended beyond Cm to BkO 2 + and CfO 2 + through transfer of an O atom from NO 2 to BkO + or CfO + , establishing a surprisingly high lower limit of 73 kcal mol -1 for the dissociation energies, D[O-(BkO + )] and D[O-(CfO + )]. CCSD(T) computations are in accord with the observed reactions, and characterize the newly observed dioxide ions as linear pentavalent actinyls; these being the first Bk and Cf species with oxidation states above IV. Computations of actinide dioxide cations AnO 2 + for An=Pa to Lr reveal an unexpected minimum for D[O-(CmO + )]. For CmO 2 + , and AnO 2 + beyond EsO 2 + , the most stable structure has side-on bonded η 2 -(O 2 ), as An III peroxides for An=Cm and Lr, and as An II superoxides for An=Fm, Md, and No. It is predicted that the most stable structure of EsO 2 + is linear [O=Es V =O] + , einsteinyl, and that FmO 2 + and MdO 2 + , like CmO 2 + , also have actinyl(V) structures as local energy minima. The results expand actinide oxidation state chemistry, the realm of the distinctive actinyl moiety, and the non-periodic character towards the end of the periodic table. © 2017 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.

  13. Californium-252: isotope for modern radiotherapy of cervix, uterine and vaginal carcinomas

    International Nuclear Information System (INIS)

    Maruyama, J.; Beach, J.L.; Nagell, J.R. van

    1984-01-01

    Cf-252 is an isotope that can easily be afterloaded into available gynecological applicators and used for bulky cervix, uterus or vaginal cancer therapy. It is economical, time and cost effective in use, and can be applied to the therapy of many patients throughout the world. It is more effective for neutron therapy than machine fast neutron therapy and is the only form of neutron therapy producing consistent complication-free 5-year cure of advanced cancers currently available. Cf-252 is an isotope for modern gynecological tumor therapy for the future. Isodose curves for Cf-252 implants revealed dose distributions conforming well to tumor. (orig.) [de

  14. Testing of ENDF/B cross section data in the Californium-252 neutron benchmark field

    International Nuclear Information System (INIS)

    Mannhart, W.

    1979-01-01

    The fission neutron field of 252 Cf presently represents one of the most well-known neutron benchmark fields. For 13 neutron reactions which are of importance in reactor metrology, measurements of spectrum-averaged cross sections, [sigma], performed in this neutron field were compared with calculated average cross sections. This comparison allows one to draw conclusions as to the quality of different sigma(E) data taken from ENDF/B-IV, from ENDF/B-V, and from recent experiments and used in the calculation of average cross sections. The comparison includes an uncertainty analysis regarding the different uncertainty contributions of [sigma], of sigma(E), and of the spectral distribution of 252 Cf fission neutrons. Additionally, in a few examples, sensitivity studies were carried out. The sensitivity of the spectrum-averaged cross sections to individual characteristics of the sigma(E) data, such as normalization factors or shifts in the energy scale, was investigated. Similarly, the sensitivity of [sigma] to the spectral distribution of 252 Cf was determined. 4 figures, 2 tables

  15. Total neutron cross sections of berkelium-249 and californium-249 below 100 eV

    International Nuclear Information System (INIS)

    Benjamin, R.W.; Harvey, J.A.; Hill, N.W.; Pandey, M.S.; Carlton, R.F.

    1979-01-01

    The neutron total cross sections of 249 Bk and 249 Cf have been measured from 0.03 to 100 eV using the Oak Ridge Electron Linear Accelerator (ORELA) as a source of pulsed neutrons. The 1.6 mm dia. cylindrical transmission samples contained initially up to 5.3 mg of 98% 249 Bk and 2% 249 Cf: 4.5 years later, when the final measurements were made, the composition of the samples had become 2.5% 249 Bk, 96.9% 249 Cf, and 0.6% 245 Cm. Samples were cooled with liquid nitrogen to reduce Doppler broadening. Thirty-nine resonances were identified in 249 Bk and analyzed using a single-level Breit-Wigner formalism. Fifty-five resonances were identified in 249 Cf and analyzed using an R-matrix multilevel formalism. Fifty-five resonances were identified in 249 Cf and analyzed using an R-matrix multilevel formalism. The resonance parameters obtained have been used to determine the average level spacings and the s-wave neutron and fission strength functions. Where possible, bound-level parameters were derived to fit the thermal neutron total cross section data

  16. Oxidation-reduction properties of americium, curium, berkelium, californium, einsteinium and fermium, and thermodynamic consequences for the 5f series

    International Nuclear Information System (INIS)

    Samhoun, K.

    1976-01-01

    The amalgamation of 5f elements from Am to Fm has been studied by using 241 Am, 244 Cm, 249 Bk, 249 Cf, 252 Cf, 253 Es, 254 Es, 252 Fm and 255 Fm with two electrochemical methods, radiocoulometry and radiopolarography, perfectly adapted to investigate extremely diluted solutions when the concentration of electroactive species is as low as 10 -16 M. The theory of radiocoulometry has been developed in the general cases of reversible and irreversible electrode process. It has been used to interpret the experimental data on the kinetic curves of amalgamation, and to estimate the standard rate constant of the electrode process in complexing medium (citric). On the other hand the radiopolarographic method has been applied to study the mechanism of reduction at the dropping mercury electrode of cations M 3+ in aqueous medium to the metal M with formation of amalgam. The results are exploited into two directions: 1- Acquisition of some data concerning the oxidation-reduction properties of elements from Am to Fm. Therefore the standard electrode E 0 [M(III-0)] potentials for Bk, Cf and Es, and the standard electrode E 0 [M(II-0)] potential for Fm are estimated and the relative stability of each oxidation state (from II to VII) of 5f elements is discussed; 2- Acquisition of unknown thermodynamic data on transcalifornium elements. Correlations between 4f and 5f elements are precised and some divergences appear for the second half of 4f and 5f series (i.e. for 65 [fr

  17. Inverse gamma ray dose rate effect in californium-252 RBE experiment with human T-1 cells irradiated in vitro

    International Nuclear Information System (INIS)

    Todd, P.; Feola, J.M.

    1986-01-01

    Metabolically deoxygenated suspensions of human T-1 cells were used to determine the RBE in hypoxia of low dose rate (LDR) Cf-252 radiation compared to LDR gamma radiation. Based upon the initial portion of the survival curves the RBE was 5.0 ± 1.0 for all components of the Cf-252 radiation and 7.1 ± 1.7 for the neutrons alone. An inverse dose rate effect was observed for LDR gamma radiation in which greater cell sensitivity was observed at lower dose rates and longer irradiation periods. It was demonstrated that there was little or no sublethal damage repair or cell progression during LDR at 21 deg C, and the observed decrease in cell survival probability with increasing irradiation time at a given dose was attributable to reoxygenation of the cell suspensions during the course of LDR exposures. (Auth.)

  18. In situ x-ray fluorescence and californium-252 neutron activation analysis for marine and terrestrial mineral exploration

    International Nuclear Information System (INIS)

    Wogman, N.A.

    1976-12-01

    Instrumentation has been designed for in situ analysis of marine and terrestrial minerals using the techniques of x-ray fluorescence and neutron activation analysis. The energy-dispersive x-ray fluorescence analyzer allows more than 20 elements to be quantitatively measured at the 10 ppM level in water depths to 300 m. The analyzer consists of a solid cryogen-cooled Si(Li) detector, a 50 mCi 109 Cd or 57 Co excitation source, and an analyzer-computer system for data storage and manipulation. The neutron activation analysis, which is designed to measure up to 30 elements at parts per hundred to ppM levels, utilizes the man-made element 252 Cf as its neutron activation source. The resulting radioelements which emit characteristic gamma radiation are then analyzed in situ during 2- to 200-s counting intervals with Ge(Li) or NaI(T1) detector systems. An extension of this latter technique, which uses a 252 Cf- 235 U fueled subcritical multiplier, is also being studied. The subcritical facility allows the neutrons from the 252 Cf source to be multiplied, thus providing greater neutron flux. Details of these in situ analysis systems, actual in situ spectra, and recorded data are discussed with respect to the detection of minerals at their varying concentration levels. The system response of each illustrates its usefulness for various rapid environmental mineral exploration studies. These techniques can be utilized on terrestrial surfaces and marine or fresh water sediments. 5 figures, 2 tables

  19. All projects related to | Page 247 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    2012-01-01

    A grant to improve a new generation of Latin American leaders' understanding of how to better manage natural resources will contribute to the region's economic and social development. Start Date: January 1, 2012 ... Region: South Asia, Central Asia, Far East Asia, Bangladesh, Sri Lanka, India, Nepal, Pakistan. Program: ...

  20. 29 CFR 779.247 - “Goods” defined.

    Science.gov (United States)

    2010-07-01

    ... OR SERVICES Employment to Which the Act May Apply; Enterprise Coverage Interstate Inflow Test Under... Act is defined in section 3(i) of the Act. The statutory definition is quoted in § 779.14, and is...

  1. 32 CFR Appendix B to Part 247 - CE Publications

    Science.gov (United States)

    2010-07-01

    ... dining at a restaurant or attending a musical performance) of a commercial organization whose primary... potentially become the CE contractor. Upon evaluation of the competing proposals by the Source Selection Advisory Committee (SSAC) and selection of a winner by the selecting official, the CE contract shall be...

  2. Maintaining Mission Critical Systems in a 247 Environment

    CERN Document Server

    Curtis, Peter M

    2011-01-01

    "This book is meant to offer Architects, Property Mangers, Facility Managers, Building Engineers, Information Technology Professionals, Data Center Personnel, Electrical & Mechanical Technicians and students in undergraduate, graduate, or continuing education programs relevant insight into the Mission Critical Environment with an emphasis on business resiliency, data center efficiency, and green power technology. Industry improvements, standards, and techniques have been incorporated into the text and address the latest issues prevalent in the Mission Critical Industry. An emphasis on green technologies and certifications is presented throughout the book. In addition, a description of the United States energy infrastructure's dependency on oil, in relation to energy security in the mission critical industry, is discussed. In conjunction with this, either a new chapter will be created on updated policies and regulations specifically related to the mission critical industry or updates to policies and regula...

  3. 40 CFR 247.14 - Park and recreation products.

    Science.gov (United States)

    2010-07-01

    ... plastic. (b) Plastic fencing containing recovered plastic for use in controlling snow or sand drifting and... containing recovered steel, aluminum, plastic, or concrete. (d) Playground equipment containing recovered plastic, steel, or aluminum. [60 FR 21381, May 1, 1995, as amended at 62 FR 60974, Nov. 13, 1997; 65 FR...

  4. 7 CFR 247.5 - State and local agency responsibilities.

    Science.gov (United States)

    2010-01-01

    ....); (6) Establishing nutritional risk criteria and a residency requirement for participants, if such... received for program administration; (8) Developing a plan for the detection and prevention of dual... compliance with Federal audit requirements; (14) Providing guidance to local agencies, as needed; and (15...

  5. 24/7 Operational Effectiveness Toolset: Mishap Investigation Interface

    Science.gov (United States)

    2008-10-01

    pressures, equipment limitations, attitudes, etc.). A PTO may have background or credentials in: Applied aerospace physiology Hyperbaric ... hypobaric physiology training Disorientation and centrifuge training Aviation human factors Life-support course Parachutist and land or water survival

  6. Dicty_cDB: SSK247 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available .. 34 9.7 AB049544_1( AB049544 |pid:none) Porcine enterovirus 10 gene for RN... 3...4 9.7 AF363453_1( AF363453 |pid:none) Porcine enterovirus 9 strain UKG/4... 34 9.7 protein update 2009. 6.14

  7. 48 CFR 252.247-7006 - Removal of contractor's employees.

    Science.gov (United States)

    2010-10-01

    ... use only experienced, responsible, and capable people to perform the work. The Contracting Officer may... continued employment under this contract is inconsistent with the interest of military security. (End of...

  8. 48 CFR 252.247-7007 - Liability and insurance.

    Science.gov (United States)

    2010-10-01

    ... harmless from, bodily injury and death of persons, resulting either in whole or in part from the negligence..., contributed jointly with the fault or negligence of the Contractor in causing such damage, injury, or death...-insurer under applicable provision of law. (2) Bodily injury liability insurance in an amount of not less...

  9. 48 CFR 52.247-57 - Transportation Transit Privilege Credits.

    Science.gov (United States)

    2010-10-01

    ... equipment and acceptance by the carrier, these shipments under paid commercial bills of lading will move for... the offered f.o.b. origin price unless a lower rate is applicable on the date of bid opening (or...

  10. 48 CFR 52.247-68 - Report of Shipment (REPSHIP).

    Science.gov (United States)

    2010-10-01

    ..., or private) for transportation to a domestic destination (other than a port for export); (2..., MEMPHIS, TN. SHIPPED YOUR DEPOT 1981 JUN 1 540 CTNS MENS COTTON TROUSERS, 30,240 LB, 1782 CUBE, VIA XX-YY...

  11. 247 Educational Policy and Technological Development in Africa ...

    African Journals Online (AJOL)

    User

    Our modern world is sharply divided along two socio- economic poles of ... This article therefore, will look at how Nigeria's educational policy affects her level of .... the scientific and technological culture” (Umoren, 1996). vii. Lack of appropriate ...

  12. 48 CFR 252.247-7008 - Evaluation of bids.

    Science.gov (United States)

    2010-10-01

    ... other factors, the Contracting Officer will evaluate bids on the basis of advantages or disadvantages to... evaluation, the Contracting Officer will assume that the administrative cost to the Government for issuing... Government, including the administrative costs in paragraph (b)(1). (c) When drayage is necessary for the...

  13. 7 CFR 247.29 - Reports and recordkeeping.

    Science.gov (United States)

    2010-01-01

    .... All records must be available during normal business hours for use in management reviews, audits... obligated, and the amount remaining unobligated. (3) FNS-191, Racial/Ethnic Group Participation. Local agencies must submit a report of racial/ethnic participation each year, using the FNS-191. (c) Is there any...

  14. 48 CFR 247.270-2 - Technical provisions.

    Science.gov (United States)

    2010-10-01

    ..., DEPARTMENT OF DEFENSE CONTRACT MANAGEMENT TRANSPORTATION Contracts for Transportation or for Transportation... sometimes within the same port, it is not practical to develop standard technical provisions covering all...

  15. Digital reference service : libraries online 24/7

    OpenAIRE

    Vijayakumar, Manju; Vijayakumar, J. K.

    2005-01-01

    The integration of the Internet Technology in to Libraries has not changed its mission of providing excellent information service to users but it has added several new dimensions and opened new avenues to their tasks. Reference librarians, while assisting users in the library, now have an additional set of remote users, who access the reference service online, who are more demanding, less patient users who have greater expectations. This paper discusses the methods in Online Reference service...

  16. 48 CFR 52.247-66 - Returnable Cylinders.

    Science.gov (United States)

    2010-10-01

    ... Cylinders (MAY 1994) (a) Cylinder, referred to in this clause, is a pressure vessel designed for pressures... clause. (c) For each cylinder lost or damaged beyond repair while in the Government's possession, the... associated replacement values.] These cylinders shall become Government property. (d) If any lost cylinder is...

  17. 24/7 Negotiation in couples' transition to parenthood

    NARCIS (Netherlands)

    Wiesmann, S.M.

    2010-01-01

    How do couples negotiate about their division of paid and unpaid work when they become parents? The division of work among couples has significantly changed in the past decades. This study focused on the underlying processes that lead couples to a certain division of paid and unpaid work. To unravel

  18. 48 CFR 252.247-7010 - Scope of contract.

    Science.gov (United States)

    2010-10-01

    ... containers (Federal Specification PPP-B-580), all equipment, plant and labor; and (2) Perform all work in accomplishing containerization of personal property for overseas or domestic movement or storage, including— (i... property (including servicing of appliances) for movement or storage, drayage and related services. Unless...

  19. Web Based Prognostics and 24/7 Monitoring

    Science.gov (United States)

    Strautkalns, Miryam; Robinson, Peter

    2013-01-01

    We created a general framework for analysts to store and view data in a way that removes the boundaries created by operating systems, programming languages, and proximity. With the advent of HTML5 and CSS3 with JavaScript the distribution of information is limited to only those who lack a browser. We created a framework based on the methodology: one server, one web based application. Additional benefits are increased opportunities for collaboration. Today the idea of a group in a single room is antiquated. Groups will communicate and collaborate with others from other universities, organizations, as well as other continents across times zones. There are many varieties of data gathering and condition-monitoring software available as well as companies who specialize in customizing software to individual applications. One single group will depend on multiple languages, environments, and computers to oversee recording and collaborating with one another in a single lab. The heterogeneous nature of the system creates challenges for seamless exchange of data and ideas between members. To address these limitations we designed a framework to allow users seamless accessibility to their data. Our framework was deployed using the data feed on the NASA Ames' planetary rover testbed. Our paper demonstrates the process and implementation we followed on the rover.

  20. 48 CFR 252.247-7017 - Erroneous shipments.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Erroneous shipments. 252... SYSTEM, DEPARTMENT OF DEFENSE CLAUSES AND FORMS SOLICITATION PROVISIONS AND CONTRACT CLAUSES Text of..., articles of personal property inadvertently packed with goods of other than the rightful owner. (2) Ensure...

  1. 247 REVIEW ARTICLE BOOK TITLE: ORAL TRADITION AS ...

    African Journals Online (AJOL)

    Some of these messages, especially those that presents an “interpretation” of existing situations, are often ... the future. Such information comes from eyewitnesses, hearsay, or internal ... In practice, most false rumours ... well as about beliefs concerning situations. ... society, which is subject to recreation by historical change.

  2. Exon 3-deleted/full-length growth hormone receptor polymorphism genotype frequencies in Spanish short small-for-gestational-age (SGA) children and adolescents (n = 247) and in an adult control population (n = 289) show increased fl/fl in short SGA.

    Science.gov (United States)

    Audí, Laura; Esteban, Cristina; Carrascosa, Antonio; Espadero, Rosa; Pérez-Arroyo, Annalisa; Arjona, Rosa; Clemente, María; Wollmann, Hartmut; Fryklund, Linda; Parodi, Luis A

    2006-12-01

    A polymorphism in the human GH receptor gene (d3/fl-GHR) resulting in genomic deletion of exon 3 has been associated with the degree of height increase in response to GH therapy. The objective of the study was to evaluate the frequencies of d3/fl-GHR polymorphism genotypes in control and short small-for-gestational-age (SGA) populations. An adult control population with heights normally distributed (ACPNH) between -2 and +2 sd score (SDS) and a short non-GH-deficient SGA child population were selected. Thirty Spanish hospitals participated in the selection of the short non-GH-deficient SGA children in the setting of a controlled, randomized trial, and one of these hospitals selected the ACPNH. CONTROLS AND PATIENTS: Two hundred eighty-nine adult subjects of both sexes constituted the ACPNH and 247 children and adolescents of both sexes the short SGA patients. Heights and weights were recorded in the ACPNH, and auxologic and biochemical data were recorded at each hospital for the SGA patients; d3/fl-GHR genotypes were determined and data analyzed in a single hospital. In short SGA patients, d3/fl-GHR genotype frequencies were significantly different from those in ACPNH, with a higher frequency of fl/fl genotype (P or=-2 SDS, n = 60). Our data showed significant differences in the frequency distribution of the d3/fl-GHR genotypes between a normally distributed adult height population and short SGA children, with the biologically less active fl/fl genotype being almost twice as frequent in SGA patients. These data suggest that the d3/fl-GHR polymorphism might be considered among the factors that contribute to the phenotypic expression of growth.

  3. [An improved method of preparing protein and peptide probes in mass spectrometry with ionization of division fragments by californium-252 (TOF-PDMS)].

    Science.gov (United States)

    Chivanov, V D; Zubarev, R A; Aksenov, S A; Bordunova, O G; Eremenko, V I; Kabanets, V M; Tatarinova, V I; Mishnev, A K; Kuraev, V V; Knysh, A N; Eremenko, I A

    1996-08-01

    The addition of organic acids (picric, oxalic, citric, or tartaric) to peptide and protein samples was found to significantly increase the yield of their quasi-molecular ions (QMI) in time-of-flight 252Cf plasma desorption mass spectrometry. The yield of the ions depended on the pKa of the acid added.

  4. The development and medical applications of a simple facility for partial body in vivo neutron activation analysis using californium-252 sources

    International Nuclear Information System (INIS)

    Boddy, K.

    1978-11-01

    A simple and cheap facility for partial body neutron activation analysis has been designed, based on the use of two 100 μg 252 Cf neutron sources. The results reported show that calcium can be measured in parts of the body such as the tibia with a precision as good as +- 1.6 % for a radiation dose of 2 rem. The uniformity of the thermal neutron flux density is better than +- 3 % over 10 cm. Some applications of this irradiation facility for studies of trace elements, in particular cadmium in liver and aluminium in liver or brain, have also been explored. However, the sensitivity attainable is not yet sufficient for the study of normal levels, but could be of interest in toxicological investigations

  5. Radiological Characterization Technical Report on Californium-252 Sealed Source Transuranic Debris Waste for the Off-Site Source Recovery Project at Los Alamos National Laboratory

    Energy Technology Data Exchange (ETDEWEB)

    Feldman, Alexander [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2014-04-24

    This document describes the development and approach for the radiological characterization of Cf-252 sealed sources for shipment to the Waste Isolation Pilot Plant. The report combines information on the nuclear material content of each individual source (mass or activity and date of manufacture) with information and data on the radionuclide distributions within the originating nuclear material. This approach allows for complete and accurate characterization of the waste container without the need to take additional measurements. The radionuclide uncertainties, developed from acceptable knowledge (AK) information regarding the source material, are applied to the summed activities in the drum. The AK information used in the characterization of Cf-252 sealed sources has been qualified by the peer review process, which has been reviewed and accepted by the Environmental Protection Agency.

  6. Calculation of neutron and gamma-ray energy spectra in liquid air and liquid nitrogen due to 14-MeV neutron and californium-252 sources

    International Nuclear Information System (INIS)

    Straker, E.A.; Gritzner, M.L.; Harris, L. Jr.

    1978-01-01

    Calculations of neutron and gamma-ray fluences from 14-MeV neutron and 252 Cf sources in liquid air and liquid nitrogen have been performed. These calculations were made specifically for comparison with experimental data measured at Stohl, Federal Republic of Germany. The discrete-ordinates method was utilized with neutron and gamma-ray cross sections from ENDF/B-IV. One-dimensional calculational models were developed for the sources and tank. Limited comparisons are made with experimental data

  7. Measurement and model description of differential neutron spectra of the californium 252 spontaneous fission depending on THETA, Msub(T), Esub(kin sum)

    International Nuclear Information System (INIS)

    Vasil'ev, Yu.A.; Sidorov, L.V.; Vasil'eva, N.K.; Barashkov, Yu.A.; Golovanov, O.A.; Kopalkin, N.V.; Nemudrov, N.I.; Surin, V.M.; Khachaturov, Yu.F.

    1984-01-01

    The results of the 4π-spectrometer mesurement of the neutron spectra in the 26-154 deg angle range for seven groups of fragments with different masses and total kinetic energies are given. Experimental spectra have been analyzed for consistency with the evaporation model of neutrons from moving fragments. The results of an analysis of differential neutron spectra shows that the main reason of the ''yearly'' neutron emission is a neutron evaporation from fragments with large excitation energy and from fragments with neutron number N>82 during the time as compared with the time of fragment acceleration

  8. Efficacy of brachytherapy with californium-252 neutrons versus cesium-137 photons for eradication of bulky localized cervical cancer: single-institution study

    International Nuclear Information System (INIS)

    Maruyama, Y.; van Nagell, J.R.; Yoneda, J.; Donaldson, E.; Gallion, H.; Higgins, R.; Powell, D.; Turner, C.; Kryscio, R.

    1988-01-01

    A fast-neutron-emitting radioisotope, 252 Cf, is being tested in clinical trials of neutron brachytherapy for cervical cancer. The efficacy for histological eradication of bulky stage IB cervical tumors (mean diameter, approximately 6 cm) using combined radiation and surgery was studied in 65 patients treated with 137 Cs or 252 Cf before surgery during 1983-1986. Forty-four patients were treated with 137 Cs and 21 were treated with 252 Cf at equivalent doses of radiation. Fifteen of the 44 specimens (34%) were positive after 137Cs therapy. Only one of the 21 specimens was positive after 252 Cf therapy (P = .025), and that patient was treated in a delayed schedule 21 days after the start of external-beam irradiation rather than early in the course. 252 Cf therapy required a much lower radiation dose and shorter treatment time. The study compared tumor destruction of an identically staged human cervical tumor in situ by direct histological means, using 252 Cf neutron therapy or conventional photon therapy at an identical and equivalent dose adjusted by a relative biological effectiveness of 6.0 for 252 Cf

  9. Accurate determination of Curium and Californium isotopic ratios by inductively coupled plasma quadrupole mass spectrometry (ICP-QMS) in 248Cm samples for transmutation studies

    Energy Technology Data Exchange (ETDEWEB)

    Gourgiotis, A.; Isnard, H.; Aubert, M.; Dupont, E.; AlMahamid, I.; Cassette, P.; Panebianco, S.; Letourneau, A.; Chartier, F.; Tian, G.; Rao, L.; Lukens, W.

    2011-02-01

    The French Atomic Energy Commission has carried out several experiments including the mini-INCA (INcineration of Actinides) project for the study of minor-actinide transmutation processes in high intensity thermal neutron fluxes, in view of proposing solutions to reduce the radiotoxicity of long-lived nuclear wastes. In this context, a Cm sample enriched in {sup 248}Cm ({approx}97 %) was irradiated in thermal neutron flux at the High Flux Reactor (HFR) of the Laue-Langevin Institute (ILL). This work describes a quadrupole ICP-MS (ICP-QMS) analytical procedure for precise and accurate isotopic composition determination of Cm before sample irradiation and of Cm and Cf after sample irradiation. The factors that affect the accuracy and reproducibility of isotopic ratio measurements by ICP-QMS, such as peak centre correction, detector dead time, mass bias, abundance sensitivity and hydrides formation, instrumental background, and memory blank were carefully evaluated and corrected. Uncertainties of the isotopic ratios, taking into account internal precision of isotope ratio measurements, peak tailing, and hydrides formations ranged from 0.3% to 1.3%. This uncertainties range is quite acceptable for the nuclear data to be used in transmutation studies.

  10. High Cycle Fatigue Damage Mechanisms of MAR-M 247 Superalloy at High Temperatures

    Czech Academy of Sciences Publication Activity Database

    Šmíd, Miroslav; Horník, Vít; Hutař, Pavel; Hrbáček, K.; Kunz, Ludvík

    2016-01-01

    Roč. 69, č. 2 (2016), s. 393-397 ISSN 0972-2815 R&D Projects: GA TA ČR(CZ) TA04011525; GA MŠk(CZ) ED1.1.00/02.0068 Institutional support: RVO:68081723 Keywords : High cycle fatigue * S-N curves * Fractography * High temperature * EBSD analysis Subject RIV: JL - Materials Fatigue, Friction Mechanics Impact factor: 0.533, year: 2016

  11. 49 CFR 173.247 - Bulk packaging for certain elevated temperature materials.

