WorldWideScience

Sample records for californium 245

  1. Californium-252 progress, report No. 7, April 1971

    Energy Technology Data Exchange (ETDEWEB)

    1971-12-31

    This report contains discusses of the following topics on Californium-252: First sales of californium-252; encapsulation services discussed; three new participants in market evaluation program; summer training programs to use californium; Californium-252 shipping casks available; Californium-252 questions and answers, radiotherapy; neutron radiography; natural resources exploration; nuclear safeguards; process control; dosimetry; neutron radiography; neutron shielding; and nuclear safeguards.

  2. Historical review of californium-252 discovery and development

    Science.gov (United States)

    Stoddard, D. H.

    This paper discusses the discovery and history of californium 252. This isotope may be synthesized by irradiating plutonium 239, plutonium 242, americium 243, or curium 244 with neutrons in a nuclear reactor. Various experiments and inventions involving (252)Cf conducted at the Savannah River Plant are discussed. The evolution of radiotherapy using californium 252 is reviewed.

  3. Californium-252: a remarkable versatile radioisotope

    Energy Technology Data Exchange (ETDEWEB)

    Osborne-Lee, I.W.; Alexander, C.W.

    1995-10-10

    A product of the nuclear age, Californium-252 ({sup 252}Cf) has found many applications in medicine, scientific research, industry, and nuclear science education. Californium-252 is unique as a neutron source in that it provides a highly concentrated flux and extremely reliable neutron spectrum from a very small assembly. During the past 40 years, {sup 252}Cf has been applied with great success to cancer therapy, neutron radiography of objects ranging from flowers to entire aircraft, startup sources for nuclear reactors, fission activation for quality analysis of all commercial nuclear fuel, and many other beneficial uses, some of which are now ready for further growth. Californium-252 is produced in the High Flux Isotope Reactor (HFIR) and processed in the Radiochemical Engineering Development Center (REDC), both of which are located at the Oak Ridge National Laboratory (ORNL) in Oak Ridge, Tennessee. The REDC/HFIR facility is virtually the sole supplier of {sup 252}Cf in the western world and is the major supplier worldwide. Extensive exploitation of this product was made possible through the {sup 252}Cf Market Evaluation Program, sponsored by the United States Department of Energy (DOE) [then the Atomic Energy Commission (AEC) and later the Energy Research and Development Administration (ERDA)]. This program included training series, demonstration centers, seminars, and a liberal loan policy for fabricated sources. The Market Evaluation Program was instituted, in part, to determine if large-quantity production capability was required at the Savannah River Laboratory (SRL). Because of the nature of the product and the means by which it is produced, {sup 252}Cf can be produced only in government-owned facilities. It is evident at this time that the Oak Ridge research facility can meet present and projected near-term requirements. The production, shipment, and sales history of {sup 252}Cf from ORNL is summarized herein.

  4. Production, Distribution, and Applications of Californium-252 Neutron Sources

    Energy Technology Data Exchange (ETDEWEB)

    Balo, P.A.; Knauer, J.B.; Martin, R.C.

    1999-10-03

    The radioisotope {sup 252}Cf is routinely encapsulated into compact, portable, intense neutron sources with a 2.6-year half-life. A source the size of a person's little finger can emit up to 10{sup 11} neutrons/s. Californium-252 is used commercially as a reliable, cost-effective neutron source for prompt gamma neutron activation analysis (PGNAA) of coal, cement, and minerals, as well as for detection and identification of explosives, laud mines, and unexploded military ordnance. Other uses are neutron radiography, nuclear waste assays, reactor start-up sources, calibration standards, and cancer therapy. The inherent safety of source encapsulations is demonstrated by 30 years of experience and by U.S. Bureau of Mines tests of source survivability during explosions. The production and distribution center for the U. S Department of Energy (DOE) Californium Program is the Radiochemical Engineering Development Center (REDC) at Oak Ridge National Laboratory (ORNL). DOE sells The radioisotope {sup 252}Cf is routinely encapsulated into compact, portable, intense neutron sources with a 2.6- year half-life. A source the size of a person's little finger can emit up to 10 neutrons/s. Californium-252 is used commercially as a reliable, cost-effective neutron source for prompt gamma neutron activation analysis (PGNAA) of coal, cement, and minerals, as well as for detection and identification of explosives, laud mines, and unexploded military ordnance. Other uses are neutron radiography, nuclear waste assays, reactor start-up sources, calibration standards, and cancer therapy. The inherent safety of source encapsulations is demonstrated by 30 years of experience and by U.S. Bureau of Mines tests of source survivability during explosions. The production and distribution center for the U. S Department of Energy (DOE) Californium Program is the Radiochemical Engineering Development Center (REDC) at Oak Ridge National Laboratory(ORNL). DOE sells {sup 252}Cf to commercial

  5. Unusual structure, bonding and properties in a californium borate

    Energy Technology Data Exchange (ETDEWEB)

    Polinski, Matthew J.; Garner, Edward B.; Maurice, Rémi; Planas, Nora; Stritzinger, Jared T.; Parker, T. Gannon; Cross, Justin N.; Green, Thomas D.; Alekseev, Evgeny V.; Van Cleve, Shelley M.; Depmeier, Wulf; Gagliardi, Laura; Shatruk, Michael; Knappenberger, Kenneth L.; Liu, Guokui; Skanthakumar, S.; Soderholm, Lynda; Dixon, David A.; Albrecht-Schmitt, Thomas E.

    2014-03-23

    The participation of the valence orbitals of actinides in bonding has been debated for decades. Recent experimental and computational investigations demonstrated the involvement of 6p, 6d and/or 5f orbitals in bonding. However, structural and spectroscopic data, as well as theory, indicate a decrease in covalency across the actinide series, and the evidence points to highly ionic, lanthanide-like bonding for late actinides. Here we show that chemical differentiation between californium and lanthanides can be achieved by using ligands that are both highly polarizable and substantially rearrange on complexation. A ligand that suits both of these desired properties is polyborate. We demonstrate that the 5f, 6d and 7p orbitals are all involved in bonding in a Cf(III) borate, and that large crystal-field effects are present. Synthetic, structural and spectroscopic data are complemented by quantum mechanical calculations to support these observations.

  6. Biomedical neutron research at the Californium User Facility for neutron science

    Energy Technology Data Exchange (ETDEWEB)

    Martin, R.C. [Oak Ridge National Lab., TN (United States); Byrne, T.E. [Roane State Community College, Harriman, TN (United States); Miller, L.F. [Univ. of Tennessee, Knoxville, TN (United States)

    1997-04-01

    The Californium User Facility for Neutron Science has been established at Oak Ridge National Laboratory (ORNL). The Californium User Facility (CUF) is a part of the larger Californium Facility, which fabricates and stores compact {sup 252}Cf neutron sources for worldwide distribution. The CUF can provide a cost-effective option for research with {sup 252}Cf sources. Three projects at the CUF that demonstrate the versatility of {sup 252}Cf for biological and biomedical neutron-based research are described: future establishment of a {sup 252}Cf-based neutron activation analysis system, ongoing work to produce miniature high-intensity, remotely afterloaded {sup 252}Cf sources for tumor therapy, and a recent experiment that irradiated living human lung cancer cells impregnated with experimental boron compounds to test their effectiveness for boron neutron capture therapy.

  7. 48 CFR 245.607 - Scrap.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Scrap. 245.607 Section 245.607 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS SYSTEM, DEPARTMENT OF... Inventory 245.607 Scrap. ...

  8. Apparatus for the measurement of total body nitrogen using prompt neutron activation analysis with californium-252.

    Science.gov (United States)

    Mackie, A; Hannan, W J; Smith, M A; Tothill, P

    1988-01-01

    Details of clinical apparatus designed for the measurement of total body nitrogen (as an indicator of body protein), suitable for the critically ill, intensive-care patient are presented. Californium-252 radio-isotopic neutron sources are used, enabling a nitrogen measurement by prompt neutron activation analysis to be made in 40 min with a precision of +/- 3.2% for a whole body dose equivalent of 0.145 mSv. The advantages of Californium-252 over alternative neutron sources are discussed. A comparison between two irradiation/detection geometries is made, leading to an explanation of the geometry adopted for the apparatus. The choice of construction and shielding materials to reduce the count rate at the detectors and consequently to reduce the pile-up contribution to the nitrogen background is discussed. Salient features of the gamma ray spectroscopy system to reduce spectral distortion from pulse pile-up are presented.

  9. Safety Analysis Report for Packaging (SARP) of the Oak Ridge National Laboratory TRU Californium Shipping Container

    Energy Technology Data Exchange (ETDEWEB)

    Box, W.D.; Shappert, L.B.; Seagren, R.D.; Klima, B.B.; Jurgensen, M.C.; Hammond, C.R.; Watson, C.D.

    1980-01-01

    An analytical evaluation of the Oak Ridge National Laboratory TRU Californium Shipping Container was made in order to demonstrate its compliance with the regulations governing off-site shipment of packages that contain radioactive material. The evaluation encompassed five primary categories: structural integrity, thermal resistance, radiation shielding, nuclear criticality safety, and quality assurance. The results of this evaluation demonstrate that the container complies with the applicable regulations.

  10. 8 CFR 245a.32 - Ineligible aliens.

    Science.gov (United States)

    2010-01-01

    ... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Ineligible aliens. 245a.32 Section 245a.32 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS ADJUSTMENT OF STATUS TO... IMMIGRATION AND NATIONALITY ACT LIFE Act Amendments Family Unity Provisions § 245a.32 Ineligible aliens. The...

  11. 48 CFR 245.601 - Definitions.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Definitions. 245.601 Section 245.601 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS SYSTEM, DEPARTMENT... Contractor Inventory 245.601 Definitions. (1) Controlled substances means— (i) Narcotic, depressant...

  12. 7 CFR 245.2 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Definitions. 245.2 Section 245.2 Agriculture... SCHOOLS § 245.2 Definitions. Adult means any individual 21 years of age or older. Commodity school means a... Temporary Assistance for Needy Families, although States may refer to the program by another name...

  13. 49 CFR 234.245 - Signs.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Signs. 234.245 Section 234.245 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION, DEPARTMENT OF... Maintenance Standards § 234.245 Signs. Each sign mounted on a highway-rail grade crossing signal post shall be...

  14. 46 CFR 169.245 - Lifesaving equipment.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Lifesaving equipment. 169.245 Section 169.245 Shipping... Inspection and Certification Inspections § 169.245 Lifesaving equipment. At each inspection for certification and periodic inspection the following tests and inspections of lifesaving equipment will be conducted...

  15. 37 CFR 2.45 - Certification mark.

    Science.gov (United States)

    2010-07-01

    ... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Certification mark. 2.45 Section 2.45 Patents, Trademarks, and Copyrights UNITED STATES PATENT AND TRADEMARK OFFICE, DEPARTMENT OF COMMERCE RULES OF PRACTICE IN TRADEMARK CASES The Written Application § 2.45 Certification mark. (a) In an...

  16. 48 CFR 245.7306 - Sales services.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Sales services. 245.7306 Section 245.7306 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS SYSTEM, DEPARTMENT OF DEFENSE CONTRACT MANAGEMENT GOVERNMENT PROPERTY Sale of Surplus Contractor Inventory 245.7306...

  17. 48 CFR 245.7302 - Competitive sales.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Competitive sales. 245.7302 Section 245.7302 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS SYSTEM, DEPARTMENT OF DEFENSE CONTRACT MANAGEMENT GOVERNMENT PROPERTY Sale of Surplus Contractor Inventory 245.7302...

  18. 32 CFR 245.3 - Responsibilities.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false Responsibilities. 245.3 Section 245.3 National... PLAN FOR THE EMERGENCY SECURITY CONTROL OF AIR TRAFFIC (ESCAT) General § 245.3 Responsibilities. The Assistant Secretary of Defense for Networks and Information Integration will ensure the responsibilities of...

  19. 32 CFR 245.13 - Responsibilities.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false Responsibilities. 245.13 Section 245.13 National Defense Department of Defense (Continued) OFFICE OF THE SECRETARY OF DEFENSE (CONTINUED) MISCELLANEOUS PLAN FOR THE EMERGENCY SECURITY CONTROL OF AIR TRAFFIC (ESCAT) The ESCAT Plan § 245.13 Responsibilities...

  20. 24 CFR 245.120 - Meeting space.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Meeting space. 245.120 Section 245... PARTICIPATION IN MULTIFAMILY HOUSING PROJECTS Tenant Organizations § 245.120 Meeting space. (a) Owners of... of any community room or other available space appropriate for meetings that is part of the...

  1. Dicty_cDB: CHF245 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHF245 (Link to dictyBase) - - - Contig-U15897-1 CHF245P (Link to Original site) CHF...245F 584 CHF245Z 703 CHF245P 1267 - - Show CHF245 Library CH (Link to library) Clone ID CHF...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/CH/CHF2-B/CHF245Q.Seq.d/ Representative seq. ID CHF...245P (Link to Original site) Representative DNA sequence >CHF245 (CHF245Q) /CSM/CH/CHF2-B/CHF...timvsyl*nfw*rsircindgcccrswfprw*qfirwsnqc picslyc*tlf--- ---ittig*hw*tssfnfg*sssknfttrfrlqlccsfnglxpr**rw*tnrqhf

  2. 24 CFR 245.115 - Protected activities.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Protected activities. 245.115... TENANT PARTICIPATION IN MULTIFAMILY HOUSING PROJECTS Tenant Organizations § 245.115 Protected activities... tenants and tenant organizers to conduct the following activities related to the establishment or...

  3. 8 CFR 245a.21 - Confidentiality.

    Science.gov (United States)

    2010-01-01

    ... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Confidentiality. 245a.21 Section 245a.21 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS ADJUSTMENT OF STATUS TO... Confidentiality. (a) No person other than a sworn officer or employee of the Department of Justice or bureau or...

  4. 42 CFR 24.5 - Peer review.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 1 2010-10-01 2010-10-01 false Peer review. 24.5 Section 24.5 Public Health PUBLIC....5 Peer review. An individual may not be considered for appointment into the SBRS unless his/her qualifications have been reviewed by a PHS peer review committee and the committee has recommended appointment to...

  5. 40 CFR 86.245-94 - [Reserved

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 18 2010-07-01 2010-07-01 false 86.245-94 Section 86.245-94 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED) CONTROL OF... Year Gasoline-Fueled New Light-Duty Vehicles, New Light-Duty Trucks and New Medium-Duty Passenger...

  6. 8 CFR 245a.17 - Citizenship skills.

    Science.gov (United States)

    2010-01-01

    ... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Citizenship skills. 245a.17 Section 245a.17... Citizenship skills. (a) Requirements. Applicants for adjustment under LIFE Legalization must meet the... permanent residence and may be based solely on the failure to pass the basic citizenship skills requirements...

  7. 48 CFR 245.607-1 - General.

    Science.gov (United States)

    2010-10-01

    ... DEFENSE CONTRACT MANAGEMENT GOVERNMENT PROPERTY Reporting, Redistribution, and Disposal of Contractor... approved, the plant clearance officer shall waive the scrap warranty required at 245.607-70. (iv) When a...

  8. Dicty_cDB: AHB245 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available library) AHB245 (Link to dictyBase) - - - Contig-U11089-1 - (Link to Original site) - - AHB245Z 622 -...- - - - Show AHB245 Library AH (Link to library) Clone ID AHB245 (Link to dictyBase) Atlas ID - NBRP ID...URL http://dictycdb.biol.tsukuba.ac.jp/CSM/AH/AHB2-B/AHB245Q.Seq.d/ Representative seq. ID - (Link to Original...site) Representative DNA sequence >AHB245 (AHB245Q) /CSM/AH/AHB2-B/AHB245Q.Seq.d/ XXXXXXXXXXTCATTGAAAAG...significant alignments: (bits) Value AHB245 (AHB245Q) /CSM/AH/AHB2-B/AHB245Q.Seq.d/ 1142 0.0 VHI436 (VHI436Q)

  9. 40 CFR 1033.245 - Deterioration factors.

    Science.gov (United States)

    2010-07-01

    ...-hour test point. For example, if you use aftertreatment technology that controls emissions of a... CONTROLS CONTROL OF EMISSIONS FROM LOCOMOTIVES Certifying Engine Families § 1033.245 Deterioration factors... testing of similar locomotives. (b) Deterioration factors may be additive or multiplicative. (1) Additive...

  10. 48 CFR 245.7309-5 - Title.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Title. 245.7309-5 Section... Title. (a) Unless otherwise specified in the Invitation, title to property sold under this Invitation... Contractor, title shall not vest until payment and loading are completed. (b) A Standard Form 97, Certificate...

  11. 8 CFR 245a.10 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... laws, such status not having changed. LIFE Act means the Legal Immigration Family Equity Act and the... and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS ADJUSTMENT OF STATUS TO THAT... IMMIGRATION AND NATIONALITY ACT Legal Immigration Family Equity (LIFE) Act Legalization Provisions § 245a.10...

  12. 42 CFR 137.245 - What is retrocession?

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 1 2010-10-01 2010-10-01 false What is retrocession? 137.245 Section 137.245 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES INDIAN HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES TRIBAL SELF-GOVERNANCE Retrocession § 137.245 What is retrocession...

  13. 48 CFR 245.7310-5 - Controlled substances.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Controlled substances. 245.7310-5 Section 245.7310-5 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS SYSTEM, DEPARTMENT OF DEFENSE CONTRACT MANAGEMENT GOVERNMENT PROPERTY Sale of Surplus Contractor Inventory 245.7310-5...

  14. 48 CFR 245.608 - Screening of contractor inventory.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Screening of contractor inventory. 245.608 Section 245.608 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS... Disposal of Contractor Inventory 245.608 Screening of contractor inventory. ...

  15. 28 CFR 2.45 - Same; youth offenders.

    Science.gov (United States)

    2010-07-01

    ... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Same; youth offenders. 2.45 Section 2.45 Judicial Administration DEPARTMENT OF JUSTICE PAROLE, RELEASE, SUPERVISION AND RECOMMITMENT OF PRISONERS, YOUTH OFFENDERS, AND JUVENILE DELINQUENTS United States Code Prisoners and Parolees § 2.45 Same; youth...

  16. 48 CFR 245.7307 - Non-competitive sales.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Non-competitive sales. 245.7307 Section 245.7307 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS SYSTEM, DEPARTMENT OF DEFENSE CONTRACT MANAGEMENT GOVERNMENT PROPERTY Sale of Surplus Contractor Inventory 245.7307...

  17. Application of TSH bioindicator for studying the biological efficiency of neutrons from californium-252 source

    Energy Technology Data Exchange (ETDEWEB)

    Cebulska-Wasilewska, A.; Rekas, K. [Institute of Nuclear Physics, Cracow (Poland); Kim, J.K. [Korea Atomic Energy Research Inst., Taejon (Korea, Republic of)

    1997-12-31

    The effectiveness of neutrons from a Californium-252 source in the induction of various abnormalities in the Tradescantia clone 4430 stamen hair cells (TSH-assay) was studied. The special attention was paid to check whether any enhancement in effects caused by process of boron neutron capture is visible in the cells enriched with boron ions. Two chemicals (borax and BSH) were applied to introduce boron-10 ions into cells. Inflorescence, normal or pretreated with chemicals containing boron, were irradiated in the air with neutrons from a Cf-252 source at KAERI, Taejon, Korea. To estimate the relative biological effectiveness (RBE) in the induction of gene mutations of the neutron beam under the study, Tradescantia inflorescences, without any chemical pretreatment, were irradiated with various doses of X-rays. The ranges of radiation doses used were 0-0.1 Gy in neutrons and 0-0.5 Gy in X-rays. After the time needed to complete the postirradiation repair Tradescantia cuttings were transferred to Cracow, where screening of gene and lethal; mutations, cell cycle alterations in somatic cells have been done, and dose response relationships were figured. The maximal RBE values were estimated in the range of 4.6-6.8. Alterations of RBE value were observed; from 6.8 to 7.8 in the case of plants pretreated with 240 ppm of B-10 from borax, and 4.6 to 6.1 in the case of 400 ppm of B-10 from BSH. Results showed a slight, although statistically insignificant increase in biological efficacy of radiation from the Cf-252 source in samples pretreated with boron containing chemicals. (author)

  18. Study of the shielding for spontaneous fission sources of Californium-252; Estudio de blindaje para fuentes de fision espontanea de Californio-252

    Energy Technology Data Exchange (ETDEWEB)

    Davila R, I

    1991-06-15

    A shielding study is made to attenuate, until maximum permissible levels, the neutrons radiation and photons emitted by spontaneous fission coming from a source of Californium-252. The compound package by a database (Library DLC-23) and the ANISNW code is used, in it version for personal computer. (Author)

  19. Simulation and design of an electron beam ion source charge breeder for the californium rare isotope breeder upgrade

    Directory of Open Access Journals (Sweden)

    Clayton Dickerson

    2013-02-01

    Full Text Available An electron beam ion source (EBIS will be constructed and used to charge breed ions from the californium rare isotope breeder upgrade (CARIBU for postacceleration into the Argonne tandem linear accelerator system (ATLAS. Simulations of the EBIS charge breeder performance and the related ion transport systems are reported. Propagation of the electron beam through the EBIS was verified, and the anticipated incident power density within the electron collector was identified. The full normalized acceptance of the charge breeder with a 2 A electron beam, 0.024π  mm mrad for nominal operating parameters, was determined by simulating ion injection into the EBIS. The optics of the ion transport lines were carefully optimized to achieve well-matched ion injection, to minimize emittance growth of the injected and extracted ion beams, and to enable adequate testing of the charge bred ions prior to installation in ATLAS.

  20. Extraction of Trivalent Actinides and Lanthanides from Californium Campaign Rework Solution Using TODGA-based Solvent Extraction System

    Energy Technology Data Exchange (ETDEWEB)

    Benker, Dennis [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Delmau, Laetitia Helene [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Dryman, Joshua Cory [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States)

    2017-07-01

    This report presents the studies carried out to demonstrate the possibility of quantitatively extracting trivalent actinides and lanthanides from highly acidic solutions using a neutral ligand-based solvent extraction system. These studies stemmed from the perceived advantage of such systems over cationexchange- based solvent extraction systems that require an extensive feed adjustment to make a low-acid feed. The targeted feed solutions are highly acidic aqueous phases obtained after the dissolution of curium targets during a californium (Cf) campaign. Results obtained with actual Cf campaign solutions, but highly diluted to be manageable in a glove box, are presented, followed by results of tests run in the hot cells with Cf campaign rework solutions. It was demonstrated that a solvent extraction system based on the tetraoctyl diglycolamide molecule is capable of quantitatively extracting trivalent actinides from highly acidic solutions. This system was validated using actual feeds from a Cf campaign.

  1. Beyond Californium-A Neutron Generator Alternative for Dosimetry and Instrument Calibration in the U.S.

    Science.gov (United States)

    Piper, Roman K; Mozhayev, Andrey V; Murphy, Mark K; Thompson, Alan K

    2017-09-01

    Evaluations of neutron survey instruments, area monitors, and personal dosimeters rely on reference neutron radiations, which have evolved from the heavy reliance on (α,n) sources to a shared reliance on (α,n) and the spontaneous fission neutrons of californium-252 (Cf). Capable of producing high dose equivalent rates from an almost point source geometry, the characteristics of Cf are generally more favorable when compared to the use of (α,n) and (γ,n) sources or reactor-produced reference neutron radiations. Californium-252 is typically used in two standardized configurations: unmoderated, to yield a fission energy spectrum; or with the capsule placed within a heavy-water moderating sphere to produce a softened spectrum that is generally considered more appropriate for evaluating devices used in nuclear power plant work environments. The U.S. Department of Energy Cf Loan/Lease Program, a longtime origin of affordable Cf sources for research, testing and calibration, was terminated in 2009. Since then, high-activity sources have become increasingly cost-prohibitive for laboratories that formerly benefited from that program. Neutron generators, based on the D-T and D-D fusion reactions, have become economically competitive with Cf and are recognized internationally as important calibration and test standards. Researchers from the National Institute of Standards and Technology and the Pacific Northwest National Laboratory are jointly considering the practicality and technical challenges of implementing neutron generators as calibration standards in the U.S. This article reviews the characteristics of isotope-based neutron sources, possible isotope alternatives to Cf, and the rationale behind the increasing favor of electronically generated neutron options. The evaluation of a D-T system at PNNL has revealed characteristics that must be considered in adapting generators to the task of calibration and testing where accurate determination of a dosimetric quantity is

  2. Californium-252 Brachytherapy Combined With External-Beam Radiotherapy for Cervical Cancer: Long-Term Treatment Results

    Energy Technology Data Exchange (ETDEWEB)

    Lei Xin; Qian Chengyuan; Qing Yi; Zhao Kewei; Yang Zhengzhou; Dai Nan; Zhong Zhaoyang; Tang Cheng; Li Zheng; Gu Xianqing; Zhou Qian; Feng Yan; Xiong Yanli; Shan Jinlu [Cancer Center, Research Institute of Surgery and Daping Hospital, Third Military Medical University, Chongqing (China); Wang Dong, E-mail: dongwang64@hotmail.com [Cancer Center, Research Institute of Surgery and Daping Hospital, Third Military Medical University, Chongqing (China)

    2011-12-01

    Purpose: To observe, by retrospective analysis, the curative effects and complications due to californium-252 ({sup 252}Cf) neutron intracavitary brachytherapy (ICBT) combined with external-beam radiotherapy (EBRT) in the treatment of cervical cancer. Methods and Materials: From February 1999 to December 2007, 696 patients with cervical cancer (Stages IB to IIIB) were treated with {sup 252}Cf-ICBT in combination of EBRT. Of all, 31 patients were at Stage IB, 104 at IIA, 363 at IIB, 64 at IIIA, and 134 at IIIB. Californium-252 ICBT was delivered at 7-12 Gy per insertion per week, with a total dose of 29-45 Gy to reference point A in three to five insertions. The whole pelvic cavity was treated with 8-MV X-ray external irradiation at 2 Gy per fraction, four times per week. After 16-38 Gy of external irradiation, the center of the whole pelvic field was blocked with a 4-cm-wide lead shield, with a total external irradiation dose of 44-56 Gy. The total treatment course was 5 to 6 weeks. Results: Overall survival rate at 3 and 5 years for all patients was 76.0% and 64.9%, respectively. Disease-free 3- and 5-year survival rates of patients were 71.2% and 58.4%, respectively. Late complications included vaginal contracture and adhesion, radiation proctitis, radiation cystitis, and inflammatory bowel, which accounted for 5.8%, 7.1%, 6.2%, and 4.9%, respectively. Univariate analysis results showed significant correlation of stage, age, histopathologic grade, and lymph node status with overall survival. Cox multiple regression analysis showed that the independent variables were stage, histopathologic grade, tumor size, and lymphatic metastasis in all patients. Conclusion: Results of this series suggest that the combined use of {sup 252}Cf-ICBT with EBRT is an effective method for treatment of cervical cancer.