    Science.gov (United States)

    2010-10-01

    ... reference to the axes of the transport vehicle. Each accelerative or decelerative load may be considered... packagings used for transportation of molten metals and molten glass by rail when movement is restricted to...

  12. 27 CFR 24.247 - Materials authorized for the treatment of distilling material.

    Science.gov (United States)

    2010-04-01

    ... fermentable carbohydrates The amylase enzyme activity shall be derived from Aspergillus niger, Aspergillus... starches to fermentable carbohydrates The amylase enzyme actvity shall be derived from Aspergillus niger or Aspergillus oryzae per FDA advisory opinion dated 8/18/83 or from Rhizopus oryzae per 21 CFR 173.130 or from...

  13. Nuclear engineering 24/7 via distance learning: Course development and management experiences

    International Nuclear Information System (INIS)

    Maldonado, G. I.; Christenson, J.; Spitz, H.; Rutz, E.; Todd, A.

    2006-01-01

    This article summarizes a few lessons learned in our early experiences in developing, delivering and implementing a series of distance learning classes for full-time undergraduate students enrolled in the combined-degree BS Mechanical + MS Nuclear Engineering 5-year and co-op based 'MNE- ACCEND' program at the Univ. of Cincinnati. This program is in its third year since inception and currently hosts approximately 35 undergraduate students enrolled in the graduating classes of 2008, 2009, and 2010, which is when these students are expected to complete their BS Mechanical and MS Nuclear Engineering degrees. In addition, 20+ newly confirmed students are expected to enter this program in the fall quarter of 2006 to become our Class of 2011. Therefore, the successful 'follow through' of the DL component of this program continues to be increasingly crucial as this student pipeline reaches a targeted steady-state of about 10 to 15 graduates per class. (authors)

  14. Episode: Phaedrus (247c6-8 by Yorgos Kentrotis, translated and introduced by Paschalis Nikolaou

    Directory of Open Access Journals (Sweden)

    Yorgos Kentrotis

    2017-05-01

    Full Text Available Yorgos Kentrotis was born in 1958 in Laconia, the Peloponnese. Following studies in Law at Greek and German universities, he was eventually won over by literature and translation. He is currently Professor in Translation Theory at the Ionian University in Corfu. Since the early 1980s he has steadily produced translations from ancient Greek, Latin, German and Russian–of works by, among others, Plato, Cicero, Robert Musil, Pablo Neruda, Vladimir Mayakovsky and Bertolt Brecht. His essays and monographs on comparative literature, poetics and translation are widely recognized. A first collection of his poems appeared in 2006; Kentrotis has published five collections since. In 2014, he put out a collection of no less than 500 of Brecht’s poems in Greek translation, as well as a selection of epigrams from the Palatine Anthology. A similar edition of Paz’s poetry is forthcoming. Most recently in 2015, he published the long-awaited Greek translation of Giambattista Vico’s (1668–1744 La Scienza Nuova (1725.

  15. S. Aft. J. Anim. Sci., 4, 247-258 (1974) INTENSIFICATION

    African Journals Online (AJOL)

    production, the cmphasis must inevitably fall on irnpoving efficiency in the oow hcrd. This is particularly evi&nt from a partitioning of thc total nutrients into the various pluses ... Maintenance of cow and calf ... creascd productivity per unit aroa and land is therefore ..... terial on this aspect the potential increase in efficiency of.

  16. Buli. Mater. Sci., Vol. 20, No. 2, April 1997, pp. 247-257. (C

    Indian Academy of Sciences (India)

    Synthesis of spodumene and spodumene-zirconia composite ... were prepared using aqueous sol-gel method employing lithium formate, aluminium formate, ... synthesis and the processing of spodumene using different precursor compounds.

  17. 32 CFR Appendix A to Part 247 - Funded Newspapers and Magazines

    Science.gov (United States)

    2010-07-01

    .... Funded publications shall not carry commercial advertising. As a service, the Funded newspaper may carry... 32 National Defense 2 2010-07-01 2010-07-01 false Funded Newspapers and Magazines A Appendix A to... (CONTINUED) MISCELLANEOUS DEPARTMENT OF DEFENSE NEWSPAPERS, MAGAZINES AND CIVILIAN ENTERPRISE PUBLICATIONS Pt...

  18. 32 CFR Appendix D to Part 247 - AFIS Print Media Directorate

    Science.gov (United States)

    2010-07-01

    ... for word processing or desktop publishing. All other PMD publications should be requisitioned through... Directorate (PMD), an element of AFIS, develops, publishes, and distributes a variety of print media products.../defenselink/afis/. B. Use of materials published by print media directorate. With the exception of copyrighted...

  19. Operational Research: Evaluating Multimodel Implementations for 24/7 Runtime Environments

    Science.gov (United States)

    Burkhart, J. F.; Helset, S.; Abdella, Y. S.; Lappegard, G.

    2016-12-01

    We present a new open source framework for operational hydrologic rainfall-runoff modeling. The Statkraft Hydrologic Forecasting Toolbox (Shyft) is unique from existing frameworks in that two primary goals are to provide: i) modern, professionally developed source code, and ii) a platform that is robust and ready for operational deployment. Developed jointly between Statkraft AS and The University of Oslo, the framework is currently in operation in both private and academic environments. The hydrology presently available in the distribution is simple and proven. Shyft provides a platform for distributed hydrologic modeling in a highly efficient manner. In it's current operational deployment at Statkraft, Shyft is used to provide daily 10-day forecasts for critical reservoirs. In a research setting, we have developed a novel implementation of the SNICAR model to assess the impact of aerosol deposition on snow packs. Several well known rainfall-runoff algorithms are available for use, allowing for intercomparing different approaches based on available data and the geographical environment. The well known HBV model is a default option, and other routines with more localized methods handling snow and evapotranspiration, or simplifications of catchment scale processes are included. For the latter, we have implemented the Kirchner response routine. Being developed in Norway, a variety snow-melt routines, including simplified degree day models or more advanced energy balance models, may be selected. Ensemble forecasts, multi-model implementations, and statistical post-processing routines enable a robust toolbox for investigating optimal model configurations in an operational setting. The Shyft core is written in modern templated C++ and has Python wrappers developed for easy access to module sub-routines. The code is developed such that the modules that make up a "method stack" are easy to modify and customize, allowing one to create new methods and test them rapidly. Due to the simple architecture and ease of access to the module routines, we see Shyft as an optimal choice to evaluate new hydrologic routines in an environment requiring robust, professionally developed software and welcome further community participation.

  20. 7 CFR 247.2 - The purpose and scope of CSFP.

    Science.gov (United States)

    2010-01-01

    ... help State and local agencies meet the nutritional needs of low-income pregnant, postpartum, and..., canned fruits and vegetables, canned meat or poultry and other protein items, and grain products such as...

  1. Nuorten tavoittaminen sosiaalisessa mediassa : case: Yle Lähiö ja Yle Sekasin 24/7

    OpenAIRE

    Luukka, Lotta

    2017-01-01

    Opinnäytetyössä pureudutaan nuorten sosiaalisen median käyttötapoihin ja siihen, miten heille siellä kannattaa markkinoida. Nuorille markkinoitaessa kanavaksi valikoituu automaattisesti sosiaalinen media. Jotta markkinointi menestyisi, on ymmärrettävä miten somessa toimitaan. 15 – 29 -vuotiaat nuoret ovat haasteellinen kohderyhmä käyttäytymisensä nopean vaihtelevuuden takia, joten markkinoinnissa on tiedettävä mistä naruista vetää. Tässä opinnäytetyössä tutkitaan kahta Ylen nuorille k...

  2. The Lived Experiences of 24/7 Connectivity on Secondary Educators

    Science.gov (United States)

    Heiden, James P.

    2012-01-01

    Student access to the Internet has dramatically increased during the first decade of 2000. A recent study indicated that over 85% of US teens have regular access to a cell phone (Rideout et al., 2010). The cell phone coupled with an Internet plan has created the smart phone. This technology allows students to decide when and where they want to…

  3. Media Madness: With TV and the Internet Available 24/7, Can Libraries Compete?

    Science.gov (United States)

    Jones, Jami

    2004-01-01

    Today's teens face an endless barrage of media--television, movies, radio, the Internet, magazines, and electronic games, not to mention those advertising slogans that shout out at them from billboards, bumper stickers, and even T-shirts. The sheer amount of time that teens spend with media is mind-boggling. Over the course of a year, young adults…

  4. Learning and Teaching 24/7: Daily Internet Usage Patterns at Nine Australian Universities

    Science.gov (United States)

    Spennemann, Dirk H. R.

    2007-01-01

    Purpose: This paper seeks to look at the usage of the internet by students, academics and university administrators as part of their normal working day. It investigates whether access to computer facilities and the mode of study have any influence, or whether other factors need to be considered when providing services. Design/methodology/approach:…

  5. S. Afr. J. Anim. Sci. I I , 247- 254 ( I 981 ) PRACTICAL ...

    African Journals Online (AJOL)

    In the case of sheep the treatment of OF-collected samples (total extrusa vs. solid frac- tion) had a significant ... of laboratory drying equipment, is discussed. Oesophageally ..... Chemistry of browning reactions in model system. J. Agric. Food ...

  6. 76 FR 25534 - Airworthiness Directives; Hamilton Sundstrand Propellers Model 247F Propellers

    Science.gov (United States)

    2011-05-05

    ... 5 p.m., Monday through Friday, except Federal holidays. The AD docket contains this AD, the... through FR2279 inclusive, FR 2398, FR2449 to FR2958 inclusive, FR20010710 to FR20010722 inclusive, and FR20010723RT to FR20020127RT inclusive, installed. Propeller blades reworked to Hamilton Sundstrand Service...

  7. 76 FR 7101 - Airworthiness Directives; Hamilton Sundstrand Propellers Model 247F Propellers

    Science.gov (United States)

    2011-02-09

    ..., except Federal holidays. The AD docket contains this AD, the regulatory evaluation, any comments received... blades part number (P/N) 817370-1, S/Ns FR2449 to FR2958 inclusive, FR20010710 to FR20010722 inclusive, and FR20010723RT to FR20020127RT inclusive, before December 31, 2010. We determined that those S/N...

  8. 48 CFR 752.247-70 - Preference for privately owned U.S.-flag commercial vessels.

    Science.gov (United States)

    2010-10-01

    ... (computed separately for dry bulk carriers, dry cargo liners, and tankers) shall be transported in privately... registry. (iv) Date of loading. (v) Port of loading. (vi) Port of final discharge. (vii) Description of...

  9. 25 CFR 247.1 - What definitions apply to this part?

    Science.gov (United States)

    2010-04-01

    ... Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR FISH AND WILDLIFE USE OF COLUMBIA RIVER... processing fish. Abandoned property may include: (1) Vehicles; (2) Mobile trailers; (3) Campers; (4) Tents..., destroy, cut, chop, girdle, dig, excavate, kill or in any way harm or disturb. Secretary means the...

  10. Safe2Tell[R]: An Anonymous, 24/7 Reporting System for Preventing School Violence

    Science.gov (United States)

    Payne, Susan R. T.; Elliott, Delbert S.

    2011-01-01

    There is widespread agreement that many school shootings could be prevented if authorities were informed that a student was planning or preparing to carry out an attack. A universal problem is that young people are highly reluctant to report on their peers. This code of silence represents a major barrier to prevention efforts. In response to the…

  11. 40 CFR 761.247 - Sample site selection for pipe segment removal.

    Science.gov (United States)

    2010-07-01

    ... end of the pipe segment. (3) If the pipe segment is cut with a saw or other mechanical device, take..., take samples from a total of seven segments. (A) Sample the first and last segments removed. (B) Select... total length for purposes of disposal, take samples of each segment that is 1/2 mile distant from the...

  12. 7 CFR 247.25 - Allowable uses of administrative funds and other funds.

    Science.gov (United States)

    2010-01-01

    ... subgrantees must comply with part 3019 of this title. State and local agencies may use procurement procedures... authority regarding the settlement of all contractual and administrative issues arising out of procurements... administrative funds provided to State and local agencies? Administrative funds may be used for costs that are...

  13. 48 CFR 252.247-7016 - Contractor liability for loss or damage.

    Science.gov (United States)

    2010-10-01

    ... the Contractor's negligence, indemnification shall be at a rate not to exceed sixty cents per pound per article. (ii) Negligent damage. When loss or damage is caused by the negligence of the Contractor...

  14. : tous les projets | Page 247 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    L'Asie du Sud-Est connaît une intensification rapide de l'agriculture qui entraîne des répercussions sur les ... Région: China, Indonesia, Thailand, Viet Nam ... Région: North of Sahara, South of Sahara, Ethiopia, Kenya, Tanzania, Sudan.

  15. 28 CFR 2.47 - Warrant placed as a detainer and dispositional review.

    Science.gov (United States)

    2010-07-01

    ... notified of his right to request counsel under the provisions of § 2.48(b) to assist him in completing this... original sentence is not interrupted by a new conviction (e.g., YCA; NARA; Mexican or Canadian treaty cases...

  16. Flame Retardant: Cyberbullies Torment Their Victims 24/7: Here's How to Stop the Abuse

    Science.gov (United States)

    Willard, Nancy

    2006-01-01

    Cyberbullying is the use of electronic information such as e-mail and other digital age tools to bully or harass individuals. Cyberbullies post angry and vulgar messages in online "flaming" wars or hack into a peer's e-mail account to wreak havoc, assaulting the reputations and already fragile egos of their young victims. The devastating effects…

  17. 26 CFR 1.247-1 - Deduction for dividends paid on preferred stock of public utilities.

    Science.gov (United States)

    2010-04-01

    ... order to secure funds with which to retire such bonds and with the money paid in for such stock retires..., or whether the entire issue of bonds is retired, will be important, but not decisive, in making such... distributions in obedience to orders of the Securities and Exchange Commission) or to the corresponding...

  18. Transuranium Processing Plant semiannual report of production, status, and plans for period ending December 31, 1976

    International Nuclear Information System (INIS)

    King, L.J.; Bigelow, J.E.; Collins, E.D.

    1977-10-01

    During the period July 1, 1976, through December 31, 1976, transuranium elements were obtained from 11 irradiated HFIR targets; products recovered are 0.3 g 243 Am, 16.6 g 244 Cm, 23 g 249 Bk, 211 g 252 Cf, 1.15 mg 253 Es, and 0.4 pg 247 Fm. Two batches of high-purity 248 Cm were purified chemically for shipment, and another batch containing about 62 mg of 248 Cm was separated from 252 Cf. Thirty shipments were made from TRU during the period; recipients and the amounts of nuclides are listed in tabular form. Nine HFIR targets, each containing 8 to 9 g of curium, were fabricated. The sequence of chemical processing steps used to purify the californium product was changed; this change yielded a shorter recovery time for high-purity 253 Es, which enabled a 50% increase in the amount obtained. Eight neutron sources were fabricated during this report period, bringing the total fabricated to date to 92. Three sources that had previously been returned to TRU were reassigned; two others are also available for reassignment. The values currently being used for transuranium element decay data and for cross-section data in planning irradiation-processing cycles, calculating production forecasts, and assaying products are tabulated in the Appendix

  19. Julgamento Pelos Media: Policiamento, Ambiente Mediatico das Noticias 24/7 e a Politica da Indignacao (Portuguese translation of 'Trial By Media: Policing, The 24-7 News Mediasphere, And The Politics Of Outrage')

    OpenAIRE

    Greer, C.; McLaughlin, E.

    2012-01-01

    Este artigo analisa a natureza em mudança das relações entre os meios de comunicação social e a chefia da polícia. Com base em estudos prévios (Greer & McLaughlin, 2010), usamos os conceitos de «estrutura inferencial» (Lang & Lang, 1955) e «hierarquia da credibilidade» (Becker, 1967) para analisar o «julgamento pelos media» do antigo comissário do Serviço da Polícia Metropolitana (MPS), Sir Ian Blair. Centramo-nos na reação coletiva e fundamentalmente hostil por parte dos media à declaração d...

  20. Activities for Studying Ponds (Limnology), Grade Level 5-6. Environmental Education Series, Bulletin No. 247-D.

    Science.gov (United States)

    Montgomery County Public Schools, Rockville, MD.

    This bulletin is one in a series of environmental education activity guides for grades K-12, developed and field-tested by teachers in the Montgomery County (Maryland) Public Schools. Primarily for use in the middle grades four through six, the guides are not intended to constitute complete units in themselves. They are, rather, a compilation of…

  1. Testing oral proficiency: what does pronunciation tell us?DOI:10.5007/2175-8026.2011n60p247

    Directory of Open Access Journals (Sweden)

    Vanessa Borges-Almeida

    2011-10-01

    Full Text Available In this study we discuss the role of pronunciation in languagetesting and investigate two features of pronunciation of eightcandidates of the Test of Oral Proficiency in English (TEPOLIalong four bands of the test scale. Deviations in vowel segmentsand in syllable structure are analyzed. The results point to theneed for a global assessment of the candidates’ phonologicalsystems.

  2. 17 CFR 247.776 - Exemption from the definition of “broker” for banks effecting certain excepted or exempted...

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Exemption from the definition of âbrokerâ for banks effecting certain excepted or exempted transactions in a company's securities... AND EXCHANGE COMMISSION (CONTINUED) REGULATION R-EXEMPTIONS AND DEFINITIONS RELATED TO THE EXCEPTIONS...

  3. 17 CFR 247.775 - Exemption from the definition of “broker” for banks effecting certain excepted or exempted...

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Exemption from the definition of âbrokerâ for banks effecting certain excepted or exempted transactions in investment company... (CONTINUED) REGULATION R-EXEMPTIONS AND DEFINITIONS RELATED TO THE EXCEPTIONS FOR BANKS FROM THE DEFINITION...

  4. Retrospective analysis of hepatitis B virus chronic infection in 247 patients: clinical stages, response to treatment and poor prognostic factors

    Directory of Open Access Journals (Sweden)

    Marlone Cunha-Silva

    2017-07-01

    Conclusions: Elevations of viral load and serum alanine aminotransferase may select patients with worse prognosis, especially progression to cirrhosis and hepatocellular carcinoma, which were strongly association with death.

  5. 17 CFR 247.721 - Defined terms relating to the trust and fiduciary activities exception from the definition of...

    Science.gov (United States)

    2010-04-01

    ..., including, without limitation, a fee paid— (A) For personal services, tax preparation, or real estate...— (1) Providing transfer agent or sub-transfer agent services for beneficial owners of investment... shares; (3) Providing beneficial owners with account statements showing their purchases, sales, and...

  6. High-temperature low-cycle fatigue behaviour of HIP treated and untreated superalloy MAR-M247

    Czech Academy of Sciences Publication Activity Database

    Šulák, Ivo; Obrtlík, Karel; Čelko, L.

    2016-01-01

    Roč. 54, č. 6 (2016), s. 471-481 ISSN 0023-432X R&D Projects: GA TA ČR(CZ) TA04011525; GA ČR(CZ) GA15-20991S Institutional support: RVO:68081723 Keywords : hot isostatic pressing * high-temperature low cycle fatigue * fatigue life curves * Ni-based superalloy * dislocation structures * planar bands Subject RIV: JL - Materials Fatigue, Friction Mechanics Impact factor: 0.366, year: 2016

  7. Beverage consumption habits “24/7” among British adults: association with total water intake and energy intake

    Directory of Open Access Journals (Sweden)

    Gibson Sigrid

    2013-01-01

    Full Text Available Abstract Background Various recommendations exist for total water intake (TWI, yet it is seldom reported in dietary surveys. Few studies have examined how real-life consumption patterns, including beverage type, variety and timing relate to TWI and energy intake (EI. Methods We analysed weighed dietary records from the National Diet and Nutrition Survey of 1724 British adults aged 19–64 years (2000/2001 to investigate beverage consumption patterns over 24 hrs and 7 days and associations with TWI and EI. TWI was calculated from the nutrient composition of each item of food and drink and compared with reference values. Results Mean TWI was 2.53 L (SD 0.86 for men and 2.03 L (SD 0.71 for women, close to the European Food Safety Authority “adequate Intake” (AI of 2.5 L and 2 L, respectively. However, for 33% of men and 23% of women TWI was below AI and TWI:EI ratio was In multi-variable regression (adjusted for sex, age, body weight, smoking, dieting, activity level and mis-reporting, replacing 100 g of caloric beverages (milk, fruit juice, caloric soft drinks and alcohol with 100 g non-caloric drinks (diet soft drinks, hot beverages and water was associated with a reduction in EI of 15 kcal, or 34 kcal if food energy were unchanged. Using within-person data (deviations from 7-day mean each 100 g change in caloric beverages was associated with 29 kcal change in EI or 35 kcal if food energy were constant. By comparison the calculated energy content of caloric drinks consumed was 47 kcal/100 g. Conclusions TWI and beverage consumption are closely related, and some individuals appeared to have low TWI. Compensation for energy from beverages may occur but is partial. A better understanding of interactions between drinking and eating habits and their impact on water and energy balance would give a firmer basis to dietary recommendations.

  8. 78 FR 19413 - Listing of Color Additives Exempt From Certification; Reactive Blue 246 and Reactive Blue 247...

    Science.gov (United States)

    2013-04-01

    ... certification of these color additives is not necessary for the protection of the public health. IV. Public... DEPARTMENT OF HEALTH AND HUMAN SERVICES Food and Drug Administration 21 CFR Part 73 [Docket Nos. FDA-2011-C-0344 and FDA-2011-C-0463] Listing of Color Additives Exempt From Certification; Reactive...

  9. Social media: a teaching & learning experience with facebook : 24/7 Education in the 21st century

    NARCIS (Netherlands)

    Wim Oostindiër

    2012-01-01

    Presentatie in het kader van het project Opening Up. Opening Up is bedoeld om een betere dienstverlening aan burgers en bedrijven te zoeken door de inzet van social media en open data. Het Opening Up-project startte in oktober 2011 en duurt drie jaar. De Hanzehogeschool Groningen is een belangrijke

  10. Teaching and Learning 24/7 Using Twitter in a University Classroom: Experiences from a Developing Country

    Science.gov (United States)

    Chawinga, Winner Dominic

    2016-01-01

    It is understood that microblogging (tweeting) which is a form of Web 2.0, has been a centre of attraction in some institutions of higher education. However, despite its hype and pomp as reported by some scholars in developed countries, integration of Twitter in a classroom environment in developing countries is just beginning to flourish. In…

  11. F247. INTERNALIZED STIGMA HAS A STRONGER RELATIONSHIP WITH INTRINSIC MOTIVATION COMPARED TO AMOTIVATION IN EARLY PHASE AND PROLONGED SCHIZOPHRENIA

    Science.gov (United States)

    Firmin, Ruth; Luther, Lauren; Lysaker, Paul; Vohs, Jennifer

    2018-01-01

    Abstract Background Motivation deficits predict decreased functioning in schizophrenia. Recent work suggests deficits reflect challenges in separate domains: intrinsic motivation (one’s internal drive to engage in a behavior out of enjoyment or interest) and amotivation (one’s broader decrease in motivated behavior linked to avolition and anhedonia). Internalized stigma is another determinant of functioning for people with schizophrenia that may impact motivation. However, little is known about these relationships, including which aspects of motivation it may impact nor when these links emerge. Identifying the link between these constructs may help to identify whether internalized stigma may be a novel treatment target to facilitate improvements in motivation. Methods Forty adults with early phase schizophrenia and 66 adults with prolonged schizophrenia completed measures of internalized stigma, intrinsic motivation, and amotivation. Pearson’s correlations were examined followed by Fischer’s r-to-z transformations to compare differences in the magnitude of associations between internalized stigma and intrinsic motivation and internalized stigma and amotivation among the first episode and prolonged samples. Next, we conducted stepwise regressions to examine whether internalized stigma was associated with intrinsic motivation above and beyond associations with amotivation in each sample. Results In the early phase sample, the association between internalized stigma was greater with intrinsic motivation (r=-0.48, p=.00) compared to amotivation (r=0.27, p=0.10). Associations with internalized stigma in the prolonged sample were also greater with intrinsic motivation (r=-0.30, p=0.02) versus amotivation (r=0.19, p=0.12). The magnitude of the associations between internalized stigma and intrinsic motivation (z=1.03, p=0.15) and between internalized stigma and amotivation (z=0.41, p = 0.34) did not significantly differ when comparing phase of illness. Regression analyses indicated that, controlling for amotivation, internalized stigma predicted intrinsic motivation in both the prolonged sample (R2=0.09, F(1,64) =6.18, p=0.02) and the early phase schizophrenia sample (R2=0.23, F(1,37)=10.98, p=.00). Discussion Results suggest internalized stigma has a stronger relationship with intrinsic motivation separate from, and above and beyond, its association with amotivation. Findings support models of intrinsic and amotivation being distinct domains. Links between internalized stigma and motivation appear to emerge and persist from the early stages of schizophrenia, suggesting that targeting stigma in early intervention services may help to improve intrinsic motivation in people with schizophrenia.

  12. SU-E-T-247: Multi-Leaf Collimator Model Adjustments Improve Small Field Dosimetry in VMAT Plans

    Energy Technology Data Exchange (ETDEWEB)

    Young, L; Yang, F [University of Washington, Seattle, WA (United States)

    2014-06-01

    Purpose: The Elekta beam modulator linac employs a 4-mm micro multileaf collimator (MLC) backed by a fixed jaw. Out-of-field dose discrepancies between treatment planning system (TPS) calculations and output water phantom measurements are caused by the 1-mm leaf gap required for all moving MLCs in a VMAT arc. In this study, MLC parameters are optimized to improve TPS out-of-field dose approximations. Methods: Static 2.4 cm square fields were created with a 1-mm leaf gap for MLCs that would normally park behind the jaw. Doses in the open field and leaf gap were measured with an A16 micro ion chamber and EDR2 film for comparison with corresponding point doses in the Pinnacle TPS. The MLC offset table and tip radius were adjusted until TPS point doses agreed with photon measurements. Improvements to the beam models were tested using static arcs consisting of square fields ranging from 1.6 to 14.0 cm, with 45° collimator rotation, and 1-mm leaf gap to replicate VMAT conditions. Gamma values for the 3-mm distance, 3% dose difference criteria were evaluated using standard QA procedures with a cylindrical detector array. Results: The best agreement in point doses within the leaf gap and open field was achieved by offsetting the default rounded leaf end table by 0.1 cm and adjusting the leaf tip radius to 13 cm. Improvements in TPS models for 6 and 10 MV photon beams were more significant for smaller field sizes 3.6 cm or less where the initial gamma factors progressively increased as field size decreased, i.e. for a 1.6cm field size, the Gamma increased from 56.1% to 98.8%. Conclusion: The MLC optimization techniques developed will achieve greater dosimetric accuracy in small field VMAT treatment plans for fixed jaw linear accelerators. Accurate predictions of dose to organs at risk may reduce adverse effects of radiotherapy.

  13. Social media: a teaching & learning experience with facebook - 24/7 education in the 21st century

    NARCIS (Netherlands)

    Oostindiër, Wim

    2012-01-01

    Presentatie in het kader van het project Opening Up.
    Opening Up is bedoeld om een betere dienstverlening aan burgers en bedrijven te zoeken door de inzet van social media en open data. Het Opening Up-project startte in oktober 2011 en duurt drie jaar. De Hanzehogeschool Groningen is een

  14. 49 CFR 40.247 - What procedures does the BAT or STT follow after a screening test result?

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 1 2010-10-01 2010-10-01 false What procedures does the BAT or STT follow after a... What procedures does the BAT or STT follow after a screening test result? (a) If the test result is an alcohol concentration of less than 0.02, as the BAT or STT, you must do the following: (1) Sign and date...

  15. Synthesis of new heterocyclic compounds using 2-(4,7-dichloro-3,3-dimethyl-indolin-2-ylidenemalonaldehyde

    Directory of Open Access Journals (Sweden)

    Razieh Mohammadnejad Aghdam

    2013-01-01

    Full Text Available 1-(2,5-Dichlorophenylhydrazine was converted via Fischer synthesis with isopropylmethylketone into 4,7-dichloro-2,3,3-trimethyl-3H-indole. Exposure of the indolenine to the vilsmeier reagent produced amino methylene malondialdehyde which reacted with hydrazine, arylhydrazine, urea, cyanoacetamide and thiourea to give pyrazols, pyrimidones and thiopyrimidone, respectively.

  16. 78 FR 46315 - Foreign-Trade Zone (FTZ) 247-Erie, Pennsylvania, Notification of Proposed Production Activity, GE...

    Science.gov (United States)

    2013-07-31

    ...; pressure valves; drain valves; fuel injectors; cock valve handles; fuel injector nozzles; bearings; tapered... locomotives and off-highway vehicles; drill equipment; marine equipment; stationary equipment; diesel...; brackets; latch assemblies; supports; blocks; bracket assemblies; holders; conduit assemblies; diesel...

  17. 48 CFR 52.247-55 - F.o.b. Point for Delivery of Government-Furnished Property.

    Science.gov (United States)

    2010-10-01

    ... specified destination. (b) If the destination of the Government-furnished property is a Contractor's plant... equipment, supplies, and property, including all property not returned in the form of acceptable end items... plant, the Contracting Officer may direct the Contractor to deliver the Government property being...

  18. 48 CFR 247.573-1 - Ocean transportation incidental to a contract for supplies, services, or construction.

    Science.gov (United States)

    2010-10-01

    ... and financial considerations. (ii) The contracting officer must forward the report to— (A) The... format, and must— (A) Take into consideration that the 1904 Act is, in part, a subsidy of the U.S.-flag...

  19. 17 CFR 247.701 - Exemption from the definition of “broker” for certain institutional referrals.

    Science.gov (United States)

    2010-04-01

    ... vivos or living trust the settlor of which is a natural person who, either individually or jointly with... customer means any corporation, partnership, limited liability company, trust or other non-natural person... value of the Personal Consumption Expenditures Chain-Type Price Index (or any successor index thereto...

  20. 17 CFR 247.760 - Exemption from definition of “broker” for banks accepting orders to effect transactions in...

    Science.gov (United States)

    2010-04-01

    ... brokerage accounts or that the bank's safekeeping and custody services substitute for a securities brokerage... custodian bank that contracted with the administrator or recordkeeper bank for services. (f) Subcustodians...

  1. Beverage consumption habits "24/7" among British adults: association with total water intake and energy intake.

    Science.gov (United States)

    Gibson, Sigrid; Shirreffs, Susan M

    2013-01-10

    Various recommendations exist for total water intake (TWI), yet it is seldom reported in dietary surveys. Few studies have examined how real-life consumption patterns, including beverage type, variety and timing relate to TWI and energy intake (EI). We analysed weighed dietary records from the National Diet and Nutrition Survey of 1724 British adults aged 19-64 years (2000/2001) to investigate beverage consumption patterns over 24 hrs and 7 days and associations with TWI and EI. TWI was calculated from the nutrient composition of each item of food and drink and compared with reference values. Mean TWI was 2.53 L (SD 0.86) for men and 2.03 L (SD 0.71) for women, close to the European Food Safety Authority "adequate Intake" (AI) of 2.5 L and 2 L, respectively. However, for 33% of men and 23% of women TWI was below AI and TWI:EI ratio was Beverages accounted for 75% of TWI. Beverage variety was correlated with TWI (r 0.34) and more weakly with EI (r 0.16). Beverage consumption peaked at 0800 hrs (mainly hot beverages/ milk) and 2100 hrs (mainly alcohol). Total beverage consumption was higher at weekends, especially among men. Overall, beverages supplied 16% of EI (men 17%, women 14%), alcoholic drinks contributed 9% (men) and 5% (women), milk 5-6%, caloric soft drinks 2%, and fruit juice 1%.In multi-variable regression (adjusted for sex, age, body weight, smoking, dieting, activity level and mis-reporting), replacing 100 g of caloric beverages (milk, fruit juice, caloric soft drinks and alcohol) with 100 g non-caloric drinks (diet soft drinks, hot beverages and water) was associated with a reduction in EI of 15 kcal, or 34 kcal if food energy were unchanged. Using within-person data (deviations from 7-day mean) each 100 g change in caloric beverages was associated with 29 kcal change in EI or 35 kcal if food energy were constant. By comparison the calculated energy content of caloric drinks consumed was 47 kcal/100 g. TWI and beverage consumption are closely related, and some individuals appeared to have low TWI. Compensation for energy from beverages may occur but is partial. A better understanding of interactions between drinking and eating habits and their impact on water and energy balance would give a firmer basis to dietary recommendations.

  2. Beverage consumption habits “24/7” among British adults: association with total water intake and energy intake

    Science.gov (United States)

    2013-01-01

    Background Various recommendations exist for total water intake (TWI), yet it is seldom reported in dietary surveys. Few studies have examined how real-life consumption patterns, including beverage type, variety and timing relate to TWI and energy intake (EI). Methods We analysed weighed dietary records from the National Diet and Nutrition Survey of 1724 British adults aged 19–64 years (2000/2001) to investigate beverage consumption patterns over 24 hrs and 7 days and associations with TWI and EI. TWI was calculated from the nutrient composition of each item of food and drink and compared with reference values. Results Mean TWI was 2.53 L (SD 0.86) for men and 2.03 L (SD 0.71) for women, close to the European Food Safety Authority “adequate Intake” (AI) of 2.5 L and 2 L, respectively. However, for 33% of men and 23% of women TWI was below AI and TWI:EI ratio was Beverages accounted for 75% of TWI. Beverage variety was correlated with TWI (r 0.34) and more weakly with EI (r 0.16). Beverage consumption peaked at 0800 hrs (mainly hot beverages/ milk) and 2100 hrs (mainly alcohol). Total beverage consumption was higher at weekends, especially among men. Overall, beverages supplied 16% of EI (men 17%, women 14%), alcoholic drinks contributed 9% (men) and 5% (women), milk 5-6%, caloric soft drinks 2%, and fruit juice 1%. In multi-variable regression (adjusted for sex, age, body weight, smoking, dieting, activity level and mis-reporting), replacing 100 g of caloric beverages (milk, fruit juice, caloric soft drinks and alcohol) with 100 g non-caloric drinks (diet soft drinks, hot beverages and water) was associated with a reduction in EI of 15 kcal, or 34 kcal if food energy were unchanged. Using within-person data (deviations from 7-day mean) each 100 g change in caloric beverages was associated with 29 kcal change in EI or 35 kcal if food energy were constant. By comparison the calculated energy content of caloric drinks consumed was 47 kcal/100 g. Conclusions TWI and beverage consumption are closely related, and some individuals appeared to have low TWI. Energy from beverages may be partly compensated. A better understanding of interactions between drinking and eating habits and their impact on water and energy balance would give a firmer basis to dietary recommendations. PMID:23305461

  3. Freeze drying method for preparing radiation source material

    International Nuclear Information System (INIS)

    Mosley, W.C.; Smith, P.K.

    1976-01-01

    Fabrication of a neutron source is specifically claimed. A palladium/californium solution is freeze dried to form a powder which, through conventional powder metallurgy, is shaped into a source containing the californium evenly distributed through a palladium metal matrix. (E.C.B.)

  4. SU-F-T-247: Collision Risks in a Modern Radiation Oncology Department: An Efficient Approach to Failure Modes and Effects Analysis

    Energy Technology Data Exchange (ETDEWEB)

    Schubert, L; Westerly, D; Vinogradskiy, Y; Fisher, C; Liu, A [University of Colorado Denver, Aurora, CO (United States); Aldridge, J [University of Colorado Hospital, Aurora, CO (United States)

    2016-06-15

    Purpose: Collisions between treatment equipment and patients are potentially catastrophic. Modern technology now commonly involves automated remote motion during imaging and treatment, yet a systematic assessment to identify and mitigate collision risks has yet to be performed. Failure modes and effects analysis (FMEA) is a method of risk assessment that has been increasingly used in healthcare, yet can be resource intensive. This work presents an efficient approach to FMEA to identify collision risks and implement practical interventions within a modern radiation therapy department. Methods: Potential collisions (e.g. failure modes) were assessed for all treatment and simulation rooms by teams consisting of physicists, therapists, and radiation oncologists. Failure modes were grouped into classes according to similar characteristics. A single group meeting was held to identify implementable interventions for the highest priority classes of failure modes. Results: A total of 60 unique failure modes were identified by 6 different teams of physicists, therapists, and radiation oncologists. Failure modes were grouped into four main classes: specific patient setups, automated equipment motion, manual equipment motion, and actions in QA or service mode. Two of these classes, unusual patient setups and automated machine motion, were identified as being high priority in terms severity of consequence and addressability by interventions. The two highest risk classes consisted of 33 failure modes (55% of the total). In a single one hour group meeting, 6 interventions were identified. Those interventions addressed 100% of the high risk classes of failure modes (55% of all failure modes identified). Conclusion: A class-based approach to FMEA was developed to efficiently identify collision risks and implement interventions in a modern radiation oncology department. Failure modes and interventions will be listed, and a comparison of this approach against traditional FMEA methods will be presented.

  5. SU-F-T-247: Collision Risks in a Modern Radiation Oncology Department: An Efficient Approach to Failure Modes and Effects Analysis

    International Nuclear Information System (INIS)

    Schubert, L; Westerly, D; Vinogradskiy, Y; Fisher, C; Liu, A; Aldridge, J

    2016-01-01

    Purpose: Collisions between treatment equipment and patients are potentially catastrophic. Modern technology now commonly involves automated remote motion during imaging and treatment, yet a systematic assessment to identify and mitigate collision risks has yet to be performed. Failure modes and effects analysis (FMEA) is a method of risk assessment that has been increasingly used in healthcare, yet can be resource intensive. This work presents an efficient approach to FMEA to identify collision risks and implement practical interventions within a modern radiation therapy department. Methods: Potential collisions (e.g. failure modes) were assessed for all treatment and simulation rooms by teams consisting of physicists, therapists, and radiation oncologists. Failure modes were grouped into classes according to similar characteristics. A single group meeting was held to identify implementable interventions for the highest priority classes of failure modes. Results: A total of 60 unique failure modes were identified by 6 different teams of physicists, therapists, and radiation oncologists. Failure modes were grouped into four main classes: specific patient setups, automated equipment motion, manual equipment motion, and actions in QA or service mode. Two of these classes, unusual patient setups and automated machine motion, were identified as being high priority in terms severity of consequence and addressability by interventions. The two highest risk classes consisted of 33 failure modes (55% of the total). In a single one hour group meeting, 6 interventions were identified. Those interventions addressed 100% of the high risk classes of failure modes (55% of all failure modes identified). Conclusion: A class-based approach to FMEA was developed to efficiently identify collision risks and implement interventions in a modern radiation oncology department. Failure modes and interventions will be listed, and a comparison of this approach against traditional FMEA methods will be presented.

  6. Unveiling stomata 24/7: can we use carbonyl sulfide (COS) and oxygen isotopes (18O) to constrain estimates of nocturnal transpiration across different evolutionary plant forms?

    Science.gov (United States)

    Gimeno, Teresa E.; Ogee, Jerome; Bosc, Alexander; Genty, Bernard; Wohl, Steven; Wingate, Lisa

    2015-04-01

    Numerous studies have reported a continued flux of water through plants at night, suggesting that stomata are not fully closed. Growing evidence indicates that this nocturnal flux of transpiration might constitute an important fraction of total ecosystem water use in certain environments. However, because evaporative demand is usually low at night, nocturnal transpiration fluxes are generally an order of magnitude lower than rates measured during the day and perilously close to the measurement error of traditional gas-exchange porometers. Thus estimating rates of stomatal conductance in the dark (gnight) precisely poses a significant methodological challenge. As a result, we lack accurate field estimates of gnight and how it responds to different atmospheric drivers, indicating the need for a different measurement approach. In this presentation we propose a novel method to obtain detectable and robust estimates of gnight. We will demonstrate using mechanistic theory how independent tracers including the oxygen isotope composition of CO2 (δ18O) and carbonyl sulfide (COS) can be combined to obtain robust estimates of gnight. This is because COS and CO18O exchange within leaves are controlled by the light insensitive enzyme carbonic anhydrase. Thus, if plant stomata are open in the dark we will continue to observe COS and CO18O exchange. Using our theoretical model we will demonstrate that the exchange of these tracers can now be measured using advances in laser spectrometry techniques at a precision high enough to determine robust estimates of gnight. We will also present our novel experimental approach designed to measure simultaneously the exchange of CO18O and COS alongside the conventional technique that relies on measuring the total water flux from leaves in the dark. Using our theoretical approach we will additionally explore the feasibility of our proposed experimental design to detect variations in gnight during drought stress and across a variety of plant types that have evolved diverse strategies to control water loss from leaf tissues.

  7. SU-E-T-247: Determinations of the Optimal Phase for Respiratory Gated Radiotherapy From Statistical Analysis Using a Visible Guidance System

    Energy Technology Data Exchange (ETDEWEB)

    Oh, S; Yea, J; Kang, M; Lee, H; Kim, S [Yeungnam University Medical Center, Daegu, Daegu (Korea, Republic of)

    2015-06-15

    Purpose: Respiratory gated radiation therapy (RGRT) is used to minimize the radiation dose to normal tissue in lung cancer patients. Determination of the optimal point in the respiratory phase of a patient is important in RGRT but it is not easy. The goal of the present study was to see if a visible guidance system is helpful in determining the optimal phase in respiratory gated therapy. Methods: The breathing signals of 23 lung cancer patients were recorded with a Real-time Position Management (RPM) respiratory gating system (Varian, USA). The patients underwent breathing training with our visible guidance system, after which their breathing signals were recorded during 5 min of free breathing and 5 min of guided breathing. The breathing signals recorded between 3 and 5 min before and after training were compared. We performed statistical analysis of the breathing signals to find the optimal duty cycle in guided breathing for RGRT. Results: The breathing signals aided by the visible guidance system had more regular cycles over time and smaller variations in the positions of the marker block than the free breathing signals. Of the 23 lung cancer patients, 19 showed statistically significant differences by time when the values obtained before and after breathing were compared (p < 0.05); 30% and 40% of the duty cycle, respectively, was determined to be the most effective, and the corresponding phases were 30 60% (duty cycle, 30%; p < 0.05) and 30 70% (duty cycle, 40%; p < 0.05). Conclusion: Respiratory regularity was significantly improved with the use of the RPM with our visible guiding system; therefore, it would help improve the accuracy and efficiency of RGRT.

  8. Non-destructive examinations of D247.01 SiC-ball. Gamma scan wires 1 and 2 and SiC-ball 1 through 7

    Energy Technology Data Exchange (ETDEWEB)

    Dassel, G.; Buurveld, H.A.; Plakman, J.C.

    1996-07-01

    In the frame of the KFA programme on Innovative Nuclear Technology SiC-coated graphite spheres have been irradiated in the HFR Petten. With this irradiation two stainless steel gamma scan wires have been irradiated to be able to reconstruct the neutron flux profile during the irradiation and to calculate the absorption of neutrons in the spheres. This report presents the results from the gamma scanning of the two gamma scan wires. Appended are the results from dose rate measurements and weighing of the spheres and gamma spectrometric results from balls 5 and 6. (orig.).

  9. Non-destructive examinations of D247.01 SiC-ball. Gamma scan wires 1 and 2 and SiC-ball 1 through 7

    International Nuclear Information System (INIS)

    Dassel, G.; Buurveld, H.A.; Plakman, J.C.

    1996-07-01

    In the frame of the KFA programme on Innovative Nuclear Technology SiC-coated graphite spheres have been irradiated in the HFR Petten. With this irradiation two stainless steel gamma scan wires have been irradiated to be able to reconstruct the neutron flux profile during the irradiation and to calculate the absorption of neutrons in the spheres. This report presents the results from the gamma scanning of the two gamma scan wires. Appended are the results from dose rate measurements and weighing of the spheres and gamma spectrometric results from balls 5 and 6. (orig.)

  10. "I'm on it 24/7 at the moment": A qualitative examination of multi-screen viewing behaviours among UK 10-11 year olds

    Directory of Open Access Journals (Sweden)

    Cillero Itziar

    2011-08-01

    Full Text Available Abstract Background Screen-viewing has been associated with increased body mass, increased risk of metabolic syndrome and lower psychological well-being among children and adolescents. There is a shortage of information about the nature of contemporary screen-viewing amongst children especially given the rapid advances in screen-viewing equipment technology and their widespread availability. Anecdotal evidence suggests that large numbers of children embrace the multi-functionality of current devices to engage in multiple forms of screen-viewing at the same time. In this paper we used qualitative methods to assess the nature and extent of multiple forms of screen-viewing in UK children. Methods Focus groups were conducted with 10-11 year old children (n = 63 who were recruited from five primary schools in Bristol, UK. Topics included the types of screen-viewing in which the participants engaged; whether the participants ever engaged in more than one form of screen-viewing at any time and if so the nature of this multiple viewing; reasons for engaging in multi-screen-viewing; the room within the house where multi-screen-viewing took place and the reasons for selecting that room. All focus groups were transcribed verbatim, anonymised and thematically analysed. Results Multi-screen viewing was a common behaviour. Although multi-screen viewing often involved watching TV, TV viewing was often the background behaviour with attention focussed towards a laptop, handheld device or smart-phone. There were three main reasons for engaging in multi-screen viewing: 1 tempering impatience that was associated with a programme loading; 2 multi-screen facilitated filtering out unwanted content such as advertisements; and 3 multi-screen viewing was perceived to be enjoyable. Multi-screen viewing occurred either in the child's bedroom or in the main living area of the home. There was considerable variability in the level and timing of viewing and this appeared to be a function of whether the participants attended after-school clubs. Conclusions UK children regularly engage in two or more forms of screen-viewing at the same time. There are currently no means of assessing multi-screen viewing nor any interventions that specifically focus on reducing multi-screen viewing. To reduce children's overall screen-viewing we need to understand and then develop approaches to reduce multi-screen viewing among children.

  11. 17 CFR 247.740 - Defined terms relating to the sweep accounts exception from the definition of “broker.”

    Science.gov (United States)

    2010-04-01

    ... securities for sales or sales promotion expenses, for personal service, or for the maintenance of shareholder... investment company's securities for sales or sales promotion expenses, for personal service, or for the... sales load has the same meaning as in 17 CFR 270.6c-10. (b) Money market fund means an open-end company...

  12. Erratum: International Journal of Global Energy Issues, Vol. 13, Nos. 1-3, 2000, p.247. Bent Soerensen and Peter Meibom 'A global renewable energy scenario'

    International Nuclear Information System (INIS)

    2001-01-01

    5.1 ecentralised renewable energy 2050 scenario. The demand categories have already, as shown in Table 6, been simplified under the assumption of an abundant fraction of the supply being in the form of electric energy. We now determine the sources of supply for each demand type. For the vegetable food-fraction, the results of comparing local supply and demand are shown in Figures 38 and 39, where Figure 38 shows the amount of surplus for those geographical grid cells, where supply exceeds demand, and Figure 39 shows the amount of deficit for those local cells where demand exceeds supply. Regional sums are given in Table 10, while the sums of individual contributions to demand and supply are given in Tables 6 and 8. It follows that on average, worldwide supply exceeds demand by 35%. This must be considered reasonable, as there has to be room for variations in crop harvests and thus food production from year to year, and further the transportation required for evening out supply and demand will entail some additional losses. Like today, there is surplus vegetable food production in the Americas and Western Europe (regions 1, 2 and 4), and by the year 2050 also in region 3 (including Russia), due to substantial improvements in agricultural practices assumed for this region. Region 5 (including China and India) will be just self-sufficient by the year 2050, whereas Africa (region 6) will have a deficit that must be covered by imports. In the scenario, Africa is the only region that by 2050 is in a development situation where it may offer labour at lower expense that the other regions, and thus there will be the possibility of paying for food imports by industrial revenues, provided that an education policy is pursued, that will give the workforce the necessary skills. In addition to inter-regional exchange, Figures 38 and 39 indicate scenario requirements for transport of vegetable food within regions, especially from farming areas into cities. The scenario assumptions for inter-regional trade in food is indicated in Figures 55-60, where the regional exports have been selected from the surpluses available. The substantial needs for both vegetable and animal foods in Africa are uniformly imported from regions 1-4. (author)

  13. Diversidade e diferenciação pela pesquisa universitária - doi: 10.5007/2175-795X.2010v28n1p247

    Directory of Open Access Journals (Sweden)

    Célia Elizabete Caregnato

    2010-06-01

    Full Text Available Os sistemas nacionais de Ensino Superior são diversi! cados e complexos, o que cria condições para a produção de pesquisa e de conhecimento pelas instituições com variados graus de abrangência e de repercussão. O presente artigo registra a construção de um caminho para a análise da relação entre a diversidade institucional e a atividade de pesquisa. Ao se interpretar a diferenciação de características das instituições de mesma natureza, contribui-se para o conhecimento do sistema de Ensino Superior. Recorre-se à metodologia de análise weberiana do tipo-ideal, sem, portanto, proporem-se modelos para classi! car as instituições reais ou os modelos ideais a serem atingidos.

  14. Coronary risk factors in Norwegian Seventh-day Adventists: a study of 247 Seventh-day Adventists and matched controls. The Cardiovascular Disease Studies in Norway.

    Science.gov (United States)

    Fønnebø, V

    1992-03-01

    Coronary risk factors in Seventh-day Adventists were compared with those in non-Seventh-day Adventist matched controls in the Norwegian Cardiovascular Disease Studies, 1973-1987. Only 10% of the Seventh-day Adventists were smokers (p less than 0.001) and serum cholesterol was 0.86 mmol/liter (95% confidence interval (CI) 0.59-1.13) lower in men and 0.48 mmol/liter (95% CI 0.25-0.71) lower in women. Blood pressure was significantly lower only in women. Ex-members of the Seventh-day Adventist Church and members who did not comply with the recommended life-style had a risk factor level significantly higher than Seventh-day Adventists who complied with the life-style.

  15. Effect of tensile dwell on high-temperature low-cycle fatigue and fracture behaviour of cast superalloy MAR-M247

    Czech Academy of Sciences Publication Activity Database

    Šulák, Ivo; Obrtlík, Karel

    2017-01-01

    Roč. 185, NOV (2017), s. 92-100 ISSN 0013-7944. [ICMFM 2016 - International Colloquium on Mechanical Fatigue of Metals /18./. Gijón, 05.09.2016-07.09.2016] R&D Projects: GA ČR(CZ) GA15-20991S Institutional support: RVO:68081723 Keywords : Nickel-based superalloy * High-temperature low-cycle fatigue * Tensile dwell * Fatigue life * Damage mechanisms Subject RIV: JL - Materials Fatigue, Friction Mechanics OBOR OECD: Audio engineering , reliability analysis Impact factor: 2.151, year: 2016

  16. Radionuclides in rodents

    International Nuclear Information System (INIS)

    Taylor, G.N.

    1985-01-01

    Studies are being conducted in mice comparing the toxicity of radium-226, plutonium-239, americium-241, californium-249 and californium-252 in C57B1/Do (albino) mice and the toxicity of americium-241, plutonium-239 and radium-226 in deer mice (Peromyscus maniculatus) and grasshopper mice (Onychomys leucogaster). These experiments will ultimately enable comparison of the toxicity of the above actinide toxicity in man to be made using radium toxicity as the baseline

  17. Improvement activities to soil stabilization near Bolivia-Brazil gas pipeline crossing through an embankment over a corrugated drainage pipe, at Km 247 in Mato Grosso do Sul, Brazil; Melhorias para estabilidade do gasoduto Bolivia-Brasil em cruzamento de aterro sobre tubo de drenagem tipo ARMCO, no km 247 em Mato Grosso do Sul

    Energy Technology Data Exchange (ETDEWEB)

    Jorge, Kemal Vieira [TBG - Transportadora Brasileira Gasoduto Bolivia Brasil S.A., Rio de Janeiro, RJ (Brazil); Costa, Cesar Augusto [TBG - Transportadora Brasileira Gasoduto Bolivia Brasil S.A., Campo Grande, MS (Brazil). Gerencia Regional Centro Oeste (CRGO)

    2005-07-01

    A hundred and seventy kilometers from Campo Grande city, on Mato Grosso do Sul State, the Brasil-Bolivia Gas Pipeline crosses a 8,5 meters high landfill, over a drainage systems made of a 2,8 meters of diameter corrugated pipe. This drainage pipe was installed to allow the drainage of the valley, and the landfill above it was built so the Gas pipeline could cross easier the 80 meters deep and 30 degree vertices valley. This paper illustrates the work tasks and solutions taken to monitor and guarantee the integrity of the drainage and landfill structures, as well as the integrity of the Gas Pipeline. Some of the work tasks illustrated are the investigation of the support conditions of the Gas Pipeline, the analysis of a drainage system under the pipeline, on a rocky soil, the analysis of the stability of the landfill, the construction of a gravity retaining walls and the monitoring of the deformations on the drainage pipe. (author)

  18. Work/Family Balancing and 24/7 Work Schedules: Network Analysis of Strategies in a Transport Company Cleaning Service: Concilier travail-famille et horaires 24/7: analyse réseau des stratégies au sein du service de nettoyage d'une compagnie de transport.