  3. 48 CFR 245.7310-4 - Dangerous property.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Dangerous property. 245..., DEPARTMENT OF DEFENSE CONTRACT MANAGEMENT GOVERNMENT PROPERTY Sale of Surplus Contractor Inventory 245.7310-4 Dangerous property. The following warning shall be included when it cannot be certified that the property is...

  4. 50 CFR 600.245 - Council member compensation.

    Science.gov (United States)

    2010-10-01

    ... 50 Wildlife and Fisheries 8 2010-10-01 2010-10-01 false Council member compensation. 600.245....245 Council member compensation. (a) All voting Council members whose eligibility for compensation has... state income taxes. A report of compensation will be furnished each year by the member's Council to the...

  5. 48 CFR 245.7310-7 - Scrap warranty.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Scrap warranty. 245.7310-7..., DEPARTMENT OF DEFENSE CONTRACT MANAGEMENT GOVERNMENT PROPERTY Sale of Surplus Contractor Inventory 245.7310-7 Scrap warranty. The following condition shall be used whenever property, other than production scrap, is...

  6. 48 CFR 245.607-70 - Scrap warranty.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Scrap warranty. 245.607-70..., DEPARTMENT OF DEFENSE CONTRACT MANAGEMENT GOVERNMENT PROPERTY Reporting, Redistribution, and Disposal of Contractor Inventory 245.607-70 Scrap warranty. (a) If the contractor sells its inventory as scrap to anyone...

  7. 7 CFR 245.6a - Verification requirements.

    Science.gov (United States)

    2010-01-01

    ... SCHOOLS § 245.6a Verification requirements. (a) Definitions—(1) Eligible programs. For the purposes of... program funded under the program of block grants to States for temporary assistance for needy families... definition of Documentation in § 245.2 and, if applicable, the household meets the income eligibility...

  8. EPA Method 245.2: Mercury (Automated Cold Vapor Technique)

    Science.gov (United States)

    Method 245.2 describes procedures for preparation and analysis of drinking water samples for analysis of mercury using acid digestion and cold vapor atomic absorption. Samples are prepared using an acid digestion technique.

  9. Long-term effects of an intracavitary treatment with californium-252 on normal tissue. [Swine, /sup 226/Ra

    Energy Technology Data Exchange (ETDEWEB)

    Sullivan, M.F.; Beamer, J.L.; Mahony, T.D.; Cross, F.T.; Lund, J.E.; Endres, G.W.R.

    1976-01-01

    About one hundred fifty swine were exposed to either radium-226 or californium-252 sources in the uterine cervix to determine an RBE for both acute and long-term effects. That value for early changes in the tissues at risk in the treatment of cervical cancer was between 6.2 and 6.8. The incidence of complications increased with time after exposure, especially among animals treated with /sup 252/Cf. Analysis of rectal injury showed that ulceration occurred frequently within a year postexposure at doses between 1600 and 2400 rad calculated at 2 cm lateral to the source midline. Fat necrosis and smooth muscle atrophy, resulting in a local rectal stricture, were delayed changes observed in some animals. The lower ureter was the site for a greater frequency of complications than the GI tract. Ureteral stricture often occurred at doses of 1200 rad from /sup 252/Cf and 7000 rad from /sup 226/Ra. Observation of delayed effects in the uterine-cervix in animals held up to 4 years postexposure indicate that the RBE for /sup 252/Cf may be increased to a value as high as 18, while repair may have even decreased it to about 5.6 in the rectum. Fifty swine are still being observed for long-term effects after doses above 800 rad from /sup 252/Cf and 5000 rad from /sup 226/Ra.

  10. Ab initio full-potential study of mechanical properties and magnetic phase stability of californium monopnictides (CfN and CfP)

    Energy Technology Data Exchange (ETDEWEB)

    Amari, S., E-mail: siham_amari@yahoo.fr [Faculté des Sciences de la Nature et de la Vie, Université Hassiba Benbouali, Chlef, 02000 (Algeria); Bouhafs, B. [Laboratoire de Modélisation et Simulation en Sciences des Matériaux, Université Djillali Liabès de Sidi Bel-Abbés, Sidi Bel-Abbés, 22000 (Algeria)

    2016-09-15

    Based on the first-principles methods, the structural, elastic, electronic, properties and magnetic ordering of californium monopnictides CfX (X = P) have been studied using the full-potential augmented plane wave plus local orbitals (FP-L/APW + lo) method within the framework of density functional theory (DFT). The electronic exchange correlation energy is described by generalized gradient approximation GGA and GGA+U (U is the Hubbard correction). The GGA+U method is applied to the rare-earth 5f states. We have calculated the lattice parameters, bulk modulii and the first pressure derivatives of the bulk modulii. The elastic properties of the studied compounds are only investigated in the most stable calculated phase. In order to gain further information, we have calculated Young’s modulus, shear modulus, anisotropy factor and Kleinman parameter by the aid of the calculated elastic constants. The results mainly show that californium monopnictides CfX (X = P) have an antiferromagnetic spin ordering. Density of states (DOS) and charge densities for both compounds are also computed in the NaCl (B1) structure.

  11. 14 CFR 135.245 - Second in command qualifications.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Second in command qualifications. 135.245... (CONTINUED) AIR CARRIERS AND OPERATORS FOR COMPENSATION OR HIRE: CERTIFICATION AND OPERATIONS OPERATING REQUIREMENTS: COMMUTER AND ON DEMAND OPERATIONS AND RULES GOVERNING PERSONS ON BOARD SUCH AIRCRAFT Flight...

  12. 8 CFR 245a.2 - Application for temporary residence.

    Science.gov (United States)

    2010-01-01

    ... (No. 76-C-4268 (N.D. ILL. March 22, 1977)); that is, an alien from an independent country of the... States was due merely to a brief temporary trip abroad due to emergent or extenuating circumstances... employment and travel abroad for temporary resident status applicants under section 245A(a) of the Act may...

  13. 48 CFR 245.105 - Contractor's property management system compliance.

    Science.gov (United States)

    2010-10-01

    ... ACQUISITION REGULATIONS SYSTEM, DEPARTMENT OF DEFENSE CONTRACT MANAGEMENT GOVERNMENT PROPERTY General 245.105 Contractor's property management system compliance. The assigned property administrator shall perform... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Contractor's property...

  14. 48 CFR 245.7303 - Formal bid procedures.

    Science.gov (United States)

    2010-10-01

    ..., DEPARTMENT OF DEFENSE CONTRACT MANAGEMENT GOVERNMENT PROPERTY Sale of Surplus Contractor Inventory 245.7303... appropriate trade journals or magazines and local newspapers. (e) When the acquisition cost of the property to... calendar days before bid opening to allow adequate opportunity to inspect property and prepare bids. (c...

  15. 48 CFR 245.7309-10 - Risk of loss.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Risk of loss. 245.7309-10...-10 Risk of loss. The Contractor is responsible for reasonable care and protection of the property until the date specified for removal. All risk of loss, damage, or destruction from any cause whatsoever...

  16. 48 CFR 245.607-2 - Recovering precious metals.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Recovering precious metals... Disposal of Contractor Inventory 245.607-2 Recovering precious metals. (b) Precious metals are silver, gold... office with disposition instructions for certain categories of precious metals-bearing property...

  17. Low-Dose-Rate Californium-252 Neutron Intracavitary Afterloading Radiotherapy Combined With Conformal Radiotherapy for Treatment of Cervical Cancer

    Energy Technology Data Exchange (ETDEWEB)

    Zhang Min [Department of Oncology, Armed Police Hospital of Hangzhou, Hangzhou, Zhejiang Province (China); Xu Hongde [Cancer Center, Armed Police Hospital of Hangzhou, Hangzhou, Zhejiang Province (China); Pan Songdan; Lin Shan; Yue Jianhua [Department of Oncology, Armed Police Hospital of Hangzhou, Hangzhou, Zhejiang Province (China); Liu Jianren, E-mail: liujianren0571@hotmail.com [Second Affiliated Hospital, School of Medicine, Zhejiang University, Hangzhou, Zhejiang Province (China)

    2012-07-01

    Purpose: To study the efficacy of low-dose-rate californium-252 ({sup 252}Cf) neutron intracavitary afterloading radiotherapy (RT) combined with external pelvic RT for treatment of cervical cancer. Methods and Materials: The records of 96 patients treated for cervical cancer from 2006 to 2010 were retrospectively reviewed. For patients with tumors {<=}4 cm in diameter, external beam radiation was performed (1.8 Gy/day, five times/week) until the dose reached 20 Gy, and then {sup 252}Cf neutron intracavitary afterloading RT (once/week) was begun, and the frequency of external beam radiation was changed to four times/week. For patients with tumors >4 cm, {sup 252}Cf RT was performed one to two times before whole-pelvis external beam radiation. The tumor-eliminating dose was determined by using the depth limit of 5 mm below the mucosa as the reference point. In all patients, the total dose of the external beam radiation ranged from 46.8 to 50 Gy. For {sup 252}Cf RT, the dose delivered to point A was 6 Gy/fraction, once per week, for a total of seven times, and the total dose was 42 Gy. Results: The mean {+-} SD patient age was 54.7 {+-} 13.7 years. Six patients had disease assessed at stage IB, 13 patients had stage IIA, 49 patients had stage IIB, 3 patients had stage IIIA, 24 patients had stage IIIB, and 1 patient had stage IVA. All patients obtained complete tumor regression (CR). The mean {+-} SD time to CR was 23.5 {+-} 3.4 days. Vaginal bleeding was fully controlled in 80 patients within 1 to 8 days. The mean {+-} SD follow-up period was 27.6 {+-} 12.7 months (range, 6-48 months). Five patients died due to recurrence or metastasis. The 3-year survival and disease-free recurrence rates were 89.6% and 87.5 %, respectively. Nine patients experienced mild radiation proctitis, and 4 patients developed radiocystitis. Conclusions: Low-dose-rate {sup 252}Cf neutron RT combined with external pelvic RT is effective for treating cervical cancer, with a low incidence of

  18. 48 CFR 252.245-7000 - Government-furnished mapping, charting, and geodesy property.

    Science.gov (United States)

    2010-10-01

    ... mapping, charting, and geodesy property. 252.245-7000 Section 252.245-7000 Federal Acquisition Regulations..., charting, and geodesy property. As prescribed in 245.107-70, use the following clause: Government-Furnished Mapping, Charting, and Geodesy Property (DEC 1991) (a) Definition—Mapping, charting, and geodesy (MC&G...

  19. 6 CFR 27.245 - Review and approval of site security plans.

    Science.gov (United States)

    2010-01-01

    ... 6 Domestic Security 1 2010-01-01 2010-01-01 false Review and approval of site security plans. 27.245 Section 27.245 Domestic Security DEPARTMENT OF HOMELAND SECURITY, OFFICE OF THE SECRETARY CHEMICAL FACILITY ANTI-TERRORISM STANDARDS Chemical Facility Security Program § 27.245 Review and approval of site...

  20. 17 CFR 245.101 - Prohibition of insider trading during pension fund blackout periods.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Prohibition of insider trading during pension fund blackout periods. 245.101 Section 245.101 Commodity and Securities Exchanges...-Blackout Trading Restriction) § 245.101 Prohibition of insider trading during pension fund blackout periods...

  1. 48 CFR 245.7101-4 - DD Form 1640, Request for Plant Clearance.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false DD Form 1640, Request for Plant Clearance. 245.7101-4 Section 245.7101-4 Federal Acquisition Regulations System DEFENSE... Forms 245.7101-4 DD Form 1640, Request for Plant Clearance. Use to request plant clearance assistance or...

  2. 48 CFR 245.608-7 - Reimbursement of cost for transfer of contractor inventory.

    Science.gov (United States)

    2010-10-01

    ... Reporting, Redistribution, and Disposal of Contractor Inventory 245.608-7 Reimbursement of cost for transfer of contractor inventory. The Defense Logistics Agency will pay for the movement of industrial plant... transfer of contractor inventory. 245.608-7 Section 245.608-7 Federal Acquisition Regulations System...

  3. 27 CFR 24.245 - Use of carbon dioxide in still wine.

    Science.gov (United States)

    2010-04-01

    ... still wine. 24.245 Section 24.245 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY LIQUORS WINE Storage, Treatment and Finishing of Wine § 24.245 Use of carbon dioxide in still wine. The addition of carbon dioxide to (and retention in) still wine...

  4. 5 CFR 531.245 - Computing locality rates and special rates for GM employees.

    Science.gov (United States)

    2010-01-01

    ... rates for GM employees. 531.245 Section 531.245 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT... Gm Employees § 531.245 Computing locality rates and special rates for GM employees. Locality rates and special rates are computed for GM employees in the same manner as locality rates and special rates...

  5. 8 CFR 245.11 - Adjustment of aliens in S nonimmigrant classification.

    Science.gov (United States)

    2010-01-01

    ... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Adjustment of aliens in S nonimmigrant classification. 245.11 Section 245.11 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION... aliens in S nonimmigrant classification. (a) Eligibility. An application on Form I-854, requesting that...

  6. 8 CFR 245.24 - Adjustment of aliens in U nonimmigrant status.

    Science.gov (United States)

    2010-01-01

    ... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Adjustment of aliens in U nonimmigrant status. 245.24 Section 245.24 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION... aliens in U nonimmigrant status. (a) Definitions. As used in this section, the term: (1) Continuous...

  7. 8 CFR 245.23 - Adjustment of aliens in T nonimmigrant classification.

    Science.gov (United States)

    2010-01-01

    ... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Adjustment of aliens in T nonimmigrant classification. 245.23 Section 245.23 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION... aliens in T nonimmigrant classification. (a) Eligibility of principal T-1 applicants. Except as described...

  8. 20 CFR 411.245 - What are a PM's responsibilities under the Ticket to Work program?

    Science.gov (United States)

    2010-04-01

    ... Ticket to Work program? 411.245 Section 411.245 Employees' Benefits SOCIAL SECURITY ADMINISTRATION THE TICKET TO WORK AND SELF-SUFFICIENCY PROGRAM Use of One or More Program Managers To Assist in... formats. For purposes of this section, accessible format means by media that is appropriate to a...

  9. 14 CFR 125.245 - Organization required to perform maintenance, preventive maintenance, and alteration.

    Science.gov (United States)

    2010-01-01

    ... maintenance, preventive maintenance, and alteration. 125.245 Section 125.245 Aeronautics and Space FEDERAL..., preventive maintenance, and alteration. The certificate holder must ensure that each person with whom it arranges for the performance of maintenance, preventive maintenance, alteration, or required inspection...

  10. 48 CFR 245.302 - Contracts with foreign governments or international organizations.

    Science.gov (United States)

    2010-10-01

    ... governments or international organizations. 245.302 Section 245.302 Federal Acquisition Regulations System... international organizations. (1) General. (i) Approval. A contractor may use Government property on work for foreign governments and international organizations only when approved in writing by the contracting...

  11. CLONING AND CHARACTERIZATION OF A CHROMOSOMAL DNA REGION REQUIRED FOR GROWTH ON 2,4,5-T BY PSEUDOMONAS CEPACIA AC1100

    Science.gov (United States)

    A series of spontaneous 2,4,5-trichlorophenoxyacetic acid (2,4,5-T) nonmetabolizing mutants of Pseudomonas cepacia AC1100 were characterized to be defective in either 2,4,5-T uptake or conversion of this compound to 2,4,5-trichlorophenol (2,4,5-TCP). Two of these mutants, RHC22 a...

  12. Californium-252 neutron intracavity brachytherapy alone for T1N0 low-lying rectal adenocarcinoma: A definitive anal sphincter-preserving radiotherapy

    Science.gov (United States)

    Xiong, Yanli; Shan, Jinlu; Liu, Jia; Zhao, Kewei; Chen, Shu; Xu, Wenjing; Zhou, Qian; Yang, Mei; Lei, Xin

    2017-01-01

    This study evaluated the 4-year results of 32 patients with T1N0 low-lying rectal adenocarcinoma treated solely with californium-252 (Cf-252) neutron intracavity brachytherapy (ICBT). Patients were solicited into the study from January 2008 to June 2011. All the patients had refused surgery or surgery was contraindicated. The patients were treated with Cf-252 neutron ICBT using a novel 3.5-cm diameter off-axis 4-channel intrarectal applicator designed by the authors. The dose reference point was defined on the mucosa surface, with a total dose of 55–62 Gy-eq/4 f (13–16 Gy-eq/f/wk). All the patients completed the radiotherapy in accordance with our protocol. The rectal lesions regressed completely, and the acute rectal toxicity was mild (≤G2). The 4-year local control, overall survival, disease-free survival, and late complication (≥G2) rates were 96.9%, 90.6%, 87.5% and 15.6%, respectively. No severe late complication (≥G3) occurred. The mean follow-up was 56.1 ± 16.0 months. At the end of last follow-up, 29 patients remained alive. The mean survival time was 82.1 ± 2.7 months. Cf-252 neutron ICBT administered as the sole treatment (without surgery) for patients with T1N0 low-lying rectal adenocarcinoma is effective with acceptable late complications. Our study and method offers a definitive anal sphincter-preserving radiotherapy for T1N0 low-lying rectal adenocarcinoma patients. PMID:28094790

  13. FTIR spectroscopic study of biofilms formed by the rhizobacterium Azospirillum brasilense Sp245 and its mutant Azospirillum brasilense Sp245.1610

    Science.gov (United States)

    Tugarova, Anna V.; Scheludko, Andrei V.; Dyatlova, Yulia A.; Filip'echeva, Yulia A.; Kamnev, Alexander A.

    2017-07-01

    Biofilms are spatially and metabolically structured communities of microorganisms, representing a mode of their existence which is ubiquitous in nature, with cells localised within an extracellular biopolymeric matrix, attached to each other, at an interface. For plant-growth-promoting rhizobacteria (PGPR), the formation of biofilms is of special importance due to their primary localisation at the surface of plant root systems. In this work, FTIR spectroscopy was used, for the first time for bacteria of the genus Azospirillum, to comparatively study 6-day-mature biofilms formed on the surface of ZnSe discs by the rhizobacterium Azospirillum brasilense Sp245 and its mutant A. brasilense Sp245.1610. The mutant strain, having an Omegon Km insertion in the gene of lipid metabolism fabG1 on the plasmid AZOBR_p1, as compared to the wild-type strain Sp245 (see http://dx.doi.org/10.1134/S1022795413110112)

  14. Yeast Interacting Proteins Database: YNL189W, YLR245C [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available YLR245C CDD1 Cytidine deaminase; catalyzes the modification of cytidine to uridine in vitro but native RNA...description Cytidine deaminase; catalyzes the modification of cytidine to uridine in vitro but native RNA

  15. First results of the 2.45 GHz Oshima electron cyclotron resonance ion source

    Energy Technology Data Exchange (ETDEWEB)

    Asaji, T., E-mail: asaji@nc-toyama.ac.jp [National Institute of Technology, Toyama College, 13 Hongo, Toyama 939-8630 (Japan); Nakamura, T.; Furuse, M. [National Institute of Technology, Oshima College, 1091-1 Komatsu, Suouoshima, Oshima, Yamaguchi 742-2193 (Japan); Hitobo, T. [Tateyama Machine Co., Ltd., 30 Shimonoban, Toyama 930-1305 (Japan); Uchida, T. [Graduate School of Engineering, Toyo University, 2100 Kujirai, Kawagoe, Saitama 350-8585 (Japan); Muramatsu, M. [National Institute of Radiological Sciences (NIRS), 4-9-1 Anagawa, Inage-ku, Chiba 263-8555 (Japan); Kato, Y. [Graduate School of Engineering, Osaka University, 2-1 Yamada-oka, Suita, Osaka 565-0871 (Japan)

    2016-02-15

    A new electron cyclotron resonance ion source has been constructed at Oshima College with a 2.45 GHz magnetron microwave source and permanent magnets employed as the main components. In addition, a solid-state power amplifier with a frequency range of 2.5–6.0 GHz was installed to study two-frequency plasma heating. Three solenoid coils were set up for adjusting the axial magnetic fields. Argon plasma generation and ion beam production have been conducted during the first year of operation. Ion current densities in the ECR plasma were measured using a biased disk. For 2.45 and 4.65 GHz two-frequency plasma heating, the ion density was approximately 1.5 times higher than that of 2.45 GHz single-frequency heating.

  16. Tannic acid Catalyzed an Efficient Synthesis of 2,4,5-Triaryl-1H-Imidazole

    Directory of Open Access Journals (Sweden)

    Shitole Nana Vikram

    2013-05-01

    Full Text Available Tannic acid (C76H52O46 has been found to be an efficient catalyst for one-pot synthesis of 2,4,5-triaryl substituted imidazoles by the reaction of an arylaldehyde, benzyl/benzoin and an ammonium acetate. The short reaction time and excellent yields making this protocol practical and economically attractive.

  17. A novel polymeric catalyst for the one-pot synthesis of 2,4,5-triaryl ...

    Indian Academy of Sciences (India)

    Abstract. An efficient synthesis of 2,4,5-trisubstituted imidazoles is achieved by three component cyclo- condensation of benzil or benzoin, aldehyde and ammonium acetate by using novel polymeric catalyst. [poly(AMPS-co-AA)] under solvent-free conditions. The key advantages of this process are high yields, shorter.

  18. Short-duration exposure to 2.45 GHz microwave radiation induces ...

    African Journals Online (AJOL)

    OBEMBE

    Key words: 2.45 GHz microwave radiation, histopathology, DNA single strand break, ovary, testis. INTRODUCTION. Microwave (MW) radiation .... single strand break (SSB) in ovary and testis of the animals after exposure to 2.39 Wkg-1 MW .... intrinsic (quantum) energy is too low to dislodge an electron from a molecule but ...

  19. Effects of 2.45 GHz Radiofrequency Radiation Exposures on Normal ...

    African Journals Online (AJOL)

    sickle cell patients. Blood samples were collected for analysis before and after being irradiated with a 2.45 GHz radiofrequency source. The osmotic fragility of the red blood cells, the packed cell volume and percentage haemolysis for irreversibly ...

  20. 27 CFR 28.245 - Shipment to foreign-trade zone.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Shipment to foreign-trade... Consignment § 28.245 Shipment to foreign-trade zone. Where distilled spirits (including specially denatured spirits), wines, or beer, are transferred to a foreign-trade zone for exportation or for storage pending...

  1. 48 CFR 245.7101-2 - DD Form 1149, Requisition and Invoice Shipping Document.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false DD Form 1149, Requisition... Plant Clearance Forms 245.7101-2 DD Form 1149, Requisition and Invoice Shipping Document. Use for... DD Form 1149. This form may also be used to consolidate contractor inventory redistribution system...

  2. 48 CFR 245.7206 - Transmitting DD Form 1342, DoD Property Record.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Transmitting DD Form 1342... Instructions 245.7206 Transmitting DD Form 1342, DoD Property Record. As a minimum, the plant clearance officer will provide the following information in a letter forwarding DD Forms 1342 to DSCR— (a) Number of DD...

  3. 7 CFR 2.45 - Deputy Under Secretary for Rural Economic and Community Development.

    Science.gov (United States)

    2010-01-01

    ... the Under Secretary for Rural Development § 2.45 Deputy Under Secretary for Rural Economic and... Under Secretary for Rural Economic and Community Development, to be exercised only during the absence or... may hereafter be delegated to the Under Secretary for Rural Economic and Community Development. ...

  4. 18 CFR 367.2450 - Account 245, Derivative instrument liabilities-Hedges

    Science.gov (United States)

    2010-04-01

    ... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false Account 245, Derivative..., Derivative instrument liabilities—Hedges (a) This account must include the change in the fair value of derivative instrument liabilities designated by the service company as cash flow or fair value hedges. (b) A...

  5. 48 CFR 1852.245-73 - Financial reporting of NASA property in the custody of contractors.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Financial reporting of NASA... CONTRACT CLAUSES Texts of Provisions and Clauses 1852.245-73 Financial reporting of NASA property in the custody of contractors. As prescribed in 1845.106-70(d), insert the following clause: Financial Reporting...

  6. Californium-252 Program Equipment Evaluation

    Energy Technology Data Exchange (ETDEWEB)

    Chattin, Fred Rhea [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Wilson, Kenton [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Ezold, Julie G. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States)

    2017-12-01

    To successfully continue the 252Cf production and meet the needs of the customers, a comprehensive evaluation of the Building 7920 processing equipment was requested to identify equipment critical to the operational continuity of the program.

  7. 12 CFR 24.5 - Public welfare investment after-the-fact notice and prior approval procedures.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 1 2010-01-01 2010-01-01 false Public welfare investment after-the-fact notice and prior approval procedures. 24.5 Section 24.5 Banks and Banking COMPTROLLER OF THE CURRENCY... capital and surplus represented by the proposed investment and by the bank's aggregate outstanding public...

  8. 48 CFR 245.606-70 - Instructions for completing DD Form 1342, DoD Property Record.

    Science.gov (United States)

    2010-10-01

    ... completing DD Form 1342, DoD Property Record. 245.606-70 Section 245.606-70 Federal Acquisition Regulations... completing DD Form 1342, DoD Property Record. (a) The contractor shall list excess industrial plant equipment (IPE) on DD Form 1342, DoD Property Record, and submit it to the Government property administrator for...

  9. 8 CFR 245.21 - Adjustment of status of certain nationals of Vietnam, Cambodia, and Laos (section 586 of Public...

    Science.gov (United States)

    2010-01-01

    ... of Vietnam, Cambodia, and Laos (section 586 of Public Law 106-429). 245.21 Section 245.21 Aliens and..., and Laos (section 586 of Public Law 106-429). (a) Eligibility. The Service may adjust the status to that of a lawful permanent resident, a native or citizen of Vietnam, Cambodia, or Laos who: (1) Was...

  10. High-Frequency Wireless Communications System: 2.45-GHz Front-End Circuit and System Integration

    Science.gov (United States)

    Chen, M.-H.; Huang, M.-C.; Ting, Y.-C.; Chen, H.-H.; Li, T.-L.

    2010-01-01

    In this article, a course on high-frequency wireless communications systems is presented. With the 145-MHz baseband subsystem available from a prerequisite course, the present course emphasizes the design and implementation of the 2.45-GHz front-end subsystem as well as system integration issues. In this curriculum, the 2.45-GHz front-end…

  11. Elevated p-CREB-2 (ser 245) expression is potentially associated with carcinogenesis and development of breast carcinoma.

    Science.gov (United States)

    Fan, Chui-Feng; Mao, Xiao-Yun; Wang, En-Hua

    2012-02-01

    CREB-2, also known as ATF-4, belongs to the CREB proteins, a family of transcription factors phosphorylated at serine residues by protein kinase A (PKA). This family is known to stimulate the transcription of genes containing CRE elements. Recently, some studies have demonstrated elevated CREB-2 expression in certain tumor types, including breast carcinoma, compared to their corresponding non-tumor tissues. However, the expression and clinical significance in malignant tumors, including breast carcinoma, of p-CREB-2 (ser 245), a phosphorylated form of the CREB-2 protein at serine 245 site, which is believed to be an active type of this protein, have not been clearly documented. In the present study, we investigated the expression of p-CREB-2 (ser 245) in a group of tumor and non-tumor breast tissues, including normal breast epithelia, hyperplasia, dysplasia, carcinoma in situ and infiltrating carcinoma of the breast using tissue microarray and immunohistochemistry (IHC). p-CREB-2 (ser 245) immunostaining was detected in the nucleus and cytoplasm of these tissues. Compared to normal breast epithelia and breast hyperplasia (total positive rate 13.3%), there was increased expression of p-CREB-2 (ser 245) in dysplasia, carcinoma in situ (total positive rate 35.7%) and infiltrating carcinoma of the breast (total positive rate 60.0%) (pser 245) was found in infiltrating breast carcinoma (total positive rate 60%) compared to normal breast epithelia and all types of non-infiltrating lesions (total positive rate 27.6%) (pser 245) was found to be associated with lymph node metastasis in infiltrating breast carcinoma (pser 245) in breast cancer MCF 7 and MDA-MB-231 cells compared with normal breast epithelial MCF 10A cells. Western blotting revealed elevated expression levels of p-CREB-2 (ser 245) in 17 cases of breast carcinoma compared with corresponding normal breast tissues (pser 245) may potentially contribute to carcinogenesis and cancer development of breast carcinoma.

  12. 245 Zoopharmacognosy

    Indian Academy of Sciences (India)

    Resonance journal of science education. March 2008 Volume 13 Number 3. SERIES ARTICLES. 212 Snippets of Physics. Quantum Mechanics on the Run ... in Integrated Biology. K Muralidhar. 261. 272. 283. Of Mechanisms, Microscopes and Methyl iso- cyanate. S Sriramachari talks to Sujata Varadarajan. 292. Erratum.

  13. Short-duration exposure to 2.45 GHz microwave radiation induces ...

    African Journals Online (AJOL)

    The genotoxic effects of 2.45 GHz microwave (MW) radiation on the testis and ovary of Sprague Dawley rats was investigated. The animals were exposed to varying levels of specific absorption rate (SAR) of 0 (control), 0.48, 0.95, 1.43, 1.91, 2.39, 2.90, 3.40, 3.80 and 4.30 Wkg-1, for 10 min. The induction of DNA damages ...

  14. 49 CFR 40.245 - What is the procedure for an alcohol screening test using a saliva ASD or a breath tube ASD?

    Science.gov (United States)

    2010-10-01

    ... test using a saliva ASD or a breath tube ASD? 40.245 Section 40.245 Transportation Office of the... Alcohol Screening Tests § 40.245 What is the procedure for an alcohol screening test using a saliva ASD or a breath tube ASD? (a) As the STT or BAT, you must take the following steps when using the saliva...

  15. 8 CFR 245.9 - Adjustment of status of certain nationals of the People's Republic of China under Public Law 102...

    Science.gov (United States)

    2010-01-01

    ..., and October 9, 1992 (if the applicant did not travel to the People's Republic of China, the applicant... of the People's Republic of China under Public Law 102-404. 245.9 Section 245.9 Aliens and... ADMITTED FOR PERMANENT RESIDENCE § 245.9 Adjustment of status of certain nationals of the People's Republic...

  16. Manganese determination om minerals by activation analysis, using the californium-252 as a neutron source; Determinacao de manganes em minerios, por analise por ativacao, usando californio-252 como fonte de neutrons

    Energy Technology Data Exchange (ETDEWEB)

    Cardoso, Antonio

    1976-07-01

    Neutron Activation Analysis, using a Californium-252 neutron source, has been applied for the determination of manganese in ores such as pyrolusite, rodonite (manganese silicate)' and blending used in dry-batteries The favorable nuclear properties of manganese, such as high thermal neutron cross-section for the reaction {sup 55}Mn (n.gamma){sup 56} Mn, high concentration of manganese in the matrix and short half - life of {sup 56}Mn, are an ideal combination for non-destructive analysis of manganese in ores. Samples and standards of manganese dioxide were irradiated for about 20 minutes, followed by a 4 to 15 minutes decay and counted in a single channel pulse-height discrimination using a NaI(Tl) scintillation detector. Counting time was equal to 10 minutes. The interference of nuclear reactions {sup 56}Fe(n,p){sup 56}Mn and {sup 59} Co (n, {alpha}){sup 56} were studied, as well as problems in connection with neutron shadowing during irradiation, gamma-rays attenuation during counting and influence of granulometry of samples. One sample,was also analysed by wet-chemical method (sodium bismuthate) in order to compare results. As a whole, i t was shown that the analytical method of neutron activation for manganese in ores and blending, is a method simple, rapid and with good precision and accuracy. (author)

  17. Design of a homogeneous subcritical nuclear reactor based on thorium with a source of californium 252; Diseno de un reactor nuclear subcritico homogeneo a base de Torio con una fuente de Californio 252

    Energy Technology Data Exchange (ETDEWEB)

    Delgado H, C. E.; Vega C, H. R. [Universidad Autonoma de Zacatecas, Unidad Academica de Estudios Nucleares, Cipres No. 10, Fracc. La Penuela, 98068 Zacatecas, Zac. (Mexico); Sajo B, L., E-mail: ce_delgado89@hotmail.com [Universidad Simon Bolivar, Laboratorio de Fisica Nuclear, Apdo. 89000, 1080A Caracas (Venezuela, Bolivarian Republic of)

    2015-10-15

    Full text: One of the energy alternatives to fossil fuels which do not produce greenhouse gases is the nuclear energy. One of the drawbacks of this alternative is the generation of radioactive wastes of long half-life and its relation to the generation of nuclear materials to produce weapons of mass destruction. An option to these drawbacks of nuclear energy is to use Thorium as part of the nuclear fuel which it becomes in U{sup 233} when capturing neutrons, that is a fissile material. In this paper Monte Carlo methods were used to design a homogeneous subcritical reactor based on thorium. As neutron reflector graphite was used. The reactor core is homogeneous and is formed of 70% light water as moderator, 12% of enriched uranium UO{sub 2}(NO{sub 3}){sub 4} and 18% of thorium Th(NO{sub 3}){sub 4} as fuel. To start the nuclear fission chain reaction an isotopic source of californium 252 was used with an intensity of 4.6 x 10{sup 7} s{sup -1}. In the design the value of the effective multiplication factor, whose value turned out k{sub eff} <1 was calculated. Also, the neutron spectra at different distances from the source and the total fluence were calculated, as well as the values of the ambient dose equivalent in the periphery of the reactor. (Author)

  18. One-pot synthesis of 2,4,5-tri-substituted-1H-imidazoles promoted by trichloromelamine

    Directory of Open Access Journals (Sweden)

    BiBi Fatemeh Mirjalili

    2013-01-01

    Full Text Available 2,4,5-Trisubstituted imidazoles have many pharmaceutical properties and can be prepared via reaction of 1, 2-diketones with aldehydes in the presence of an acidic catalyst. In this work, we have prepared 2,4,5-trisubstituted imidazoles in the presence of trichloromelamine as a source of positive chlorine. Short reaction times, high yield, simplicity of operation and easy work-up are some advantages of this method.

  19. One-pot synthesis of 2,4,5-trisubstituted imidazole derivatives catalyzed by btppc under solvent-free conditions

    Directory of Open Access Journals (Sweden)

    M. Alikarami

    2017-07-01

    Full Text Available A simple and efficient method for one-pot synthesis of lophine derivatives (2,4,5-trisubstituted imidazoles by using the benzyltriphenylphosphonium chloride (BTPPC, as a catalyst, under solvent-free conditions is described. BTPPC is an available and inexpensive catalyst; also, it can be easily supplied. This procedure led to the corresponding 2,4,5-trisubstituted imidazoles products in high yields.

  20. Rectenna Technology Program: Ultra light 2.45 GHz rectenna 20 GHz rectenna

    Science.gov (United States)

    Brown, William C.

    1987-01-01

    The program had two general objectives. The first objective was to develop the two plane rectenna format for space application at 2.45 GHz. The resultant foreplane was a thin-film, etched-circuit format fabricated from a laminate composed of 2 mil Kapton F sandwiched between sheets of 1 oz copper. The thin-film foreplane contains half wave dipoles, filter circuits, rectifying Schottky diode, and dc bussing lead. It weighs 160 grams per square meter. Efficiency and dc power output density were measured at 85% and 1 kw/sq m, respectively. Special testing techniques to measure temperature of circuit and diode without perturbing microwave operation using the fluoroptic thermometer were developed. A second objective was to investigate rectenna technology for use at 20 GHz and higher frequencies. Several fabrication formats including the thin-film scaled from 2.45 GHz, ceramic substrate and silk-screening, and monolithic were investigated, with the conclusion that the monolithic approach was the best. A preliminary design of the monolithic rectenna structure and the integrated Schottky diode were made.

  1. Formation of persistent organic pollutants from 2,4,5-trichlorothiophenol combustion: a density functional theory investigation.

    Science.gov (United States)

    Dar, Tajwar; Shah, Kalpit; Moghtaderi, Behdad; Page, Alister J

    2016-06-01

    Polychlorinated dibenzothiophene (PCDT) and polychlorinated thianthrene (PCTA) are sulfur analogues of dioxins, such as polychlorinated dibenzo-p-dioxins and polychlorinated dibenzofurans (PCDD/F). In this work, we present a detailed mechanistic and kinetic analysis of PCDT and PCTA formation from the combustion of 2,4,5-trichlorothiophenol. It is shown that the formation of these persistent organic pollutants is more favourable, both kinetically and thermodynamically, than their analogous dioxin counterparts. This is rationalised in terms of the different influences of the S-H and O-H moieties in the 2,4,5-trichlorothiophenol and 2,4,5-trichlorophenol precursors. Kinetic parameters also indicate that the yield of PCDT should exceed that of PCDD. Finally, we demonstrate here that the degree and pattern of chlorination on the 2,4,5-trichlorothiophenol precursor leads to subtle thermodynamic and kinetic changes to the PCDT/PCTA formation mechanisms. Graphical abstract Formation mechanisms of persistant organic pollutants, PCDT and PCTA, from 2,4,5-trichlorothiophenol combustion, has been investigated using density functional theory.

  2. Superluminal motion in the double-lobed quasar 3C 245

    Science.gov (United States)

    Hough, D. H.; Readhead, A. C. S.

    1987-01-01

    VLBI observations of 3C 245 obtained at 10.7 GHz with the Mark III array at five epochs in 1981-1986 are reported. The data-reduction and model-fitting procedures are explained, and the results are presented in tables, graphs, and maps along with previously published data on 11 other superluminal sources. The central component of the quasar is found to have an apparent transverse velocity of (3.1 + or - 1.4) c/h, assuming H0 = 100h km/s Mpc and q0 = 0.5. From the apparent source orientation (based on R, variability, apparent curvature, and projected linear size) it is inferred that the apparent transverse velocity is anticorrelated with the angle to the line of sight, as predicted by relativistic-beaming models of superluminal motion.

  3. Remote powering platform for implantable sensor systems at 2.45 GHz.

    Science.gov (United States)

    Kazanc, Onur; Yilmaz, Gurkan; Maloberti, Franco; Dehollain, Catherine

    2014-01-01

    Far-field remotely powered sensor systems enable long distance operation for low-power sensor systems. In this work, we demonstrate a remote powering platform with a miniaturized antenna and remote powering base station operating at 2.45 GHz. The rectenna, which is the energy receiving and conversion element of the sensor system, is designed and measured. The measurements for the tag are performed within 15 cm distance from the remote powering base station. The realized gain of the tag antenna is measured as -3.3 dB, which is 0.5 dB close to the simulations, where simulated realized gain is -2.8 dB.

  4. VUV irradiance measurement of a 2.45 GHz microwave-driven hydrogen discharge

    CERN Document Server

    Komppula, J; Kalvas, T; Koivisto, H; Kronholm, R; Laulainen, J; Myllyperkiö, P

    2015-01-01

    Absolute values of VUV-emission of a 2.45 GHz microwave-driven hydrogen discharge are reported. The measurements were performed with a robust and straightforward method based on a photodiode and optical filters. It was found that the volumetric photon emission rate in the VUV-range (80-250 nm) is $10^{16}$-$10^{17}$ 1/cm$^3$s, which corresponds to approximately 8% dissipation of injected microwave power by VUV photon emission. The volumetric emission of characteristic emission bands was utilized to diagnostics of molecular plasma processes including volumetric rates of ionization, dissociation and excitation to high vibrational levels and metastable states. The estimated reaction rates imply that each injected molecule experiences several inelastic electron impact collisions. The upper limit for the total density of metastable neutrals ($2S$ atoms and $c^3\\Pi_u$ molecules) was estimated to be approximately 0.5% of the neutral gas density.

  5. 48 CFR 245.7101-3 - DD Form 1348-1, DoD Single Line Item Release/Receipt Document.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false DD Form 1348-1, DoD Single Line Item Release/Receipt Document. 245.7101-3 Section 245.7101-3 Federal Acquisition Regulations... PROPERTY Plant Clearance Forms 245.7101-3 DD Form 1348-1, DoD Single Line Item Release/Receipt Document...

  6. Microwave-assisted rapid synthesis of methyl 2,4,5-trimethoxyphenylpropionate, a metabolite of Cordia alliodora.

    Science.gov (United States)

    Sinha, A K; Joshi, B P; Sharma, A; Kumar, J K; Kaul, V K

    2003-12-01

    Microwave assisted condensation of asaronaldehyde (2) with malonic acid in piperidine-AcOH provides 2,4,5-trimethoxycinnamic acid (3) in 87% yield within 4 min, which upon further reduction with PdCl2- HCOOH-aq. NaOH gives 3-(2,4,5-trimethoxy)phenyl propionic acid (4) in 88% yield within 3 min. Esterification of 4 with MeOH-H+ gives methyl 2,4,5-trimethoxyphenylpropionate (1), a metabolite of Cordia alliodora, in 94% yield within 3 min (overall 69% yield).

  7. 8 CFR 245.12 - What are the procedures for certain Polish and Hungarian parolees who are adjusting status to...

    Science.gov (United States)

    2010-01-01

    ... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false What are the procedures for certain Polish and Hungarian parolees who are adjusting status to that of permanent resident under the Illegal... PERMANENT RESIDENCE § 245.12 What are the procedures for certain Polish and Hungarian parolees who are...

  8. Comparative study of electrochemical oxidation of herbicide 2,4,5-T: Kinetics, parametric optimization and mineralization pathway

    Directory of Open Access Journals (Sweden)

    Hicham Zazou

    2017-01-01

    Full Text Available Oxidative degradation of herbicide 2,4,5-T was studied by electrochemical advanced oxidation processes anodic oxidation and electro-Fenton (EF using Pt/carbon felt and BDD/carbon felt cells. The effect of main operating parameters on oxidation of 2,4,5-T and mineralization of its aqueous solution were investigated. The rate constant for oxidation of 2,4,5-T by ·≡OH was determined as (3.7 ± 0.2 × 109 M−1 s−1 using competition kinetics method. The EF process with BDD anode was shown to be very efficient reaching 94% mineralization in 3 h treatment. Based on identified aromatic intermediates, short-chain carboxylic acids, released inorganic ions and total organic carbon removal measurements, a plausible oxidation pathway for mineralization of 2,4,5-T by hydroxyl radical was proposed. In addition, the evolution of solution toxicity during treatment was monitored by Microtox method showing the formation of toxic aromatic/cyclic intermediates. The results showed also that EF process was able to remove efficiently toxic intermediates and consequently solution toxicity.

  9. USP2-45 Is a Circadian Clock Output Effector Regulating Calcium Absorption at the Post-Translational Level.

    Directory of Open Access Journals (Sweden)

    Daniel Pouly

    Full Text Available The mammalian circadian clock influences most aspects of physiology and behavior through the transcriptional control of a wide variety of genes, mostly in a tissue-specific manner. About 20 clock-controlled genes (CCGs oscillate in virtually all mammalian tissues and are generally considered as core clock components. One of them is Ubiquitin-Specific Protease 2 (Usp2, whose status remains controversial, as it may be a cogwheel regulating the stability or activity of core cogwheels or an output effector. We report here that Usp2 is a clock output effector related to bodily Ca2+ homeostasis, a feature that is conserved across evolution. Drosophila with a whole-body knockdown of the orthologue of Usp2, CG14619 (dUsp2-kd, predominantly die during pupation but are rescued by dietary Ca2+ supplementation. Usp2-KO mice show hyperabsorption of dietary Ca2+ in small intestine, likely due to strong overexpression of the membrane scaffold protein NHERF4, a regulator of the Ca2+ channel TRPV6 mediating dietary Ca2+ uptake. In this tissue, USP2-45 is found in membrane fractions and negatively regulates NHERF4 protein abundance in a rhythmic manner at the protein level. In clock mutant animals (Cry1/Cry2-dKO, rhythmic USP2-45 expression is lost, as well as the one of NHERF4, confirming the inverse relationship between USP2-45 and NHERF4 protein levels. Finally, USP2-45 interacts in vitro with NHERF4 and endogenous Clathrin Heavy Chain. Taken together these data prompt us to define USP2-45 as the first clock output effector acting at the post-translational level at cell membranes and possibly regulating membrane permeability of Ca2+.

  10. Assessing the effects of the three herbicides acetochlor, 2,4,5-trichlorophenoxyacetic acid (2,4,5-T) and 2,4-dichlorophenoxyacetic acid on the compound action potential of the sciatic nerve of the frog (Rana ridibunda).

    Science.gov (United States)

    Zafeiridou, Georgia; Geronikaki, Athina; Papaefthimiou, Chrisovalantis; Tryfonos, Melpomeni; Kosmidis, Efstratios K; Theophilidis, George

    2006-11-01

    To assess the relative toxicity of the herbicides acetochlor and 2,4,5-trichlorophenoxyacetic acid (2,4,5-T) on the nervous system, the sciatic nerve of the frog (Rana ridibunda) nerve was incubated in saline inside a specially designed recording chamber. This chamber permits monitoring of the evoked compound action potential (CAP) of the nerve, a parameter that could be used to quantify the vitality of the nerve in normal conditions as well as when the nerve was exposed to the compounds under investigation. Thus, when the nerve was exposed to acetochlor, the EC(50) was estimated to be 0.22mM, while for 2,4,5-T the EC(50) was 0.90mM. Using the identical nerve preparation, the EC(50) of 2,4-D was estimated to be 3.80mM [Kouri, G., Theophilidis, G., 2002. The action of the herbicide 2,4-dichlorophenoxyacetic acid on the isolated sciatic nerve of the frog (Rana ridibunda). Neurotoxicol. Res. 4, 25-32]. The ratio of the relative toxicity for acetochlor, 2,4,5-T and 2,4-D was found to be 1:4:17.2. However, because it is well-known that the action of 2,4-D is dependent on the pH, the relative toxicity of the three compounds was tested at pH 3.3, since it has been found that the sciatic nerve of the frog is tolerant of such a low pH. Under these conditions, the EC(50) was 0.77mM (from 0.22mM at pH 7.2) for acetochlor, 0.20mM (from 0.90mM) for 2,4,5-T and 0.24mM (from 3.80mM at pH 7.2) for 2,4-D. Thus, the relative toxicity of the three compounds changed drastically to 1:0.25:0.31. This change in the relative toxicity is due not only to the increase in the toxicity of 2,4,5-T and 2,4-D at low pH levels, but also to the decrease in the toxicity of acetochlor at pH 3.3.

  11. Scalable 2.45 GHz electrically small antenna design for metaresonator array

    Directory of Open Access Journals (Sweden)

    Yee Loon Sum

    2017-04-01

    Full Text Available In many planar antenna array designs, impedance transformers are required to interconnect the elements to ensure that their impedances are matched. However, impedance transformers take up space and reduce area utilisation. If each element is electrically small and able to function individually as an electrically small antenna (ESA, they can be combined into an array without using impedance transformers. In this study, a stubbed hexagonal shaped folded dipole ESA of one tenth of the wavelength is proposed and developed. This metamaterial inspired design of loading the folded dipole with split ring resonator overcomes the problem of fabricating ESA of one tenth of the wavelength using typical printed circuit board fabrication technologies for the 2.45 GHz band. To show the potential of using this ESA as a unit element for antenna array without using impedance transformers, a seven-element array is designed and fabricated. By optimising the element separation distance, and stub lengths, the ESA array shows good S(11 of less than −25 dB, and gain improvement of up to 12 dB compared with a single unit ESA.

  12. Staphylococcus aureus peritonitis complicates peritoneal dialysis: review of 245 consecutive cases.

    Science.gov (United States)

    Szeto, Cheuk-Chun; Chow, Kai-Ming; Kwan, Bonnie Ching-Ha; Law, Man-Ching; Chung, Kwok-Yi; Yu, Samuel; Leung, Chi-Bon; Li, Philip Kam-Tao

    2007-03-01

    Peritonitis that is caused by Staphylococcus aureus is a serious complication in peritoneal dialysis (PD), but the clinical course of PD-related S. aureus peritonitis remains unclear. All of the S. aureus peritonitis in a dialysis unit from 1994 to 2005 were reviewed. During this period, 2065 episodes of peritonitis were recorded; 245 (11.9%) episodes in 152 patients were caused by S. aureus and 45 (18.4%) episodes were caused by methicillin-resistant S. aureus (MRSA). Patients with a history of recent hospitalization had a higher risk for isolation of MRSA than the others (30.6 versus 14.2%; P = 0.004). The overall primary response rate was 87.8%; the complete cure rate was 74.3%. However, 21 (8.6%) episodes developed relapse and 59 (24.1%) developed repeat S. aureus peritonitis. Episodes that were caused by MRSA had a lower primary response rate (64.4 versus 93.0%; P index episode.

  13. 2.45 GHz Rectenna Designed for Wireless Sensors Operating at 500 C

    Science.gov (United States)

    Ponchak, George E.; Schwartz, Zachary D.; Jordan, Jennifer L.; Downey, Alan N.; Neudeck, Philip G.

    2004-01-01

    High temperature wireless sensors that operate at 500 C are required for aircraft engine monitoring and performance improvement These sensors would replace currently used hard-wired sensors and lead to a substantial reduction in mass. However, even if the sensor output data is transmitted wirelessly to a receiver in the cooler part of the engine, and the associated cables are eliminated, DC power cables are still required to operate the sensors and power the wireless circuits. To solve this problem, NASA is developing a rectenna, a circuit that receives RF power and converts it to DC power. The rectenna would be integrated with the wireless sensor, and the RF transmitter that powers the rectenna would be located in the cooler part of the engine. In this way, no cables to or from the sensors are required. Rectennas haw been demonstrated at ambient room temperature, but to date, no high temperature rectennas haw been reported. In this paper, we report the first rectenna designed for 2.45 GHz operation at 500 C. The circuit consists of a microstrip dipole antenna, a stripline impedance matching circuit, and a stripline low pass filter to prevent transmission of higher harmonics created by the rectifying diode fabricated on an Alumina substrate. The rectifying diode is the gate to source junction of a 6H Sic MESFET and the capacitor and load resistor are chip elements that are each bonded to the Alumina substrate. Each element and the hybrid, rectenna circuit haw been characterized through 500 C.

  14. Identification of CD245 as myosin 18A, a receptor for surfactant A: A novel pathway for activating human NK lymphocytes.

    Science.gov (United States)

    De Masson, A; Giustiniani, J; Marie-Cardine, A; Bouaziz, J D; Dulphy, N; Gossot, D; Validire, P; Tazi, A; Garbar, C; Bagot, M; Merrouche, Y; Bensussan, A

    2016-05-01

    CD245 is a human surface antigen expressed on peripheral blood lymphocytes, initially delineated by two monoclonal antibodies DY12 and DY35. Until now, CD245 molecular and functional characteristics remained largely unknown. We combined immunological and proteomic approaches and identified CD245 as the unconventional myosin 18A, a highly conserved motor enzyme reported as a receptor for the surfactant protein A (SP-A), that plays a critical role in cytoskeleton organization and Golgi budding. We report that the recruitment of CD245 strongly enhanced NK cell cytotoxicity. Further, we show that the enhancement of the NK lymphocytes killing ability toward CD137-ligand expressing target cells could result from the induction of CD137 expression following CD245 engagement. The SP-A receptor could therefore represent a novel and promising target in cancer immunotherapy.