    Science.gov (United States)

    Lefrançois, Mélanie; Saint-Charles, Johanne; Riel, Jessica

    2017-11-01

    Whether or not official work/family balance measures exist within an organization, scheduling accommodations often go through informal channels involving colleagues and superiors and are negotiated within interpersonal relationships. This study examines the relationship dimensions of the scheduling strategies of cleaners working atypical hours in the transport sector through the lenses of ergonomic activity, network, and gender analyses. Using semi-directed interviews, observation, and network analysis, we revealed the effect of gender on relationship dynamics and the influence of these dynamics on work/family balance strategies deployed by cleaners. One of the main contributions of this study is to demonstrate the decisive effect of relationships by revealing inequalities in access to organizational social networks. Creating spaces to discuss work/family balancing and a more equitable circulation of information could contribute to reducing inequalities associated with gender, social status, and family responsibilities and support the work/family strategies developed by workers dealing with restrictive work schedules. Résumé Les accommodements du temps de travail pour la conciliation travail-famille (CTF) passent souvent par des ententes informelles qui s'inscrivent dans les relations entre collègues ou avec des gestionnaires. Notre étude, intégrant l'ergonomie et la communication dans une perspective de genre, porte sur les dimensions relationnelles des stratégies de choix d'horaire d'agentes et agents de nettoyage devant composer avec des horaires atypiques dans le secteur des transports. À partir d'entretiens semi-dirigés, d'observations et d'analyse de réseaux, nous avons pu observer l'influence des dynamiques relationnelles, notamment de genre, sur les stratégies de CTF. Un apport central de cette étude est de montrer l'effet structurant des relations en révélant notamment des inégalités dans l'accès aux ressources facilitant le choix d'horaire, mais aussi dans l'inclusion au sein du réseau de relations. L'article conclut en proposant des pistes de solutions concrètes pour la réduction de ces inégalités.

  19. Trends in radioisotope development and utilization in the United States

    Energy Technology Data Exchange (ETDEWEB)

    Mott, W E [Energy Research and Development Administration, Washington, D.C. (USA)

    1976-06-01

    The current trends in radioisotope and radiation technology in the United States are overviewed with emphasis on the developments since the 1973 Conference. The comments focus primarily on the research and development activities receiving the most attention today from the various agencies of the Government. Among the many available radionuclides, technetium-99m has played the single most important role for making possible the developments in the field of nuclear medicine. Many other short lived medium-lived nuclides are applied in the fields of nuclear medicine, cardiac pacemaker, artificial heart, and blood irradiator. Radiation processing is now firmly established in the United States. The trends in sewage treatment, polymer-impregnated materials, bioengineering, and food irradiation are reviewed. The programs for californium-252, strontium-90, cesium-137, plutonium-238, and krypton-85 are also reviewed. The author concludes this paper with the acknowledgement that Japanese researchers have contributed to and have been closely involved in many of the programs discussed. Of particular note is the participation in the clinical phase of the californium-252 radiotherapy program. Several Japanese hospitals have been cooperating with the United States since the very beginning of the californium-252 program in determining the value of the californium-252 neutron therapy. The research being performed is unique, and will contribute greatly to the decisions on the ultimate future of californium-252 for therapeutic purposes.

  20. Quantum-chemical consideration of extermal valent forms of actinides

    International Nuclear Information System (INIS)

    Ionova, G.V.; Pershina, V.G.; Spitsyn, V.I.

    1982-01-01

    Stability of valent forms of actinides that has not yet studied experimentally, is considered within the framework of quantum-chemical considerations. Oxidizing potentials E 0 for actinide elements are determined theoretically. A dependence of the definite valent state stability on relativistic effect is shown. A conclusion is made that oxidizing potential E 0 (4-5) for americium should be higher than E 0 (4-5) for plutonium. A relatively small oxidizing potential E 0 (4-5) for curium speaks about principle possibility of production of five-valent curium in solution, though it is less stable than the six-valent one. Oxidizing potential corresponding to transition of three-valent californium into the four-valent state should be less than the value adopted in literature. A relatively small oxidizing potential of californium E 0 (4-5) speaks about possible existence of five-valent californium in solution

  1. Comments on the paper 'Phase diagram calculations of the U-Pu-N system with carbon and oxygen impurities', by D.D. Sood, R. Agarwal, V. Venugopal, ibid., vol.247, p.299, 1997

    International Nuclear Information System (INIS)

    Jain, G.C.

    1998-01-01

    We published a paper entitled 'Experimental evaluation of oxygen solubility in UN, PuN and (U,Pu)N' authored by G.C. Jain and C. Ganguly (1993). Oxygen solubility limits were experimentally determined from lattice parameter and composition of the phases. The lattice parameter was determined from X-ray diffraction measurement and the composition was evaluated from chemical analysis results. Sood et al. have m[e some comments on a part of our data on the UNCO and PuNCO systems in the last two paragraphs in the chapter of Results and discussion on p. 299 of their above cited paper. In this context, the following comments are offered. (orig.)

  2. Cultura corporal na pauta do jornal: notas de uma análise a partir do "Programa AN Escola"doi: 10.5007/2175-8042.2010v22n35p247

    Directory of Open Access Journals (Sweden)

    Daniel Minuzzi de Souza

    2010-01-01

    Full Text Available Este estudo objetivou apresentar elementos de uma análise de um programa de jornal escolar, em que identificamos matérias referentes aos conteúdos da cultura corporal. Para tanto, utilizamos procedimentos de análise de conteúdo para analisar o suplemento AN Escola, tendo o recorte temporal de 2004-2008. Nesse corpus identificamos a presença de conteúdos da cultura corporal em 1145 matérias que foram distribuídas em 11 categorias (Esporte, Temas transversais, Lazer, Corpo/identidade, Jogos/brincadeiras, Saúde, Estética, Circo, Dança, Lutas, e Outros. As conclusões apontam indícios de o Programa AN Escola tratar-se de mais uma estratégia de marketing institucional do que ser um programa que promove mídia-educação, apesar dessa possibilidade.

  3. «Julgamento pelos media»: policiamento, ambiente mediático das notícias 24/7 e a «política da indignação»

    OpenAIRE

    Greer, Chris; McLaughlin, Eugene

    2012-01-01

    Este artigo analisa a natureza em mudança das relações entre os meios de comunicação social e a chefia da polícia. Com base em estudos prévios (Greer & McLaughlin, 2010), usamos os conceitos de «estrutura inferencial» (Lang & Lang, 1955 e «hierarquia da credibilidade» (Becker, 1967) para analisar o «julgamento pelos media» do antigo comissário do Serviço da Polícia Metropolitana (MPS), Sir Ian Blair. Centramo-nos na reação coletiva e fundamentalmente hostil por parte dos media à declaração de...

  4. A Review of the Literature on Social and Emotional Learning for Students Ages 3-8: Teacher and Classroom Strategies that Contribute to Social and Emotional Learning (Part 3 of 4). REL 2017-247

    Science.gov (United States)

    O'Conner, Rosemarie; De Feyter, Jessica; Carr, Alyssa; Luo, Jia Lisa; Romm, Helen

    2017-01-01

    Social and emotional learning (SEL) is the process by which children and adults learn to understand and manage emotions, maintain positive relationships, and make responsible decisions. This is the third in a series of four related reports about what is known about SEL programs for students ages 3-8. The report series addresses four issues raised…

  5. Source storage and transfer cask: Users Guide

    International Nuclear Information System (INIS)

    Eccleston, G.W.; Speir, L.G.; Garcia, D.C.

    1985-04-01

    The storage and shield cask for the dual californium source is designed to shield and transport up to 3.7 mg (2 Ci) of 252 Cf. the cask meets Department of Transportation (DOT) license requirements for Type A materials (DOT-7A). The cask is designed to transfer sources to and from the Flourinel and Fuel Storage (FAST) facility delayed-neutron interrogator. Californium sources placed in the cask must be encapsulated in the SR-CF-100 package and attached to Teleflex cables. The cask contains two source locations. Each location contains a gear box that allows a Teleflex cable to be remotely moved by a hand crank into and out of the cask. This transfer procedure permits sources to be easily removed and inserted into the delayed-neutron interrogator and reduces personnel radiation exposure during transfer. The radiation dose rate with the maximum allowable quantity of californium (3.7 mg) in the cask is 30 mR/h at the surface and less than 2 mR/h 1 m from the cask surface. This manual contains information about the cask, californium sources, describes the method to ship the cask, and how to insert and remove sources from the cask. 28 figs

  6. Neutron spectra from radionuclide sources for cardiac pacemakers

    International Nuclear Information System (INIS)

    Kluge, H.

    1975-01-01

    Neutron spectra from Plutonium 238 radioisotope batteries powering cardiac pacemakers are measured in the energy range above 0.7 MeV. The results are used to calculate radiation doses within a cylindrical phantom. There are only minor differences between the different types of plutonium 238-batteries and californium 252-batteries

  7. Validation of the MCNP-DSP Monte Carlo code for calculating source-driven noise parameters of subcritical systems

    International Nuclear Information System (INIS)

    Valentine, T.E.; Mihalczo, J.T.

    1995-01-01

    This paper describes calculations performed to validate the modified version of the MCNP code, the MCNP-DSP, used for: the neutron and photon spectra of the spontaneous fission of californium 252; the representation of the detection processes for scattering detectors; the timing of the detection process; and the calculation of the frequency analysis parameters for the MCNP-DSP code

  8. Magnetic measurements of the transuranium elements. Progress report, January 1, 1984-December 31, 1984

    International Nuclear Information System (INIS)

    Huray, P.G.; Nave, S.E.

    1984-01-01

    Measurements of the magnetic properties of dhcp californium-249 metal indicated the presence of three regions of differing magnetic character. Additional measurements are also reported. Magnetic moments and valence states of terbium in TbF 3 , BaTbO 3 , and TbO 1 8 are discussed. Progress on high-field operation of the micro-magnetic susceptometer is reported

  9. Single-event burnout of power MOSFET devices for satellite application

    International Nuclear Information System (INIS)

    Xue Yuxiong; Tian Kai; Cao Zhou; Yang Shiyu; Liu Gang; Cai Xiaowu; Lu Jiang

    2008-01-01

    Single-event burnout (SEB) sensitivity was tested for power MOSFET devices, JTMCS081 and JTMCS062, which were made in Institute of Microelectronics, Chinese Academy of Sciences, using californium-252 simulation source. SEB voltage threshold was found for devices under test (DUT). It is helpful for engineers to choose devices used in satellites. (authors)

  10. ORF Alignment: EHA1 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available AYD 180 ... Query: 247 RVNPKERITIKEIKEHKFFQSNNPIIENVPSVIEEAGEPIKNIDSNIMAILCYLLNNVHI 306 ... RVNPKERITIKE...IKEHKFFQSNNPIIENVPSVIEEAGEPIKNIDSNIMAILCYLLNNVHI Sbjct: 241 RVNPKERITIKEIKEHKFFQSNNPIIENVPSVIEEAGEPIKNIDSNIMAIL

  11. ORF Alignment: EHA1 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available EAYD 180 ... Query: 247 RVNPKERITIKEIKEHKFFQSNNPIIENVPSVIEEAGEPIKNIDSNIMAILCYLLNNVHI 306 ... RVNPKERITIK...EIKEHKFFQSNNPIIENVPSVIEEAGEPIKNIDSNIMAILCYLLNNVHI Sbjct: 241 RVNPKERITIKEIKEHKFFQSNNPIIENVPSVIEEAGEPIKNIDSNIMAIL

  12. ORF Alignment: NC_002936 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available 247 EDREILRIVRHHHEHFNGSGYPDGLKGEEIPLGARIMALADAYDAMTSLRPY 298 ... EDREILRIVRHHHEHFNGSGYPDGLKGEEIPLGARIMA...LADAYDAMTSLRPY Sbjct: 241 EDREILRIVRHHHEHFNGSGYPDGLKGEEIPLGARIMALADAYDAMTSLRPY 292

  13. ORF Alignment: NC_002976 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available TLE 180 ... Query: 247 ASVTIISDHGIDGEVWSTICSFGQSQKNIELLNLIDGIEGIIVTRDGSVLMTSKMQKY 304 ... ASVTIISDHGIDGEVWSTICS...FGQSQKNIELLNLIDGIEGIIVTRDGSVLMTSKMQKY Sbjct: 241 ASVTIISDHGIDGEVWSTICSFGQSQKNIELLNLIDGIEGIIVTRDGSVLMTSKMQKY 298

  14. Computer-assisted nuclear fuel manufacture

    International Nuclear Information System (INIS)

    Maloney, J.P.; Schaumann, S.M.; Stone, E.

    1976-01-01

    At the ERDA Savannah River Plant, a process monitor, which incorporates an online digital computer, assists in manufacturing fuel elements used to produce nuclides such as plutonium, tritium, and californium in the plant's nuclear reactors. Also, inventory functions assist in safeguarding fissile material and protecting against accidental nuclear criticality. Terminals at strategic locations throughout the process area enable production operators to send and receive instructions and information on each manufacturing step

  15. Computer-assisted nuclear fuel manufacture

    International Nuclear Information System (INIS)

    Maloney, J.P.; Schaumann, C.M.; Stone, E.

    1976-06-01

    At the ERDA Savannah River Plant, a process monitor, which incorporates an online digital computer, assists in manufacturing fuel elements used to produce nuclides such as plutonium, tritium, and californium in the plant's nuclear reactors. Also, inventory functions assist in safeguarding fissile material and protecting against accidental nuclear criticality. Terminals at strategic locations throughout the process area enable production operators to send and receive instructions and information on each manufacturing step. 11 fig

  16. Heavy ion tests on programmable VLSI

    International Nuclear Information System (INIS)

    Provost-Grellier, A.

    1989-11-01

    The radiation from space environment induces operation damages in onboard computers systems. The definition of a strategy, for the Very Large Scale Integrated Circuitry (VLSI) qualification and choice, is needed. The 'upset' phenomena is known to be the most critical integrated circuit radiation effect. The strategies for testing integrated circuits are reviewed. A method and a test device were developed and applied to space applications candidate circuits. Cyclotron, synchrotron and Californium source experiments were carried out [fr

  17. Charge breeding of radioactive isotopes at the CARIBU facility with an electron beam ion source

    Science.gov (United States)

    Vondrasek, R. C.; Dickerson, C. A.; Hendricks, M.; Ostroumov, P.; Pardo, R.; Savard, G.; Scott, R.; Zinkann, G.

    2018-05-01

    An Electron Beam Ion Source Charge Breeder (EBIS-CB) has been developed at Argonne National Laboratory as part of the californium rare ion breeder upgrade. For the past year, the EBIS-CB has been undergoing commissioning as part of the ATLAS accelerator complex. It has delivered both stable and radioactive beams with A/Q 18% into a single charge state. The operation of this device, challenges during the commissioning phase, and future improvements will be discussed.

  18. Solid-State Neutron Multiplicity Counting System Using Commercial Off-the-Shelf Semiconductor Detectors

    Energy Technology Data Exchange (ETDEWEB)

    Rozhdestvenskyy, S. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

    2017-08-09

    This work iterates on the first demonstration of a solid-state neutron multiplicity counting system developed at Lawrence Livermore National Laboratory by using commercial off-the-shelf detectors. The system was demonstrated to determine the mass of a californium-252 neutron source within 20% error requiring only one-hour measurement time with 20 cm2 of active detector area.

  19. Safety analysis report for packaging: neutron shipping cask, model 0.5T

    International Nuclear Information System (INIS)

    Peterson, R.T.

    1976-01-01

    The Safety Analysis Report for Packaging demonstrates that the neutron shipping cask can safely transport, in solid or powder form, all isotopes of uranium, plutonium, americium, curium, berkelium, californium, einsteinium, and fermium. The shipping cask and its contents are described. It also evaluates transport conditions, structural parameters (e.g., load resistance, pressure and impact effects, lifting and tiedown devices), and shielding. Finally, it discusses compliance with Chapter 0529 of the Energy Research and Development Administration Manual

  20. Directed evolution of the periodic table: probing the electronic structure of late actinides.

    Science.gov (United States)

    Marsh, M L; Albrecht-Schmitt, T E

    2017-07-25

    Recent investigations of the coordination chemistry and physical properties of berkelium (Z = 97) and californium (Z = 98) have revealed fundamental differences between post-curium elements and lighter members of the actinide series. This review highlights these developments and chronicles key findings and concepts from the last half-century that have helped usher in a new understanding of the evolution of electronic structure in the periodic table.

  1. NWIS casting measurements taken during demonstrations to Russian visitors

    International Nuclear Information System (INIS)

    Mullens, J.A.; Valentine, T.E.; Mihalczo, J.T.

    1998-01-01

    This report describes a set of NWIS measurements made during demonstrations to Russian visitors on August 28, 1997. These measurements will be given to the Russian visitors from Arzamus-16 as part of their NWIS training (part of a DOE laboratory-to-laboratory exchange program). These measurements are made on standard highly enriched Uranium annular castings (as used for storage). Associated NWIS calibration runs were made in air (no casting, just the NWIS Californium source and detectors)

  2. Properties of neutron sources

    International Nuclear Information System (INIS)

    1987-03-01

    The Conference presentations were divided into sessions devoted to the following topics: white neutron sources, primarily pulsed (6 papers); fast neutron fields (5 papers); Californium-252 prompt fission neutron spectra (14 papers); monoenergetic sources and filtered beams (11 papers); 14 MeV neutron sources (10 papers); selected special application (one paper); and a general interest session (4 papers). Individual abstracts were prepared separately for the papers

  3. Health physics aspects of 252Cf

    International Nuclear Information System (INIS)

    Bhagwat, A.M.

    1974-01-01

    After briefly describing the methods of production, radioactive, chemical and biological properties of californium-252, its health physics aspects are reviewed in detail. Its external and internal radiation hazards can be minimised through control of radiation and contamination and proper shield design. Use of various shielding materials is evaluated. The following aspects are also discussed : (1) radiation detectors for neutrons and gamma radiation (2) personnel monitoring techniques (3) bioassay and (4) storage and transportation. (M.G.B.)

  4. Definitive Brachytherapy for Kaposi's Sarcoma

    International Nuclear Information System (INIS)

    Williams, A.; Ezzell, G.; Zalupski, M.; Fontanesi, J.

    1996-01-01

    Purpose: To assess the efficacy and possible complications in patients diagnosed with Kaposi's sarcoma and treated with definitive brachytherapy. Methods and Materials: Between January, 1995 and December, 1995, four patients with Kaposi's sarcoma (KS) were treated with brachytherapy. Three patients, all with positive HIV status were treated using Iridium 192 (Ir-192) sources via a high-dose rate remote afterloader. One patient with endemic KS was treated using the application of catheters loaded with Californium 252. Eight sites were treated and included scalp, feet, nose, penis, hand, neck, and back. Dose rate for Ir-192 was 330cGy/fx to a total dose of 990cGy. The Californium was delivered as 100nGy/b.i.d. to a total dose of 900nGy. Follow-up as ranged from 2-6 months. Results: All four patients remain alive. Seven of eight sites have had complete clinical response and each patient has reported durable pain relief that has not subsided through last follow-up of 1/96. Two of eight sites, both treated with surface mold technique with Californium 252 developed moist desquamation. The remaining six sites did not demonstrate significant toxicity. Conclusion: Brachytherapy can offer Kaposi's sarcoma patients results that are equivalent to external beam radiation therapy, with minimal complications, a shorter treatment time and potential cost effectiveness

  5. Learning by bidding: evidence from a large-scale natural experiment

    Czech Academy of Sciences Publication Activity Database

    Hanousek, Jan; Kočenda, Evžen

    -, č. 247 (2005), s. 1-33 ISSN 1211-3298 Institutional research plan: CEZ:AV0Z70850503 Keywords : learning * natural experiment * auction Subject RIV: AH - Economics http://www.cerge-ei.cz/pdf/wp/Wp247.pdf

  6. ‘A dialogue about the art of portraiture’ Originally published as ‘Gespräch von der Bildniskunst’, Österreichische Rundschau, Volume 6, 1906, 502—516, and republished: Julius Schlosser, Präludien Vorträge und Aufsätze, Berlin: Bard 1927, 227—247. Translated with an introduction by Karl Johns

    Directory of Open Access Journals (Sweden)

    Julius Schlosser

    2011-12-01

    Full Text Available In an unusually popular and readable dialogue form, Schlosser alludes to the classical education he takes for granted in any reader approaching his favourite ‘thorny’ questions from aesthetics and history. These involve the problems of naturalism, impressionism, portrait likeness, psychology of perception and numerous others being bandied around academic circles at the turn of the century. It is of further interest in directly referring critically to his recently deceased friend (Alois Riegl, and being written just at a moment in his career when Schlosser had been casting around the ideas of Ernst Brücke, Konrad Lange, even Henri Bergson, but had discovered the recent contribution of Benedetto Croce, which would colour his approach with an increasing intensity for the remainder of his life. He became what might be seen as the archetypical art historical theorist, but continues to distinguish himself from his successors by his greater consistency.

  7. RIBEIRO, Nelson de Figueiredo. A questão geopolítica da Amazônia: da soberania difusa a soberania restrita. Belém: EDUFPA, 2006, 417 p. ISBN 85-247-0337-7 - DOI: 10.5801/ncn.v16i1.1202

    OpenAIRE

    da Silva, Alberto Teixeira; de Sena Júnior, Paulo Roberto

    2013-01-01

    http://dx.doi.org/10.5801/ncn.v16i1.1202 No limiar do século XXI, a Amazônia como fronteira periférica do capitalismo contemporâneo, tornou-se espaço territorial estratégico pelos estoques de biodiversidade, abundância de recursos hídricos e serviços climáticos indispensáveis para a manutenção do equilíbrio planetário, colocando em pauta questões controversas sobre soberania, defesa, segurança, presença de múltiplos stakeholders e, sobretudo, o desafio de conciliar crescimento econômico, just...

  8. Antonio Maria Baggio (ed., Adriana Cossedu, Paolo Giusta, Rodrigo Mardones Z. y Antonio Márquez Prieto, Caino e i suoi fratelli. Il fondamento relazionale nella politica e nel diritto, Città Nuova, Roma, 2012, 247 págs.

    Directory of Open Access Journals (Sweden)

    María Salas Porras

    2013-03-01

    Full Text Available Los estudios recogidos en este volumen intentan reinterpretar los fundamentos de la Política y del Derecho, enmarcados en el horizonte relacional que la fraternidad les abre. Desde esta perspectiva, la fraternidad asume una relevancia política y jurídica en la medida en que se la entienda sustancialmente ligada a la libertad y a la igualdad. Cada una de las tres categorías, en la medida en que sean consideradas conjuntamente, llegan a adquirir su propio significado a través de la relación con las otras. El redescubrimiento de la fraternidad significa por tanto volver a proponer el "tríptico" entero, para recuperar, a través del mismo, el proyecto humanísitico de la modernidad, y liberarnos del destino del conflicto radical al que nuestro tiempo parece condenado: Caín no sólo ha matado a su hermano, sino que también ha fundado la primera ciudad, es decir, el lugar donde la violencia se ve confinada por el gobierno y por las leyes. Abrir el Derecho al horizonte de la fraternidad significa, hoy, llevar la racionalidad jurídica más allá de la mera racionalidad técnica; permitir renovar la relación jurídica, volver a encontrar sus fundamentos humanísticos, redescubriendo una justicia que reconcilia y reconstruye, fortificando el vínculo social. Considerar la fraternidad una categoría política significa poder emitir juicios políticos, capaces de producir un pensamiento político a través de la óptica de la fraternidad; se abandonan así las lógicas de la ideología, para intentar construir una forma de pensamiento en disposición de pasar, de una idea intuitiva de fraternidad, a una definición que la haga operativa, "operacionalizable". Es una tarea que no corresponde hoy a una sola disciplina, sino que interesa a todo el conjunto de los ya numerosos estudiosos que se han enrolado en este frente, interactuando entre sí de manera interdisiciplinar y abriendo un camino en el cual resulte posible, a todos los que han abrazado un humanismo y un ideal político, encontrar las mejores razones de su esperanza.

  9. Antonio Maria Baggio (ed.), Adriana Cossedu, Paolo Giusta, Rodrigo Mardones Z. y Antonio Márquez Prieto, Caino e i suoi fratelli. Il fondamento relazionale nella politica e nel diritto, Città Nuova, Roma, 2012, 247 págs.

    OpenAIRE

    María Salas Porras

    2013-01-01

    Los estudios recogidos en este volumen intentan reinterpretar los fundamentos de la Política y del Derecho, enmarcados en el horizonte relacional que la fraternidad les abre. Desde esta perspectiva, la fraternidad asume una relevancia política y jurídica en la medida en que se la entienda sustancialmente ligada a la libertad y a la igualdad. Cada una de las tres categorías, en la medida en que sean consideradas conjuntamente, llegan a adquirir su propio significado a través de la relación con...

  10. Sistemas de trabalho de alto envolvimento (STAE sobre a perspectiva da dimensão soft da gestão estratégica de pessoas: análise de conteúdo de 2000 a 2012 http://dx.doi.org/10.15601/1983-7631/rt.v6n11p229-247

    Directory of Open Access Journals (Sweden)

    Denilson Aparecida Leite Freire

    2013-11-01

    Full Text Available Esse artigo teve por objetivo comparar as variáveis que compõe os Sistemas de Trabalho de Alto Envolvimento (CIAVARELLA, 2003 com as estratégias “Hard” e “Soft” (LEGGE, 1995 e de Controle e Comprometimento (WALTON, 1985, sugerindo um modelo de análise que favoreça futuras investigações desses sistemas. O trabalho demonstrou que se pode efetuar, teoricamente, uma comparação entre as variáveis investigadas, contudo, há a necessidade de pesquisas quantitativas, que mensurem as correlações necessárias para validação do modelo de Análise. A análise de conteúdo das publicações da ANPAD de 2000 a 2012 revelaram poucos estudos, indicando a necessidade de estudos sobre esses sistemas.

  11. ORF Alignment: NC_006361 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available 121 ASVDCYERFLPPPFKLLTPLARIPGSLRPATELLRIRALHPLPIALGWVVKRPVPPEVVD 180 ... Query: 247 LAADLPNATLRFVDDSYTAIPE...DQPAALTELILDFTRQ 284 ... LAADLPNATLRFVDDSYTAIPEDQPAALTELILDFTRQ Sbjct: 241 LAADLPNATLRFVDDSYTAIPEDQPAALTELILDFTRQ 278

  12. ORF Alignment: NC_002944 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available QFTKDEVQAIVAALDAAGVPVIEVTHGDGLGGSSFNY 60 ... Query: 127 IQHFGLARELGLETVGFLMMSHTIPPEKLAQQARIMADAGCQCVYVVDSAGALVL...EGVRD 186 ... IQHFGLARELGLETVGFLMMSHTIPPEKLAQQARIMADAGCQCVYVVDSAGALVLEGVRD... Sbjct: 121 IQHFGLARELGLETVGFLMMSHTIPPEKLAQQARIMADAGCQCVYVVDSAGALVLEGVRD 180 ... Query: 247 IGVFDKIGVKTGIDFFDIX

  13. ORF Alignment: EHA1 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available RFIKYVQFETTSNAMSSSVPSTPTQIEFEKYLQNELNEMGIKNELTQTGHLFAYLSN 60 ... Query: 127 DTLLGADDKCAVAILMTICE...MYKNKEVPVVIVFTPDEEIGRSITHLDINKLKAKKAYSLD 186 ... DTLLGADDKCAVAILMTICEMYKNKEVPVVIVFTPDEEIG...RSITHLDINKLKAKKAYSLD Sbjct: 121 DTLLGADDKCAVAILMTICEMYKNKEVPVVIVFTPDEEIGRSITHLDINKLKAKKAYSLD 180 ... Query: 247

  14. Determination of the relative power density distribution in a heterogeneous reactor from the results of measurements of the reactivity effects and the neutron importance function

    International Nuclear Information System (INIS)

    Bobrov, A. A.; Glushkov, E. S.; Zimin, A. A.; Kapitonova, A. V.; Kompaniets, G. V.; Nosov, V. I.; Petrushenko, R. P.; Smirnov, O. N.