  15. 2,4,5-Trichlorophenoxyacetic acid promotes somatic embryogenesis in the rose cultivar "Livin' Easy" (Rosa sp.).

    Science.gov (United States)

    Estabrooks, Tammy; Browne, Robin; Dong, Zhongmin

    2007-02-01

    Somatic embryogenesis (SE) offers vast potential for the clonal propagation of high-value roses. However, some recalcitrant cultivars unresponsive to commonly employed SE-inducing agents and low induction rates currently hinder the commercialization of SE technology in rose. Rose SE technology requires improvement before it can be implemented as a production system on a commercial scale. In the present work, we assessed 2,4,5-trichlorophenoxyacetic acid (2,4,5-T), a synthetic auxin not previously tested in rose, for its effectiveness to induce SE in the rose cultivar "Livin' Easy" (Rosa sp.). We ran a parallel comparison to the commonly used 2,4-dichlorophenoxyacetic acid (2,4-D). We tested each auxin with two different basal media: Murashige and Skoog (MS) basal medium and woody plant medium (WPM). MS medium resulted in somatic embryo production, whereas WPM did not. 2,4,5-T induced SE over a greater concentration range than 2,4-D's and resulted in significantly greater embryo yields. 2,4,5-T at a concentration of 10 or 25 microM was better for embrygenic tissue initiation than 2,4,5-T at 5 microM. Further embryo development occurred when the tissue was transferred to plant growth regulator (PGR) free medium or media with 40% the original auxin concentration. However, the PGR-free medium resulted in a high percentage of abnormal embryos (32.31%) compared to the media containing auxins. Upon transfer to germination medium, somatic embryos successfully converted into plantlets at rates ranging from 33.3 to 95.2%, depending on treatment. Survival rates 3 months ex vitro averaged 14.0 and 55.6% for 2,4-D- and 2,4,5-T-derived plantlets, respectively. Recurrent SE was observed in 60.2% of the plantlets growing on germination medium. This study is the first report of SE in the commercially valuable rose cultivar 'Livin' Easy' (Rosa sp.) and a suitable methodology was developed for SE of this rose cultivar.

  16. Which neuro-physiologic effects at low level 2.45 GHz RF exposure?; Quels effets neurophysiologiques pour un champ electromagnetique de faible puissance a 2,45 GHz?

    Energy Technology Data Exchange (ETDEWEB)

    Crouzier, D.; Perrin, A.; Debouzy, J.C. [Centre de Recherches du Service Sante des Armees, Unite BCM, 38 - La-Tronche (France); Testylier, G. [Centre de Recherches du Service Sante des Armees, Unite de Neuropharmacologie, 38 - La-Tronche (France)

    2007-06-15

    The LS electromagnetic band (1-4 GHz) is widely used both in domestic and industrial domains. Several studies suggested that the biological systems would exhibit a specific sensitivity to the 2.45 GHz microwaves (water resonance frequency). Potential human health hazards and especially a disruption of the cholinergic system have been reported, due to exposure to microwaves even at low power density. This work presents a multi-parametric study of freely moving rat where neuro-physiology was investigated during 70 hours using neurochemical (micro-dialysis technique), electrophysiological, behavioral (vigilance stages quantification) and thermo-physiological approaches. The rats were exposed 24 hours to a 2.45 GHz pulsed electromagnetic field at low power density. In this exposure conditions, no significant effect have been reported. (authors)

  17. Purification and characterization of β-Fructosidase with inulinase activity from Aspergillus niger - 245

    Directory of Open Access Journals (Sweden)

    Vinícius D'Arcadia Cruz

    1998-01-01

    Full Text Available Aspergillus niger - 245, a strain isolated from soil samples showed good β-fructosidase activity when inoculated in medium formulated with dahlia extract tubers. The enzyme was purified by precipitation in ammonium sulphate and percolated in DEAE-Sephadex A-50 and CM-cellulose columns, witch showed a single peack in all the purification steps, maintaining the I/S ratio between 0.32 to, 0.39. Optimum pH for inulinase activity (I was between 4.0 - 4.5 and for invertase activity (S between 2.5 and 5.0. The optimum temperature was 60O.C for both activities and no loss in activity was observed when it was maintained at this temperature for 30 min. The Km value was 1.44 and 5.0, respectively, for I and S and Vm value 10.48 and 30.55, respectively. The I activity was strongly inhibited by Hg2+ and Ag+ and 2 x 10-3 M of glucose, but not by fructose at the same concentration. The enzyme showed an exo-action mechanism, acting on the inulin of different origins. In assay conditions total hydrolysis of all the frutans was obtained, although it has shown larger activity on the chicory inulin than that one from artichoke Jerusalem and dahlia, in the first 30 min. The obtained results suggested that the enzyme presented good potential for industrial application in the preparing the fructose syrupsAspergillus niger - 245, isolado do solo mostrou boa atividade de b-frutosidase meio formulado com extrato de tubérculos de dahlia. A enzima foi purificada por precipitação em sulfato de amônia e percolada em colunas de DEAE-Sephadex A-50 e CM-celulose, produzindo um único pico em todas as fases de purificação e mantendo a relação I/S entre 0,32 a 0,39. O pH ótimo para a atividade de inulinase (I foi encontrado entre 4,0 - 4.5 e para a atividade de invertase (S em 2,5 e 5,0. A temperatura ótima foi de 60O.C para ambas as atividades e nenhuma perda foi observada quando mantida nesta temperatura por 30 min. Os valores de Km foram de 1,44 e 5

  18. Distribution of blood types in a sample of 245 New Zealand non-purebred cats.

    Science.gov (United States)

    Cattin, R P

    2016-05-01

    To determine the distribution of feline blood types in a sample of non-pedigree, domestic cats in New Zealand, whether a difference exists in this distribution between domestic short haired and domestic long haired cats, and between the North and South Islands of New Zealand; and to calculate the risk of a random blood transfusion causing a severe transfusion reaction, and the risk of a random mating producing kittens susceptible to neonatal isoerythrolysis. The results of 245 blood typing tests in non-pedigree cats performed at the New Zealand Veterinary Pathology (NZVP) and Gribbles Veterinary Pathology laboratories between the beginning of 2009 and the end of 2014 were retrospectively collated and analysed. Cats that were identified as domestic short or long haired were included. For the cats tested at Gribbles Veterinary Pathology 62 were from the North Island, and 27 from the South Island. The blood type distribution differed between samples from the two laboratories (p=0.029), but not between domestic short and long haired cats (p=0.50), or between the North and South Islands (p=0.76). Of the 89 cats tested at Gribbles Veterinary Pathology, 70 (79%) were type A, 18 (20%) type B, and 1 (1%) type AB; for NZVP 139/156 (89.1%) cats were type A, 16 (10.3%) type B, and 1 (0.6%) type AB. It was estimated that 18.3-31.9% of random blood transfusions would be at risk of a transfusion reaction, and neonatal isoerythrolysis would be a risk in 9.2-16.1% of random matings between non-pedigree cats. The results from this study suggest that there is a high risk of complications for a random blood transfusion between non-purebred cats in New Zealand. Neonatal isoerythrolysis should be considered an important differential diagnosis in illness or mortality in kittens during the first days of life.

  19. Fertility outcomes in asthma: a clinical study of 245 women with unexplained infertility.

    Science.gov (United States)

    Gade, Elisabeth Juul; Thomsen, Simon Francis; Lindenberg, Svend; Backer, Vibeke

    2016-04-01

    Evidence is increasing of an association between asthma and aspects of female reproduction. However, current knowledge is limited and furthermore relies on questionnaire studies or small populations. In a prospective observational cohort study to investigate whether time to pregnancy, the number of fertility treatments, and the number of successful pregnancies differ significantly between women with unexplained infertility with and without asthma.245 women with unexplained infertility (aged 23-45 years) underwent questionnaires and asthma and allergy testing while undergoing fertility treatment. 96 women entering the study had either a former doctor's diagnosis of asthma or were diagnosed with asthma when included. After inclusion they were followed for a minimum of 12 months in fertility treatment, until they had a successful pregnancy, stopped treatment, or the observation ended.The likelihood of achieving pregnancy was lower in women with asthma compared with those without asthma: median total time to pregnancy was 32.3 months in non-asthmatic women versus 55.6 months in those with asthma, hazard ratio 0.50 (95% confidence interval 0.34-0.74) pWomen with asthma had fewer successful pregnancies during fertility treatment, 39.6 versus 60.4% (p=0.002). Increasing age was of negative importance for expected time to pregnancy, especially among asthmatic women (interaction between age and asthma on time to pregnancy, p=0.001). Female asthmatics had a longer time to pregnancy and less often became pregnant than non-asthmatic women. Increasing age reduced the chances of conceiving especially among asthmatic women. The causal relationship between asthma and subfertility remains unclear. Copyright ©ERS 2016.

  20. The reticulin algorithm for adrenocortical tumor diagnosis: a multicentric validation study on 245 unpublished cases.

    Science.gov (United States)

    Duregon, Eleonora; Fassina, Ambrogio; Volante, Marco; Nesi, Gabriella; Santi, Raffaella; Gatti, Gaia; Cappellesso, Rocco; Dalino Ciaramella, Paolo; Ventura, Laura; Gambacorta, Marcello; Dei Tos, Angelo Paolo; Loli, Paola; Mannelli, Massimo; Mantero, Franco; Berruti, Alfredo; Terzolo, Massimo; Papotti, Mauro

    2013-09-01

    The pathologic diagnosis of adrenocortical carcinoma (ACC) still needs to be improved, because the renowned Weiss Score (WS) system has a poor reproducibility of some parameters and is difficult to apply in borderline cases and in ACC variants. The "reticulin algorithm" (RA) defines malignancy through an altered reticulin framework associated with 1 of the 3 following parameter: necrosis, high mitotic rate, and vascular invasion. This study aimed at validating the interobserver reproducibility of reticulin stain evaluation in an unpublished series of 245 adrenocortical tumors (61 adenomas and 184 carcinomas) from 5 Italian centers, classified according to the WS. Eight pathologists reviewed all reticulin-stained slides. After training, a second round of evaluation on discordant cases was performed 10 weeks later. The RA reclassified 67 cases (27%) as adenomas, including 44 with no reticulin alterations and 23 with an altered reticulin framework but lacking the subsequent parameters of the triad. The other 178 cases (73%) were carcinomas according to the above-mentioned criteria. A complete (8/8 pathologists) interobserver agreement was reached in 75% of cases (κ=0.702), irrespective of case derivation, pathologists' experience, and histologic variants, and was further improved when only those cases with high WS and clinically malignant behavior were considered. After the training, the overall agreement increased to 86%. We conclude that reticulin staining is a reliable technique and an easy-to-interpret system in adrenocortical tumors; moreover, it has a high interobserver reproducibility, which supports the notion of using such a method in the proposed 2-step RA approach for ACC diagnosis.

  1. Review of Australian health economic evaluation – 245 interventions: what can we say about cost effectiveness?

    Directory of Open Access Journals (Sweden)

    Mortimer Duncan

    2008-05-01

    Full Text Available Abstract Background There is an increasing body of published cost-utility analyses of health interventions which we sought to draw together to inform research and policy. Methods To achieve consistency in costing base and policy context, study scope was limited to Australian-based cost-effectiveness analyses. Through a comprehensive literature review we identified 245 health care interventions that met our study criteria. Results The median cost-effectiveness ratio was A$18,100 (~US$13,000 per QALY/DALY/LY (quality adjusted life year gained or, disability adjusted life year averted or life year gained. Some modalities tended to perform worse, such as vaccinations and diagnostics (median cost/QALY $58,000 and $68,000 respectively, than others such as allied health, lifestyle, in-patient interventions (median cost/QALY/DALY/LY all at ~A$9,000~US$6,500. Interventions addressing some diseases such as diabetes and impaired glucose tolerance or alcohol and drug dependence tended to perform well (median cost/QALY/DALY/LY 25 years (median cost/QALY/DALY/LY Conclusion For any given condition, modality or setting there are likely to be examples of interventions that are cost effective and cost ineffective. It will be important for decision makers to make decisions based on the individual merits of an intervention rather than rely on broad generalisations. Further evaluation is warranted to address gaps in the literature and to ensure that evaluations are performed in areas with greatest potential benefit.

  2. Polarization of Unbalanced Antennas for Ear-to-Ear On-Body Communications at 2.45 GHz

    DEFF Research Database (Denmark)

    Kvist, Søren Helstrup; Thaysen, Jesper; Jakobsen, Kaj Bjarne

    2011-01-01

    The impact of antenna polarization on the earto- ear transmission channel at 2.45 GHz is investigated. Two antenna configurations have been considered for monopole antennas operated on small ground planes that are placed next to the human head. The two setups provide different current distributions...... on the ground planes, which has a drastic impact on the antenna polarization. Their performances are compared in terms of maximum path gain (|S21|) and obtainable bandwidth of the antenna structures....

  3. Experimental evidence of E × B plasma rotation in a 2.45 GHz hydrogen discharge

    Energy Technology Data Exchange (ETDEWEB)

    Cortázar, O. D., E-mail: daniel.cortazar@uclm.es [Institute for Energy Research-INEI, University of Castilla-La Mancha, C.J. Cela s/n, 13170 Ciudad Real (Spain); Megía-Macías, A. [CERN, BE-ABP-HSL Department, CH1211 Geneva (Switzerland); E.S.S. Bilbao, Polígono Ugaldeguren III, A-7B, 48170 Zamudio (Spain); Tarvainen, O.; Koivisto, H. [Department of Physics, Accelerator Laboratory, University of Jyväskylä, PO Box 35 (YFL), 40500 Jyväskylä (Finland)

    2015-12-15

    An experimental observation of a rotating plasma structure in a 2.45 GHz microwave-driven hydrogen discharge is reported. The rotation is presumably produced by E × B drift. The formation of the rotating plasma structure is sensitive to the strength of the off-resonance static magnetic field. The rotation frequency is on the order of 10 kHz and is affected by the neutral gas pressure and applied microwave power.

  4. Zinc (II) [tetra(4-methylphenyl)] Porphyrin: a Novel and Reusable Catalyst for Efficient Synthesis of 2,4,5-trisubstituted Imidazoles Under Ultrasound Irradiation

    Energy Technology Data Exchange (ETDEWEB)

    Safari, Javad; Khalili, Shiva Dehghan; Banitaba, Sayed Hossein; Dehghani, Hossein [Univ. of Kashan, Kashan (Iran, Islamic Republic of)

    2011-10-15

    An efficient three-component one-step synthesis of 2,4,5-trisubstituted imidazoles by condensation reaction of 1,2-diketones or α-hydroxyketones with aromatic aldehydes and ammonium acetate using Zinc (II) [tetra (4-methylphenyl)] porphyrin as a novel and reusable catalyst under ultrasound irradiation at ambient temperature is described. In this method, α-hydroxyketones as well as 1,2-diketones were converted to their corresponding 2,4,5-trisubstituted imidazoles in excellent yields.

  5. Insights into the Effect of the G245S Single Point Mutation on the Structure of p53 and the Binding of the Protein to DNA.

    Science.gov (United States)

    Lepre, Marco Gaetano; Omar, Sara Ibrahim; Grasso, Gianvito; Morbiducci, Umberto; Deriu, Marco Agostino; Tuszynski, Jack A

    2017-08-16

    The transcription factor p53 is a potent tumor suppressor dubbed as the "guardian of the genome" because of its ability to orchestrate protective biological outputs in response to a variety of oncogenic stresses. Mutation and thus inactivation of p53 can be found in 50% of human tumors. The majority are missense mutations located in the DNA binding region. Among them, G245S is known to be a structural hotspot mutation. To understand the behaviors and differences between the wild-type and mutant, both a dimer of the wild type p53 (wt-p53) and its G245S mutant (G245S-mp53), complexed with DNA, were simulated using molecular dynamics for more than 1 μs. wt-p53 and G245S-mp53 apo monomers were simulated for 1 μs as well. Conformational analyses and binding energy evaluations performed underline important differences and therefore provide insights to understand the G245S-mp53 loss of function. Our results indicate that the G245S mutation destabilizes several structural regions in the protein that are crucial for DNA binding when found in its apo form and highlight differences in the mutant-DNA complex structure compared to the wt protein. These findings not only provide means that can be applied to other p53 mutants but also serve as structural basis for further studies aimed at the development of cancer therapies based on restoring the function of p53.

  6. Extension of Sphingobium sp. BHC-A to a 2,4,5-trichlorophenoxyacetic acid mineralizing strain by metabolic engineering.

    Science.gov (United States)

    Ge, Feng; Chen, Xu; Wang, Xin; Liao, Xuewei; Jiao, Yiying; Hong, Qing; Zhang, Longjiang; Wu, Jun

    2013-07-20

    The gene cassette encoding for TftAB and TftCD proteins was integrated into the 16srDNA gene of the γ-hexachlorocyclohexane (γ-HCH) mineralizing strain Sphingobium sp. BHC-A by homologous recombination. The recombinant γ-HCH mineralizing strain may degrade 2,4,5-trichlorophenoxyacetic acid at a rate of 250nmol mg [protein](-1)h(-1), and the generated intermediate 2,5-dichlorohydroquinone may be further mineralized through γ-HCH downstream degradation pathway. Copyright © 2013 Elsevier B.V. All rights reserved.

  7. Genetic Variants Of Cytochrome b-245, Alpha Polypeptide Gene And Premature Acute Myocardial Infarction Risk In An Iranian Population

    Directory of Open Access Journals (Sweden)

    Amin Fatemeh

    2015-10-01

    Full Text Available Background: Oxidative stress induced by superoxide anion plays critical roles in the pathogenesis of coronary artery disease (CAD and hence acute myocardial infarction (AMI. The major source of superoxide production in vascular smooth muscle and endothelial cells is the NADPH oxidase complex. An essential component of this complex is p22phox, that is encoded by the cytochrome b-245, alpha polypeptide (CYBA gene. The aim of this study was to investigate the association of CYBA variants (rs1049255 and rs4673 and premature acute myocardial infarction risk in an Iranian population.

  8. Improvement of the ear-to-ear path gain at 2.45 GHz using parasitic antenna element

    DEFF Research Database (Denmark)

    Kvist, Søren Helstrup; Ôzden, Sinasi; Thaysen, Jesper

    2012-01-01

    Two antenna configurations are considered for ear-to-ear on-body communications at 2.45 GHz. Both consist of monopole antennas operated on small ground planes that are placed next to the human head. Their performances are compared in terms of maximum path gain (|S21|) and obtainable bandwidth...... of the antenna structures. It is found that the bandwidth, as well as the ear-to-ear path gain can be improved by the addition of a parasitic monopole antenna element. The parasitic antenna element affects the electric current distribution on the ground plane, which has a favorable impact on the on-body antenna...

  9. Hexaaquazinc(II bis(2,4,5-tricarboxybenzoate 4,5-diazafluoren-9-one disolvate dihydrate

    Directory of Open Access Journals (Sweden)

    Gui-Fu Yang

    2010-07-01

    Full Text Available The asymmetric unit of the title complex, [Zn(H2O6](C10H5O82·2C11H6N2O·2H2O, contains one half of the complex cation with the ZnII ion located on an inversion center, a monovalent 2,4,5-tricarboxybenzoate (1,2,4,5-BTC counter-anion, a 4,5-diazafluoren-9-one (DAFO molecule and an uncoordinated water molecule. In the crystal structure, O—H...O and O—H...N hydrogen bonds link the cations, anions and water molecules into a three-dimensional network.

  10. Microwave radiation (2.45 GHz)-induced oxidative stress: Whole-body exposure effect on histopathology of Wistar rats.

    Science.gov (United States)

    Chauhan, Parul; Verma, H N; Sisodia, Rashmi; Kesari, Kavindra Kumar

    2017-01-01

    Man-made microwave and radiofrequency (RF) radiation technologies have been steadily increasing with the growing demand of electronic appliances such as microwave oven and cell phones. These appliances affect biological systems by increasing free radicals, thus leading to oxidative damage. The aim of this study was to explore the effect of 2.45 GHz microwave radiation on histology and the level of lipid peroxide (LPO) in Wistar rats. Sixty-day-old male Wistar rats with 180 ± 10 g body weight were used for this study. Animals were divided into two groups: sham exposed (control) and microwave exposed. These animals were exposed for 2 h a day for 35 d to 2.45 GHz microwave radiation (power density, 0.2 mW/cm(2)). The whole-body specific absorption rate (SAR) was estimated to be 0.14 W/kg. After completion of the exposure period, rats were sacrificed, and brain, liver, kidney, testis and spleen were stored/preserved for determination of LPO and histological parameters. Significantly high level of LPO was observed in the liver (p microwave radiation. Also histological changes were observed in the brain, liver, testis, kidney and spleen after whole-body microwave exposure, compared to the control group. Based on the results obtained in this study, we conclude that exposure to microwave radiation 2 h a day for 35 d can potentially cause histopathology and oxidative changes in Wistar rats. These results indicate possible implications of such exposure on human health.

  11. Time resolved measurements of hydrogen ion energy distributions in a pulsed 2.45 GHz microwave plasma

    Science.gov (United States)

    Megía-Macías, A.; Cortázar, O. D.; Tarvainen, O.; Koivisto, H.

    2017-11-01

    A plasma diagnostic study of the Ion Energy Distribution Functions (IEDFs) of H+, H2+ , and H3+ ions in a 2.45 GHz hydrogen plasma reactor called TIPS is presented. The measurements are conducted by using a Plasma Ion Mass Spectrometer with an energy sector and a quadrupole detector from HIDEN Analytical Limited in order to select an ion species and to measure its energy distribution. The reactor is operated in the pulsed mode at 100 Hz with a duty cycle of 10% (1 ms pulse width). The IEDFs of H+, H2+ , and H3+ are obtained each 5 μs with 1 μs time resolution throughout the entire pulse. The temporal evolution of the plasma potential and ion temperature of H+ is derived from the data. It is shown that the plasma potential is within the range of 15-20 V, while the ion temperature reaches values of 0.25-1 eV during the pulse and exhibits a fast transient peak when the microwave radiation is switched off. Finally, the ion temperatures are used to predict the transverse thermal emittance of a proton beam extracted from 2.45 GHz microwave discharges.

  12. A highly efficient magnetic solid acid catalyst for synthesis of 2,4,5-trisubstituted imidazoles under ultrasound irradiation.

    Science.gov (United States)

    Safari, Javad; Zarnegar, Zohre

    2013-03-01

    Fe(3)O(4) nanoparticles were prepared by chemical coprecipitation method and subsequently coated with 3-aminopropyltriethoxysilane (APTES) via silanization reaction. Grafting of chlorosulfuric acid on the amino-functionalized Fe(3)O(4) nanoparticles afforded sulfamic acid-functionalized magnetic nanoparticles (SA-MNPs). SA-MNPs was found to be a mild and effective solid acid catalyst for the efficient, one-pot, three-component synthesis of 2,4,5-trisubstituted imidazoles under ultrasound irradiation. This protocol afforded corresponding imidazoles in shorter reaction durations, and in high yields. This green procedure has many obvious advantages compared to those reported in the previous literatures, including avoiding the use of harmful catalysts, easy and quick isolation of the products, excellent yields, short routine, and simplicity of the methodology. Copyright © 2012 Elsevier B.V. All rights reserved.

  13. Development of a Novel Switched-Mode 2.45 GHz Microwave Multiapplicator Ablation System

    Directory of Open Access Journals (Sweden)

    Guido Biffi Gentili

    2014-01-01

    Full Text Available The development of a novel switched-mode 2.45 GHz microwave (MW multiapplicator system intended for laparoscopic and open surgical thermoablative treatments is presented. The system differs from the other synchronous and asynchronous commercially available equipments because it employs a fast sequential switching (FSS technique for feeding an array of up to four high efficiency MW applicators. FSS technology, if properly engineered, allows improving system compactness, modularity, overall efficiency, and operational flexibility. Full-wave electromagnetic (EM and thermal (TH simulations have been made to confirm the expected performances of the FSS technology. Here we provide an overview of technical details and early ex-vivo experiments carried out with a full functional β-prototype of the system.

  14. Hexaaqua-zinc(II) bis-(2,4,5-tricarboxybenzoate) 4,5-diaza-fluoren-9-one disolvate dihydrate.

    Science.gov (United States)

    Yang, Gui-Fu; Zhao, Ya-Hui

    2010-06-16

    The asymmetric unit of the title complex, [Zn(H(2)O)(6)](C(10)H(5)O(8))(2)·2C(11)H(6)N(2)O·2H(2)O, contains one half of the complex cation with the Zn(II) ion located on an inversion center, a monovalent 2,4,5-tricarboxybenzoate (1,2,4,5-BTC) counter-anion, a 4,5-diaza-fluoren-9-one (DAFO) mol-ecule and an uncoordinated water mol-ecule. In the crystal structure, O-H⋯O and O-H⋯N hydrogen bonds link the cations, anions and water mol-ecules into a three-dimensional network.

  15. The Effects of Metallic Loop-Like Accessory Worn on the Human Body on SAR at 2.45 GHz

    Directory of Open Access Journals (Sweden)

    Zainal H. H.

    2017-01-01

    Full Text Available This paper presents the Specific Absorption Rates (SAR in the human body with a monopole antenna. The distance between the antenna and the body were varied at different distances. The parameters (εr, σ used in the human body set according to the standard tissue equivalent liquids recommended by the IEEE and FCC. The simulations were made by means of CST Microwave Studio software at frequencies of 2.45GHz .The effect of the body on the SAR calculation in the body were measured. The SAR values were recorded in term of SAR for 10g of tissue. The TM is positioned against the metallic loop-like accessory, place on the left wrist of the generic arm at a varied distance from the cylindrical phantom. Numerical analysis conducted using a broadband textile monopole antenna (TM with variations of orientation and distance showed that SAR values increased when the TM is horizontally polarized.

  16. Local atomic structure in equilibrium and supercooled liquid Zr[subscript 75.5]Pd[subscript 24.5

    Energy Technology Data Exchange (ETDEWEB)

    Mauro, N.A.; Fu, W.; Bendert, J.C.; Cheng, Y.Q.; Ma, E.; Kelton, K.F. (WU); (ORNL); (JHU)

    2012-09-06

    Atomic structures were obtained in equilibrium and supercooled eutectic Zr{sub 75.5}Pd{sub 24.5} liquids by in situ high-energy synchrotron diffraction measurements using the beamline electrostatic levitation (BESL) technique, which provides a high-vacuum, containerless, environment. Reverse Monte Carlo fits to the x-ray static structure factors, constrained using partial pair correlation functions obtained from ab initio molecular dynamics simulations, indicate the presence of medium-range order (MRO) in the form of a strong tendency for Pd-Pd (solute-solute) avoidance. This order persists over the entire temperature range studied, from 170 C above the equilibrium liquidus temperature to 263 C below it. Further, a quantitative analysis of the atomic structures obtained indicates a modest degree of icosahedral-like local order around Pd atoms, with the clusters showing an increased tendency for face-sharing to form more extended structures with decreasing temperature.

  17. Income gaps in self-rated poor health and its association with life expectancy in 245 districts of Korea.

    Science.gov (United States)

    Kim, Ikhan; Bahk, Jinwook; Yun, Sung-Cheol; Khang, Young-Ho

    2017-01-01

    To examine the income gaps associated with self-rated poor health at the district level in Korea and to identify the geographical correlations between self-rated poor health, life expectancy, and the associated income gaps. We analyzed data for 1,578,189 participants from the Community Health Survey of Korea collected between 2008 and 2014. The age-standardized prevalence of self-rated poor health and the associated income gaps were calculated. Previously released data on life expectancy and the associated income gaps were also used. We performed correlation and regression analyses for self-rated poor health, life expectancy, and associated income gaps. Across 245 districts, the median prevalence of self-rated poor health was 15.7% (95% confidence interval [CI], 14.6 to 16.8%), with interquartile range (IQR) of 3.1 percentage points (%p). The median interquintile gaps in the prevalence of self-rated poor health was 11.1%p (95% CI, 8.1 to 14.5%p), with IQR of 3.6%p. Pro-rich inequalities in self-rated health were observed across all 245 districts of Korea. The correlation coefficients for the association between self-rated poor health and the associated income gaps, self-rated poor health and life expectancy, and income gaps associated with self-rated poor health and life expectancy were 0.59, 0.78 and 0.55 respectively. Income gaps associated with self-rated poor health were evident across all districts in Korea. The magnitude of income gaps associated with self-rated poor health was larger in the districts with greater prevalence of self-rated poor health. A strong correlation between self-rated poor health and life expectancy was also observed.

  18. Effects of Wi-Fi (2.45 GHz) Exposure on Apoptosis, Sperm Parameters and Testicular Histomorphometry in Rats: A Time Course Study

    OpenAIRE

    Saeed Shokri; Aiob Soltani; Mahsa Kazemi; Dariush Sardari; Farshid Babapoor Mofrad

    2015-01-01

    Objective: In today’s world, 2.45-GHz radio-frequency radiation (RFR) from industrial, scientific, medical, military and domestic applications is the main part of indoor-outdoor electromagnetic field exposure. Long-term effects of 2.45-GHz Wi-Fi radiation on male reproductive system was not known completely. Therefore, this study aimed to investigate the major cause of male infertility during short- and long-term exposure of Wi-Fi radiation. Materials and Methods: This is an an...

  19. EVALUACIÓN EXPERIMENTAL DE CAPACIDAD MIMO DE ARREGLOS DE ANTENAS PIFA COMPACTOS EN BANDA DE 2.45 GHz EXPERIMENTAL EVALUATION OF MIMO CHANNEL CAPACITY FOR COMPACT ARRAYS OF PIFA ANTENNAS AT 2.45 GHz BAND

    Directory of Open Access Journals (Sweden)

    Héctor Carrasco E

    2007-12-01

    Full Text Available En este trabajo se presentan resultados experimentales de medición de canal y evaluación de capacidad MIMO (Multiple Input Multiple Output de arrays de antenas PIFA (Planar Inverted "F" Antenna compactos en la banda de frecuencia de 2.45 GHz, en entornos interiores ricos en multitrayecto. Se evalúan dos configuraciones básicas de arrays, Lineal y Cuadrada de cuatro antenas PIFA, cuyas características de bajo perfil y grados de libertad de construcción y configuración constituyen ventajas comparativas para aplicaciones con terminales compactos potables. Las mediciones de la matriz de canal MIMO se hacen utilizando un VNA (Vector Network Analyzer controlado vía estándar GPIB (General Purpose Interface Bus. La capacidad MIMO se evalúa estadísticamente para un gran número de medidas del canal, en espacio y frecuencia, con separación de antenas en cada array de 0,1 a 0,8 longitudes de onda, con el objetivo principal de estudiar el efecto del acoplamiento mutuo en la capacidad MIMO. Los resultados de capacidad medida muestran que las configuraciones propuestas más eficientes pueden operar como mínimo hasta separaciones de antenas en el rango de 0,3 a 0,4 longitudes de onda, sin producir gran degradación de capacidad debido al acoplamiento y bloqueo de señal. Este resultado implica separaciones cercanas a 4 cm y, en consecuencia, arrays significativamente compactosThis paper presents experimental results of indoor MIMO wireless channel and channel capacity evaluation for compact PIFA (Planar Inverted "F" Antenna antenna arrays at the 2.45 GHz frequency band. Linear and square array configurations are evaluated using PIFA antenna elements because of its advantages of low profile and flexible configuration design for compact and portable mobile terminals. Measurements are performed using a VNA with GPIB standard for automatic data acquisition. MIMO channel capacity results are calculated from a large amount of data combining uncorrelated

  20. Residues in blackcurrants, fodder peas, spinach and potatoes treated with sublethal doses of 2,4,5-T to simulate wind drift damage

    DEFF Research Database (Denmark)

    Løkke, Hans; Odgaard, Peder

    1981-01-01

    concentrations declined in the same period due to growth dilution. In spinach leaves from old plants, treated with 0.1 kg ha-1, 0.05 mg of 2,4,5-T kg-1 was found 14 days after treatment. Fodder peas showed no residues (

  1. Electrochemical decontamination of waters by advanced oxidation processes (aops: Case of the mineralization of 2,4,5-t on bdd electrode

    Directory of Open Access Journals (Sweden)

    Birame Boye

    2004-12-01

    Full Text Available In the present work, herbicide 2,4,5-trichlorophenoxyacetic acid, more commonly known as 2,4,5-T herbicide, has been completely mineralized (i.e. transformed into CO2 and H2O in saturated aqueous solutions using a semi-industrial electrochemical cell that contains a boron doped diamond anode and a zirconium cathode. We have performed cyclic voltammetry, chronoamperometry and bulk electrolysis to give the optimization characteristics of the degradation of such a compound and its by-products. Bulk electrolysis in the potential region of electrolyte decomposition leads to the complete destruction of 2,4,5-T and its degradation intermediates by means of the electrogeneration of the highly reactive hydroxyl radicals. The evolution of the chemical oxygen demand (COD and the instant current efficiency (ICE during the degradation process is perfectly predicted by a theoretical mathematical model. HPLC and GC-MS have also been performed to highlight the evolution of the mother product and its degradation intermediates. Kinetic analysis of the obtained results has shown a fast destruction of the mother herbicide asserting a diffusion-controlled process. 2,4,5-trichlorophenol and quinone-based organic compounds have been depicted as aromatic intermediates, all of them transformed into short chains carboxylic acids before complete mineralization happens.

  2. Time-Domain Measurement of the Ear-to-Ear On-Body Path Gain at 2.45 GHz in a Radio Anechoic Environment

    DEFF Research Database (Denmark)

    Kvist, Søren Helstrup; Thaysen, Jesper; Jakobsen, Kaj Bjarne

    2012-01-01

    The ear-to-ear on-body path gain (jS21j) at 2:45 GHz is measured in the time domain. The measurements were conducted in a radio anechoic environment to study the effects of the on-body paths only. Two different monopole antenna configurations that are polarized normal and tangential to the surface...

  3. Effect of exposure to 2.45 GHz microwave on DNA repair genes transcription in cultured cells

    Energy Technology Data Exchange (ETDEWEB)

    Perrin, A.; Bachelet, C. [Molecular and Cellular Biophysics Unit of the Health Service Research Center for Defense (CRSSA), 38 - Grenoble (France); Fournier, C.; Peinnequin, A. [Radiobiology and Inflamation Unit of the Health Service Research Center for Defense (CRSSA), 38 - Grenoble (France); Leveque, P.; Collin, A. [Research Institut on Microwave and Optical Communications (IRCOM), CNRS UMR 6615, 87 - Limoges (France)

    2006-07-01

    The aim of the study was to investigate, in vitro, the effect of 2.45 GHz continuous (C.W.) and pulsed (P.W.) electromagnetic field exposure combined with a known mutagen on the induction of enzymes implicated in the DNA repair pathway. Microwaves do not create bonds breaks within molecules and there is no clear hypothesis for a possible mechanism supporting a biological action. Nevertheless, an indirect influence of microwaves during an intermediary step of the complex sequence of events involved in mutagenesis cannot yet be excluded. Highly sensitive real-time R.T.q.P.C.R. was used to monitor transcriptional variations of DNA repair genes. The experiments were carried out using the monocyte human cell line T.H.P.1 with the genotoxic compound 4- nitro-quinoline-N-oxide (4-N.Q.O.). The carrier frequency was 2.45 GHz C.W. and P.W. (1 khz repetition time, 10 % duty cycle) with the same power density corresponding to an average specific absorption rate (S.A.R.) value of 0.19 W/kg in the biological samples. Non exposed (sham) and exposed (P.W. and C.W.) cell culture plates were incubated simultaneously in three identical incubators in the presence of 4-N.Q.O., under shaking, at 37 Celsius degrees. Specially designed incubators were integrated in three identical anechoic chambers equipped with waveguide antennas. Care was taken to increase the reproducibility of the experiments and to avoid false positive or misinterpretation of the results. The presence or the absence of the electromagnetic field was the only difference between the sham and exposed assays. The different exposure conditions were applied alternatively in the three anechoic chambers in order to avoid cage effects. The temperature inside the cell plates was measured with an optic fiber probe (Luxtron). Numerical dosimetry was calculated using the Finite Difference Time Domain method. A time-scaled form of the heat transfer equation allowed to calculate the temperature distribution inside the petri dishes

  4. Crystal structure of triaqua(1,10-phenanthroline-κ2N,N′(2,4,5-trifluoro-3-methoxybenzoato-κO1cobalt(II 2,4,5-trifluoro-3-methoxybenzoate

    Directory of Open Access Journals (Sweden)

    Junshan Sun

    2014-11-01

    Full Text Available The title salt, [Co(C8H4F3O3(C12H8N2(H2O3](C8H4F3O3, was obtained under solvothermal conditions by the reaction of 2,4,5-trifluoro-3-methoxybenzoic acid with CoCl2 in the presence of 1,10-phenanthroline (phen. The CoII ion is octahedrally coordinated by two N atoms [Co—N = 2.165 (2 and 2.129 (2 Å] from the phen ligand, by one carboxylate O atom [Co—O = 2.107 (1 Å] and by three O atoms from water molecules [Co—O = 2.093 (1, 2.102 (1 and 2.114 (1 Å]. The equatorial positions of the slightly distorted octahedron are occupied by the N atoms, the carboxylate O and one water O atom. An intra- and intermolecular O—H...O hydrogen-bonding network between the water-containing complex cation and the organic anion leads to the formation of ribbons parallel to [010].

  5. Spectroscopic (FT-IR, FT-Raman, UV and NMR) investigation and NLO, HOMO-LUMO, NBO analysis of organic 2,4,5-trichloroaniline.

    Science.gov (United States)

    Govindarajan, M; Karabacak, M; Periandy, S; Tanuja, D

    2012-11-01

    In this work, the experimental and theoretical study on the molecular structure and vibrational spectra of 2,4,5-trichloroaniline (C(6)H(4)NCl(3), abbreviated as 2,4,5-TClA) were studied. The FT-IR and FT-Raman spectra were recorded. The molecular geometry and vibrational frequencies in the ground state were calculated by using the Hartree-Fock (HF) and density functional theory (DFT) methods (B3LYP) with 6-311++G(d,p) basis set. Comparison of the observed fundamental vibrational frequencies of 2,4,5-TClA with calculated results by HF and DFT indicates that B3LYP is superior to HF method for molecular vibrational problems. The difference between the observed and scaled wavenumber values of most of the fundamentals is very small. The theoretically predicted FT-IR and FT-Raman spectra of the title molecule have been constructed. A study on the electronic properties, such as HOMO and LUMO energies, were performed by time-dependent DFT (TD-DFT) approach. Besides, molecular electrostatic potential (MEP) and thermodynamic properties were performed. The electric dipole moment (μ) and the first hyperpolarizability (β) values of the investigated molecule were computed using ab initio quantum mechanical calculations. The calculated results also show that the 2,4,5-TClA molecule may have microscopic nonlinear optical (NLO) behavior with non-zero values. Mulliken atomic charges of 2,4,5-TClA was calculated and compared with aniline and chlorobenzene molecules. The (13)C nuclear magnetic resonance (NMR) chemical shifts of the molecule were calculated by the gauge independent atomic orbital (GIAO) method and compared with experimental results. Copyright © 2012 Elsevier B.V. All rights reserved.

  6. Calcifications of Vertebrobasilar Arteries on CT: Detailed Distribution and Relation to Risk Factors in 245 Ischemic Stroke Patients

    Directory of Open Access Journals (Sweden)

    Slaven Pikija

    2013-01-01

    Full Text Available Introduction. Intracranial atherosclerosis is responsible for a substantial proportion of strokes worldwide but its detailed morphology in the vertebrobasilar arteries (VBA is unknown. Subject and Methods. Cases with ischemic strokes were retrospectively sought from the hospital database. Native CT scans were assessed for vessel area and intracranial artery calcifications (ICACs in VBA. The calcifications were classified as focal (FCs, crescent, and circular. Results. 245 patients (mean age: years, 57.6% females had visible ICACs. Calcifications were found in 75.9%, 63.3%, and 17.1% in the left vertebral artery (LVA, the right vertebral artery (RVA, and the basilar artery (BA, respectively. FCs were present in 91.0%, 90.3%, and 100.0%; crescents in 30.3%, 29.0%, and 7.1%, and circulars in 6.4%, 4.8%, and 0.0% of the RVA, LVA, and BA, respectively. FCs in dorsolateral quadrant were least prevalent in both vertebral arteries (VAs: 46 (29.8% and 46 (27.4% for RVA and LVA, respectively. Risk factors associated with vertical dispersion of ICACs were male gender (OR : 2.69, 1.38–5.28 and diabetes (OR : 2.28, 1.04–4.99. Conclusions. FCs in VAs are least prevalent in dorsolateral quadrants. The vertical dispersion of ICACs seems to be associated with the male gender and diabetes.

  7. Dielectric Properties and Oxidation Roasting of Molybdenite Concentrate by Using Microwave Energy at 2.45 GHz Frequency

    Science.gov (United States)

    Yonglin, Jiang; Bingguo, Liu; Peng, Liu; Jinhui, Peng; Libo, Zhang

    2017-12-01

    Conversion of electromagnetic energy into heat depends largely on the dielectric properties of the material being treated. Therefore, determining the dielectric properties of molybdenite concentrate and its microwave power penetration depth in relation to a temperature increment at the commercial frequency of 2.45 GHz is necessary to design industrial microwave processing units. In this study, the dielectric constants increased as the temperature increased in the entire experimental range. The loss factor presented an opposite trend, except for 298 K to 373 K (25 °C to 100 °C) in which a cavity perturbation resonator was used. The plots of nonlinear surface fitting indicate that the increase in dielectric loss causes a considerable decrease in penetration depth, but the dielectric constants exert a small positive effect. The thermogravimetric analysis (TGA-DSC) of the molybdenite concentrate was carried out to track its thermal decomposition process, aim to a dielectric analysis during the microwave heating. MoO3 was prepared from molybdenite concentrate through oxidation roasting in a microwave heating system and a resistance furnace, respectively. The phase transitions and morphology evolutions during oxidation roasting were characterized through X-ray diffraction and scanning electron microscopy. Results show that microwave thermal technique can produce high-purity molybdenum trioxide.

  8. Effects of acute exposure to WIFI signals (2.45GHz) on heart variability and blood pressure in Albinos rabbit.

    Science.gov (United States)

    Saili, Linda; Hanini, Amel; Smirani, Chiraz; Azzouz, Ines; Azzouz, Amina; Sakly, Mohsen; Abdelmelek, Hafedh; Bouslama, Zihad

    2015-09-01

    Electrocardiogram and arterial pressure measurements were studied under acute exposures to WIFI (2.45GHz) during one hour in adult male rabbits. Antennas of WIFI were placed at 25cm at the right side near the heart. Acute exposure of rabbits to WIFI increased heart frequency (+22%) and arterial blood pressure (+14%). Moreover, analysis of ECG revealed that WIFI induced a combined increase of PR and QT intervals. By contrast, the same exposure failed to alter maximum amplitude and P waves. After intravenously injection of dopamine (0.50ml/kg) and epinephrine (0.50ml/kg) under acute exposure to RF we found that, WIFI alter catecholamines (dopamine, epinephrine) action on heart variability and blood pressure compared to control. These results suggest for the first time, as far as we know, that exposure to WIFI affect heart rhythm, blood pressure, and catecholamines efficacy on cardiovascular system; indicating that radiofrequency can act directly and/or indirectly on cardiovascular system. Copyright © 2015 Elsevier B.V. All rights reserved.

  9. Exposure to 2.45 GHz electromagnetic fields elicits an HSP-related stress response in rat hippocampus.

    Science.gov (United States)

    Yang, Xue-Sen; He, Gen-Lin; Hao, Yu-Tong; Xiao, Yang; Chen, Chun-Hai; Zhang, Guang-Bin; Yu, Zheng-Ping

    2012-07-01

    The issue of possible neurobiological effects of the electromagnetic field (EMF) exposure is highly controversial. To determine whether electromagnetic field exposure could act as an environmental stimulus capable of producing stress responses, we employed the hippocampus, a sensitive target of electromagnetic radiation, to assess the changes in its stress-related gene and protein expression after EMF exposure. Adult male Sprague-Dawley rats with body restrained were exposed to a 2.45 GHz EMF at a specific absorption rate (SAR) of 6 W/kg or sham conditions. cDNA microarray was performed to examine the changes of gene expression involved in the biological effects of electromagnetic radiation. Of 2048 candidate genes, 23 upregulated and 18 downregulated genes were identified. Of these differential expression genes, two heat shock proteins (HSP), HSP27 and HSP70, are notable because expression levels of both proteins are increased in the rat hippocampus. Result from immunocytochemistry revealed that EMF caused intensive staining for HSP27 and HSP70 in the hippocampus, especially in the pyramidal neurons of cornu ammonis 3 (CA3) and granular cells of dentate gyrus (DG). The gene and protein expression profiles of HSP27 and HSP70 were further confirmed by reverse transcription polymerase chain reaction (RT-PCR) and Western blot. Our data provide direct evidence that exposure to electromagnetic fields elicits a stress response in the rat hippocampus. Copyright © 2012 Elsevier Inc. All rights reserved.

  10. Properties and Toxicity of Cobalt(II Complex with 2,4,5-triphenyl-1H-imidazole Ligand

    Directory of Open Access Journals (Sweden)

    Fahimah Martak

    2016-12-01

    Full Text Available Binuclear cobalt(II complex with 2,4,5-triphenyl-1H-imidazole ligand has been synthesized using reflux method. The yellowish green crystals with needle-like shape were obtained. Determination of molecular formula of the complex was carried out using Atomic Absorption Spectroscopy (AAS and CHN elemental analysis. The contents of carbon, hydrogen, nitrogen and cobalt(II in the complex were 36.28, 5.32, 4.17, and 16.64% by weight, respectively. The calculation of element composition showed that the molecular formula of complex [(H2O5Co-L-Co(H2O5]Cl3. The IR spectrum showed absorption peaks of Co-N and Co=O at 397.31 and 493.74 cm-1, respectively, confirming the formation of complex. The complex compound showed paramagnetic properties with μeff value of 3.18 BM. Toxicity of the complex was determined by Brine Shrimp Lethality Test (BSLT method, and the LC50 value of the complex was 362.24 mg/L.

  11. Electrochemical degradation of 2,4,5-trichlorophenoxyacetic acid in aqueous medium by peroxi-coagulation. Effect of pH and UV light

    Energy Technology Data Exchange (ETDEWEB)

    Boye, Birame; Marieme Dieng, Momar; Brillas, Enric

    2003-02-20

    Acidic aqueous solutions with 2,4,5-trichlorophenoxyacetic acid (2,4,5-T) concentrations up to 270 ppm in the pH range 2.0-6.0 at 35 deg. C can be rapidly degraded by peroxi-coagulation using an Fe anode and an O{sub 2}-diffusion cathode. 2,4,5-T and its products are then efficiently oxidized with OH{center_dot} radicals produced from Fenton's reaction between Fe{sup 2+} and H{sub 2}O{sub 2} generated by the electrodes. Under pH regulation at low currents, more than 90% of organics are destroyed at pH 3.0, although its optimum pH is 4.0. Higher degradations are reached without pH regulation. Solutions with 2,4,5-T concentration {<=}200 ppm are more rapidly depolluted under UV irradiation, because of the production of more OH{center_dot} from photo-Fenton reaction. Coagulation of products with the Fe(OH){sub 3} precipitate formed predominates when pH is regulated to 2.0 and 3.0 in the absence of UV light, whereas parallel mineralization is favored without pH regulation and under UV irradiation. The 2,4,5-T decay follows a pseudo first-order reaction, with the same rate constant in the presence and absence of UV light. 2,4,5-trichlorophenol, 2,5-dichlorohydroquinone, 4,6-dichlororesorcinol and 2,5-dihydroxy-p-benzoquinone have been identified and quantified as aromatic intermediates by reverse-phase chromatography. Chloride ions are released from the oxidation of these chlorinated products. The evolution of generated carboxylic acids, such as glycolic, glyoxylic, formic, malic, maleic, fumaric and oxalic, has been followed by ion-exclusion chromatography. The great stability of oxalic acid and its complexes with Fe{sup 3+} at pH regulated to 3.0 can explain that concentrated solutions can not be completely degraded.

  12. Income Differences in Smoking Prevalences in 245 Districts of South Korea: Patterns by Area Deprivation and Urbanity, 2008-2014.

    Science.gov (United States)

    Kim, Ikhan; Bahk, Jinwook; Yoon, Tae-Ho; Yun, Sung-Cheol; Khang, Young-Ho

    2017-03-01

    The aim of this study was to measure income differences in smoking prevalence at the district level and to investigate correlations among area deprivation, smoking prevalence, and income differences in smoking prevalence, stratified by urbanity. Data were pooled from the Community Health Survey data of South Korea between 2008 and 2014. The age-standardized prevalence of smoking and its interquintile income differences were calculated. We conducted correlation analyses to investigate the association of the deprivation index with smoking prevalence and interquintile differences in smoking prevalence. Across 245 districts, the median prevalence of smoking in men was 45.9% (95% confidence interval [CI], 43.4 to 48.5%), with an interquartile range (IQR) of 4.6% points. In women, the median prevalence was 3.0% (95% CI, 2.4 to 3.6%) and IQR was 1.6% points. The median interquintile difference in smoking prevalence was 7.4% points (95% CI, 1.6 to 13.2% points) in men and 2.7% points (95% CI, 0.5 to 4.9% points) in women. The correlation coefficients for the association between the deprivation index and smoking prevalence was 0.58, 0.15, -0.22 in metropolitan, urban, and rural areas, respectively, among men, and 0.54, -0.33, -0.43 among women. No meaningful correlation was found between area deprivation and interquintile difference in smoking prevalence. The correlation between smoking prevalence and interquintile difference in smoking prevalence was more evident in women than in men. This study provides evidence of geographical variations in smoking prevalence and interquintile difference in smoking prevalence. Neither smoking prevalence nor the deprivation index was closely correlated with interquintile income difference in smoking prevalence. Measuring inequalities in smoking prevalence is crucial to developing policies aimed at reducing inequalities in smoking.

  13. Abatement of fluorinated compounds using a 2.45 GHz microwave plasma torch with a reverse vortex plasma reactor

    Energy Technology Data Exchange (ETDEWEB)

    Kim, J.H.; Cho, C.H.; Shin, D.H. [Plasma Technology Research Center, National Fusion Research Institute, 814-2 Oxikdo-dong, Gunsan-city, Jeollabuk-do (Korea, Republic of); Hong, Y.C., E-mail: ychong@nfri.re.kr [Plasma Technology Research Center, National Fusion Research Institute, 814-2 Oxikdo-dong, Gunsan-city, Jeollabuk-do (Korea, Republic of); Shin, Y.W. [Plasma Technology Research Center, National Fusion Research Institute, 814-2 Oxikdo-dong, Gunsan-city, Jeollabuk-do (Korea, Republic of); School of Advanced Green Energy and Environments, Handong Global University, Heunghae-eup, Buk-gu, Pohang-city, Gyeongbuk (Korea, Republic of)

    2015-08-30

    Highlights: • We developed a microwave plasma torch with reverse vortex reactor (RVR). • We calculated a volume fraction and temperature distribution of discharge gas and waste. • The performance of reverse vortex reactor increased from 29% to 43% than conventional vortex reactor. - Abstract: Abatement of fluorinated compounds (FCs) used in semiconductor and display industries has received an attention due to the increasingly stricter regulation on their emission. We have developed a 2.45 GHz microwave plasma torch with reverse vortex reactor (RVR). In order to design a reverse vortex plasma reactor, we calculated a volume fraction and temperature distribution of discharge gas and waste gas in RVR by ANSYS CFX of computational fluid dynamics (CFD) simulation code. Abatement experiments have been performed with respect to SF{sub 6}, NF{sub 3} by varying plasma power and N{sub 2} flow rates, and FCs concentration. Detailed experiments were conducted on the abatement of NF{sub 3} and SF{sub 6} in terms of destruction and removal efficiency (DRE) using Fourier transform infrared (FTIR). The DRE of 99.9% for NF{sub 3} was achieved without an additive gas at the N{sub 2} flow rate of 150 liter per minute (L/min) by applying a microwave power of 6 kW with RVR. Also, a DRE of SF{sub 6} was 99.99% at the N{sub 2} flow rate of 60 L/min using an applied microwave power of 6 kW. The performance of reverse vortex reactor increased about 43% of NF{sub 3} and 29% of SF{sub 6} abatements results definition by decomposition energy per liter more than conventional vortex reactor.