    2012-01-01

    A method for experimental determination of the relative power density distribution in a heterogeneous reactor based on measurements of fuel reactivity effects and importance of neutrons from a californium source is proposed. The method was perfected on two critical assembly configurations at the NARCISS facility of the Kurchatov Institute, which simulated a small-size heterogeneous nuclear reactor. The neutron importance measurements were performed on subcritical and critical assemblies. It is shown that, along with traditionally used activation methods, the developed method can be applied to experimental studies of special features of the power density distribution in critical assemblies and reactors.

  15. Nuclear assay of coal. Volume 1. Coal composition by prompt neutron activation analysis: basic experiments. Final report

    International Nuclear Information System (INIS)

    Reynolds, G.; Bozorganesh, H.; Elias, E.; Gozani, T.; Maung, T.; Orphan, V.

    1979-01-01

    Using californium-252 as a source of exciting neutrons, prompt gamma photons emitted by elemental nuclei in the coal have been measured using several detectors, including sodium--iodide and germanium--lithium. Several coal types, including bituminous, subbituminous lignite and anthracite were crushed to various top sizes and analyzed carefully be traditional ASTM wet chemistry techniques at two or three different laboratories. The elements (sulfur, hydrogen, carbon, aluminum, silicon, iron, calcium, sodium, nitrogen, and chlorine) were determined by prompt neutron activations and the quantities compared with those of the wet chemical analyses

  16. PROCEEDINGS OF THE SYMPOSIUM COMMEMORATING THE 25th ANNIVERSARY OF ELEMENTS 97 and 98 HELD ON JAN. 20, 1975

    Energy Technology Data Exchange (ETDEWEB)

    Seaborg, Glenn T.; Street Jr., Kenneth; Thompson, Stanley G.; Ghiorso, Albert

    1976-07-01

    This volume includes the talks given on January 20, 1975, at a symposium in Berkeley on the occasion of the celebration of the 25th anniversary of the discovery of berkelium and californium. Talks were given at this symposium by the four people involved in the discovery of these elements and by a number of people who have made significant contributions in the intervening years to the investigation of their nuclear and chemical properties. The papers are being published here, without editing, in the form in which they were submitted by the authors in the months following the anniversary symposium, and they reflect rather faithfully the remarks made on that occasion.

  17. Radiological safety considerations in the design and operation of the ORNL Transuranium Research Laboratory (TRL)

    International Nuclear Information System (INIS)

    Haynes, C.E.

    1976-01-01

    The Transuranium Research Laboratory (TRL) is the central facility at Oak Ridge National Laboratory (ORNL) for chemical and physical research involving transuranium elements. Transuranium Research Laboratory investigations are about equally divided between studies of inorganic and structural chemistry of the heavy elements and nuclear structure and properties of their isotopes. Elements studied include neptunium, plutonium, americium, curium, berkelium, californium, and einsteinium, each in microgram-to-gram quantities depending upon availability and experimental requirements. This paper describes an eight-step safety procedure followed in planning and approving individual research projects. This procedure should provide an optimum margin of safety and should permit the accomplishment of successful research

  18. Neutron crosstalk between liquid scintillators

    Energy Technology Data Exchange (ETDEWEB)

    Verbeke, J.M., E-mail: verbeke2@llnl.gov; Prasad, M.K., E-mail: prasad1@llnl.gov; Snyderman, N.J., E-mail: snyderman1@llnl.gov

    2015-09-11

    A method is proposed to quantify the fractions of neutrons scattering between liquid scintillators. Using a spontaneous fission source, this method can be utilized to quickly characterize an array of liquid scintillators in terms of crosstalk. The point model theory due to Feynman is corrected to account for these multiple scatterings. Using spectral information measured by the liquid scintillators, fractions of multiple scattering can be estimated, and mass reconstruction of fissile materials under investigation can be improved. Monte Carlo simulations of mono-energetic neutron sources were performed to estimate neutron crosstalk. A californium source in an array of liquid scintillators was modeled to illustrate the improvement of the mass reconstruction.

  19. Method for measuring multiple scattering corrections between liquid scintillators

    Energy Technology Data Exchange (ETDEWEB)

    Verbeke, J.M., E-mail: verbeke2@llnl.gov; Glenn, A.M., E-mail: glenn22@llnl.gov; Keefer, G.J., E-mail: keefer1@llnl.gov; Wurtz, R.E., E-mail: wurtz1@llnl.gov

    2016-07-21

    A time-of-flight method is proposed to experimentally quantify the fractions of neutrons scattering between scintillators. An array of scintillators is characterized in terms of crosstalk with this method by measuring a californium source, for different neutron energy thresholds. The spectral information recorded by the scintillators can be used to estimate the fractions of neutrons multiple scattering. With the help of a correction to Feynman's point model theory to account for multiple scattering, these fractions can in turn improve the mass reconstruction of fissile materials under investigation.

  20. Neutron crosstalk between liquid scintillators

    International Nuclear Information System (INIS)

    Verbeke, J.M.; Prasad, M.K.; Snyderman, N.J.

    2015-01-01

    A method is proposed to quantify the fractions of neutrons scattering between liquid scintillators. Using a spontaneous fission source, this method can be utilized to quickly characterize an array of liquid scintillators in terms of crosstalk. The point model theory due to Feynman is corrected to account for these multiple scatterings. Using spectral information measured by the liquid scintillators, fractions of multiple scattering can be estimated, and mass reconstruction of fissile materials under investigation can be improved. Monte Carlo simulations of mono-energetic neutron sources were performed to estimate neutron crosstalk. A californium source in an array of liquid scintillators was modeled to illustrate the improvement of the mass reconstruction

  1. Beam test of a grid-less multi-harmonic buncher

    International Nuclear Information System (INIS)

    Ostroumov, P.N.; Aseev, V.N.; Barcikowski, A.; Clifft, B.; Pardo, R.; Sharamentov, S.I.; Sengupta, M.

    2008-01-01

    The Argonne Tandem Linear Accelerator System (ATLAS) is the first superconducting heavy-ion linac in the world. Currently ATLAS is being upgraded with the Californium Rare Ion Breeder Upgrade (CARIBU). The latter is a funded project to expand the range of shortlived, neutron-rich rare isotope beams available for nuclear physics research at ATLAS. To avoid beam losses associated with the existing gridded multi-harmonic buncher (MHB), we have developed and built a grid-less four-harmonic buncher with fundamental frequency of 12.125 MHz. In this paper, we report the results of the MHB commissioning and ATLAS beam performance with the new buncher.

  2. Radiation protection data sheet. Radiation protection data sheets for the use of radionuclides in unsealed sources

    International Nuclear Information System (INIS)

    Anon.

    1999-01-01

    These radiation protection data sheet are devoted to responsible persons and employees of various laboratories or medical, pharmaceutical, university and industrial departments where radionuclides are handled as well as all the persons who attend to satisfy in this field. They contain the essential radiation protection data for the use of unsealed sources: physical characteristics, risk assessment, administrative procedures, recommendations, regulations and bibliography. This new series includes the following radionuclides: californium 252, curium 244, gallium 67, indium 113m, plutonium 238, plutonium 239, polonium 210, potassium 42, radium 226, thorium 232, uranium 238 and zinc 65. (O.M.)

  3. Development of a transportable neutron radiography system for non-destructive tests application

    International Nuclear Information System (INIS)

    Silva, Ademir X. da; Crispim, Verginia R.

    1999-01-01

    This paper presents a study of a transportable neutron radiography system utilizing californium-252. Studies about moderation, collimation and shielding are showed. A Monte Carlo Code, MCNP3b, has been used to obtain a maximum and more homogeneous thermal neutron flux in the collimator outlet next to the image plain, and an adequate radiation shielding to attend radiological protection rules. With the presented collimator, it was possible to obtain for the thermal neutron flux, at the collimator outlet and next to the image plain, a L/D ratio 7,5, for neutron flux up to 6 X 10 -6 cm -2 .s -1 per neutron source. (author)

  4. Composition containing transuranic elements for use in the homeopathic treatment of aids

    International Nuclear Information System (INIS)

    Lustig, D.

    1996-01-01

    A homeopathic remedy consisting of a composition containing one or more transuranic elements, particularly plutonium, for preventing and treating acquired immunodeficiency syndrome (AIDS) in humans, as well as seropositivity for human immunodeficiency virus (HIV). Said composition is characterized in that it uses any chemical or isotopic form of one or more transuranic elements (neptunium, plutonium, americium, curium, berkelium, californium or einsteinium), particularly plutonium, said form being diluted and dynamized according to conventional homeopathic methods, particularly the so-called Hahnemann and Korsakov methods, and provided preferably but not exclusively in the form of lactose and/or saccharose globules or granules impregnated with the active principle of said composition. (author)

  5. Determination of alpha activity and fissile mass content in solid waste by systems using neutron interrogation

    International Nuclear Information System (INIS)

    Romeyer Dherbey, J.; Lacruche, G.; Berne, R.; Auge, J.; Martin Deidier, L.; Butez, M.

    1990-01-01

    The Quantitative control (determination of heavy nuclides and alpha activity) of alpha radioactive wastes is necessary, particularly to determine if the waste is in accordance with the surface storage limits. In order to reduce the uncertainty on the alpha activity resulting from unknown isotopic composition, inhomogeneity of heavy nuclides in the matrix, combination of several methods is necessary. In the paper we present the Cadarache development work in the NDA of solid waste using the Californium shuffler, 14 Mev neutron generator, and also passive techniques such as neutron emission measurement and gamma spectrometry. Experimental systems combining active and passive methods are presented (COSAC, BANCO, DANAIDE, PROMETHEE)

  6. Actinides

    International Nuclear Information System (INIS)

    Martinot, L.; Fuger, J.

    1985-01-01

    The oxidation behavior of the actinides is explained on the basis of their electronic structure. The actinide elements, actinium, thorium, protactinium, uranium, neptunium, plutonium, americium, curium, berkelium, californium, einsteinium, fermium, mendelevium, nobelium, and laurencium are included. For all except the last three elements, the points of discussion are oxidation states, Gibbs energies and potentials, and potential diagram for the element in acid solution; and thermodynamic properties of these same elements are tabulated. References are cited following discussion of each element with a total of 97 references being cited. 13 tables

  7. Safety analysis report for packaging: neutron shipping cask, model 4T

    International Nuclear Information System (INIS)

    Peterson, R.T.

    1977-01-01

    This Safety Analysis Report for Packaging demonstrates that the neutron shipping cask can safely transport, in solid or powder form, all isotopes of uranium, plutonium, americium, curium, berkelium, californium, einsteinium, and fermium. The cask and its contents are described. It also evaluates transport conditions, structural parameters (e.g., load resistance, pressure and impact effects, lifting and tiedown devices), and shielding. Finally, it discusses compliance with Chapter 0529 of the Energy Research and Development Administration Manual, Safety Standards for the Packaging of Fissile and Other Radioactive Materials

  8. TOWARD AN IMPROVED UNDERSTANDING OF STRUCTURE AND MAGNETISM IN NEPTUNIUM AND PLUTONIUM PHOSPHONATES AND SULFONATES

    Energy Technology Data Exchange (ETDEWEB)

    Albrecht-Schmitt, Thomas

    2012-03-01

    This grant supported the exploratory synthesis of new actinide materials with all of the actinides from thorium to californium with the exceptions of protactinium and berkelium. We developed detailed structure-property relationships that allowed for the identification of novel materials with selective ion-exchange, selective oxidation, and long-range magnetic ordering. We found novel bonding motifs and identified periodic trends across the actinide series. We identified structural building units that would lead to desired structural features and novel topologies. We also characterized many different spectroscopic trends across the actinide series. The grant support the preparation of approximately 1200 new compounds all of which were structurally characterized.

  9. Citric complexes of trivalent cerium and berkelium

    International Nuclear Information System (INIS)

    Boulhassa, S.

    1977-01-01

    The extraction by thenoyltrifluoroacetone (TTA) in benzene of trivalent cerium, berkelium and californium, at the indicator scale, hydrolysis and complexation by citric acid of these cations are studied. The radionuclides used were 144 Ce, 249 Bk and 249 Cf respectively γ, β and α emitters. The solvent extraction technique of the elements by TTA in benzene from a perchloric medium at the ionic stength 0.1 was employed. The distribution coefficients D were measured by the γ, β or α radiometry. Cerium and berkelium, which have a comparable redox behavior, show in solution a relatively stable valency IV. Therefore the study by solvent extraction of their trivalent form required the standing up of complete reducing conditions of these elements and their stabilization in solution at the valency III. The thermodynamic data obtained for berkelium and californium contribute to understand the chemistry of these elements and permit to complete the third 'tetrad branch' of 5f elements from Cm 3+ to Es 3+ . This tetrad effect is a manifestation of thermodynamic consequence of the 'nephelauxetic effect'. As for Ce(III), the data confirm the pronounced acid property and may be show no neglected ligand effect for f 1 configuration [fr

  10. Radioactive materials production

    International Nuclear Information System (INIS)

    Anon.

    1985-01-01

    The Radiochemical Processing Plant (RPP) at ORNL has served as the national repository and distribution center for 233 U for > 20 years. Several hundred kilograms of uranium, containing approximately 90 to 98% 233 U, are stored there in the form of metal, oxides, and nitrate solutions. All of these uranium materials contain small, but significant, concentrations of 232 U, ranging from 2 to 225 ppm. Most of the radioactivity associated with the 233 U comes from the decay daughters of 232 U (74-year half-life). The 252 Cf Industrial Sales/Loan Program involves loans of 252 Cf neutron sources to agencies of the US Government and sales of 252 Cf as the bulk oxide and as palladium-californium alloy pellets and wires. The program has been operated since 1968 in temporary facilities at the Savannah River Laboratory (SRL). The obsolete hot-cell facilities at SRL are now being decommissioned, and the program activities are being transferred to ORNL's Californium Facility in Bldg. 7930, which is managed by the staff of the Transuranium Processing Plant

  11. ORF Alignment: NC_003306 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available C58, Dupont) plasmid AT ... Length = 247 ... Query: 28 ... DVTSNGKLRVGVLLDAAPWGYKDAEGKDTGLDVELARIMA...KDLNAELEIVPLTGASRIPS 87 ... DVTSNGKLRVGVLLDAAPWGYKDAEGKDTGLDVELARIMAKDLNAELEIVPLTG...ASRIPS Sbjct: 21 ... DVTSNGKLRVGVLLDAAPWGYKDAEGKDTGLDVELARIMAKDLNAELEIVPLTGASRIPS 80 ... Query: 148 STLDTWLTDNAPEV

  12. ORF Alignment: ch_oct10_gene_aa_db [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available 2 PPVLEKSDPRWPGNELIYKGICPSCLPTTECLKDTVERVKPYFEDVIAPSIMSGKSVLVS 181 ... PPVLEKSDPRWPGNELIYKGICPSCLPTTECLKDTVERVKPYFEDVIAPSIM...SGKSVLVS Sbjct: 121 PPVLEKSDPRWPGNELIYKGICPSCLPTTECLKDTVERVKPYFEDVIAPSIMSGKSVLVS 180 ... Query: 242 VANQGK 247 ... VANQGK Sbjct: 241 VANQGK 246

  13. ORF Alignment: NC_003902 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available thomonas ... campestris pv. campestris str. ATCC 33913] ... Length = 247 ... Query: 49 ... LNPFVPVQF...PLKLVDRRMLAPTVAHCQFLRDDGQPLDFQPGQFIQIHFQYADGTDAKRSY 108 ... LNPFVPVQFPLKLV...DRRMLAPTVAHCQFLRDDGQPLDFQPGQFIQIHFQYADGTDAKRSY Sbjct: 1 ... LNPFVPVQFPLKLVDRRMLAPTVAHCQFLRDDGQPLDFQPGQFIQIHFQY

  14. ORF Alignment: NC_002967 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ... Length = 242 ... Query: 188 GSSRAWTTVLDSIKLVAASDVPVLISGETGTGKEQAARTIHRLSNRAEKPFVPV...NCSALV 247 ... GSSRAWTTVLDSIKLVAASDVPVLISGETGTGKEQAARTIHRLSNRAEKPFVPVNCSALV Sbjct: 1 ... GSSRAWTTVLDS...IKLVAASDVPVLISGETGTGKEQAARTIHRLSNRAEKPFVPVNCSALV 60 ... Query: 308 ERVGGEKPVSVDVRIIAATNVDLAEAVSMGRFREDLLYRLDVFP

  15. 76 FR 61279 - Defense Federal Acquisition Regulation Supplement; Defense Cargo Riding Gang Member (DFARS Case...

    Science.gov (United States)

    2011-10-04

    ... that the language of the proposed clause be amended to read as follows to reinforce DoD's role in the... Military Sealift Command), and specific procedural guidance for DoD personnel obtaining the background... 247.5. B. Language Inconsistency Comment: DFARS 252.247-7027(a) defines ``riding gang member'' as it...

  16. Cultural Economy, Capitalism and the Logic of the Public Sphere

    DEFF Research Database (Denmark)

    Schwarzkopf, Stefan

    2015-01-01

    Review essay: Promotional Cultures: The Rise and Spread of Advertising, Public Relations, Marketing and Branding/ by Aeron Davis. (Polity, 2013, ISBN 978-0-7456-3983-3, 247 + xi pp.......Review essay: Promotional Cultures: The Rise and Spread of Advertising, Public Relations, Marketing and Branding/ by Aeron Davis. (Polity, 2013, ISBN 978-0-7456-3983-3, 247 + xi pp....

  17. 78 FR 78067 - Focused Mitigation Strategies To Protect Food Against Intentional Adulteration; Public Meeting on...

    Science.gov (United States)

    2013-12-24

    ... summary of your oral presentation and send to: Juanita Yates, Center for Food Safety and Applied Nutrition... Vol. 78 Tuesday, No. 247 December 24, 2013 Part V Department of Health and Human Services Food and.... 247 / Tuesday, December 24, 2013 / Proposed Rules#0;#0; [[Page 78068

  18. 78 FR 15049 - Notice of Determinations Regarding Eligibility To Apply for Worker Adjustment Assistance

    Science.gov (United States)

    2013-03-08

    ... market disruption or threat thereof under section 421(b)(1); or (C) An affirmative final determination of... Newsprint Company. 82,247 Kincaid Furniture Co., Hudson, NC July 20, 2012. Inc., Plant 9 Lumber Yard, Foothills Temporary Employment. 82,247A Kincaid Furniture Co., Hudson, NC July 22, 2012. Inc., Plant 1...

  19. Bulletin of Materials Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Author Affiliations. M R Meshram1 Nawal K Agrawal1 Bharoti Sinha1 P S Misra2. Department of Electronics and Computer Engineering, Indian Institute of Technology, Roorkee 247 667, India; Department of Metallurgical and Materials Engineering, Indian Institute of Technology, Roorkee 247 667, India ...

  20. Alzheimer's Disease Facts and Figures

    Medline Plus

    Full Text Available alz.org | Find Your Chapter 24/7 Helpline: 1.800.272.3900 Find your chapter: search by state In My Area | ... us 24/7 Helpline: 1-800-272-3900 Find Your Local Chapter Get Involved Make a donation ...

  1. Production of Aspergillus niger β-mannosidase in Pichia pastoris

    Czech Academy of Sciences Publication Activity Database

    Fliedrová, Barbora; Weignerová, Lenka; Křen, Vladimír

    2012-01-01

    Roč. 279, č. 1 (2012), s. 247-247 ISSN 1742-464X. [IUBMB Congress /22./ and FEBS Congress /37./. 04.09.2012-09.09.2012, Seville] R&D Projects: GA ČR GD305/09/H008; GA ČR GAP207/10/0321 Institutional support: RVO:61388971 Keywords : NAG-thiazoline

  2. Reliability of semiconductor and gas-filled diodes for over-voltage protection exposed to ionizing radiation

    Directory of Open Access Journals (Sweden)

    Stanković Koviljka

    2009-01-01

    Full Text Available The wide-spread use of semiconductor and gas-filled diodes for non-linear over-voltage protection results in a variety of possible working conditions. It is therefore essential to have a thorough insight into their reliability in exploitation environments which imply exposure to ionizing radiation. The aim of this paper is to investigate the influence of irradiation on over-voltage diode characteristics by exposing the diodes to californium-252 combined neutron/gamma radiation field. The irradiation of semiconductor over-voltage diodes causes severe degradation of their protection characteristics. On the other hand, gas-filled over-voltage diodes exhibit a temporal improvement of performance. The results are presented with the accompanying theoretical interpretations of the observed changes in over-voltage diode behaviour, based on the interaction of radiation with materials constituting the diodes.

  3. The CARIBU EBIS control and synchronization system

    Science.gov (United States)

    Dickerson, Clayton; Peters, Christopher

    2015-01-01

    The Californium Rare Isotope Breeder Upgrade (CARIBU) Electron Beam Ion Source (EBIS) charge breeder has been built and tested. The bases of the CARIBU EBIS electrical system are four voltage platforms on which both DC and pulsed high voltage outputs are controlled. The high voltage output pulses are created with either a combination of a function generator and a high voltage amplifier, or two high voltage DC power supplies and a high voltage solid state switch. Proper synchronization of the pulsed voltages, fundamental to optimizing the charge breeding performance, is achieved with triggering from a digital delay pulse generator. The control system is based on National Instruments realtime controllers and LabVIEW software implementing Functional Global Variables (FGV) to store and access instrument parameters. Fiber optic converters enable network communication and triggering across the platforms.

  4. Designing on-line analyzer for coal on belt conveyor using neutron activation technique

    International Nuclear Information System (INIS)

    Rony Djokorayono; Agus Cahyono

    2014-01-01

    Basic design of on-line analyzer for coal on belt conveyor using neutron activation technique has been carried out. Compared with sampling technique, this neutron activation technique has some advantages in term of analysis accuracy and time. The design activities performed include the establishment of design requirements, functional requirements, technical requirements, technical specification, detection sub-system design, data acquisition subsystem design, and operator computer console design. This program will use Nal(Tl) scintillation detector to detect gamma-rays emitted by elements in coal due to neutron activation of a neutron source, "2"5"2Cf (Californium-252). This basic design of on-line analyzer for coal on belt conveyor using neutron activation technique should be followed up with the development of detailed design, prototype construction, and field testing. (author)

  5. Nuclear assay of coal. Volume 8. Continuous nuclear assay of coal (CONAC). Final report

    International Nuclear Information System (INIS)

    Lagarias, J.; Irminger, P.; Dodson, W.

    1979-01-01

    Using californium-252 as a source of exciting neutrons, prompt gamma photons emitted by elemental nuclei in the coal have been measured using several detectors, including sodium-iodide and germanium-lithium. Several coal types, including bituminous, subbituminous lignite and anthracite were crushed to various top sizes and analyzed carefully by traditional ASTM wet chemistry techniques at two or three different laboratories. The elements (sulfur, hydrogen, carbon, aluminum, silicon, iron, calcium, sodium, nitrogen, and chlorine) were determined by prompt neutron activations and the quantities compared with those of the wet chemical analyses. Since satisfactory correlation has been obtained at bench-scale level using 100 to 200 kG samples, an apparatus has been designed to analyze a coal stream of up to 50 ton/hour, at an electric power generating station

  6. Neutron dosimetry and spectrometry with Bonner spheres. Working out a log-normal reference matrix

    International Nuclear Information System (INIS)

    Zaborowski, Henrick.

    1981-11-01

    From the experimental and theoretical studies made upon the BONNER's spheres System with a I 6 Li(Eu) crystal and with a miniaturized 3 He counter we get the normalized energy response functions R*sub(i)(E). This normalization is obtained by the mathematization of the Resolution Function R*(i,E) in the Log-Normal distribution hypothesis to mono energetic neutrons given in April 1976 to the International Symposium on Californium 252. The fit of the Log-Normal Hypothesis with the experimental and Theoretical data is very satisfactory. The parameter's tabulated values allow a precise interpolation, at all energies between 0.4 eV and 15 MeV and for all spheres diameters between 2 and 12 inches, of the discretized R*sub(ij) Reference Matrix for the applications to neutron dosimetry and spectrometry [fr

  7. Experimental survey of the potential energy surfaces associated with fission

    International Nuclear Information System (INIS)

    Britt, H.C.

    1980-01-01

    Progress in the experimental determination of the properties of the potential energy surface associated with fission is reviewed. The importance of nuclear symmetry effects on the calculation of fission widths is demonstrated. Evidence is presented for the fragmentation of the mass-asymmetric second barrier in the thorium region and the axial asymmetric first barrier in the californium region. Detailed analyses of experimental data suggest the presence of two parallel second barriers; the normal mass-asymmetric, axial-symmetric barrier and a slightly higher mass-symmetric, axial-asymmetric barrier. Experimental barrier parameters are determined systematically and compared with calculations from various theoretical models. Techniques for expanding fission probability measurements to higher energies are discussed. (author)

  8. Dynamic vortex dust structures in a nuclear-track plasma

    International Nuclear Information System (INIS)

    Rykov, V A; Khudyakov, A V; Filinov, V S; Vladimirov, V I; Deputatova, L V; Krutov, D V; Fortov, V E

    2003-01-01

    Results are presented from Monte Carlo calculations of the electric charge on dust grains in a plasma produced during the slowing down of radioactive decay products of californium nuclei in neon. The dust grain charging is explained as being due to the drift of electrons and ions in an external electric field. It is shown that the charges of the grains depend on their coordinates and strongly fluctuate with time. The time-averaged grain charges agree with the experimental data obtained on ordered liquid-like dust structures in a nuclear-track plasma. The time-averaged dust grain charges are used to carry out computer modelling of the formation of dynamic vortex structures observed in experiments. Evidence is obtained for the fact that the electrostatic forces experienced by the dust grains are potential in character. The paper is supplemented by a video clip showing the typical dynamics of the simulated vortex dust structure

  9. Operation manual for the INEL on-line mass-separator facility

    International Nuclear Information System (INIS)

    Anderl, R.A.

    1984-06-01

    This report is an operation manual for an on-line mass-separator facility which is located in Building 661 at the Test Reactor Area of the Idaho National Engineering Laboratory. The facility provides mass-separated sources of short-lived fission-product radionuclides whose decay properties can be studied using a variety of nuclear spectroscopic techniques. This facility is unique in that it utilizes the gas-jet technique to transport fission products from a 252 Cf source located in a hot cell to the ion source of the mass separator. This document includes the following: (a) a detailed description of the facility, (b) identification of equipment hazards and safety controls, (c) detailed operating procedures for startup, continuous operation and shutdown, (d) operating procedures for the californium hot cell, and (e) an operator's manual for the automated moving tape collector/data acquisition system. 7 references, 16 figures, 8 tables

  10. Separation of 248Cm (III) from 252Cf (III) and its use in time resolved fluorescence spectroscopic (TRFS) studies

    International Nuclear Information System (INIS)

    Murali, M.S.; Nair, A.G.C.; Gujar, R.B.; Jain, A.; Tomar, B.S.; Godbole, S.V.; Reddy, A.V.R.; Manchanda, V.K.