  14. Microwave-induced One-pot Synthesis of 2,4,5-trisubstituted Imidazoles Using Rochelle Salt as a Green Novel Catalyst

    Directory of Open Access Journals (Sweden)

    Balasaheb V. Shitole

    2015-09-01

    Full Text Available Rochelle Salt is used as an efficient catalyst for the synthesis of 2,4,5-triaryl-1H-imidazoles via condensation of benzil, ammonium acetate, and aromatic aldehydes. The key advantages of this process are the usage of an inexpensive and readily available catalyst, simple procedure, shorter reaction time, and high yield of products. DOI: http://dx.doi.org/10.17807/orbital.v7i3.720 

  15. Structure, activity and thermostability investigations of OXA-163, OXA-181 and OXA-245 using biochemical analysis, crystal structures and differential scanning calorimetry analysis.

    Science.gov (United States)

    Lund, Bjarte Aarmo; Thomassen, Ane Molden; Carlsen, Trine Josefine Olsen; Leiros, Hanna Kirsti S

    2017-10-01

    The first crystal structures of the class D β-lactamases OXA-181 and OXA-245 were determined to 2.05 and 2.20 Å resolution, respectively; in addition, the structure of a new crystal form of OXA-163 was resolved to 2.07 Å resolution. All of these enzymes are OXA-48-like and have been isolated from different clinical Klebsiella pneumoniae strains and also from other human pathogens such as Pseudomonas aeruginosa and Escherichia coli. Here, enzyme kinetics and thermostability studies are presented, and the new crystal structures are used to explain the observed variations. OXA-245 had the highest melting point (T m = 55.8°C), as determined by differential scanning calorimetry, compared with OXA-163 (T m = 49.4°C) and OXA-181 (T m = 52.6°C). The differences could be explained by the loss of two salt bridges in OXA-163, and an overall decrease in the polarity of the surface of OXA-181 compared with OXA-245.

  16. Measurement of neutron induced fission of {sup 235}U, {sup 233}U and {sup 245}Cm with the FIC detector at the CERN n-TOF facility

    Energy Technology Data Exchange (ETDEWEB)

    Calviani, M.; Karadimos, D.; Abbondanno, U.; Aerts, G.; Alvarez, H.; Alvarez-Velarde, F.; Andriamonje, S.; Andrzejewski, J.; Assimakopoulos, P.; Audouin, L.; Badurek, G.; Baumann, P.; Becvar, F.; Berthoumieux, E.; Calvino, F.; Cano-Ott, D.; Capote, R.; Carrapic, C.; Cennini, P.; Chepel, V.; Chiaveri, E.; Colonna, N.; Cortes, G.; Couture, A.; Cox, J.; Dahlfors, M.; David, S.; Dillmann, I.; Domingo-Pardo, C.; Dridi, W.; Duran, I.; Eleftheriadis, C.; Embid-Segura, M.; Ferrant, L.; Ferrari, A.; Ferreira-Marques, R.; Fujii, K.; Furman, W.; Goncalves, I.; Gonzalez-Romero, E.; Gramegna, F.; Guerrero, C.; Gunsing, F.; Haas, B.; Haight, R.; Heil, M.; Herrera-Martinez, A.; Igashira, M.; Jericha, E.; Kappeler, F.; Kadi, Y.; Karamanis, D.; Kerveno, M.; Koehler, P.; Kossionides, E.; Krticka, M.; Lampoudis, C.; Leeb, H.; Lindote, A.; Lopes, I.; Lozano, M.; Lukic, S.; Marganiec, J.; Marrone, S.; Martinez, T.; Massimi, C.; Mastinu, P.; Mengoni, A.; Milazzo, P.M.; Moreau, C.; Mosconi, M.; Neves, F.; Oberhummer, H.; O' Brien, S.; Pancin, J.; Papachristodoulou, C.; Papadopoulos, C.; Paradela, C.; Patronis, N.; Pavlik, A.; Pavlopoulos, P.; Perrot, L.; Pigni, M.T.; Plag, R.; Plompen, A.; Plukis, A.; Poch, A.; Praena, J.; Pretel, C.; Quesada, J.; Rauscher, T.; Reifarth, R.; Rubbia, C.; Rudolf, G.; Rullhusen, P.; Salgado, J.; Santos, C.; Sarchiapone, L.; Savvidis, I.; Stephan, C.; Tagliente, G.; Tain, J.L.; Tassan-Got, L.; Tavora, L.; Terlizzi, R.; Vannini, G.; Vaz, P.; Ventura, A.; Villamarin, D.; Vincente, M.C.; Vlachoudis, V.; Vlastou, R.; Voss, F.; Walter, S.; Wiescher, M.; Wisshak, K

    2008-07-01

    A series of measurements of neutron induced fission cross section of various transuranic isotopes have been performed at the CERN n-TOF spallation neutron facility, in the energy range from thermal to nearly 250 MeV. The experimental apparatus consists in a fast ionization chamber (FIC), used as a fission fragment detector with a high efficiency. Good discrimination between alphas and fission fragments can be obtained with a simple amplitude threshold. In order to allow the monitoring of the neutron beam and to extract the n-TOF neutron flux, the well known cross section of the {sup 235}U(n,f) reaction, considered as a fission standard, has been used. Preliminary results for the cross section are shown for some selected isotopes such as {sup 235}U, {sup 233}U and {sup 245}Cm in the energy range from 0.050 eV to about 2 MeV. These results for {sup 235}U, {sup 233}U and {sup 245}Cm show results consistent with databases in the resonance region, with no normalization required for {sup 233}U. In the case of {sup 245}Cm, for the energy range between thermal and 20 eV, we obtained the first experimental data ever published, while showing a good agreement with previous data in the region above that value.

  17. Avlosarservice Som Stod Till Familjer Med Barn Med Funktionsnedsattningar. En Enkatstudie i 245 Kommuner. Familjestodsprojektet (FAS-Projektet). Teknik, Kommunikation, Handikapp, Forskningsrapport n11 (Respite Care Service as Support for Families with Children with Disabilities. A Survey in 245 Local Authorities. The Family Support Project. Technology, Communication, Disability Research Report, No. 11).

    Science.gov (United States)

    Brodin, Jane

    This study surveyed how respite care services functioned for Swedish families who have children with disabilities and compared the results with a previous study made 6 years earlier. The study was based on a questionnaire completed by 245 of Sweden's municipalities. The study examined the quantity and quality of the services and respondents' views…

  18. Fate of the herbicides 2,4,5-T, atrazine, and DNOC in a shallow, anaerobic aquifer investigated by in situ passive diffusive emitters and laboratory batch experiments

    DEFF Research Database (Denmark)

    Arildskov, N.P.; Pedersen, Philip Grinder; Albrechtsen, Hans-Jørgen

    2001-01-01

    simultaneously with tritiated water (HTO) as tracer in the depth interval 3 to 4 rubs (meters below surface) by use of passive diffusive emitters. Atrazine and 2,4,5-T were persistent during the approximately 18 days residence time in the aquifer. In contrast, DNOC was rapidly removed from the water phase...... following first-order kinetics. The removal mechanism was likely an abiotic reduction. At day 25, the first-order rate constant was 1.47 d(-1), but it decreased with time and seemed to stabilize at 0.35 d(-1) after 150 to 200 days. In the laboratory, batch experiments were conducted with sediments from 3...

  19. The relationship between visible light emission and species fraction of the hydrogen ion beams extracted from 2.45 GHz microwave discharge

    CERN Document Server

    Cortázar, O D; Tarvainen, O; Kalvas, T; Koivisto, H

    2015-01-01

    The relationship between Balmer-α and Fulcher-band emissions with extracted H +, H+2 , and H+3 ions is demonstrated for a 2.45 GHz microwave discharge. Ion mass spectra and optical measurements of Balmer-α and Fulcher-band emissions have been obtained with a Wien Filter having an optical view-port on the plasma chamber axis. The beam of approximately 1 mA is analyzed for different plasma conditions simultaneously with the measurement of light emissions both with temporal resolution. The use of visible light emissions as a valuable diagnostic tool for monitoring the species fraction of the extracted beams is proposed.

  20. The ameliorative effect of gallic acid on pancreas lesions induced by 2.45 GHz electromagnetic radiation (Wi-Fi in young rats

    Directory of Open Access Journals (Sweden)

    Senay Topsakal

    2017-07-01

    Full Text Available The aim of this study was to investigate the effects of electromagnetic radiation (EMR on the pancreas tissue of young rats and the ameliorative effect of Gallic acid (GA. Six-week-old, 48 male rats were equally divided into four groups: Sham group, EMR group (2.45 GHz, EMR (2.45 GHz+GA group (30 mg/kg/daily orally and GA group (30 mg/kg/daily. After 30 days, serum and pancreatic tissue samples were harvested for biochemical, histopathological and immunohistochemical analysis. Serum amylase, lipase, glucose, and tissue malondialdehyde, total oxidant status and oxidative stress index were increased, whereas total antioxidant status decreased in the EMR group. The histopathological examination of the pancreases indicated slight degenerative changes in some pancreatic endocrine and exocrine cells and slight inflammatory cell infiltrations in the EMR group. At the immunohistochemical examination, marked increase was observed in calcitonin gene related protein and Prostaglandin E2 expressions in pancreatic cells in this group. There were no changes in interleukin-6 expirations. GA ameliorated biochemical and pathological findings in the EMR+GA group. These findings clearly demonstrate that EMR can cause degenerative changes in both endocrine and exocrine pancreas cells in rats during the developmental period and GA has an ameliorative effect.

  1. Pantothenate kinase-associated neurodegeneration initially presenting as postural tremor alone in a Japanese family with homozygous N245S substitutions in the pantothenate kinase gene.

    Science.gov (United States)

    Yamashita, Satoshi; Maeda, Yasushi; Ohmori, Hiroyuki; Uchida, Yuji; Hirano, Teruyuki; Yonemura, Kiminobu; Uyama, Eiichiro; Uchino, Makoto

    2004-10-15

    We describe a 24-year-old Japanese woman with pantothenate kinase-associated neurodegeneration (PKAN) whose only early symptom was postural tremor in the right hand at around 18 years of age, leading to a diagnosis of essential tremor at age 21. Although she was treated with arotinolol hydrochloride and clonazepam, she gradually progressed to extrapyramidal and pyramidal signs several years later. T2-weighted magnetic resonance images (MRI) showed bilaterally marked hypointensity with a central region of hyperintensity in the globus pallidus, or the so-called "eye-of-the-tiger" sign. Six years have passed since the initial appearance of postural tremor, whereas she has not shown choreoathetosis, retinitis pigmentosa, optic atrophy, or seizure. Direct sequencing of the patient's genomic DNA revealed homozygous base substitutions in the pantothenate kinase gene (PANK2): the A764-->G substitution (N245S) due to consanguinity of her parents. Although the heterozygous form of this mutation has already been reported among several families, this is the first report of the homozygous mutation in a patient with atypical-type PKAN. This detailed description of the clinical features of a Japanese patient with PKAN arising from homozygous N245S mutations in PANK2 would be useful for elucidating the pathogenesis of PKAN.

  2. Design and development of CPW fed monopole antenna at 2.45 GHz and 5.5 GHz for wireless applications

    Directory of Open Access Journals (Sweden)

    S. Ashok Kumar

    2017-06-01

    Full Text Available The behaviour of various families of the antenna structures is studied. In that, CPW (Coplanar Waveguide fed antennas show better behaviour for the Wireless applications. The slot antenna is used for precise operating frequency, where the frequency spectrum is 2.45 GHz and 5.5 GHz. To achieve the proposed frequency, the slot antenna is fed with Coplanar waveguide is implemented and measured with dimensions of 70 mm × 70 mm. To increase the bandwidth, first the mid section of two short slots of either side of the single pole length is increased slowly to check out the maximum bandwidth. The achieved peak bandwidth gradually starts decreasing at some length, considering the achieved peak value, The length responsible for decreasing peak value is to be noted. Now for obtaining the operating frequency lies in the frequency band, the mid section of long slot has to be decreased gradually; thus, operating frequency shows at 2.45 GHz and 5.51 GHz with return loss of −20 dB, and the whole design is printed on the FR4 substrate for better efficiency to the proposed frequency at maximum bandwidth, and thereafter to check out the characteristics of antenna the parameters such as Return loss characteristics, VSWR, Azimuth pattern, Elevation pattern and 3D distribution pattern.

  3. Effect of Change in Portal Venous Blood Flow Rates on the Performance of a 2.45-GHz Microwave Ablation Device.

    Science.gov (United States)

    Dodd, Gerald D; Kreidler, Sarah M; Lanctot, Anthony C; Glueck, Deborah H

    2015-12-01

    To investigate the effect of change in portal venous blood flow rates on the size and shape of ablations created by a 2.45-GHz microwave ablation device. This study was exempt from review by the institutional animal care and use committee. An in vitro bovine liver model perfused with autologous blood via the portal vein at five flow rates (60, 70, 80, 90, and 100 mL/min per 100 g of liver) was used to evaluate the effect of change in flow rates on the size and shape of coagulation created by a 2.45-GHz, 140-W microwave ablation device operated for 5 and 10 minutes. Three ablations per ablation time were conducted in each of 10 livers, with two livers perfused at each flow rate. Short- and long-axis diameters were measured from gross specimens, and volume and sphericity index were calculated. General linear mixed models that accounted for correlations within the liver were used to evaluate the effects of lobe, flow, and ablation time on size and sphericity index of ablations. Flow did not have a significant effect on the size or shape of coagulation created at 5 or 10 minutes (P > .05 for all tests). The mean short- and long-axis diameters and volume were 3.2 cm (95% confidence interval [CI]: 3.1, 3.3), 5.6 cm (95% CI: 5.4, 5.8), and 30.2 cm(3) (95% CI: 28.4, 32.1) for the 5-minute ablations and 3.8 cm (95% CI: 3.7, 3.9), 6.5 cm (95% CI: 6.3, 6.7), and 49.3 cm(3) (95% CI: 47.5, 51.2), for the 10-minute ablations, respectively. The mean sphericity index for both 5- and 10-minute ablations was 34.4% (95% CI: 32%, 36.7%). Change in portal venous blood flow rates did not have an effect on the size and shape of ablations created by a 2.45-GHz microwave ablation device.

  4. Atlantic meridional overturning transport at 14.5° N and 24.5° N during 1989-1992 and 2013-2015

    Science.gov (United States)

    Fu, Yao; Karstensen, Johannes; Brandt, Peter

    2017-04-01

    We analyzed the Atlantic meridional overturning circulation (AMOC) from transatlantic sections along 14.5° N, occupied in 1989 and 2013, in combination with data along a section at 24.5° N, occupied in 1992 and 2015. By applying a box inverse model, volume, salt, and heat conservation in layers, defined by neutral density surfaces, was applied. Considering direct and indirect Ekman transport estimates and specific transport features, such as the deep western boundary current, as constraints, the reference velocity for each station pair and the dianeutral velocity for each property across neutral density surfaces was determined. Our analysis shows that the Antarctic Intermediate Water (AAIW) has become significantly warmer and saltier along the 14.5° N section, while the North Atlantic Deep Water (NADW) has become colder and fresher at both sections. At 24.5° N, the water mass transport from the inverse model is in good agreement with that from the RAPID-MOCHA-WBTS arrays. At 14.5° N, we observed a decent of the upper boundary of the northward flowing Antarctic Bottom Water (AABW) by one density layer (from 28.141 to 28.154 kg m-3). The AMOC was generally stronger in 1989/1992 than in 2013/2015 (19.3±6.8 Sv versus 16.5±7.1 Sv at 14.5° N, and 20.3±5.2 Sv versus 18.8±5.8 Sv at 24.5° N, respectively). In the inverse model solution the transport changes are caused by a reduction of the northward AAIW and AABW transport and a corresponding reduction of the southward NADW transport at both sections. Comparison between our AMOC estimates at 14.5° N and results from the GECCO2 ocean synthesis data shows that the observed changes between the two time periods could be explained by the seasonal cycle and interannual changes found in GECCO2. Heat and freshwater fluxes through each section were estimated using the inverse results.

  5. Ionophore silica-coated magnetite nanoparticles as a recyclable heterogeneous catalyst for one-pot green synthesis of 2,4,5-trisubstituted imidazoles.

    Science.gov (United States)

    Naeimi, Hossein; Aghaseyedkarimi, Dorsa

    2016-01-21

    Novel multi-SO3H functionalized strong Brønsted acidic ionic liquid coated magnetite nanoparticles have been prepared and applied as catalyst for the synthesis of 2,4,5-trisubstituted imidazoles. The results showed that a novel catalyst was very efficient for the reaction and could be magnetically separated and reused at least 6 times with less reduction in its catalytic activity. Operational simplicity, low cost of the catalyst used, high yields, environmental friendliness, wide applicability, reusability and easy recovery of the catalyst using an external magnet are the most important features of this methodology. The catalyst was characterized by Fourier transform infrared spectroscopy (FT-IR), X-Ray diffraction analysis (XRD), field emission scanning electron microscopy (FE-SEM), energy dispersive X-ray analysis (EDX), dynamic laser scattering (DLS) and vibrating sample magnetometry (VSM).

  6. Hexaaqua­zinc(II) bis­(2,4,5-tricarboxybenzoate) 4,5-diaza­fluoren-9-one disolvate dihydrate

    Science.gov (United States)

    Yang, Gui-Fu; Zhao, Ya-Hui

    2010-01-01

    The asymmetric unit of the title complex, [Zn(H2O)6](C10H5O8)2·2C11H6N2O·2H2O, contains one half of the complex cation with the ZnII ion located on an inversion center, a monovalent 2,4,5-tricarboxybenzoate (1,2,4,5-BTC) counter-anion, a 4,5-diaza­fluoren-9-one (DAFO) mol­ecule and an uncoordinated water mol­ecule. In the crystal structure, O—H⋯O and O—H⋯N hydrogen bonds link the cations, anions and water mol­ecules into a three-dimensional network. PMID:21587724

  7. Synthesis and biological evaluation of novel 2,4,5-triarylimidazole-1,2,3-triazole derivatives via click chemistry as α-glucosidase inhibitors.

    Science.gov (United States)

    Wang, Guangcheng; Peng, Zhiyun; Wang, Jing; Li, Juan; Li, Xin

    2016-12-01

    A novel series of 2,4,5-triarylimidazole-1,2,3-triazole derivatives were synthesized via copper(I)-catalyzed azide-alkyne click chemistry, and evaluated for their α-glucosidase inhibitory activity. All tested compounds showed potent α-glucosidase inhibitory activity with IC50 ranging from 15.16±0.18 to 48.15±0.37μM, in comparison to the standard drug, acarbose (IC50=817.38±6.27μM). Among all the tested compounds, 5j was found to be the most active compound with IC50 value of 15.16±0.18μM and behaved as a noncompetitive inhibitor with a Ki of 14.78μM. In addition, molecular docking study was carried out to explore the binding interactions of these compounds with α-glucosidase enzyme. Copyright © 2016 Elsevier Ltd. All rights reserved.

  8. Dosimetry of a set-up for the exposure of newborn mice to 2.45-GHZ WiFi frequencies.

    Science.gov (United States)

    Pinto, R; Lopresto, V; Galloni, P; Marino, C; Mancini, S; Lodato, R; Pioli, C; Lovisolo, G A

    2010-08-01

    This work describes the dosimetry of a two waveguide cell system designed to expose newborn mice to electromagnetic fields associated with wireless fidelity signals in the frequency band of 2.45 GHz. The dosimetric characterisation of the exposure system was performed both numerically and experimentally. Specific measures were adopted with regard to the increase in both weight and size of the biological target during the exposure period. The specific absorption rate (SAR, W kg(-1)) for 1 W of input power vs. weight curve was assessed. The curve evidenced an SAR pattern varying from 6 W kg(-1) during the first 5 weeks of the life of mice, with a peak resonance phenomenon at a weight around 5 g. This curve was used to set the appropriate level of input power during experimental sessions to expose the growing mice to a defined and constant dose.

  9. Bis(tetramethylamonium bis(2,4,5-carboxybenzoate–benzene-1,2,4,5-tetracarboxylic acid (1/1

    Directory of Open Access Journals (Sweden)

    Penka I. Girginova

    2008-01-01

    Full Text Available The asymmetric unit of the title compound, 2C4H12N+·2C10H5O8−·C10H6O8, consists of a tetramethylamonium cation, an anion derived from the singly deprotonated pyromellitic acid anion, 2,4,5-carboxybenzoate (H3bta−, and one-half of a benzene-1,2,4,5-tetracarboxylic acid (H4bta molecule, which has the centroid of the aromatic ring positioned at a crystallographic centre of inversion. The H4bta and H3bta− residues are involved in an extensive intermolecular O—H...O hydrogen-bonding network, which leads to a three-dimensional supramolecular structure containing one-dimensional channels running parallel to the [001] crystallographic direction. These channels house the tetramethylamonium cations.

  10. Strategic Petroleum Reserve (SPR) oil storage cavern sulphur mines 2-4-5 certification tests and analysis. Part I: 1981 testing. Part II: 1982 testing

    Energy Technology Data Exchange (ETDEWEB)

    Beasley, R.R.

    1982-12-01

    Well leak tests and a cavern pressure were conducted in June through December 1981, and are described in Part I. The tests did not indicate conclusively that there was no leakage from the cavern, but the data indicate that cavern structural failure during oil storage is unlikely. The test results indicated that retesting and well workover were desirable prior to making a decision on the cavern use. Well leak tests were conducted in March through May 1982, and are described in Part II. The tests indicated that there was no significant leakage from wells 2 and 4 but that the leakage from wells 2A and 5 exceeded the DOE criterion. Because of the proximity of cavern 2-4-5 to the edge of the salt, this cavern should be considered for only one fill/withdrawal cycle prior to extensive reevaluation. 57 figures, 17 tables.

  11. Fission Cross-section Measurements of (233)U, (245)Cm and (241,243)Am at CERN n_TOF Facility

    CERN Document Server

    Calviani, M; Andriamonje, S; Chiaveri, E; Vlachoudis, V; Colonna, N; Meaze, M H; Marrone, S; Tagliente, G; Terlizzi, R; Belloni, F; Abbondanno, U; Fujii, K; Milazzo, P M; Moreau, C; Aerts, G; Berthoumieux, E; Dridi, W; Gunsing, F; Pancin, J; Perrot, L; Plukis, A; Alvarez, H; Duran, I; Paradela, C; Alvarez-Velarde, F; Cano-Ott, D; Gonzalez-Romero, E; Guerrero, C; Martinez, T; Villamarin, D; Vicente, M C; Andrzejewski, J; Marganiec, J; Assimakopoulos, P; Karadimos, D; Karamanis, D; Papachristodoulou, C; Patronis, N; Audouin, L; David, S; Ferrant, L; Isaev, S; Stephan, C; Tassan-Got, L; Badurek, G; Jericha, E; Leeb, H; Oberhummer, H; Pigni, M T; Baumann, P; Kerveno, M; Lukic, S; Rudolf, G; Becvar, F; Krticka, M; Calvino, F; Capote, R; Carrillo De Albornoz, A; Marques, L; Salgado, J; Tavora, L; Vaz, P; Cennini, P; Dahlfors, M; Ferrari, A; Gramegna, F; Herrera-Martinez, A; Kadi, Y; Mastinu, P; Praena, J; Sarchiapone, L; Wendler, H; Chepel, V; Ferreira-Marques, R; Goncalves, I; Lindote, A; Lopes, I; Neves, F; Cortes, G; Poch, A; Pretel, C; Couture, A; Cox, J; O'brien, S; Wiescher, M; Dillman, I; Heil, M; Kappeler, F; Mosconi, M; Plag, R; Voss, F; Walter, S; Wisshak, K; Dolfini, R; Rubbia, C; Domingo-Pardo, C; Tain, J L; Eleftheriadis, C; Savvidis, I; Frais-Koelbl, H; Griesmayer, E; Furman, W; Konovalov, V; Goverdovski, A; Ketlerov, V; Haas, B; Haight, R; Reifarth, R; Igashira, M; Koehler, P; Kossionides, E; Lampoudis, C; Lozano, M; Quesada, J; Massimi, C; Vannini, G; Mengoni, A; Oshima, M; Papadopoulos, C; Vlastou, R; Pavlik, A; Pavlopoulos, P; Plompen, A; Rullhusen, P; Rauscher, T; Rosetti, M; Ventura, A

    2011-01-01

    Neutron-induced fission cross-sections of minor actinides have been measured using the n_TOF white neutron source at CERN, Geneva, as part of a large experimental program aiming at collecting new data relevant for nuclear astrophysics and for the design of advanced reactor systems. The measurements at n_TOF take advantage of the innovative features of the n_TOF facility, namely the wide energy range, high instantaneous neutron flux and good energy resolution. Final results on the fission cross-section of 233U, 245Cm and 243Am from thermal to 20 MeV are here reported, together with preliminary results for 241Am. The measurement have been performed with a dedicated Fast Ionization Chamber (FIC), a fission fragment detector with a very high efficiency, relative to the very well known cross-section of 235U, measured simultaneously with the same detector.