    2008-07-01

    The present report gives a description of the methodology for the separation of 248 Cm(III) from decayed 252 Cf (III) waste solution. The waste solution was first assayed for 252 Cf content by neutron counting using a neutron well coincidence counter. The sample was subjected to the chemical separation of 248 Cm (III) from 252 Cf (III) following anion and cation exchange chromatography. The alpha spectrum of the separated curium fraction showed peaks due to 246 Cm and 248 Cm while the corresponding alpha spectrum of californium fraction showed 249,250,251,252 Cf. The gamma ray abundances of 249 Cf were determined with respect to its gamma rays of 387 keV and the data agreed well with that in literature. Separated Cm(III) was further characterized by recording its time resolved fluorescence spectrum (TRFS) in aqueous medium. (author)

  11. Decay Curves and Half-Lives of Gamma-Emitting States from a Study of Prompt Fission Gamma Radiation

    Energy Technology Data Exchange (ETDEWEB)

    Albinsson, H [Chalmers Univ. of Technology, Goeteborg (SE)

    1971-04-15

    Measurements were made on the time distributions of the prompt gamma radiation emitted from fragments in the thermal-neutron induced fission of 235U. The gamma radiation emitted during different time intervals after the fission event was studied with the help of a collimator, the position of which was changed along the path of the fragments. In this way decay curves were obtained from which half-lives could be estimated. Time components with half-lives of 7.5, 18 and 60 ps were found and their relative intensities were calculated. Half-lives and associated intensities are in good agreement with earlier data from uranium and californium fission. Problems involved in this type of study are discussed. The collimator technique has proved to be effective for determination of half lives down to less than 10 ps

  12. Utilization of radiation facilities at TNRC for shielding researches and related topics

    Energy Technology Data Exchange (ETDEWEB)

    Akki, T S [Physics Department, Nuclear Physics and Radiation Shielding Division Tajura Nuclear Research Center, Tripoli (Libyan Arab Jamahiriya)

    1997-12-31

    This paper presents the running shielding research activities at Tajura Nuclear research center. The main area of researches are concentrated on the investigation of different types of concrete made from local materials such as conventional concrete, Magnetite-Limonite concrete, and heat resistant concrete. The measuring techniques used were neutron-gamma spectrometry, and activation foils. The measurements were performed using collimated beam of reactor neutrons emitted from one of the horizontal channels, as well as from californium-252 neutron source. The transmitted neutron spectra through concrete barriers of different thicknesses were measured by a scintillation spectrometer with NE-213 liquid organic scintillator. A non-destructive testing of some reactor materials were also carried out using neutron and gamma ray computerized tomography technique (CT). Some experiments were also carried out related to measurements of neutron depth dose distributions inside tissue equivalent materials. 10 figs.

  13. Physical-chemical studies of transuranium elements: Progress report for the period April 1, 1985-March 31, 1988

    International Nuclear Information System (INIS)

    Peterson, J.R.

    1987-01-01

    New knowledge is being accumulated in the role of the 5f electrons in the bonding in actinide elements and compounds, the relationships of metallic structures to metallic valence and radius, the extent and magnitude of the actinide contraction, the magnetic, thermodynamic, spectroscopic, and crystallographic properties of these materials as related to general theories, the effect of self-irradiation on chemical and physical properties, the chemical and physical consequences of radioactive decay in the bulk-phase solid state, and in general, the range of validity of the actinide hypothesis. Separate reports are given on: spectrophotometric studies of Cf(III) ions in lanthanide trihalide hosts, new ternary transplutonium chalcogenide halides, Raman spectrometric studies of lanthanide trihalides as function of T or P, and solution calorimetry of californium halides

  14. Dust grain charges in a nuclear-track plasma and the formation of dynamic vortex dust structures

    International Nuclear Information System (INIS)

    Rykov, V.A.; Khudyakov, A.V.; Filinov, V.S.; Vladimirov, V.I.; Deputatova, L.V.; Krutov, D.V.; Nefedov, A.P.; Fortov, V.E.

    2002-01-01

    Results are presented from Monte Carlo calculations of the electric charge of dust grains in a plasma produced during the slowing down of the radioactive decay products of californium nuclei in neon. The dust grain charging is explained for the first time as being due to the drift of electrons and ions in an external electric field. It is shown that the charges of the grains depend on their coordinates and strongly fluctuate with time. The time-averaged grain charges agree with the experimental data obtained on ordered liquidlike dust structures in a nuclear-track plasma. The time-averaged dust grain charges are used to carry out computer modeling of the formation of dynamic vortex structures observed in experiments. Evidence is obtained of the fact that the electrostatic forces experienced by the dust grains are potential in character

  15. Neutron radiography for nondestructive testing

    International Nuclear Information System (INIS)

    John, J.

    1979-01-01

    Neutron radiography is similar to X-ray inspection in that both depend upon use of radiation that penetrates some materials and is absorbed by others to provide a contrast image of conditions not readily available for visual inspection. X-rays are absorbed by dense materials, such as metals, whereas neutrons readily penetrate metals, but are absorbed by materials containing hydrogen. The neutron radiography has been successfully applied to a number of inspection situations. These include the inspection of explosives, advanced composites, adhesively bonded structures and a number of aircraft engine components. With the availability of Californium-252, it has become feasible to construct mobile neutron radiography systems suitable for field use. Such systems have been used for in-situ inspection of flight line aircraft, particularly to locate and measure hidden corrosion

  16. Microscopic nature of inhomogeneous line broadening: Analysis of the excitation-line-narrowing spectra of Cf4+ in CeF4

    International Nuclear Information System (INIS)

    Liu, G.K.; Huang, J.; Beitz, J.V.

    1993-01-01

    Optical transitions between 5f states of tetravalent californium ion doped (1 metal-atom %) into CeF 4 exhibit unusually large inhomogeneous broadening. The nature of the inhomogeneous broadening in this system has been studied by using fluorescence line narrowing and excitation line narrowing (ELN). It is shown that the energy distributions of different electronic states of Cf 4+ in this system are correlated. In the ELN experiments, reduced excitation linewidth was obtained when selectively monitoring fluorescence emission. A linear relation was observed between the excitation energies of crystal-field states of the 5 G 4' manifold and the fluorescence wavelength monitored across the inhomogeneous profile of a 5 G 6' -- 7 F 6' transition. Analysis of these results by means of a microscopic theory proposed by Laird and Skinner [J. Chem. Phys. 90, 3880 (1989)] has provided insights into the structural properties of this disordered system

  17. Transuranic biokinetic parameters for marine invertebrates--a review.

    Science.gov (United States)

    Ryan, T P

    2002-04-01

    A catalogue of biokinetic parameters for the transuranic elements plutonium, americium, curium, neptunium, and californium in marine invertebrates is presented. The parameters considered are: the seawater-animal concentration factor (CF); the sediment-animal concentration ratio (CR); transuranic assimilation efficiency; transuranic tissue distribution and transuranic elimination rates. With respect to the seawater-animal CF, authors differ considerably on how they define this parameter and a seven-point reporting system is suggested. Transuranic uptake from sediment by animals is characterised by low CRs. The assimilation efficiencies of transuranic elements in marine invertebrates are high compared to vertebrates and mammals in general and the distribution of transuranics within the body tissue of an animal is dependent on the uptake path. The elimination of transuranics from most species examined conformed to a standard biphasic exponential model though some examples with three elimination phases were identified.

  18. Alternative irradiation system for efficiency manganese bath determination

    Energy Technology Data Exchange (ETDEWEB)

    Passos Leite, Sandro, E-mail: sandro@ird.gov.b [Programa de Engenharia Nuclear/COPPE, Universidade Federal do Rio de Janeiro, Ilha do Fundao, Caixa Postal 68509, 21945-970, Rio de Janeiro, RJ (Brazil); Wagner Pereira, Walsan, E-mail: walsan@ird.gov.b [Instituto de Radioprotecao e Dosimetria LNMRI/IRD/CNEN, Av. Salvador Allende, s/no, Recreio dos Bandeirantes, CEP: 22780-160, Rio de Janeiro (Brazil); Xavier da Silva, Ademir, E-mail: ademir@con.ufrj.b [Programa de Engenharia Nuclear/COPPE, Universidade Federal do Rio de Janeiro, Ilha do Fundao, Caixa Postal 68509, 21945-970, Rio de Janeiro, RJ (Brazil); Simoes da Fonseca, Evaldo, E-mail: evaldo@ird.gov.b [Instituto de Radioprotecao e Dosimetria LNMRI/IRD/CNEN, Av. Salvador Allende, s/no, Recreio dos Bandeirantes, CEP: 22780-160, Rio de Janeiro (Brazil); Souza Patrao, Karla Cristina de, E-mail: karla@ird.gov.b [Instituto de Radioprotecao e Dosimetria LNMRI/IRD/CNEN, Av. Salvador Allende, s/no, Recreio dos Bandeirantes, CEP: 22780-160, Rio de Janeiro (Brazil)

    2010-12-15

    An alternative irradiation system, which works with a radionuclide neutron source and manganese sulphate solution volume have been proposed for efficiency determination of a Manganese Bath System (MBS). This irradiation system was designed by simulation with MCNP5 code, considering a californium neutron source in several manganese sulphate volumes and different neutron reflectors. Although its solution specific activity are less than those in nuclear reactors, the simulation results have showed that the irradiation system proposed takes a manganese neutron capture increase up to 200 times when it compared to manganese neutron capture from a MBS whose diameter is about 100 cm. That becomes possible to use those samples for some of the absolute specific activity measuring methods.

  19. The CARIBU EBIS control and synchronization system

    Energy Technology Data Exchange (ETDEWEB)

    Dickerson, Clayton, E-mail: cdickerson@anl.gov; Peters, Christopher, E-mail: cdickerson@anl.gov [Argonne National Laboratory, Argonne, IL 60439 (United States)

    2015-01-09

    The Californium Rare Isotope Breeder Upgrade (CARIBU) Electron Beam Ion Source (EBIS) charge breeder has been built and tested. The bases of the CARIBU EBIS electrical system are four voltage platforms on which both DC and pulsed high voltage outputs are controlled. The high voltage output pulses are created with either a combination of a function generator and a high voltage amplifier, or two high voltage DC power supplies and a high voltage solid state switch. Proper synchronization of the pulsed voltages, fundamental to optimizing the charge breeding performance, is achieved with triggering from a digital delay pulse generator. The control system is based on National Instruments realtime controllers and LabVIEW software implementing Functional Global Variables (FGV) to store and access instrument parameters. Fiber optic converters enable network communication and triggering across the platforms.

  20. Review of microscopic integral cross section data in fundamental reactor dosimetry benchmark neutron fields

    International Nuclear Information System (INIS)

    Fabry, A.; McElroy, W.N.; Kellogg, L.S.; Lippincott, E.P.; Grundl, J.A.; Gilliam, D.M.; Hansen, G.E.

    1976-01-01

    This paper is intended to review and critically discuss microscopic integral cross section measurement and calculation data for fundamental reactor dosimetry benchmark neutron fields. Specifically the review covers the following fundamental benchmarks: the spontaneous californium-252 fission neutron spectrum standard field; the thermal-neutron induced uranium-235 fission neutron spectrum standard field; the (secondary) intermediate-energy standard neutron field at the center of the Mol-ΣΣ, NISUS, and ITN-ΣΣ facilities; the reference neutron field at the center of the Coupled Fast Reactor Measurement Facility; the reference neutron field at the center of the 10% enriched uranium metal, cylindrical, fast critical; the (primary) Intermediate-Energy Standard Neutron Field

  1. Measurements of the neutron capture cross sections and incineration potentials of minor-actinides in high thermal neutron fluxes: Impact on the transmutation of nuclear wastes; Mesures des sections efficaces de capture et potentiels d'incineration des actinides mineurs dans les hauts flux de neutrons: Impact sur la transmutation des dechets

    Energy Technology Data Exchange (ETDEWEB)

    Bringer, O

    2007-10-15

    This thesis comes within the framework of minor-actinide nuclear transmutation studies. First of all, we have evaluated the impact of minor actinide nuclear data uncertainties within the cases of {sup 241}Am and {sup 237}Np incineration in three different reactor spectra: EFR (fast), GT-MHR (epithermal) and HI-HWR (thermal). The nuclear parameters which give the highest uncertainties were thus highlighted. As a result of fact, we have tried to reduce data uncertainties, in the thermal energy region, for one part of them through experimental campaigns in the moderated high intensity neutron fluxes of ILL reactor (Grenoble). These measurements were focused onto the incineration and transmutation of the americium-241, the curium-244 and the californium-249 isotopes. Finally, the values of 12 different cross sections and the {sup 241}Am isomeric branching ratio were precisely measured at thermal energy point. (author)

  2. Environmental assessment of the thermal neutron activation explosive detection system for concourse use at US airports

    Energy Technology Data Exchange (ETDEWEB)

    Jones, C.G.

    1990-08-01

    This document is an environmental assessment of a system designed to detect the presence of explosives in checked airline baggage or cargo. The system is meant to be installed at the concourse or lobby ticketing areas of US commercial airports and uses a sealed radioactive source of californium-252 to irradiate baggage items. The major impact of the use of this system arises from direct exposure of the public to scattered or leakage radiation from the source and to induced radioactivity in baggage items. Under normal operation and the most likely accident scenarios, the environmental impacts that would be created by the proposed licensing action would not be significant. 44 refs., 19 figs., 18 tabs.

  3. Radionuclide toxicity

    International Nuclear Information System (INIS)

    Galle, P.

    1982-01-01

    The aim of this symposium was to review the radionuclide toxicity problems. Five topics were discussed: (1) natural and artificial radionuclides (origin, presence or emission in the environment, human irradiation); (2) environmental behaviour of radionuclides and transfer to man; (3) metabolism and toxicity of radionuclides (radioiodine, strontium, rare gas released from nuclear power plants, ruthenium-activation metals, rare earths, tritium, carbon 14, plutonium, americium, curium and einsteinium, neptunium, californium, uranium) cancerogenous effects of radon 222 and of its danghter products; (4) comparison of the hazards of various types of energy; (5) human epidemiology of radionuclide toxicity (bone cancer induction by radium, lung cancer induction by radon daughter products, liver cancer and leukaemia following the use of Thorotrast, thyroid cancer; other site of cancer induction by radionuclides) [fr

  4. A survey of uses and users of 252Cf

    International Nuclear Information System (INIS)

    Bigelow, J.E.; Alexander, C.W.; King, L.J.; Knauer, J.B.; Notz, K.J.

    1989-01-01

    Californium-252, which is one of the transuranium-element isotopes being produced in the Radiochemical Engineering Development Center (REDC) at Oak Ridge National Laboratory (ORNL), has found many applications in service to industry and medicine. As a neutron source, 252 Cf is unique in providing a highly concentrated and extremely reliable neutron spectrum from a very small assembly. Over the past 22 years, 252 Cf has been applied with great success to cancer therapy, to neutron radiography of objects ranging from flowers to entire aircraft, to startup sources for nuclear reactors, to fission activation assay for quality control and safeguards of all commercial nuclear fuel, and to many other beneficial uses, some of which are now poised for further growth. The extensive exploitation of this highly specialized product has been made possible through 252 Sales/Loan programs sponsored by the US DOE Office of Nuclear Materials Production, initially at the Savannah River Laboratory and now at ORNL

  5. Off-line commissioning of EBIS and plans for its integration into ATLAS and CARIBU

    Energy Technology Data Exchange (ETDEWEB)

    Ostroumov, P. N., E-mail: ostroumov@anl.gov; Barcikowski, A.; Dickerson, C. A.; Mustapha, B.; Perry, A.; Sharamentov, S. I.; Vondrasek, R. C.; Zinkann, G. [Argonne National Laboratory, Argonne, Illinois 60439 (United States)

    2016-02-15

    An Electron Beam Ion Source Charge Breeder (EBIS-CB) has been developed at Argonne to breed radioactive beams from the CAlifornium Rare Isotope Breeder Upgrade (CARIBU) facility at Argonne Tandem Linac Accelerator System (ATLAS). The EBIS-CB will replace the existing ECR charge breeder to increase the intensity and significantly improve the purity of reaccelerated radioactive ion beams. The CARIBU EBIS-CB has been successfully commissioned offline with an external singly charged cesium ion source. The performance of the EBIS fully meets the specifications to breed rare isotope beams delivered from CARIBU. The EBIS is being relocated and integrated into ATLAS and CARIBU. A long electrostatic beam transport system including two 180° bends in the vertical plane has been designed. The commissioning of the EBIS and the beam transport system in their permanent location will start at the end of this year.

  6. Off-line commissioning of EBIS and plans for its integration into ATLAS and CARIBU

    Science.gov (United States)

    Ostroumov, P. N.; Barcikowski, A.; Dickerson, C. A.; Mustapha, B.; Perry, A.; Sharamentov, S. I.; Vondrasek, R. C.; Zinkann, G.

    2016-02-01

    An Electron Beam Ion Source Charge Breeder (EBIS-CB) has been developed at Argonne to breed radioactive beams from the CAlifornium Rare Isotope Breeder Upgrade (CARIBU) facility at Argonne Tandem Linac Accelerator System (ATLAS). The EBIS-CB will replace the existing ECR charge breeder to increase the intensity and significantly improve the purity of reaccelerated radioactive ion beams. The CARIBU EBIS-CB has been successfully commissioned offline with an external singly charged cesium ion source. The performance of the EBIS fully meets the specifications to breed rare isotope beams delivered from CARIBU. The EBIS is being relocated and integrated into ATLAS and CARIBU. A long electrostatic beam transport system including two 180° bends in the vertical plane has been designed. The commissioning of the EBIS and the beam transport system in their permanent location will start at the end of this year.

  7. Chemical consequences of radioactive decay. 1. Study of 249Cf ingrowth into crystalline 249BkBr3: a new crystalline phase of CfBr3

    International Nuclear Information System (INIS)

    Young, J.P.; Haire, R.G.; Peterson, J.R.; Ensor, D.D.; Fellows, R.L.

    1980-01-01

    Spectrophotometric and x-ray powder diffraction methods have been applied to a study of the ingrowth of californium-249 by β - decay of berkelium-249 in crystalline 249 BkBr 3 . It was found that the Cf daughter grows in with the same oxidation state and crystal structure as the parent. Thus, six-coordinate BkBr 3 (AlCl 3 -type monoclinic structure) generates six-coordinate CfBr 3 , and eight-coordinate BkBr 3 (PuBr 3 -type orthorhombic structure) generates eight-coordinate CfBr 3 , a previously unknown form of CfBr 3 . It was also found that the daughter Cf(III) in the BkBr 3 parent compound can be reduced to Cf(II) by treatment with H 2 , as it can in pure CfBr 3 . 5 figures

  8. Chelation and stabilization of berkelium in oxidation state +IV

    Science.gov (United States)

    Deblonde, Gauthier J.-P.; Sturzbecher-Hoehne, Manuel; Rupert, Peter B.; An, Dahlia D.; Illy, Marie-Claire; Ralston, Corie Y.; Brabec, Jiri; de Jong, Wibe A.; Strong, Roland K.; Abergel, Rebecca J.

    2017-09-01

    Berkelium (Bk) has been predicted to be the only transplutonium element able to exhibit both +III and +IV oxidation states in solution, but evidence of a stable oxidized Bk chelate has so far remained elusive. Here we describe the stabilization of the heaviest 4+ ion of the periodic table, under mild aqueous conditions, using a siderophore derivative. The resulting Bk(IV) complex exhibits luminescence via sensitization through an intramolecular antenna effect. This neutral Bk(IV) coordination compound is not sequestered by the protein siderocalin—a mammalian metal transporter—in contrast to the negatively charged species obtained with neighbouring trivalent actinides americium, curium and californium (Cf). The corresponding Cf(III)-ligand-protein ternary adduct was characterized by X-ray diffraction analysis. Combined with theoretical predictions, these data add significant insight to the field of transplutonium chemistry, and may lead to innovative Bk separation and purification processes.

  9. Reactor production of 252Cf and transcurium isotopes

    International Nuclear Information System (INIS)

    Alexander, C.W.; Halperin, J.; Walker, R.L.; Bigelow, J.E.

    1990-01-01

    Berkelium, californium, einsteinium, and fermium are currently produced in the High Flux Isotope Reactor (HFIR) and recovered in the Radiochemical Engineering Development Center (REDC) at the Oak Ridge National Laboratory (ORNL). All the isotopes are used for research. In addition, 252 Cf, 253 Es, and 255 Fm have been considered or are used for industrial or medical applications. ORNL is the sole producer of these transcurium isotopes in the western world. A wide range of actinide samples were irradiated in special test assemblies at the Fast Flux Test Facility (FFTF) at Hanford, Washington. The purpose of the experiments was to evaluate the usefulness of the two-group flux model for transmutations in the special assemblies with an eventual goal of determining the feasibility of producing macro amounts of transcurium isotopes in the FFTF. Preliminary results from the production of 254g Es from 252 Cf will be discussed. 14 refs., 5 tabs

  10. Robotics and remote systems applications

    International Nuclear Information System (INIS)

    Rabold, D.E.

    1996-01-01

    This article is a review of numerous remote inspection techniques in use at the Savannah River (and other) facilities. These include: (1) reactor tank inspection robot, (2) californium waste removal robot, (3) fuel rod lubrication robot, (4) cesium source manipulation robot, (5) tank 13 survey and decontamination robots, (6) hot gang valve corridor decontamination and junction box removal robots, (7) lead removal from deionizer vessels robot, (8) HB line cleanup robot, (9) remote operation of a front end loader at WIPP, (10) remote overhead video extendible robot, (11) semi-intelligent mobile observing navigator, (12) remote camera systems in the SRS canyons, (13) cameras and borescope for the DWPF, (14) Hanford waste tank camera system, (15) in-tank precipitation camera system, (16) F-area retention basin pipe crawler, (17) waste tank wall crawler and annulus camera, (18) duct inspection, and (19) deionizer resin sampling

  11. General purpose nuclear irradiation chamber

    International Nuclear Information System (INIS)

    Nurul Fadzlin Hasbullah; Nuurul Iffah Che Omar; Nahrul Khair Alang Md Rashid; Jaafar Abdullah

    2013-01-01

    Nuclear technology has found a great need for use in medicine, industry, and research. Smoke detectors in our homes, medical treatments and new varieties of plants by irradiating its seeds are just a few examples of the benefits of nuclear technology. Portable neutron source such as Californium-252, available at Industrial Technology Division (BTI/ PAT), Malaysian Nuclear Agency, has a 2.645 year half-life. However, 252 Cf is known to emit gamma radiation from the source. Thus, this chamber aims to provide a proper gamma shielding for samples to distinguish the use of mixed neutron with gamma-rays or pure neutron radiation. The chamber is compatible to be used with other portable neutron sources such as 241 Am-Be as well as the reactor TRIGA PUSPATI for higher neutron dose. This chamber was designed through a collaborative effort of Kulliyyah Engineering, IIUM with the Industrial Technology Division (BTI) team, Malaysian Nuclear Agency. (Author)

  12. Environmental assessment of the thermal neutron activation explosive detection system for concourse use at US airports

    International Nuclear Information System (INIS)

    Jones, C.G.

    1990-08-01

    This document is an environmental assessment of a system designed to detect the presence of explosives in checked airline baggage or cargo. The system is meant to be installed at the concourse or lobby ticketing areas of US commercial airports and uses a sealed radioactive source of californium-252 to irradiate baggage items. The major impact of the use of this system arises from direct exposure of the public to scattered or leakage radiation from the source and to induced radioactivity in baggage items. Under normal operation and the most likely accident scenarios, the environmental impacts that would be created by the proposed licensing action would not be significant. 44 refs., 19 figs., 18 tabs

  13. Test and evaluation results of the 252Cf shuffler at the Savannah River Plant

    International Nuclear Information System (INIS)

    Crane, T.W.

    1981-03-01

    The 252 Cf Shuffler, a nondestructive assay instrument employing californium neutron source irradiation and delayed-neutron counting, was developed for measuring 235 U content of scrap and waste items generated at the Savannah River Plant (SRP) reactor fuel fabrication facility. The scrap and waste items include high-purity uranium-aluminum alloy ingots as well as pieces of castings, saw and lathe chips from machining operations, low-purity items such as oxides of uranium or uranium intermixed with flux materials found in recovery operations, and materials not recoverable at SRP such as floor sweepings or residues from the uranium scrap recovery operation. The uranium contains about 60% 235 U with the remaining isotopes being 236 U, 238 U, and 234 U in descending order. The test and evaluation at SRP concluded that the accuracy, safety, reliability, and ease of use made the 252 Cf Shuffler a suitable instrument for routine use in an industrial, production-oriented plant

  14. Provenance and composition study on Terengganu inscribed stone using in-situ nuclear technology

    International Nuclear Information System (INIS)

    Jaafar Abdullah; Roslan Yahya; Hearie Hassan; Engku Mohd Fahmi Engku Chik; Mohamad Rabaie Shari; Airwan Affendi Mahmood; Abdul Quddoss Abu Bakar; Ainul Mardhiah Terry

    2012-01-01

    This paper focused on the analysis of trace elements and provenance study of the Inscribed Stone of Terengganu (BBPT) using Neutron-induced Prompt Gamma-Ray Techniques (NIPGAT). In this study, portable NIPGAT system was designed and developed by using volume-based measurement. It is a nondestructive testing technique for the samples. This system uses low activity of isotopic neutron radioactive source from californium-252 (Cf-252) as an irradiation source. Gamma ray spectroscopy as well as specialized computer software has been utilized to conduct the research. The study has determined that the stone was a dolerite stone based on the composition of the stone elements. Although most of the scientific data for this study have been collected, this project is still running to complete the scope of provenance study. (author)

  15. Measurements of the neutron capture cross sections and incineration potentials of minor-actinides in high thermal neutron fluxes: Impact on the transmutation of nuclear wastes

    International Nuclear Information System (INIS)

    Bringer, O.

    2007-10-01

    This thesis comes within the framework of minor-actinide nuclear transmutation studies. First of all, we have evaluated the impact of minor actinide nuclear data uncertainties within the cases of 241 Am and 237 Np incineration in three different reactor spectra: EFR (fast), GT-MHR (epithermal) and HI-HWR (thermal). The nuclear parameters which give the highest uncertainties were thus highlighted. As a result of fact, we have tried to reduce data uncertainties, in the thermal energy region, for one part of them through experimental campaigns in the moderated high intensity neutron fluxes of ILL reactor (Grenoble). These measurements were focused onto the incineration and transmutation of the americium-241, the curium-244 and the californium-249 isotopes. Finally, the values of 12 different cross sections and the 241 Am isomeric branching ratio were precisely measured at thermal energy point. (author)

  16. Nuclear fission and the transuranium elements

    International Nuclear Information System (INIS)

    Seaborg, G.T.

    1989-02-01

    Many of the transuranium elements are produced and isolated in large quantities through the use of neutrons furnished by nuclear fission reactions: plutonium (atomic number 94) in ton quantities; neptunium (93), americium (95), and curium (96) in kilogram quantities; berkelium (97) in 100 milligram quantities; californium (98) in gram quantities; and einsteinium (99) in milligram quantities. Transuranium isotopes have found many practical applications---as nuclear fuel for the large-scale generation of electricity, as compact, long-lived power sources for use in space exploration, as means for diagnosis and treatment in the medical area, and as tools in numerous industrial processes. Of particular interest is the unusual chemistry and impact of these heaviest elements on the periodic table. This account will feature these aspects. 9 refs., 5 figs

  17. Operational safety at the radiometallurgy laboratory of Fontenay-aux-Roses

    International Nuclear Information System (INIS)

    Hayet, Lucien; Petit, Pierre; Conche, Roger.

    1976-01-01

    Opened in 1967, the Radiometallurgy Laboratory is responsible for the examination of plutonium 239 based nuclear fuels of breeder reactors such as Rapsodie and Phenix. Part of the same laboratory is also responsible for the manufacture of californium 252 sources. These neutron sources can have a neutron fluency yield of 2,3 10 10 n/s/4π (i.e. 10mg of 252cf). This large laboratory includes a total area of 117m 2 of hot surfaces. It also includes 14 high activity cells with a capacity of 100000Ci at 1MeV. Located only 7km from the center of Paris, it must incorporate a special design and a particularly sure safety policy. Several statistics are given: irradiations, contaminations, incidents, quantity of fissile material, solid and liquid wastes etc... The principles of safety management are outlined and an analysis given of this basic nuclear facility [fr

  18. Review of microscopic integral cross section data in fundamental reactor dosimetry benchmark neutron fields

    International Nuclear Information System (INIS)

    Fabry, A.; McElroy, W.N.; Kellogg, L.S.; Lippincott, E.P.; Grundl, J.A.; Gilliam, D.M.; Hansen, G.E.

    1976-10-01

    The paper is intended to review and critically discuss microscopic integral cross section measurement and calculation data for fundamental reactor dosimetry benchmark neutron fields. Specifically the review covers the following fundamental benchmarks: (1) the spontaneous californium-252 fission neutron spectrum standard field; (2) the thermal-neutron induced uranium-235 fission neutron spectrum standard field; (3) the (secondary) intermediate-energy standard neutron field at the center of the Mol-ΣΣ, NISUS, and ITN--ΣΣ facilities; (4) the reference neutron field at the center of the Coupled Fast Reactor Measurement Facility (CFRMF); (5) the reference neutron field at the center of the 10 percent enriched uranium metal, cylindrical, fast critical; and (6) the (primary) Intermediate-Energy Standard Neutron Field

  19. Triton and alpha-particle contribution from LiF converter for neutron dosimeter

    CERN Document Server

    Camacho, M E; Balcazar, M

    1999-01-01

    A personnel neutron dosimeter prototype based on chemical and electrochemical etched CR-39 detector, combined with LiF converter, has been calibrated using an ICRP-like phantom, under a heavy-water moderated Californium source neutron spectra; A conversion factor of 1.052+-126 spots cm sup - sup 2 mSv sup - sup 1 was obtained. The sealing properties of the detector holder showed a ten-fold reduction in radon background when it was tested in a high radon atmosphere. A convenient mechanical shock resistance was achieved in LiF converters by sintering to 11 tons pressure LiF powder at 650 deg. C, during one hour.

  20. Fabrication of 50-mg 252Cf neutron sources for the FDA [Food and Drug Administration] activation analysis facility

    International Nuclear Information System (INIS)

    Bigelow, J.E.; Cagle, E.B.; Knauer, J.B.

    1987-01-01

    The Transuranium Processing Plant (TPP) at ORNL has been requested by the Food and Drug Administration (FDA) to furnish 200 mg of 252 Cf for use in their new activation analysis facility. This paper discusses the procedure to be employed in fabricating the californium into four neutron sources, each containing a nominal 50-mg of 252 Cf. The ORNL Model LSD (Large, Stainless steel, Doubly encapsulated) neutron source consists of a 6.33-mm-diam aluminum pellet doubly encapsulated in Type 304L stainless steel. The pellet is comprised of an aluminum tube holding Cf 2 O 2 SO 4 microspheres confined by pressed aluminum powder. The microspheres are prepared in a separate vessel and then transferred into the specially designed aluminum tube prior to pressing

  1. Nuclear fission and the transuranium elements

    Energy Technology Data Exchange (ETDEWEB)

    Seaborg, G.T.

    1989-02-01

    Many of the transuranium elements are produced and isolated in large quantities through the use of neutrons furnished by nuclear fission reactions: plutonium (atomic number 94) in ton quantities; neptunium (93), americium (95), and curium (96) in kilogram quantities; berkelium (97) in 100 milligram quantities; californium (98) in gram quantities; and einsteinium (99) in milligram quantities. Transuranium isotopes have found many practical applications---as nuclear fuel for the large-scale generation of electricity, as compact, long-lived power sources for use in space exploration, as means for diagnosis and treatment in the medical area, and as tools in numerous industrial processes. Of particular interest is the unusual chemistry and impact of these heaviest elements on the periodic table. This account will feature these aspects. 9 refs., 5 figs.

  2. Spectrum-averaged cross-section measurement of /sup 103/Rh(n,n)/sup 103m/Rh in the /sup 252/Cf fission neutron spectrum

    International Nuclear Information System (INIS)

    Lamaze, G.P.; Schima, F.J.; Eisenhauer, C.M.; Spiegel, V.

    1988-01-01

    Because of the similarity in energy dependence of the /sup 103/Rh(n,n') differential cross section to the kerma muscle response function for neutrons, rhodium may be useful as a neutron kerma monitor. In support of its use as a neutron monitor, the spectrum-averaged cross section σ-bar has been measured for a /sup 252/Cf fission neutron spectrum. Pairs of thin rhodium samples were irradiated on opposite sides of a thinly encapsulated /sup 252/Cf neutron source. The neutron emission rate of the /sup 252/Cf source was determined by the manganous sulfate (MnSO/sub 4/) bath technique. In this method, the californium source emission rate is determined by comparison to the known emission rate of NBS-I, a standard radium-beryllium neutron source. The neutron fluence incident on the rhodium samples is determined from the californium source strength, average sample-to-source distance, and the duration of the irradiation. Corrections are made for neutron scattering saturation of activity, and attenuation of the X rays by the sample during counting. The X rays were detected with an intrinsic germanium detector designed specifically for low-energy X-ray detection. The activity was not determined by absolute counting so that the final results depend on the value of P/sub Κx/, to total Κ X-ray emission probability. The results of five separate irradiations yield a value of σ-bar . P/sub Κx/ = 62.3 +- 1.9 mb. Using the most recently published value of P/sub Κx/ gives a value of σ-bar = 739 +- 22 mb. A discussion of systematic uncertainties is given

  3. Study of reproducibility of measurements with the spectrometer of Bonner multispheres

    International Nuclear Information System (INIS)

    Azevedo, G.A.; Pereira, W.W.; Patrao, K.C.S.; Fonseca, E.S.

    2013-01-01

    This work aims to study the metrological behavior of the Bonner Multisphere Spectrometer (BMS) of the LN / LNMRI / IRD - Laboratorio Metrologia de Neutrons / Laboratorio Nacional de Metrologia e Radiacao Ionizante / Instituto de Radioprotecao e Dosimetria, for measurements in repeatability and reproducibility conditions. Initially, a simulation was done by applying the Monte Carlo method, using the MCNP code and respecting the ISO 8529-1 (2001), using the sources of Californium ( 252 Cf), Americium-Beryllium ( 241 AmBe) and californium in heavy water (Cf + D 2 O), all located at a distance of 100 cm from the neutron detector ( 6 Li (Eu) - crystal scintillator). In this program, the counting of neutrons that are captured by the detector was made. The source is located in the center of a sphere of radius 300 cm. Analyzes the impact of these neutrons in a point of the sphere wall, which in this case acted as a neutron detector and from there, it is estimated the number of neutrons that collide in the whole sphere. The purpose is to obtain the neutron count for different energy bands in a solid field of neutrons, since they have a spectrum ranging from a low to a high energy that can also vary within a particular environment. Wishes to obtain new fields with different sources and moderators materials to be used as new reference fields. Measurements are being conducted for these fields, with the aim of analyzing the variability conditions of the measurement (repeatability and reproducibility) in LEN - Laboratorio de Espectrometria de Neutrons of the LN/LMNRI/IRD. Thus, the spectrometer will be used to improve both the knowledge of the spectrum as the standard of neutrons of the lab, proving that a spectrometry is essential for correct measurement

  4. Retinitis Pigmentosa Mutations in Bad Response to Refrigeration 2 (Brr2) Impair ATPase and Helicase Activity.

    Science.gov (United States)

    Ledoux, Sarah; Guthrie, Christine

    2016-06-03

    Brr2 is an RNA-dependent ATPase required to unwind the U4/U6 snRNA duplex during spliceosome assembly. Mutations within the ratchet helix of the Brr2 RNA binding channel result in a form of degenerative human blindness known as retinitis pigmentosa (RP). The biochemical consequences of these mutations on Brr2's RNA binding, helicase, and ATPase activity have not yet been characterized. Therefore, we identified the largest construct of Brr2 that is soluble in vitro, which truncates the first 247 amino acids of the N terminus (Δ247-Brr2), to characterize the effects of the RP mutations on Brr2 activity. The Δ247-Brr2 RP mutants exhibit a gradient of severity of weakened RNA binding, reduced helicase activity, and reduced ATPase activity compared with wild type Δ247-Brr2. The globular C-terminal Jab1/Mpn1-like domain of Prp8 increases the ability of Δ247-Brr2 to bind the U4/U6 snRNA duplex at high pH and increases Δ247-Brr2's RNA-dependent ATPase activity and the extent of RNA unwinding. However, this domain of Prp8 does not differentially affect the Δ247-Brr2 RP mutants compared with the wild type Δ247-Brr2. When stimulated by Prp8, wild type Δ247-Brr2 is able to unwind long stable duplexes in vitro, and even the RP mutants capable of binding RNA with tight affinity are incapable of fully unwinding short duplex RNAs. Our data suggest that the RP mutations within the ratchet helix impair Brr2 translocation through RNA helices. © 2016 by The American Society for Biochemistry and Molecular Biology, Inc.

  5. Alzheimer's Disease Facts and Figures

    Medline Plus

    Full Text Available ... were diagnosed in the mild cognitive impairment (MCI) stage — before dementia — it would collectively save $7 trillion ... symptoms What is dementia What is Alzheimer's 7 stages of Alzheimer's Treatments Contact us 24/7 Helpline: ...

  6. 75 FR 5877 - Commodity Supplemental Food Program (CSFP): Amendment Removing Priority Given to Women, Infants...

    Science.gov (United States)

    2010-02-05

    ... Education, Food assistance programs, Grant programs--health, Grant programs--social programs, Indians... requirements, Surplus agricultural commodities, Women. 0 Accordingly, 7 CFR part 247 is amended as follows...

  7. Report on progress of researches by common utilization of JAERI nuclear facilities, for fiscal 1992

    International Nuclear Information System (INIS)

    1993-08-01

    The results of the joint researches by utilizing the facilities of JAERI in 1992 fiscal year were summarized. The number of research themes in 1992 was 247 cases. In this book, 166 reports are collected. (J.P.N.)

  8. Microstructure and oxidation performance of a γ–γ′ Pt-aluminide ...

    Indian Academy of Sciences (India)

    Microstructure and oxidation performance of a –' Pt-aluminide bond coat on directionally solidified superalloy CM-247LC ... Keywords. Platinum aluminide bond coat; coating; cyclic oxidation; superalloy; microstructure. ... Defence Metallurgical Research Laboratory, Kanchanbagh, Hyderabad 500 058, India ...

  9. Fulltext PDF

    Indian Academy of Sciences (India)

    Unknown

    Department of Metallurgical and Materials Engineering, Indian Institute of Technology, Roorkee 247 667, India .... nucleation, dispersoids can also increase the rate of crack ... compounds allows the possibility of precracking during.

  10. Basal metabolic rate scaled to body mass between species by the ...

    African Journals Online (AJOL)

    Marlene Botha

    2017-03-19

    Mar 19, 2017 ... whole body fractal vascular dimension D is also applicable to all organs or ... slices, mitochondrial surface areas, and blood oxygen transport. ... Sci. vol. 47. 247. Results and Discussion. The principle of self-similarity implies ...

  11. Head Injury and Dizziness

    Science.gov (United States)

    ... was developed by subject matter experts from the Defense Department and Department of Veterans Affairs. (Revised January 2018) ... to Improve Your Memory Crisis Intervention (24/7) Department of ... Contact Us Terms and Conditions Privacy and Security Freedom of ...

  12. TAX REFORMS AND INVESTMENT IN NIGERIA: AN EMPIRICAL ...

    African Journals Online (AJOL)

    GRACE

    Tax generated revenues are used to finance public utilities, perform social responsibilities and grease the ..... Capital Theory and Investment Behaviours, The American Review,. 53:247-257. ... ESUT Journal of Accounting, 5(2). December ...

  13. Alzheimer's Disease Facts and Figures

    Medline Plus

    Full Text Available ... on the latest news and advances in Alzheimer's treatments, care and research. Get tips for living with ... dementia What is Alzheimer's 7 stages of Alzheimer's Treatments Contact us 24/7 Helpline: 1-800-272- ...

  14. Bulletin of Materials Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Author Affiliations. RAVI KANT1 UJJWAL PRAKASH1 VIJAYA AGARWALA1 V V SATYA PRASAD2. Department of Metallurgical and Materials Engineering, IIT Roorkee, Roorkee 247 667, India; Defence Metallurgical Research Laboratory, Kanchanbagh, Hyderabad 500 058, India ...

  15. Download this PDF file

    African Journals Online (AJOL)

    cptldesign4

    asymptomatic pregnant women attending Bugando Medical centre (BMC) in Mwanza, Tanzania. A total of 247 ... In conclusion, asymptomatic bacteriuria among pregnant women is .... Symptomatic patients were given treatment empirically ...

  16. Historie a současný stav urychlovačů částic v českých zemích. II. Kruhové urychlovače

    Czech Academy of Sciences Publication Activity Database

    Janovský, I.; Šimáně, Čestmír

    2012-01-01

    Roč. 62, č. 4 (2012), s. 239-247 ISSN 0009-0700 Institutional support: RVO:61389005 Keywords : accelerator history * cyclic accelerator s Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders

  17. Alzheimer's Disease Facts and Figures

    Medline Plus

    Full Text Available ... is Alzheimer's 7 stages of Alzheimer's Treatments Contact us 24/7 Helpline: 1-800-272-3900 Find ... Walk to End Alzheimer's Become an advocate About Us | News | Events | Press | About this Site | Privacy Policy | ...

  18. delta-Thiolactones as Prodrugs of Thiol-Based Glutamate Carboxypeptidase II (GCPII) Inhibitors

    Czech Academy of Sciences Publication Activity Database

    Ferraris, D. V.; Majer, Pavel; Ni, C.; Slusher, C. E.; Rais, R.; Wu, Y.; Wozniak, K. M.; Alt, J.; Rojas, C.; Slusher, B. S.; Tsukamoto, T.

    2014-01-01

    Roč. 57, č. 1 (2014), s. 243-247 ISSN 0022-2623 Institutional support: RVO:61388963 Keywords : pharmacokinetics * discovery * disorders * diagnosis * pain Subject RIV: CC - Organic Chemistry Impact factor: 5.447, year: 2014

  19. AFRREV IJAH, Vol.2 (1) February, 2012

    African Journals Online (AJOL)

    user

    formidable force for governance and the people had great respect for it. Commendably, the rule ... not only revered but wielded unreserved influence on their subjects. .... in Asemah (2010, p.247) defines Public Relations as ―winning friends,.

  20. Bulletin of Materials Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Author Affiliations. Abdulhaqq A Hamid1 2 Rafi K Yahya1. Mechanical Engineering Department, College of Engineering, University of Mosul, Mosul, Iraq; Mechanical and Industrial Engineering Department, Indian Institute of Technology, Roorkee 247 667, India ...

  1. Creutzfeldt-Jakob Disease

    Science.gov (United States)

    ... in the chromosome 20 gene coding the biological blueprint for prion protein. People who develop familial CJD ... other dementias, and help you find local support services. Call our 24/7 Helpline at 800.272. ...

  2. Antagonistic effects of three species of Trichoderma sp. on ...

    African Journals Online (AJOL)

    Francis

    This research was funded by a grant (Project No. 247) from National ... quantities of protein utilizing the principle of protein-dye binding, Analytical Biochemistry 72, 248-254. ... Innovative approaches to plant disease control. John Wiley &.

  3. Statistical analysis of long term spatial and temporal trends of ...

    Indian Academy of Sciences (India)

    Water Resources Systems Division, National Institute of Hydrology, Roorkee 247 667, India. ∗. Corresponding author. e-mail: ..... adopting established meteorological techniques like ...... a decision support tool for the assessment of regional.

  4. Present and future water resources in India: Insights from satellite ...

    Indian Academy of Sciences (India)

    C climate change (although the range of model results, 247 mm/year, demonstrates high ... may subsequently influence the longevity of the local groundwater resource. However, at recent .... cloud cover fraction (all detrended prior to 1901),.

  5. Technical Findings, Lessons Learned, and Recommendations Resulting from the Helios Prototype Vehicle Mishap

    National Research Council Canada - National Science Library

    Noll, Thomas E; Ishmael, Stephen D; Henwood, Bart; Perez-Davis, Marla E; Tiffany, Geary C; Madura, John; Gaier, Matthew; Brown, John M; Wierzbanowski, Ted

    2007-01-01

    .... One configuration, designated HP01, was designed to operate at extremely high altitudes using batteries and high-efficiency solar cells spread across the upper surface of its 247-foot wingspan...

  6. Bezradnost metodologie kosmologie?

    Czech Academy of Sciences Publication Activity Database

    Havlík, Vladimír

    2015-01-01

    Roč. 63, č. 2 (2015), s. 247-266 ISSN 0015-1831 Institutional support: RVO:67985955 Keywords : methodology of science * anomalies * dark energy * dark matter * I. Lakatos * T. Kuhn Subject RIV: AA - Philosophy ; Religion

  7. 76 FR 55407 - Announcement of Funding Awards; Public and Indian Housing Family Self-Sufficiency Program Under...

    Science.gov (United States)

    2011-09-07

    ... Bowling Green 247 Double Springs Bowling Green........ KY 42101 47,740 Road. Housing Authority of Glasgow... Norman Street... Saginaw MI 48605 48,675 Housing and Redevelopment 442 Pine Mill Court.. Virginia MN...

  8. 77 FR 14540 - Announcement of Funding Awards for the Public and Indian Housing Family Self-Sufficiency Program...

    Science.gov (United States)

    2012-03-12

    ... Authority of Bowling Green.... 247 Double Springs Road....... Bowling Green 42101 KY 42101 47,470 Housing... MI 49507 65,500 Saginaw Housing Commission 1803 Norman Street Saginaw 48605 MI 48605 48,675 Housing...

  9. Statistical downscaling and projection of future temperature and ...

    Indian Academy of Sciences (India)

    2Water Resources Systems Division, National Institute of Hydrology, Roorkee 247 667, India. 3Department of .... Generator (SWG) based downscaling methods .... It receives water ...... A decision support tool for the assessment of regional cli-.

  10. Ghana Journal of Geography: Submissions

    African Journals Online (AJOL)

    PROMOTING ACCESS TO AFRICAN RESEARCH ... The title page should include: The name(s) of the author(s); A concise and informative ... General Guide ... Journal of Database Marketing & Customer Strategy Management, 17, 247 – 256.

  11. A quantification of discharge readiness after outpatient anaesthesia ...

    African Journals Online (AJOL)

    Adele

    RESEARCH. Southern ... Nurses and patients were blinded to each other's assessments . ... and, 3) time to discharge readiness according to nursing assessments. .... Male/ Female. 69/125. 36/64. Ethnicity: Caucasian. 132. 68. Asian. 48. 24.7.

  12. A Capacitance-Based Methodology for the Estimation of Piezoelectric Coefficients of Poled Piezoelectric Materials

    KAUST Repository

    Al Ahmad, Mahmoud; Alshareef, Husam N.

    2010-01-01

    A methodology is proposed to estimate the piezoelectric coefficients of bulk piezoelectric materials using simple capacitance measurements. The extracted values of d33 and d31 from the capacitance measurements were 506 pC/N and 247 p

  13. Proceedings of the Second Environmental Physics Conference (EPC-2006)

    International Nuclear Information System (INIS)

    Comsan, M.N.H.

    2007-01-01

    The publication has been set up as proceedings of the environmental physics conference. the conference consistes of atmospere and climate; the ecosystem; radiation and radioactivity; activity review; environmental issues. This conference consistes of 247p., figs., tabs., refs

  14. Ilmus väärt artiklikogumik / Arvo Tering

    Index Scriptorium Estoniae

    Tering, Arvo, 1949-

    2008-01-01

    Arvustus: Ajalookirjutaja aeg = Aetas historicum / Eesti Rahvusraamatukogu ; koost. Piret Lotman. - Tallinn, 2008. - 247 lk. - (Eesti Rahvusraamatukogu toimetised. A, Raamat ja aeg, 1736-6984 ; nr. 1) ; (Eesti Rahvusraamatukogu toimetised ; 11)

  15. Iron Chelation

    Science.gov (United States)

    ... U.S.A. Share. Social media brings us together 24/7. Join our online community where you can report, reflect, reconnect. Twitter Facebook LinkedIn YouTube Instagram Pinterest Sign Up. Your First ...

  16. Naegleria

    Science.gov (United States)

    ... Work: Naegleria fowleri CDC at Work: On Call 24/7 Healthy Water Sites Healthy Water Drinking Water Healthy ... Information Language: English (US) Español (Spanish) Recommend on Facebook Tweet Share Compartir Frequently Asked Questions What is ...

  17. Schizophrenia

    Science.gov (United States)

    ... Library Public Policy Research Find Support Free Support 24/7 Text NAMI to 741741 Find Help Living with ... 6264 Press & Media In A Crisis? Stay Connected facebook twitter Instagram tumblr youtube Discussion Groups Terms of ...

  18. Tardive Dyskinesia

    Science.gov (United States)

    ... Library Public Policy Research Find Support Free Support 24/7 Text NAMI to 741741 Find Help Living with ... 6264 Press & Media In A Crisis? Stay Connected facebook twitter Instagram tumblr youtube Discussion Groups Terms of ...

  19. Progress has Stalled in U.S. Stroke Death Rates after Decades of Decline

    Science.gov (United States)

    ... Resistance Cancer Cardiovascular Disease CDC Works for you 24/7 Child Development Disease & Conditions Food Safety Healthcare Associated ... outcomes Language: English (US) Español (Spanish) Recommend on Facebook Tweet Share Compartir Press Release Embargoed Until: Wednesday, ...

  20. Older Adults and Mental Health

    Science.gov (United States)

    ... counselor at a crisis center in your area 24/7. Disaster Distress Helpline : People affected by natural or ... MSC 9663 Bethesda, MD 20892-9663 Follow Us Facebook Twitter YouTube Google Plus NIMH Newsletter NIMH RSS ...

  1. Managing Diabetes: New Technologies Can Make It Easier

    Science.gov (United States)

    ... Epub ahead of print]. PMID: 28855239. 12-Week 24/7 Ambulatory Artificial Pancreas With Weekly Adaptation of Insulin ... nih.gov/wellnesstoolkits . Footer Subscribe Find us on Facebook RSS Home Past Issues About Us Privacy Accessibility ...

  2. Psychosis

    Science.gov (United States)

    ... Library Public Policy Research Find Support Free Support 24/7 Text NAMI to 741741 Find Help Living with ... 6264 Press & Media In A Crisis? Stay Connected facebook twitter Instagram tumblr youtube Discussion Groups Terms of ...

  3. End of Life Care (Brain Tumors)

    Science.gov (United States)

    ... download a template for your state from the Internet. Words on the template can be inserted or ... for free and have access to the site 24/7. Visit Connections TrialConnect™ links patients with appropriate clinical ...

  4. a case study of Ede north local government workers.

    African Journals Online (AJOL)

    ABEOLUGBENGAS

    Risky behaviours and attitudes of healthy Nigerians towards kidney failure: a case ... attitudes of healthy populace of workers of Ede North Local Government Area of Osun State, Nigeria. .... exercise 247 (74.6%), use of alcohol 239 (72.2%).

  5. 2018-05-13T09:08:56Z https://www.ajol.info/index.php/all/oai oai:ojs ...

    African Journals Online (AJOL)

    ... carbon footprint, green and blue water, human nutrition, production systems, ... is a major contributor to global warming resulted mainly from the FAO publication, ... animal production, from environment to human health; 247-254 2221-4062 ...

  6. 76 FR 56724 - Proposed Flood Elevation Determinations

    Science.gov (United States)

    2011-09-14

    ... Town of Clarkstown. Hackensack River confluence. At the upstream side of +248 +247 Little Tor Road... Emergency Management Agency. [FR Doc. 2011-23413 Filed 9-13-11; 8:45 am] BILLING CODE 9110-12-P ...

  7. Defense Infrastructure: General and Flag Officer Quarters at Pearl Harbor, Hawaii

    National Research Council Canada - National Science Library

    2002-01-01

    .... We reviewed 17 GFOQs at Pearl Harbor, Hawaii, with budgeted maintenance and repair costs of $1,247,300, to determine whether the Navy had properly classified interior shutter costs as maintenance and repair...

  8. 78 FR 20324 - Proposed Information Collection Activity: Comment Request

    Science.gov (United States)

    2013-04-04

    ... leadership/ managers, instructional staff, case managers/advisors, partners and employers; (d) a brief survey... (including program leadership, case managers and instructional staff), and other local informants. Annual....083 247 82 Survey, Additional HPOG Questions [[Page 20325

  9. Odraz vrcholně středověké urbanizace v archeologických pramenech na základě vybraných příkladů

    Czech Academy of Sciences Publication Activity Database

    Procházka, Rudolf

    2010-01-01

    Roč. 2010, č. 51 (2010), s. 209-247 ISSN 1211-7250 Institutional research plan: CEZ:AV0Z80010507 Keywords : medieval towns * pre-urban settlements * central Europe Subject RIV: AC - Archeology, Anthropology, Ethnology

  10. Právnický elektronický slovník (PES)

    Czech Academy of Sciences Publication Activity Database

    Cvrček, František

    2015-01-01

    Roč. 154, č. 3 (2015), s. 247-260 ISSN 0231-6625 Institutional support: RVO:68378122 Keywords : legal language * legal dictionaries * linguistic analysis of legal texts Subject RIV: AG - Legal Sciences

  11. Listeria monocytogenes in poultry and poultry products: Epidemiological investigations in seven Danish abattoirs

    DEFF Research Database (Denmark)

    Ojeniyi, B.; Wegener, Henrik Caspar; Jensen, N.E.