  12. Dual applicator thermal ablation at 2.45 GHz: a numerical comparison and experiments on synchronous versus asynchronous and switched-mode feeding.

    Science.gov (United States)

    Biffi Gentili, Guido; Ignesti, Cosimo

    2015-01-01

    This paper compares the results obtained with numerical simulations and ex vivo experiments involving a dual applicator microwave thermal ablation system operating at a 2.45 GHz frequency, both in synchronous and asynchronous modes. Our purpose was to demonstrate that at this frequency an asynchronous or switched-mode system performs essentially as well as the synchronous one, in spite of the prevailing belief that coherence would assure better thermal (TH) synergy. Numerical analysis: The calculations of temperature fields were based on the Pennes bioheat equation, taking into account the effects of blood perfusion by means of a full-wave 3D simulator that allows numerical electromagnetic (EM) and TH analyses. Experiments were done using a 100 W microwave (MW) power generator and a fast switched-mode sequential 'active' power splitter. By adding a further passive power splitter we arranged a test bed for an accurate experimental comparison of synchronous versus switched-mode TH ablations. The experimental ablation zones produced by a dual applicator array on ex vivo swine tissue corresponded well with the simulated ones, confirming that the simplifications assumed in the full-wave analysis were compatible with the aim of our work. Numerical simulations and experiments show that at a 2.45 GHz industrial, scientific and medical (ISM) frequency, synchronous, asynchronous and switched-mode multi-probe systems are substantially equivalent in terms of ablative performance. Moreover, the switched-mode solution offers simpler operation along with lesser sensitivity to the placement of applicators in the tissue.

  13. Microwave endometrial ablation at a frequency of 2.45 GHz for menorrhagia: analysis of treatment results at a single facility.

    Science.gov (United States)

    Nakayama, Kentaro; Ishibashi, Tomoka; Ishikawa, Masako; Katagiri, Atsuko; Katagiri, Hiroshi; Iida, Kouji; Nakayama, Naomi; Miyazaki, Kohji

    2014-01-01

    We aimed to evaluate the efficacy of microwave endometrial ablation at a frequency of 2.45 GHz in women with menorrhagia. This method has been attracting attention as an alternative to hysterectomy in the treatment of functional and organic menorrhagia. We performed microwave endometrial ablation in 103 women with menorrhagia between August 2007 and October 2012. All patients had completed child bearing. We evaluated the efficacy of microwave endometrial ablation using a visual analog scale for menorrhagia, dysmenorrhea, and patient satisfaction. We also evaluated the incidence of hypermenorrhea recurrence, amenorrhea, and procedure complications in relation to patients' clinical factors, such as the presence of myoma, adenomyosis, uterine size, and type of bleeding. A total of 76 patients completed the evaluation period. Excessive menstruation improved from a preoperative mean visual analog score of 10, to 1.9 after treatment. Dysmenorrhea improved from a mean score of 4.2, to 1.3, and patient satisfaction had a mean score of 9.0. Hemoglobin levels improved from 10.1 g/dL preoperatively to 12.5 g/dL postoperatively. Four patients experienced recurrence of excessive menstruation. No related clinical factors could be identified for recurrence risk or the occurrence of postoperative infection. A total of 26 patients (34.2%) became amenorrheic; these patients were less likely to have myomata, intramural myomata, and myomata larger than 5 cm. Microwave endometrial ablation at a frequency of 2.45 GHz is an effective and safe treatment. It should be considered as a standard treatment for conservative therapy-resistant menorrhagia. © 2013 The Authors. Journal of Obstetrics and Gynaecology Research © 2013 Japan Society of Obstetrics and Gynecology.

  14. Dielectric and magnetic properties of NiFe{sub 2}O{sub 4} at 2.45 GHz and heating capacity for potential uses under microwaves

    Energy Technology Data Exchange (ETDEWEB)

    Polaert, Isabelle, E-mail: isabelle.polaert@insa-rouen.fr [LSPC (Laboratoire de Sécurité des Procédés Chimiques). Institut National des Sciences Appliquées INSA Rouen (France); Bastien, Samuel [Département de génie chimique et de génie biotechnologique, Université de Sherbrooke, Sherbrooke, Québec, Canada J1K 2R1 (Canada); Legras, Benoit [LSPC (Laboratoire de Sécurité des Procédés Chimiques). Institut National des Sciences Appliquées INSA Rouen (France); Département de génie chimique et de génie biotechnologique, Université de Sherbrooke, Sherbrooke, Québec, Canada J1K 2R1 (Canada); Estel, Lionel [LSPC (Laboratoire de Sécurité des Procédés Chimiques). Institut National des Sciences Appliquées INSA Rouen (France); Braidy, Nadi [Département de génie chimique et de génie biotechnologique, Université de Sherbrooke, Sherbrooke, Québec, Canada J1K 2R1 (Canada)

    2015-01-15

    This paper presents the dielectric and magnetic properties, measured at 2.45 GHz, of a new nickel ferrite, NiFe{sub 2}O{sub 4}, synthetized by plasma technology. These properties were measured by the small perturbation method in a resonant cavity, from 293 to 513 K. Using these values, the adiabatic heating of nanoparticles of NiFe{sub 2}O{sub 4} under microwave irradiation was also modeled. The wave propagation equation (Maxwell's equation) coupled to the heat transfer in the solid was numerically solved. The influence of parameters such as the bed volume, its porosity, the microwave incident power or the microwave system geometry is discussed. This study demonstrates that NiFe{sub 2}O{sub 4} nanoparticles can be rapidly heated up to at least 513 K under microwaves and can probably achieve higher temperatures according to the thermal insulation. The magnetic contribution to heating overcomes the dielectric one in the explored temperature range. Very efficient energy yield (>90%) can then be achieved when the magnetic field position is centered over the bed. - Highlights: • A new nickel ferrite, NiFe{sub 2}O{sub 4}, was synthetized by plasma technology. • Its dielectric and magnetic properties were measured at 2.45 GHz. • The adiabatic heating of nanoparticles of NiFe{sub 2}O{sub 4} under microwave was modeled. • NiFe{sub 2}O{sub 4} nanoparticles can be rapidly heated up to at least 513 K. • The magnetic contribution to heating overcomes the dielectric one from 293 K to 513 K.

  15. Synthesis and crystal structure of a new homoleptic tetraarylruthenium(IV) complex Ru(2,4,5-Me{sub 3}C{sub 6}H{sub 2}){sub 4}

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Chang-Jiu; Wu, Xiu-Li; Ma, Xiu-Fang; Jia, Ai-Quan; Zhang, Qian-Feng [Anhui Univ. of Technology, Anhui (China). Inst. of Molecular Engineering and Applied Chemistry and Anhui Province Key Lab. of Metallurgy Engineering and Resources Recycling

    2017-08-01

    Treatment of [Ru(acac){sub 3}] (acac-=acetylacetonate) with (2,4,5-Me{sub 3}C{sub 6}H{sub 2})MgBr, followed by column chromatography in air, afforded the homoleptic tetraaryl-ruthenium(IV) complex [Ru(2,4,5-Me{sub 3}C{sub 6}H{sub 2}){sub 4}] (1) in moderate yield. The product was characterized by proton NMR spectroscopy and microanalyses. Its crystal structure has also been established by X-ray crystallography.

  16. Automated absolute activation analysis with californium-252 sources

    Energy Technology Data Exchange (ETDEWEB)

    MacMurdo, K.W.; Bowman, W.W.

    1978-09-01

    A 100-mg /sup 252/Cf neutron activation analysis facility is used routinely at the Savannah River Laboratory for multielement analysis of many solid and liquid samples. An absolute analysis technique converts counting data directly to elemental concentration without the use of classical comparative standards and flux monitors. With the totally automated pneumatic sample transfer system, cyclic irradiation-decay-count regimes can be pre-selected for up to 40 samples, and samples can be analyzed with the facility unattended. An automatic data control system starts and stops a high-resolution gamma-ray spectrometer and/or a delayed-neutron detector; the system also stores data and controls output modes. Gamma ray data are reduced by three main programs in the IBM 360/195 computer: the 4096-channel spectrum and pertinent experimental timing, counting, and sample data are stored on magnetic tape; the spectrum is then reduced to a list of significant photopeak energies, integrated areas, and their associated statistical errors; and the third program assigns gamma ray photopeaks to the appropriate neutron activation product(s) by comparing photopeak energies to tabulated gamma ray energies. Photopeak areas are then converted to elemental concentration by using experimental timing and sample data, calculated elemental neutron capture rates, absolute detector efficiencies, and absolute spectroscopic decay data. Calculational procedures have been developed so that fissile material can be analyzed by cyclic neutron activation and delayed-neutron counting procedures. These calculations are based on a 6 half-life group model of delayed neutron emission; calculations include corrections for delayed neutron interference from /sup 17/O. Detection sensitivities of < or = 400 ppB for natural uranium and 8 ppB (< or = 0.5 (nCi/g)) for /sup 239/Pu were demonstrated with 15-g samples at a throughput of up to 140 per day. Over 40 elements can be detected at the sub-ppM level.

  17. Metastable charge-transfer state of californium(iii) compounds.

    Science.gov (United States)

    Liu, Guokui; Cary, Samantha K; Albrecht-Schmitt, Thomas E

    2015-06-28

    Among a series of anomalous physical and chemical properties of Cf(iii) compounds revealed by recent investigations, the present work addresses the characteristics of the optical spectra of An(HDPA)3·H2O (An = Am, Cm, and Cf), especially the broadband photoluminescence from Cf(HDPA)3·H2O induced by ligand-to-metal charge transfer (CT). As a result of strong ion-ligand interactions and the relative ease of reducing Cf(iii) to Cf(ii), a CT transition occurs at low energy (transfer state undergoes radiative and non-radiative relaxations. Broadening of the CT transition arises from strong vibronic coupling and hole-charge interactions in the valence band. The non-radiative relaxation of the metastable CT state results from a competition between phonon-relaxation and thermal tunneling that populates the excited states of Cf(iii).

  18. A short and facile synthesis of 2-(1Z)-(3-hydroxy-3,7-dimethylocta-1,6-dienyl)-1,4-benzenediol and 1-(3'-methoxypropanoyl)-2,4,5-trimethoxybenzene isolated from Cordia alliodora.

    Science.gov (United States)

    Kaur, Sukhbir; Singh, Vasundhara; Kumar, Gulshan; Kad, G L; Singh, Jasvinder

    2010-03-01

    A novel synthesis of 2-(1Z)-(3-hydroxy-3,7-dimethylocta-1,6-dienyl)-1,4-benzenediol and 1-(3'-methoxypropanoyl)-2,4,5-trimethoxybenzene has been carried out by making use of an easily available starting material, acceleration by MW irradiation and the use of water as a green solvent in the key steps.

  19. Recoil-range studies of heavy products of multinucleon transfer from /sup 18/O to /sup 245/Cm and /sup 249/Cf

    Energy Technology Data Exchange (ETDEWEB)

    McFarland, R.M.

    1982-09-01

    Recoil range distributions were measured for alpha and spontaneous fission activities made in the bombardment of /sup 245/Cm and /sup 249/Cf with /sup 18/O from 6.20 MeV/nucleon down to the interaction barrier. The shape of the distributions indicates tht transfers of up to four protons take place via a combination of quasi-elastic (QET) and deep inelastic (DIT) mechanisms, rather than complete fusion-de-excitation (CF) or massive transfer (MT). Angular distributions constructed from recoil range distributions, assuming QET/DIT, indicate that the QET component contributes more significantly to the heavy product residue cross section than the DIT, even though primary cross sections are expected to be higher for DIT than for QET. This may be explained qualitatively as a result of the high excitation energies associated with DIT; the very negative Q/sub gg/ of projectile stripping for these systems combined with the lower expected optimal Q/sub rxn/ of QET compared to DIT can give QET products comparatively low excitation.

  20. FDTD analysis of temperature elevation in the lens of human and rabbit models due to near-field and far-field exposures at 2.45 GHz.

    Science.gov (United States)

    Oizumi, Takuya; Laakso, Ilkka; Hirata, Akimasa; Fujiwara, Osamu; Watanabe, Soichi; Taki, Masao; Kojima, Masami; Sasaki, Hiroshi; Sasaki, Kazuyuki

    2013-07-01

    The eye is said to be one of the most sensitive organs to microwave heating. According to previous studies, the possibility of microwave-induced cataract formation has been experimentally investigated in rabbit and monkey eyes, but not for the human eye due to ethical reasons. In the present study, the temperature elevation in the lens, the skin around the eye and the core temperature of numerical human and rabbit models for far-field and near-field exposures at 2.45 GHz are investigated. The temperature elevations in the human and rabbit models were compared with the threshold temperatures for inducing cataracts, thermal pain in the skin and reversible health effects such as heat exhaustion or heat stroke. For plane-wave exposure, the core temperature elevation is shown to be essential both in the human and in the rabbit models as suggested in the international guidelines and standards. For localised exposure of the human eye, the temperature elevation of the skin was essential, and the lens temperature did not reach its threshold for thermal pain. On the other hand, the lens temperature elevation was found to be dominant for the rabbit eye.

  1. The therapeutic effect of a pulsed electromagnetic field on the reproductive patterns of male Wistar rats exposed to a 2.45-GHz microwave field

    Directory of Open Access Journals (Sweden)

    Sanjay Kumar

    2011-01-01

    Full Text Available INTRODUCTION: Environmental exposure to man-made electromagnetic fields has been steadily increasing with the growing demand for electronic items that are operational at various frequencies. Testicular function is particularly susceptible to radiation emitted by electromagnetic fields. OBJECTIVES: This study aimed to examine the therapeutic effects of a pulsed electromagnetic field (100 Hz on the reproductive systems of male Wistar rats (70 days old. METHODS: The experiments were divided into five groups: microwave sham, microwave exposure (2.45 GHz, pulsed electromagnetic field sham, pulsed electromagnetic field (100 Hz exposure, and microwave/pulsed electromagnetic field exposure. The animals were exposed for 2 hours/day for 60 days. After exposure, the animals were sacrificed, their sperm was used for creatine and caspase assays, and their serum was used for melatonin and testosterone assays. RESULTS: The results showed significant increases in caspase and creatine kinase and significant decreases in testosterone and melatonin in the exposed groups. This finding emphasizes that reactive oxygen species (a potential inducer of cancer are the primary cause of DNA damage. However, pulsed electromagnetic field exposure relieves the effect of microwave exposure by inducing Faraday currents. CONCLUSIONS: Electromagnetic fields are recognized as hazards that affect testicular function by generating reactive oxygen species and reduce the bioavailability of androgen to maturing spermatozoa. Thus, microwave exposure adversely affects male fertility, whereas pulsed electromagnetic field therapy is a non-invasive, simple technique that can be used as a scavenger agent to combat oxidative stress.

  2. Computational model for calculating body-core temperature elevation in rabbits due to whole-body exposure at 2.45 GHz

    Science.gov (United States)

    Hirata, Akimasa; Sugiyama, Hironori; Kojima, Masami; Kawai, Hiroki; Yamashiro, Yoko; Fujiwara, Osamu; Watanabe, Soichi; Sasaki, Kazuyuki

    2008-06-01

    In the current international guidelines and standards with regard to human exposure to electromagnetic waves, the basic restriction is defined in terms of the whole-body average-specific absorption rate. The rationale for the guidelines is that the characteristic pattern of thermoregulatory response is observed for the whole-body average SAR above a certain level. However, the relationship between energy absorption and temperature elevation was not well quantified. In this study, we improved our thermal computation model for rabbits, which was developed for localized exposure on eye, in order to investigate the body-core temperature elevation due to whole-body exposure at 2.45 GHz. The effect of anesthesia on the body-core temperature elevation was also discussed in comparison with measured results. For the whole-body average SAR of 3.0 W kg-1, the body-core temperature in rabbits elevates with time, without becoming saturated. The administration of anesthesia suppressed body-core temperature elevation, which is attributed to the reduced basal metabolic rate.

  3. Granular activated carbon adsorption and microwave regeneration for the treatment of 2,4,5-trichlorobiphenyl in simulated soil-washing solution.

    Science.gov (United States)

    Liu, Xitao; Yu, Gang; Han, Wenya

    2007-08-25

    The treatment of 2,4,5-trichlorobiphenyl (PCB29) in simulated soil-washing solution by granular activated carbon (GAC) adsorption and microwave (MW) regeneration was investigated in this study. The PCB29 adsorption process was carried out in a continuous flow adsorption column. After adsorption, the PCB29-loaded GAC was dried at 103 degrees C, and regenerated in a quartz reactor by 2450MHz MW irradiation at 700W for 5min. The efficacy of this procedure was analyzed by determining the rates and amounts of PCB29 adsorbed in successive adsorption/MW regeneration cycles. Effects of the regeneration on the textural properties and the PCB29 adsorption capacity of GAC were examined. It was found that after several adsorption/MW regeneration cycles, the adsorption rate of GAC increased, whereas, the adsorption capacity decreased, which could be explained according to the change of textural properties. Most of the PCB29 adsorbed on GAC was degraded within 3min under MW irradiation, and the analysis of degradation products by GC-MS demonstrated that PCB29 experienced dechlorination during this treatment.

  4. 2,4,5-Trichlorophenol degradation using a novel TiO2-coated biofilm carrier: roles of adsorption, photocatalysis, and biodegradation.

    Science.gov (United States)

    Li, Guozheng; Park, Seongjun; Kang, Dae-Wook; Krajmalnik-Brown, Rosa; Rittmann, Bruce E

    2011-10-01

    Intimate coupling of photocatalysis and biodegradation (ICPB) offers potential for degrading biorecalcitrant and toxic organic compounds. This study reports on a novel sponge-type, TiO(2)-coated biofilm carrier that showed significant adherence of TiO(2) and ability to accumulate biomass in its interior. This carrier was tested for ICPB in a continuous-flow photocatalytic circulating-bed biofilm reactor (PCBBR) to mineralize 2,4,5-trichlorophenol (TCP), which is biorecalcitrant. Four mechanisms possibly acting in ICPB were tested separately: TCP adsorption to the carrier, UV photolysis, UV photocatalysis, and biodegradation by biofilm inside the carrier. The carrier exhibited strong TCP adsorption that followed a Freundlich isotherm with an exponent near 2. Whereas UV photolysis was negligible, photocatalysis produced TCP-degradation products that could be mineralized, and the strong adsorption of TCP to the carrier enhanced biodegradation by relieving toxicity. Validating the ICPB concept, biofilm was protected inside the carriers, although biomass originally on the outer surface of the carriers was eliminated. ICPB significantly lowered the diversity of the bacterial community, but five genera known to biodegrade chlorinated phenols (Ralstonia, Bradyrhizobium, Methylobacterium, Cupriavidus, and Pandoraea) were markedly enriched.

  5. Exploration of aroyl/heteroaroyl iminothiazolines featuring 2,4,5-trichlorophenyl moiety as a new class of potent, selective, and in vitro efficacious glucosidase inhibitors.

    Science.gov (United States)

    Kazmi, Madiha; Zaib, Sumera; Amjad, Sayyeda Tayyeba; Khan, Imtiaz; Ibrar, Aliya; Saeed, Aamer; Iqbal, Jamshed

    2017-10-01

    A series of iminothiazolines (4a-j) featuring 2,4,5-trichlorophenyl moiety and aroyl/heteroaroyl substituents has been prepared from readily accessible thioureas. In-vitro screening against glucosidase enzymes showed highly specific inhibition of α-glucosidase with a marked dependence of the potency upon the nature of the aroyl/heteroaroyl substituents. The most potent representatives, bearing ortho-tolyl and bulky naphthyl groups displayed the highest inhibitory potential with IC50 value of 0.15±0.01µM compared to standard drug acarbose (IC50=38.2±0.12µM). Several other derivatives (4c, 4d, 4i and 4j) were also significantly powerful and selective inhibitors of α-glucosidase. Binding interactions of potent compounds 4b, 4c, 4h and 4i with α-glucosidase were explored by molecular docking simulation. These results clearly identified a new class of structural leads which can be further investigated for the development of promising α-glucosidase inhibitors for the prevention of diabetes mellitus. Copyright © 2017 Elsevier Inc. All rights reserved.

  6. An adiabatic calorimeter for heat capacity measurements of polyurethane foam with blowing agent of HFC245fa in the temperature range 60-290K

    Energy Technology Data Exchange (ETDEWEB)

    Yang, C.G.; Xu, L.; Zhang, L.Q.; Chen, N. [Institute of Refrigeration and Cryogenics, Shanghai Jiao Tong University, Shanghai 200030 (China)

    2006-06-15

    In order to meet the urgent need of heat insulating materials used under low temperature in the area of aerospace, a new polyurethane (PU) foam with HFC245fa as blowing agent was developed. In this paper, the heat capacity in the temperature range of 60-290K of the new material was measured through an automated adiabatic calorimeter, which was composed of a heat insulation system, a power measuring system, a vacuum pumping system and a cooling system. The sample cell of the calorimeter was equipped with a miniature platinum thermometer surrounded by two adiabatic shields and housed in a high vacuum can. The temperature differences among the sample cell and the inner and outer adiabatic shields could be adjusted automatically to less than 0.05K, all which ensure there was no heat exchange between the sample and surroundings. Under these conditions, the mathematical formulation of the sample with the physical model was given. Through measuring the heat capacity of {alpha}-Al{sub 2}O{sub 3}, which is a standard reference material, a relatively high reliability with a deviation of +/-2.5% of this adiabatic calorimeter was shown compared with the standard data. The results indicate that the newly developed PU foam has a higher heat capacity compared with other heat insulating materials, and there is no obvious sign of any phase transition or thermal anomaly in the entire temperature range. That is to say, the material is thermodynamically stable when used in the low temperature range. (author)

  7. An adiabatic calorimeter for heat capacity measurements of polyurethane foam with blowing agent of HFC245fa in the temperature range 60-290 K

    Energy Technology Data Exchange (ETDEWEB)

    Yang, C.G. [Institute of Refrigeration and Cryogenics, Shanghai Jiao Tong University, Shanghai 200030 (China)]. E-mail: chunguang_yang@sjtu.edu.cn; Xu, L. [Institute of Refrigeration and Cryogenics, Shanghai Jiao Tong University, Shanghai 200030 (China); Zhang, L.Q. [Institute of Refrigeration and Cryogenics, Shanghai Jiao Tong University, Shanghai 200030 (China); Chen, N. [Institute of Refrigeration and Cryogenics, Shanghai Jiao Tong University, Shanghai 200030 (China)

    2006-06-15

    In order to meet the urgent need of heat insulating materials used under low temperature in the area of aerospace, a new PU foam with HFC245fa as blowing agent was developed. In this paper, the heat capacity in the temperature range of 60-290 K of the new material was measured through an automated adiabatic calorimeter, which was composed of a heat insulation system, a power measuring system, a vacuum pumping system and a cooling system. The sample cell of the calorimeter was equipped with a miniature platinum thermometer surrounded by two adiabatic shields and housed in a high vacuum can. The temperature differences among the sample cell and the inner and outer adiabatic shields could be adjusted automatically to less than 0.05 K, all which ensure there was no heat exchange between the sample and surroundings. Under these conditions, the mathematical formulation of the sample with the physical model was given. Through measuring the heat capacity of {alpha}-Al{sub 2}O{sub 3}, which is a standard reference material, a relatively high reliability with a deviation of {+-}2.5% of this adiabatic calorimeter was shown compared with the standard data. The results indicate that the newly developed PU foam has a higher heat capacity compared with other heat insulating materials, and there is no obvious sign of any phase transition or thermal anomaly in the entire temperature range. That is to say, the material is thermodynamically stable when used in the low temperature range.

  8. Origin of the 2.45 eV luminescence band observed in ZnO epitaxial layers grown on c-plane sapphire by chemical vapour deposition

    Science.gov (United States)

    Saroj, R. K.; Dhar, S.

    2014-12-01

    Zinc oxide epitaxial layers have been grown on c-plane sapphire substrates by the chemical vapour deposition (CVD) technique. A structural study shows (0001)-oriented films with good crystalline quality. The temperature and excitation power dependence of the photoluminescence (PL) characteristics of these layers is studied as a function of various growth parameters, such as the growth temperature, oxygen flow rate and Zn flux, which suggest that the origin of the broad visible luminescence (VL), which peaks at 2.45 eV, is the transition between the conduction band and the Zn vacancy acceptor states. A bound excitonic transition observed at 3.32 eV in low temperature PL has been identified as an exciton bound to the neutral Zn vacancy. Our study also reveals the involvement of two activation processes in the dynamics of VL, which has been explained in terms of the fluctuation of the capture barrier height for the holes trapped in Zn vacancy acceptors. The fluctuation, which might be a result of the inhomogeneous distribution of Zn vacancies, is found to be associated with an average height of 7 and 90 meV, respectively, for the local and global maxima.

  9. Intra-annual upwelling patterns and its linkage with primary production in the euphotic zone (24.5°N) of Southern Baja California coast

    Science.gov (United States)

    Cervantes-Duarte, Rafael; Prego, Ricardo; Gaxiola-Castro, Gilberto; López-López, Silverio; Aguirre-Bahena, Fernando; Murillo-Murillo, Iban

    2015-05-01

    The continental shelf of Southern Baja California has been scarcely researched south of 25°N despite it being oceanographically necessary to gain a better understanding of the north-eastern Pacific transitional zone between middle and tropical latitudes. Therefore, the intra-annual patterns of the upwelling cycle and primary production were studied in a monitoring station (24.5°N, 112.1°W; 85 m depth) from August 2008 to December 2011. Monthly, thermohaline vertical profiles were recorded and seawater sampled at 100, 33, 10, 3 and 1% irradiance depth levels. Dissolved oxygen, nutrients and chlorophyll-a concentrations and net primary production (NPP, remote sensed and in situ) were determined. Two half-yearly recurrent periods (P < 0.001) were observed: an intense (cold) period from February to July and a faint (warm) period from August to January. In the euphotic layer, nitrate concentrations were inversely related to temperature, showing their dependence on upwelling. NPP was directly related to the upwelling process, with an annual average of 1.21 ± 0.81 gC m-2 d-1 in the triennium 2009-2011. Although the influence of La-Niña event was observed during the warm period of 2010 and the cold period of 2011, this change did not significantly affect NPP (P < 0.05).