    1996-01-01

    Listeria monocytogenes was isolated from 11/236 (4 . 7%) caecal samples from parent flocks, providing broilers to the abattoirs investigated. Caecal samples from 2078 broilers representing 90 randomly selected broiler flocks were negative for L. monocytogenes. A total of 3080 samples from seven...... abattoirs including poultry processing line samples, and final products were also examined for L. monocytogenes. Listeria monocytogenes was isolated in 0 . 3% to 18 . 7% of the samples collected in the different abattoirs. Epidemiological typing of 247 L. monocytogenes isolates, including serotyping, phage...... isolates of L. monocytogenes since only 120/247 (48 . 6%) isolates were typable by phage typing and 230/247 (93 . 1%) L. monocytogenes belonged to serotype 01 while 6/247 (2 . 4%) belonged to 04. The discovery of a few dominating clones in each abattoir might indicate an endemic occurrence of L...

  12. Achados Ultra-Sonográficos em Pacientes com Ameaça de Abortamento no Primeiro Trimestre da Gestação Ultrasound Findings in First-trimester Threatened Abortion

    Directory of Open Access Journals (Sweden)

    Luiz Carlos Watanabe

    2000-06-01

    Full Text Available Objetivo: avaliar os achados ultra-sonográficos nas gestantes com ameaça de abortamento no primeiro trimestre da gestação. Métodos: exames de ultra-som obstétrico transabdominal e transvaginal foram realizados nas pacientes com sangramento vaginal e teste de gravidez positivo. Foram incluídas as gestantes entre 6 a 14 semanas de gestação pela data da última menstruação ou pelo exame ultra-sonográfico, que apresentavam colo do útero impérvio ao exame clínico. Foram excluídas as gestações múltiplas ou aquelas que realizaram tentativa de abortamento por meio de drogas ou manipulação. Resultados: em 132 dos 247 casos (53.4% foi diagnosticada gestação viável e em 46.6% (115/247, gestação inviável. Abortamento incompleto foi identificado em 19% (47/247, abortamento completo em 8,5% (21/247, abortamento retido em 7,7% (19/247, gestação anembrionada em 6,1% (15/247, gestação ectópica em 4,5% (11/247 e mola hidatiforme em 0,8% (2/247. Conclusão: aproximadamente metade (46,6% das gestações com ameaça de abortamento no primeiro trimestre apresentaram diagnóstico de inviabilidade da gestação. O exame ultra-sonográfico pode ajudar a definir esta condição e a conduta obstétrica.Objective: to evaluate ultrasound findings in pregnant women with threatened abortion in the first trimester of pregnancy. Methods: transabdominal and transvaginal ultrasound scans were performed in patients with vaginal bleeding with previous positive pregnancy test. Patients with 6-14-week gestation (by the last menstrual period or ultrasound scan, with closed cervix on clinical evaluation were included. Multiple pregnancies and those patients who have tried abortion by using abortive drugs or manipulation were excluded. Results: in 132 of 247 (53.4% the pregnancy was viable and in 46.6% (115/247 the pregnancy was nonviable. Incomplete miscarriage was found in 19% (47/247, complete miscarriage in 8.5% (21/247, missed abortion in 7.7% (19/247

  13. Extraction optimization and characterization of polysaccharide ...

    African Journals Online (AJOL)

    Keywords: Pinellia rhizoma, Polysaccharides Optimization extraction, Monosaccharide composition,. Antioxidant ..... mean yield of PRP was 2.47 %. Therefore ... Table 3: Analysis of variance (ANOVA) for the fitted quadratic polynomial model.

  14. Statistical analysis of long term spatial and temporal trends of ...

    Indian Academy of Sciences (India)

    Statistical analysis of long term spatial and temporal trends of temperature ... CGCM3; HadCM3; modified Mann–Kendall test; statistical analysis; Sutlej basin. ... Water Resources Systems Division, National Institute of Hydrology, Roorkee 247 ...

  15. Decline in snowfall in response to temperature in Satluj basin ...

    Indian Academy of Sciences (India)

    The study also consists an analysis of average values of annual snowfall and temperature ... During the study, it was observed that the snowfall exhibited declining trends in the basin. ... National Institute of Hydrology, Roorkee 247 667, India.

  16. The Prevalence of Enterhaemorrhagic Escherichia Coli in children ...

    African Journals Online (AJOL)

    EHEC), the pathogenicity of other strains of Escherichia coli and other organisms in children presenting with and without diarrhoea in the hospital. Subjects and Methods: A total of 247 stool samples collected from children aged 1 month to 7 ...

  17. Synthesis and characterization of electroless Ni–P coated graphite ...

    Indian Academy of Sciences (India)

    Wintec

    Metallurgical and Materials Engineering Department, Indian Institute of Technology Roorkee, Roorkee 247 667, India ... the chemical composition of the bath was also reported ..... viour of electroless Ni–P films, Ph.D. Thesis, University of.

  18. Trematodes of fishes of the Indo-west Pacific: told and untold richness

    Czech Academy of Sciences Publication Activity Database

    Cribb, T.H.; Bray, R. A.; Diaz, P.E.; Huston, D.C.; Kudlai, Olena; Martin, S.B.; Yong, R.Q.-Y.; Cutmore, S.C.

    2016-01-01

    Roč. 93, č. 3 (2016), s. 237-247 ISSN 0165-5752 Institutional support: RVO:60077344 Keywords : Great Barrier reef * French Polynesia * Cardicola forsteri Subject RIV: EH - Ecology, Behaviour Impact factor: 1.181, year: 2016

  19. Communication, timing, and common learning

    Czech Academy of Sciences Publication Activity Database

    Steiner, Jakub; Stewart, C.

    2011-01-01

    Roč. 146, č. 1 (2011), s. 230-247 ISSN 0022-0531 Institutional research plan: CEZ:AV0Z70850503 Keywords : common knowledge * learning * communication Subject RIV: AH - Economics Impact factor: 1.235, year: 2011

  20. Alzheimer's Disease Facts and Figures

    Medline Plus

    Full Text Available alz.org | Find Your Chapter 24/7 Helpline: 1.800.272.3900 Find your chapter: search by state In My Area | Alzheimer's & Dementia | Life with ALZ | Research | Professionals

  1. Journal of Earth System Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Author Affiliations. Pravin K Gupta1 Sri Niwas1 Neeta Chaudhary2. Department of Earth Sciences, Indian Institute of Technology Roorkee, Roorkee 247 667, India. Oil and Natural Gas Corporation, Priyadarshini Building, Sion, Mumbai, India.

  2. Development of a specification for flexible base construction.

    Science.gov (United States)

    2014-01-01

    The Texas Department of Transportation (TxDOT) currently uses Item 247 Flexible Base to specify a : pavement foundation course. The goal of this project was to evaluate the current method of base course : acceptance and investigate methods to r...

  3. 0-6621 : developing a mixture-based specification for flexible base.

    Science.gov (United States)

    2012-08-01

    The Texas Department of Transportation : (TxDOT) currently utilizes Item 247, Flexible : Base, to specify a foundation course of flexible : base utilized in a pavement. Base materials are : not allowed to be used by the contractors until : the ...

  4. Enhancing parallelism of tile bidiagonal transformation on multicore architectures using tree reduction

    KAUST Repository

    Ltaief, Hatem; Luszczek, Piotr R.; Dongarra, Jack

    2012-01-01

    The objective of this paper is to enhance the parallelism of the tile bidiagonal transformation using tree reduction on multicore architectures. First introduced by Ltaief et. al [LAPACK Working Note #247, 2011], the bidiagonal transformation using

  5. Alpha1a-Adrenoceptor Genetic Variant Triggers Vascular Smooth Muscle Cell Hyperproliferation and Agonist Induced Hypertrophy via EGFR Transactivation Pathway.

    Directory of Open Access Journals (Sweden)

    Irina Gradinaru

    Full Text Available α1a Adrenergic receptors (α1aARs are the predominant AR subtype in human vascular smooth muscle cells (SMCs. α1aARs in resistance vessels are crucial in the control of blood pressure, yet the impact of naturally occurring human α1aAR genetic variants in cardiovascular disorders remains poorly understood. To this end, we present novel findings demonstrating that 3D cultures of vascular SMCs expressing human α1aAR-247R (247R genetic variant demonstrate significantly increased SMC contractility compared with cells expressing the α1aAR-WT (WT receptor. Stable expression of 247R genetic variant also triggers MMP/EGFR-transactivation dependent serum- and agonist-independent (constitutive hyperproliferation and agonist-dependent hypertrophy of SMCs. Agonist stimulation reduces contractility Using pathway-specific inhibitors we determined that the observed hyperproliferation of 247R-expressing cells is triggered via β-arrestin1/Src/MMP-2/EGFR/ERK-dependent mechanism. MMP-2-specific siRNA inhibited 247R-triggered hyperproliferation indicating MMP-2 involvement in 247R-triggered hyperproliferation in SMCs. β-arrestin1-specific shRNA also inhibited 247R-triggered hyperproliferation but did not affect hypertrophy in 247R-expressing SMCs, indicating that agonist-dependent hypertrophy is independent of β-arrestin1. Our data reveal that in different cardiovascular cells the same human receptor genetic variant can activate alternative modulators of the same signaling pathway. Thus, our findings in SMCs demonstrate that depending on the type of cells expressing the same receptor (or receptor variant, different target-specific inhibitors could be used to modulate aberrant hyperproliferative or hypertrophic pathways in order to restore normal phenotype.

  6. Study of the effect of moisture content and bending rate on the fracture toughness of rocks

    Czech Academy of Sciences Publication Activity Database

    Vavro, Leona; Souček, Kamil

    2013-01-01

    Roč. 10, č. 2 (2013), s. 247-253 ISSN 1214-9705 R&D Projects: GA MŠk ED2.1.00/03.0082 Institutional support: RVO:68145535 Keywords : fracture toughness * bending rate * tensile strength Subject RIV: DB - Geology ; Mineralogy Impact factor: 0.667, year: 2013 http://www.irsm.cas.cz/materialy/acta_content/2013_02/acta_170_14_Vavro_Soucek_247-253.pdf

  7. Ruggedized Portable Instrumentation Package for Marine Mammal Evoked Potential Hearing Measurements (DURIP)

    Science.gov (United States)

    2011-09-30

    NUMBER 5e. TASK NUMBER 5f. WORK UNIT NUMBER 7. PERFORMING ORGANIZATION NAME(S) AND ADDRESS(ES) Hawaii Institute of Marine Biology,Marine Mammal...Program Hawaii Institute of Marine Biology P.O. Box 1106 Kailua, Hawaii 96734 phone: (808) 247-5297 fax: (808) 247-5831 email: nachtiga...portable equipment was used at the Hilo Stranding Center to obtain the audiograms. Ready and available for RIMPAC excercises. 2 IMPACT

  8. Military Smokes and Obscurants Fate and Effects: A Literature Review Relative to Threatened and Endangered Species

    Science.gov (United States)

    2004-12-01

    aqueous phases indicated that hexachloroethane (HC) is dechlorinated to the same metabolites by sterilized and axenically cultivated aquatic plants and...Secondary poisoning of kestrels by white phosphorus. Ecotoxicology . 6(4):239-247. Since 1982, extensive waterfowl mortality due to white...D.W. and N.E. Federoff. 1997. Secondary poisoning of kestrels by white . Ecotoxicology . 6(4):239-247. WP T N Toxicity studies in waterfowl

  9. Infusorial concentration in rumen fluid of red deer, fallow deer, roe deer and moufflon

    Czech Academy of Sciences Publication Activity Database

    Kamler, Jiří

    1999-01-01

    Roč. 68, č. 4 (1999), s. 247-252 ISSN 0001-7213 R&D Projects: GA ČR GA206/97/0172; GA AV ČR KSK2005601 Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 0.227, year: 1999 http://vfu-www.vfu.cz/acta-vet/vol68/pdf/68_247.pdf

  10. Clinical study of p-aminobenzoic acid-N-xyloside Na in advanced cancer patients

    Energy Technology Data Exchange (ETDEWEB)

    Fukushima, M.; Ota, K. (Aichi Cancer Center, Nagoya (Japan))

    1982-02-01

    Therapeutic effect of p-aminobenzoic acid-N-xyloside Na (K-247) were studied. Eleven patients with a variety of solid tumors were treated with K-247 alone. K-247 was given orally 800 mg daily for 4 weeks. As for side effect of the drug, only mild gastritis was observed in a few patients. Partial response (over 25% reduction of tumor size) with a median duration of two months was observed in 3 patients. These cases were metastatic tumor of lung from the carcinoma of thyroid, metastatic tumors of lung from the carcinoma of kidney, and mediastinal tumor. In eight patients the response was classified as no change and in one patient there was progressive disease. Thus K-247 has some therapeutic activity in patients with solid tumor. Combination therapy of irradiation and administration of K-247 were also studied. In the twelve patients receiving the combination therapy, partial response was observed in 7 patients with complete response in 3 patients. In some patients it seems that the effect of irradiation was enhanced by K-247 administration. To confirm this observation, randomized controlled trial is required.

  11. Clinical study of p-aminobenzoic acid-N-xyloside Na in advanced cancer patients

    International Nuclear Information System (INIS)

    Fukushima, Masanori; Ota, Kazuo

    1982-01-01

    Therapeutic effect of p-aminobenzoic acid-N-xyloside Na (K-247) were studied. Eleven patients with a variety of solid tumors were treated with K-247 alone. K-247 was given orally 800 mg daily for 4 weeks. As for side effect of the drug, only mild gastritis was observed in a few patients. Partial response (over 25% reduction of tumor size) with a median duration of two months was observed in 3 patients. These cases were metastatic tumor of lung from the carcinoma of thyroid, metastatic tumors of lung from the carcinoma of kidney, and mediastinal tumor. In eight patients the response was classified as no change and in one patient there was progressive disease. Thus K-247 has some therapeutic activity in patients with solid tumor. Combination therapy of irradiation and administration of K-247 were also studied. In twelve patients received the conbination therapy, partial response was observed in 7 patients with complete response in 3 patients. In some patients it seems that the effect of irradiation was enhanced by K-247 administration. To confirm this observation, randomized controlled trial is required. (author)

  12. A new type-B cask design for transporting 252Cf

    International Nuclear Information System (INIS)

    Simmons, C.M.

    2000-01-01

    A project to design, certify, and build a new US Department of Energy (DOE) Type B container for transporting >5 mg of 252 Cf is more than halfway to completion. This project was necessitated by the fact that the existing Oak Ridge National Laboratory (ORNL) Type B containers were designed and built many years ago and thus do not have the records and supporting data that current regulations require. Once the new cask is available, it will replace the existing Type B containers. The cask design is driven by the unique properties of 252 Cf, which is a very intense spontaneous fission neutron source and necessitates a large amount of neutron shielding. The cask is designed to contain up to 60 mg of 252 Cf in the form of californium oxide or californium oxysulfate, in pellet, wire, or sintered material forms that are sealed inside small special-form capsules. The new cask will be capable of all modes of transport (land, sea, and air). The ORNL team, composed of technical and purchasing personnel and using rigorous selection criteria, chose NAC, International (NAC), as the subcontractor for the project. In January 1997, NAC started work on developing the conceptual design and performing the analyses. The original design concept was for a tungsten alloy gamma shield surrounded by two concentric shells of NS-4-FR neutron shield material. A visit to US Nuclear Regulatory Commission (NRC) regulators in November 1997 to present the conceptual design for their comments resulted in a design modification when the question of potential straight-line cracking in the NS-4-FR neutron shield material arose. NAC's modified design includes offset, wedgelike segments of the neutron shield material. The new geometry eliminates concerns about straight-line cracking but increases the weight of the packaging and makes the fabrication more complex. NAC has now completed the cask design and performed the analyses (shielding, structural, thermal, etc.) necessary to certify the cask. The cask

  13. Transuranium Processing Plant semiannual report of production, status, and plans for period ending June 30, 1975

    Energy Technology Data Exchange (ETDEWEB)

    King, L.J.; Bigelow, J.E.; Collins, E.D.

    1976-03-01

    During the period January 1, 1975, through June 30, 1975, the following amounts of transuranium elements were recovered from 22 irradiated HFIR targets: 2g /sup 243/Am, 59 g /sup 244/Cm, 51 mg /sup 249/Bk, 465 mg /sup 252/Cf, 2.5 mg /sup 253/Es, and 1.4 pg /sup 257/Fm. In addition, 45 mg of high-purity /sup 248/Cm was operated from /sup 252/Cf which had been recovered and purified during earlier periods, and 56 mg of a lower-quality /sup 248/Cm was separated from californium purification rework solutions. Five HFIR targets, each containing approximately 9 g of actinides (predominantly curium), were fabricated. A new long-term projection showed that /sup 252/Cf production in the TRU-HFIR complex could increase to as much as 2.5 g/year. During the next 18 months, we expect to recover totals of 46 mg of /sup 249/Bk, 520 mg of /sup 252/Cf, 2.0 mg of /sup 253/Es (in a mixture of isotopes), 220 ..mu..g of high-purity /sup 253/Es, and 1.6 pg of /sup 257/Fm. We also expect to obtain 125 mg of high-purity /sup 248/Cm from purified californium now in storage. There are no plans to process any of the remaining SRP Pu-Al tubes or to irradiate any plutonium targets in the HFIR; thus, we do not expect to recover any /sup 244/Pu. No changes were made in the chemical processing flowsheets normally used at TRU. Two neutron sources were fabricated, bringing the total fabricated to 77. In special projects, we (1) produced about 1 mg of /sup 250/Cf by irradiation of /sup 249/Bk in HFIR rabbits, and (2) processed some irradiated /sup 248/Cm samples and obtained yield and isotopic composition data for use in determining the capture cross section of /sup 249/Cm in the HFIR. The values that are currently being used for transuranium element decay data and for cross-section data in planning irradiation-processing cycles, calculating production forecasts, and assaying products are tabulated in the Appendix.

  14. Transuranium Processing Plant semiannual report of production, status, and plans for period ending June 30, 1975

    International Nuclear Information System (INIS)

    King, L.J.; Bigelow, J.E.; Collins, E.D.

    1976-03-01

    During the period January 1, 1975, through June 30, 1975, the following amounts of transuranium elements were recovered from 22 irradiated HFIR targets: 2g 243 Am, 59 g 244 Cm, 51 mg 249 Bk, 465 mg 252 Cf, 2.5 mg 253 Es, and 1.4 pg 257 Fm. In addition, 45 mg of high-purity 248 Cm was operated from 252 Cf which had been recovered and purified during earlier periods, and 56 mg of a lower-quality 248 Cm was separated from californium purification rework solutions. Five HFIR targets, each containing approximately 9 g of actinides (predominantly curium), were fabricated. A new long-term projection showed that 252 Cf production in the TRU-HFIR complex could increase to as much as 2.5 g/year. During the next 18 months, we expect to recover totals of 46 mg of 249 Bk, 520 mg of 252 Cf, 2.0 mg of 253 Es (in a mixture of isotopes), 220 μg of high-purity 253 Es, and 1.6 pg of 257 Fm. We also expect to obtain 125 mg of high-purity 248 Cm from purified californium now in storage. There are no plans to process any of the remaining SRP Pu-Al tubes or to irradiate any plutonium targets in the HFIR; thus, we do not expect to recover any 244 Pu. Two neutron sources were fabricated, bringing the total fabricated to 77. Two sources that had been used previously in various projects were returned to the TRU inventory and are available for reassignment. In special projects, we (1) produced about 1 mg of 250 Cf by irradiation of 249 Bk in HFIR rabbits, and (2) processed some irradiated 248 Cm samples and obtained yield and isotopic composition data for use in determining the capture cross section of 249 Cm in the HFIR. The values that are currently being used for transuranium element decay data and for cross-section data in planning irradiation-processing cycles, calculating production forecasts, and assaying products are tabulated in the Appendix

  15. Origin of uranium isotope variations in early solar nebula condensates.

    Science.gov (United States)

    Tissot, François L H; Dauphas, Nicolas; Grossman, Lawrence

    2016-03-01

    High-temperature condensates found in meteorites display uranium isotopic variations ((235)U/(238)U), which complicate dating the solar system's formation and whose origin remains mysterious. It is possible that these variations are due to the decay of the short-lived radionuclide (247)Cm (t 1/2 = 15.6 My) into (235)U, but they could also be due to uranium kinetic isotopic fractionation during condensation. We report uranium isotope measurements of meteoritic refractory inclusions that reveal excesses of (235)U reaching ~+6% relative to average solar system composition, which can only be due to the decay of (247)Cm. This allows us to constrain the (247)Cm/(235)U ratio at solar system formation to (1.1 ± 0.3) × 10(-4). This value provides new clues on the universality of the nucleosynthetic r-process of rapid neutron capture.

  16. Evaluation of Heat Capacity and Resistance to Cyclic Oxidation of Nickel Superalloys

    Directory of Open Access Journals (Sweden)

    Przeliorz R.

    2014-08-01

    Full Text Available Paper presents the results of evaluation of heat resistance and specific heat capacity of MAR-M-200, MAR-M-247 and Rene 80 nickel superalloys. Heat resistance was evaluated using cyclic method. Every cycle included heating in 1100°C for 23 hours and cooling for 1 hour in air. Microstructure of the scale was observed using electron microscope. Specific heat capacity was measured using DSC calorimeter. It was found that under conditions of cyclically changing temperature alloy MAR-M-247 exhibits highest heat resistance. Formed oxide scale is heterophasic mixture of alloying elements, under which an internal oxidation zone was present. MAR-M-200 alloy has higher specific heat capacity compared to MAR-M-247. For tested alloys in the temperature range from 550°C to 800°C precipitation processes (γ′, γ″ are probably occurring, resulting in a sudden increase in the observed heat capacity.

  17. Comparative efficacy of different post-emergence herbicides in wheat (triticum aestivum L.)

    International Nuclear Information System (INIS)

    Shehzad, M.A.; Nadeem, M.A.; Sarwar, M.A.; Naseer-ud-Din, G.M.; Ilahi, F.

    2012-01-01

    A field experiment was carried out to study the efficacy of different post-emergence herbicides for controlling weeds in wheat during a Rabi season 2008-09. Experiment comprised of six treatments, i.e. weed-infested control, pyroxasulfone at 50 g a.i ha/sup -1/, metribuzin at 250 g a.i ha/sup -1/, isoproturon at 1080 g a.i ha/sup -1/, clodinafop propargyl at 240 g a.i ha/sup -1/ and as post-emergence herbicides. Results revealed that Post-emergence application of bromoxynil + MCPA at 247+247 g a.i ha/sup -1/ isoproturon (1080 g a.i ha) proved to be best for obtaining maximum grain plus straw yield up to the level of weed-free -1 -1 control. Bromoxynil + MCPA (247+247 g a.i ha) and clodinafop propargyl (240 g a.i ha/sup -1/) also gave maximum spike bearing tillers, number of grains spike and 1000-grain weight. Isoproturon (1080 g a.i ha/sup -1/) strictly reduced the weeds population as well as biomass as compared to weed-infested control. Poor weed control was achieved by using pyroxasulfone and metribuzin treatments. Hence, post-emergence Isoproturon (1080 g a.i ha/sup -1/) followed by bromoxynil + MCPA (247+247 g a.i ha/sup -1/ ) was provide to be the most effective herbicide against weeds and resulted in maximum wheat yield. (author)

  18. Comparative efficacy of different post-emergence herbicides in wheat (triticum aestivum l.)

    International Nuclear Information System (INIS)

    Shehzad, M.A.; Nadeem, M.A.; Sarwar, M.A.

    2012-01-01

    A field experiment was carried out to study the efficacy of different post-emergence herbicides for controlling weeds in wheat during a Rabi season 2008-09. Experiment comprised of six treatments, i.e. weed-infested control, pyroxasulfone at 50 g a.i ha/sup -1/, metribuzin at 250 g a.i ha/sup -1/, isoproturon at 1080 g a.i ha/sup -1/, clodinafop propargyl at 240 g a.i ha/sup -1/ and bromoxynil+MCPA at 247+247 g a.i ha/sup -1/ as post-emergence herbicides. Results revealed that Post-emergence application of isoproturon (1080 g a.i ha-1) proved to be best for obtaining maximum grain plus straw yield up to the level of weed-free control. Bromoxynil+MCPA (247+247 g a.i ha/sup -1/) and clodinafop propargyl (240 g a.i ha-1) also gave maximum spike bearing tillers, number of grains spike-1 and 1000-grain weight. Isoproturon (1080 g a.i ha/sup -1/) strictly reduced the weeds population as well as biomass as compared to weed-infested control. Poor weed control was achieved by using pyroxasulfone and metribuzin treatments. Hence, post-emergence Isoproturon (1080 g a.i ha/sup -1/) followed by bromoxynil + MCPA (247+247 g a.i ha/sup -1/) was provide to be the most effective herbicide against weeds and resulted in maximum wheat yield. (author)

  19. Estimation of the sub-criticality of the sodium-cooled fast reactor Monju using the modified neutron source multiplication method

    International Nuclear Information System (INIS)

    Truchet, G.; Van Rooijen, W. F. G.; Shimazu, Y.; Yamaguchi, K.

    2012-01-01

    The Modified Neutron Source Method (MNSM) is applied to the Monju reactor. This static method to estimate sub-criticality has already given good results on commercial Pressurized Water Reactors. The MNSM consists both in the extraction of the fundamental mode seen by a detector to avoid the effect of higher modes near sources, and the correction of flux distortion effects due to control rod movement. Among Monju's particularities that have a big influence on MNSM factors are: the presence of two californium sources and the position of the detector which is located far from the core outside of the reactor vessel. The importance of spontaneous fission and (α, n) reactions which have increased during the shutdown period of 15 years will also be discussed. The relative position of detectors and sources deeply affect the correction factors in some regions. In order to evaluate the detector count rate, an analytical propagation has been conducted from the reactor vessel. For two subcritical states, an estimation of the reactivity has been made and compared to experimental data obtained in the restart experiments at Monju (2010). (authors)

  20. Cleanex process: a versatile solvent extraction process for recovery and purification of lanthanides, americium, and curium

    International Nuclear Information System (INIS)

    Bigelow, J.E.; Collins, E.D.; King, L.J.

    1979-01-01

    At a concentration of 1 M in straight-chain hydrocarbon diluent, HDEHP will extract americium, curium, and other trivalent actinide and lanthanide elements from dilute acid or salt solutions. The solute is back-extracted with more concentrated acid, either nitric or hydrochloric. The process has been used in the continuous, countercurrent mode, but its greatest advantage arises in batch extractions where the excess acid can be titrated with NaOH to produce a final acidity of about 0.03 M. Under these conditions, 99% recovery can be achieved, usually in one stage. Cleanex was used on the 50-liter scale at the Transuranium Processing Plant at Oak Ridge for 12 years to provide a broad spectrum cleanup to transuranium elements before applying more sophisticated techniques for separating individual products. The process is also used routinely to recover excessive losses of curium and/or californium from plant waste streams. The solvent system is relatively resistant to radiation damage, being usable up to 200 W-h/liter