  10. Effect of water pH on the toxicity of 2,4,5-trichlorophenol to four species of freshwater animals

    Energy Technology Data Exchange (ETDEWEB)

    Brooke, L.T.; Markee, T.; Vande Venter, F. [Univ. of Wisconsin, Superior, WI (United States); Spehar, R.; Erickson, R. [Environmental Protection Agency, Duluth, MN (United States). Environmental Research Lab.

    1994-12-31

    2,4,5-Trichlorophenol (TCP) is a weak acid with a pH of approximately 7.2 which is expected to have a significant effect upon its toxicity. Lumbriculus variegatus, Oncorhynchus mykiss, Pimephales promelas, and Hyalella azteca were exposed to TCP in 96 h flow-through toxicity tests. For the first two species, simultaneous tests were conducted at three pH values (7.0, 7.8, 8.6). The other two species were tested at six pH values conducted in two sets of three simultaneous tests (6.2, 7.4, 8.6 and 6.8, 8.0, 9.2). All species tested showed decreased sensitivity to TCP with increased pH of the water. Over the pH range tested, LC50s for L. variegatus varied by about 5-fold, for P. promelas by 12-fold, for H. azteca by 10-fold, and for O. mykiss by 1.5-fold. The effects of pH on TCP toxicity to P. promelas was also tested in 30 day chronic tests at pH 7.0, 7.8 and 8.6. Survival in these tests was affected by pH similarly to the acute tests. Growth also was less severely affected at higher pH.

  11. Nutrition for Nurses: Nursing 245.

    Science.gov (United States)

    Palermo, Karen R.

    A description is presented of "Nutrition for Nurses," a prerequisite course for students anticipating entrance into the junior level of a state university registered nursing program. Introductory material highlights the course focus (i.e., the basics of good nutrition; nutrition through the life cycle; nursing process in nutritional care; and…

  12. U-Pb Geochronology, Geochemistry and Kinematic Analyses of Subduction-Related Late Triassic Basins in Northern Chile (24.5º-26ºS).

    Science.gov (United States)

    Espinoza, M. E.

    2015-12-01

    In northern Chile (24.5°-26°S) two Pre-Andean depocenters crop out: the Cifuncho basin in the Coastal Cordillera and the Profeta basin in the Precordillera. These basins have been classically interpreted as a continental rifting unrelated to subduction during the period prior to the Andean orogenic cycle. However, recent petrographic and geochemical data suggest the development of these basins in an active subduction system. In order to test this hypothesis and to establish the geologic evolution of the basins and the strain field during the rifting process, we present preliminary U-Pb geochronological and geochemical data together with structural analyses of synrift structures. The geochronological data along the Cifuncho and Profeta basins, show a main continental sedimentary deposition during the Norian to Raethian. Volcanosedimentary rocks show a main detrital supply of Early Permian age (~297-283 Ma). This input can be associated with the volcanic La Tabla Formation and/or the exhumation of Permian granitoids. A minor supply close to ~478 Ma is related to a source from the Lower Ordovician arc (~480 Ma), suggesting the tectonic exhumation of this source to the east of the Profeta basin during the Late Triassic. On the other hand, structural analysis was carried in third and four order extensional faults (<10 m of slip) along the Profeta basin. Most of the faults show a clear synrift character with the development of fault controlled growing strata. The kinematic analyses evidence a variability in the orientation of the maximum strain axes from a main northwest to a subordinate northeast direction of extension. Thus, the intimate relation between the continental sedimentary deposition and a proximal volcanism of intermediate composition and calk-alkaline affinity, suggests the development of these basins in a supra-subduction setting during the Late Triassic. Structural data probably reflect local variation in the strain field across the basins.

  13. Effects of prenatal exposure to WIFI signal (2.45GHz) on postnatal development and behavior in rat: Influence of maternal restraint.

    Science.gov (United States)

    Othman, Haifa; Ammari, Mohamed; Sakly, Mohsen; Abdelmelek, Hafedh

    2017-05-30

    The present study was carried out to investigate the potential combined influence of maternal restraint stress and 2.45GHz WiFi signal exposure on postnatal development and behavior in the offspring of exposed rats. 24 pregnant albino Wistar rats were randomly assigned to four groups: Control, WiFi-exposed, restrained and both WiFi-exposed and restrained groups. Each of WiFi exposure and restraint occurred 2h/day along gestation till parturition. The pups were evaluated for physical development and neuromotor maturation. Moreover, elevated plus maze test, open field activity and stationary beam test were also determined on postnatal days 28, 30 and 31, respectively. After behavioral tests, the rats were anesthetized and their brains were removed for biochemical analysis. Our main findings showed no detrimental effects on gestation progress and outcomes at delivery in all groups. Subsequently, WiFi and restraint, per se and mainly in concert altered physical development of pups with slight differences between genders. Behaviorally, the gestational WiFi irradiation, restraint and especially the associated treatment affected the neuromotor maturation mainly in male progeny. At adult age, we noticed anxiety, motor deficit and exploratory behavior impairment in male offspring co-exposed to WiFi radiation and restraint, and in female progeny subjected to three treatments. The biochemical investigation showed that, all three treatments produced global oxidative stress in brain of both sexes. As for serum biochemistry, phosphorus, magnesium, glucose, triglycerides and calcium levels were disrupted. Taken together, prenatal WiFi radiation and restraint, alone and combined, provoked several behavioral and biochemical impairments at both juvenile and adult age of the offspring. Copyright © 2017 Elsevier B.V. All rights reserved.

  14. Effects of 2.45-GHz Electromagnetic Fields with a Wide Range of SARs on Micronucleus Formation in CHO-K1 Cells

    Directory of Open Access Journals (Sweden)

    S. Koyama

    2004-01-01

    Full Text Available There has been considerable discussion about the influence of high-frequency electromagnetic fields (HFEMF on the human body. In particular, HFEMF used for mobile phones may be of great concern for human health. In order to investigate the properties of HFEMF, we have examined the effects of 2.45-GHz EMF on micronucleus (MN formation in Chinese hamster ovary (CHO-K1 cells. MN formation is induced by chromosomal breakage or inhibition of spindles during cell division and leads to cell damage. We also examined the influence of heat on MN formation, since HFEMF exposure causes a rise in temperature. CHO-K1 cells were exposed to HFEMF for 2 h at average specific absorption rates (SARs of 5, 10, 20, 50, 100, and 200 W/kg, and the effects on these cells were compared with those in sham-exposed control cells. The cells were also treated with bleomycin alone as a positive control or with combined treatment of HFEMF exposure and bleomycin. Heat treatment was performed at temperatures of 37, 38, 39, 40, 41, and 42°C.The MN frequency in cells exposed to HFEMF at a SAR of lower than 50 W/kg did not differ from the sham-exposed controls, while those at SARs of 100 and 200 W/kg were significantly higher when compared with the sham-exposed controls. There was no apparent combined effect of HFEMF exposure and bleomycin treatment. On heat treatment at temperatures from 38–42°C, the MN frequency increased in a temperature-dependent manner. We also showed that an increase in SAR causes a rise in temperature and this may be connected to the increase in MN formation generated by exposure to HFEMF.

  15. Iron absorption and hepatic iron uptake are increased in a transferrin receptor 2 (Y245X) mutant mouse model of hemochromatosis type 3.

    Science.gov (United States)

    Drake, S F; Morgan, E H; Herbison, C E; Delima, R; Graham, R M; Chua, A C G; Leedman, P J; Fleming, R E; Bacon, B R; Olynyk, J K; Trinder, D

    2007-01-01

    Hereditary hemochromatosis type 3 is an iron (Fe)-overload disorder caused by mutations in transferrin receptor 2 (TfR2). TfR2 is expressed highly in the liver and regulates Fe metabolism. The aim of this study was to investigate duodenal Fe absorption and hepatic Fe uptake in a TfR2 (Y245X) mutant mouse model of hereditary hemochromatosis type 3. Duodenal Fe absorption and hepatic Fe uptake were measured in vivo by 59Fe-labeled ascorbate in TfR2 mutant mice, wild-type mice, and Fe-loaded wild-type mice (2% dietary carbonyl Fe). Gene expression was measured by real-time RT-PCR. Liver nonheme Fe concentration increased progressively with age in TfR2 mutant mice compared with wild-type mice. Fe absorption (both duodenal Fe uptake and transfer) was increased in TfR2 mutant mice compared with wild-type mice. Likewise, expression of genes participating in duodenal Fe uptake (Dcytb, DMT1) and transfer (ferroportin) were increased in TfR2 mutant mice. Nearly all of the absorbed Fe was taken up rapidly by the liver. Despite hepatic Fe loading, hepcidin expression was decreased in TfR2 mutant mice compared with wild-type mice. Even when compared with Fe-loaded wild-type mice, TfR2 mutant mice had increased Fe absorption, increased duodenal Fe transport gene expression, increased liver Fe uptake, and decreased liver hepcidin expression. In conclusion, despite systemic Fe loading, Fe absorption and liver Fe uptake were increased in TfR2 mutant mice in association with decreased expression of hepcidin. These findings support a model in which TfR2 is a sensor of Fe status and regulates duodenal Fe absorption and liver Fe uptake.

  16. Vascular comorbidities in younger people with dementia: a cross-sectional population-based study of 616 245 middle-aged people in Scotland.

    Science.gov (United States)

    Heath, C A; Mercer, S W; Guthrie, B

    2015-09-01

    There is growing evidence of an aetiological relationship between vascular risk factors and the development of dementia in later life. Dementia in the under-65s has historically been considered to be more driven by genetic factors, but previous epidemiological studies in the young have been relatively small. This study aims to determine the prevalence of vascular comorbidity in people aged dementia in comparison to the general population. Analysis of routine clinical data from 314 (30%) general medical practices in Scotland. From an overall population of 616 245 individuals, 1061 cases of 'all-cause' dementia were identified (prevalence 172/100 000 population, 95% CI 161 to 182). The prevalence of dementia was higher in people with vascular morbidities, and prevalence progressively increased from 129/100 000 in people with no vascular comorbidity to 999/100 000 in people with four or more (p=0.01). The strength of association was greatest with a previous transient ischaemic attack (TIA) or stroke and chronic kidney disease (adjusted OR=3.1 and 2.9, respectively). Statistically significant, but smaller associations were seen with the presence of hypertension, diabetes, ischaemic heart disease and peripheral vascular disease (adjusted OR=1.4, 2.0, 1.9 and 2.2, respectively). Vascular comorbid diseases were more commonly recorded in people aged 40-64 with dementia than those without. This finding indicates that vascular disease may be more important in the aetiology of young-onset dementia than previously believed, and is of concern given the continuing rise in obesity and diabetes internationally. Published by the BMJ Publishing Group Limited. For permission to use (where not already granted under a licence) please go to http://group.bmj.com/group/rights-licensing/permissions.

  17. Comparative Analysis of the Effects of Severe Plastic Deformation and Thermomechanical Training on the Functional Stability of Ti50.5Ni24.5Pd25 High-Temperature Shape Memory Alloy

    Science.gov (United States)

    Atli, K. C.; Karaman, I.; Noebe, R. D.; Maier, H. J.

    2010-01-01

    We compare the effectiveness of a conventional thermomechanical training procedure and severe plastic deformation via equal channel angular extrusion to achieve improved functional stability in a Ti50.5Ni24.5Pd25 high-temperature shape memory alloy. Thermomechanical testing indicates that both methods result in enhanced shape memory characteristics, such as reduced irrecoverable strain and thermal hysteresis. The mechanisms responsible for the improvements are discussed in light of microstructural findings from transmission electron microscopy.

  18. Erratum to "Solar Sources and Geospace Consequences of Interplanetary Magnetic Clouds Observed During Solar Cycle 23-Paper 1" [J. Atmos. Sol.-Terr. Phys. 70(2-4) (2008) 245-253

    Science.gov (United States)

    Gopalswamy, N.; Akiyama, S.; Yashiro, S.; Michalek, G.; Lepping, R. P.

    2009-01-01

    One of the figures (Fig. 4) in "Solar sources and geospace consequences of interplanetary magnetic Clouds observed during solar cycle 23 -- Paper 1" by Gopalswamy et al. (2008, JASTP, Vol. 70, Issues 2-4, February 2008, pp. 245-253) is incorrect because of a software error in t he routine that was used to make the plot. The source positions of various magnetic cloud (MC) types are therefore not plotted correctly.

  19. Glycerol as a green solvent for efficient, one-pot and catalyst free synthesis of 2,4,5-triaryl and 1,2,4,5-tetraaryl imidazole derivatives

    Directory of Open Access Journals (Sweden)

    Firouzeh Nemati

    2016-09-01

    Full Text Available A simple, efficient and catalyst-free method has been developed for the synthesis of 2,4,5-triaryl and 1,2,4,5-tetraaryl imidazole derivatives in glycerol as green solvent at 90 °C. It is noteworthy that in this protocol the yields of products were comparable to or better than, those in conventional media. The use of green reaction media makes this methodology simple, safe and cost-effective.

  20. Prevention of colonic fibrosis by Boswellia and Scutellaria extracts in rats with colitis induced by 2,4,5-trinitrobenzene sulphonic acid.

    Science.gov (United States)

    Latella, G; Sferra, R; Vetuschi, A; Zanninelli, G; D'Angelo, A; Catitti, V; Caprilli, R; Gaudio, E

    2008-06-01

    Currently, no effective preventive measures or medical therapies are available for intestinal fibrosis and, thus, surgery remains the only available strategy in the management of fibrostenotic enteropathies, especially Crohn's disease. The aim of this study was to evaluate the efficacy of a combined therapy of anti-inflammatory Boswellia and antifibrotic Scutellaria extracts on the development of colonic fibrosis in rats. Chronic colonic inflammation-associated fibrosis was induced in rats by intracolonic administration of 2,4,5-trinitrobenzene sulphonic acid (TNBS). Sixty-four healthy male Sprague-Dawley rats were assigned to five groups: 8 controls, 14 TNBS, 14 TNBS orally treated with Boswellia extracts (50 mg kg(-1) day(-1)), 14 TNBS orally treated with Scutellaria extracts (150 mg kg(-1) day(-1)), and 14 TNBS orally treated with both Boswellia (50 mg kg(-1) day(-1)) and Scutellaria extracts (150 mg kg(-1) day(-1)). The colon was removed after 21 days of treatment and assessed by macroscopic, histological, morphometric and immunohistochemical analyses. For immunohistochemical analysis, alpha-smooth muscle actin (alpha-SMA), collagen types I-III, connective tissue growth factor (CTGF), transforming growth factor-beta1 (TGF-beta1), Smad3, Smad7 and CD3 antibodies were used. Combined oral administration of Boswellia and Scutellaria significantly improved the course and macroscopic findings of TNBS-induced chronic colitis assessed by disease activity index, colon weight, length, adhesions, strictures, dilatation, thickness, oedema, ulcerations and extension of damage. The histological severity of the colonic fibrosis was also notably improved by the treatment and associated with a significant reduction in the colonic expression of alpha-SMA, collagen I-III, CTGF, TGF-beta1, Smad3, and Smad7. These data demonstrate that the prophylactic administration of anti-inflammatory Boswellia and antifibrotic Scutellaria extracts is effective in preventing colonic fibrosis in

  1. Stable Isotope Geochemistry of Extremely Well-Preserved 2.45-Billion-Year-Old Hydrothermal Systems in the Vetreny Belt, Baltic Shield: Insights into Paleohydrosphere

    Science.gov (United States)

    Zakharov, D. O.; Bindeman, I. N.

    2015-12-01

    The early Paleoproterozoic was an eventful period in the Earth's history. The first portions of free oxygen emerged in the atmosphere, Snowball Earth glaciations happened several times and the first supercontinent broke up due to extensive rifting. These events should have affected the stable isotopic composition of the hydrosphere. In this study, we use rocks that were altered in underwater hydrothermal systems to investigate the stable isotopic composition of the hydrosphere 2.39-2.45 billion years ago (hereinafter, Ga). Extremely low-δ18O (down to -27.5‰ SMOW) rocks from 2.39 Ga metamorphosed subglacial hydrothermal systems of the Belomorian belt, Baltic Shield formed at near-equatorial latitudes suggesting a Snowball (or Slushball) Earth glaciation. These results motivated us to look at temporally and geographically close hydrothermal systems from the unmetamorhposed 2.45 Ga Vetreny Belt rift. The length of the rift is 250 km and it is composed of high-Mg basalts, mafic-ultramafic intrusions and sedimentary successions. We examined several localities of high-Mg basalt flows that include astonishingly fresh pillow lavas, often with preserved volcanic glass, eruptive breccias, and hydrothermal alteration zones. Collected samples serve a great textural evidence of water-rock interaction that occurred in situ while basalts were cooling. The preliminary results from coexisting quartz and epidote (T, D18O=311°C), and from coexisting calcite and quartz (T, D18O=190°C) yield values of δ18O of involved water between -1.6 and -0.9 ‰. The values of δ13C in calcites vary between -4.0 and -2.3 ‰. It is likely that hydrothermal fluids operated in the Vetreny Belt rift were derived from seawater that is no different from modern oceanic water in terms of δ18O. Apparently, the rift was a Paleoproterozoic analog of the modern Red Sea, filled with oceanic water. The result is important because the Vetreny Belt rift predates the onset of Snowball Earth glaciation at 2

  2. Desain Beam Shaping Assembly (BSA berbasis D-D Neutron Generator 2,45 MeV untuk Uji Fasilitas BNCT

    Directory of Open Access Journals (Sweden)

    Desman P. Gulo

    2015-12-01

    Full Text Available Boron Neutron Capture Therapy (BNCT is one of the cancer treatments that are being developed in nowadays. In order to support BNCT treatment for cancer that exists in underneath skin like breast cancer, the facility needs a generator that is able to produce epithermal neutron. One of the generator that is able to produce neutron is D-D neutron generator with 2.45 MeV energy. Based on the calculation of this paper, we found that the total production of neutron per second (neutron yield from Neutron Generator (NG by PSTA-BATAN Yogyakarta is 2.55×1011 n/s. The energy and flux that we found is in the range of quick neutron. Thus, it needs to be moderated to the level of epithermal neutron which is located in the interval energy of 1 eV to 10 KeV with 109 n/cm2s flux. This number is the recommendation standard from IAEA. Beam Shaping Assembly (BSA is needed in order to moderate the quick neutron to the level of epithermal neutron. One part of BSA that has the responsibility in moderating the quick neutron to epithermal neutron is the moderator. The substance of moderator used in this paper is MgF2 and A1F3. The thickness of moderator has been set in in such a way by using MCNPX software in order to fulfill the standard of IAEA. As the result of optimizing BSA moderator, the data obtain epithermal flux with the total number of 4.64×108 n/cm2/s for both of moderators with the thickness of moderator up to 15 cm. At the end of this research, the number of epithermal flux does not follow the standard of IAEA. This is because the flux neutron that is being produced by NG is relatively small. In conclusion, the NG from PSTA-BATAN Yogyakarta is not ready to be used for the BNCT treatment facility for the underneath skin cancer like breast cancer.

  3. Crystal structure of tri-aqua-(1,10-phen-anthroline-κ(2) N,N')(2,4,5-tri-fluoro-3-meth-oxy-benzoato-κO (1))cobalt(II) 2,4,5-tri-fluoro-3-meth-oxy-benzoate.

    Science.gov (United States)

    Sun, Junshan

    2014-11-01

    The title salt, [Co(C8H4F3O3)(C12H8N2)(H2O)3](C8H4F3O3), was obtained under solvothermal conditions by the reaction of 2,4,5-tri-fluoro-3-meth-oxy-benzoic acid with CoCl2 in the presence of 1,10-phenanthroline (phen). The Co(II) ion is octa-hedrally coordinated by two N atoms [Co-N = 2.165 (2) and 2.129 (2) Å] from the phen ligand, by one carboxyl-ate O atom [Co-O = 2.107 (1) Å] and by three O atoms from water mol-ecules [Co-O = 2.093 (1), 2.102 (1) and 2.114 (1) Å]. The equatorial positions of the slightly distorted octa-hedron are occupied by the N atoms, the carboxyl-ate O and one water O atom. An intra- and inter-molecular O-H⋯O hydrogen-bonding network between the water-containing complex cation and the organic anion leads to the formation of ribbons parallel to [010].

  4. Effects of long-term of 2,4-D and MCPA field applications on the soil breakdown of 2,4-D, MCPA, mecoprop, and 2,4,5-T

    Energy Technology Data Exchange (ETDEWEB)

    Smith, A.E.; Aubin, A.J. (Agriculture Canada, Regina, Saskatchawan (Canada))

    Under laboratory conditions, the rates of breakdown of ({sup 14}C)2,4-D (2,4-dichlorophenoxyacetic acid), ({sup 14}C)MCPA (4-chloro-2-methyl-phenoxyacetic acid), ({sup 14}C)mecoprop (2-(4-chloro-2-methylphenoxy)propionic acid), and 2,4,5-T (2,4-5-trichlorophenoxyacetic acid) in soils from Canadian prairie field plots, 6 wk after receiving the 43rd annual application of 2,4-D formulations or the 37th annual treatment with MCPA, were compared with those in soils from untreated plots. Loss of 2,4-D and MCPA was faster in soils that had received continuous applications with the apopropriate herbicide than in soil from the control plots. There was some indication that ({sup 14}C)2,4-D was dissipated more rapidly from soils treated annually with MCPA than from the control soils, though breakdown was slower than in soil from the 2,4-D treated plots. In contrast, ({sup 14}C)MCPA breakdown in the 2,4-D treated plots was similar to that in untreated soils. Breakdown of ({sup 14}C)mecoprop and 2,4,5-T in the 2,4-D and MCPA-treated soils was very similar to that in the control soils. Thus, there was no support for the phenomenon of cross-enhancement. Forty-eight weeks after the last herbicide applications, the field soils still maintained their ability to degrade 2,4-D or MCPA more rapidly than soil from untreated control plots.

  5. Synthesis, characterization and catalytic application of silica supported tin oxide nanoparticles for synthesis of 2,4,5-tri and 1,2,4,5-tetrasubstituted imidazoles under solvent-free conditions

    Directory of Open Access Journals (Sweden)

    Ashok V. Borhade

    2017-02-01

    Full Text Available Highly efficient and eco-friendly, one pot synthesis of 1,2,4,5-tetra substituted imidazoles and 2,4,5-trisubstituted imidazoles was reported under solvent free conditions using nanocrystalline silica supported tin oxide (SiO2:SnO2 as a catalyst with excellent yield. The present methodology offers several advantages such as mild reaction conditions, short reaction time, good yield, high purity of product, recyclable catalyst without a noticeable decrease in catalytic activity and can be used for large scale synthesis. The synthesized SiO2:SnO2 nanocrystalline catalyst was characterized by XRD, BET surface area and TEM techniques.

  6. Performance of a radial-inflow turbine integrated in an ORC system and designed for a WHR on truck application: An experimental comparison between R245fa and R1233zd

    OpenAIRE

    Guillaume, Ludovic; Legros, Arnaud; Desideri, Adriano; Lemort, Vincent

    2016-01-01

    The goal of this study is to experimentally compare the performance of an Organic Rankine Cycle (ORC) system equipped with a radial-inflow turbine for two working fluids: R245fa and R1233zd. The radial- inflow turbine is a small-scale prototype designed to convert the waste heat from the exhaust gases of a truck combustion engine and was developed mainly using components of truck turbochargers. It is directly connected to a high-speed synchronous generator. The bearings system of the turbine ...

  7. Measurement of the Neutron Capture Cross Sections of $^{233}$U, $^{237}$Np, $^{240,242}$Pu, $^{241,243}$Am and $^{245}$Cm with a Total Absorption Calorimeter at n_TOF

    CERN Multimedia

    Beer, H; Wiescher, M; Cox, J; Rapp, W; Embid, M; Dababneh, S

    2002-01-01

    Accurate and reliable neutron capture cross section data for actinides are necessary for the poper design, safety regulation and precise performance assessment of transmutation devices such as Fast Critical Reactors or Accelerator Driven Systems (ADS). The goal of this proposal is the measurement of the neutron capture cross sections of $^{233}$U, $^{237}$Np, $^{240,242}$Pu, $^{241,243}$Am and $^{245}$Cm at n_TOF with an accuracy of 5~\\%. $^{233}$U plays an essential role in the Th fuel cycle, which has been proposed as a safer and cleaner alternative to the U fuel cycle. The capture cross sections of $^{237}$Np,$^{240,242}$Pu, $^{241,243}$Am and $^{245}$Cm play a key role in the design and optimization of a strategy for the Nuclear Waste Transmutation. A high accuracy can be achieved at n_TOF in such measurements due to a combination of features unique in the world: high instantaneous neutron fluence and excellent energy resolution of the facility, innovative Data Acquisition System based on flash ADCs and t...

  8. The effect of Fe addition on the transformation temperatures, lattice parameter and magnetization saturation of Ni{sub 52.5-X}Mn{sub 23}Ga{sub 24.5}Fe{sub X} ferromagnetic shape memory alloy

    Energy Technology Data Exchange (ETDEWEB)

    Soto-Parra, D.E.; Alvarado-Hernandez, F.; Ayala, O.; Ochoa-Gamboa, R.A. [Centro de Investigacion en Materiales Avanzados S.C. Miguel de Cervantes 120, Complejo industrial Chihuahua, 31109 Chihuahua (Mexico); Flores-Zuniga, H. [Centro de Investigacion en Materiales Avanzados S.C. Miguel de Cervantes 120, Complejo industrial Chihuahua, 31109 Chihuahua (Mexico)], E-mail: horacio.flores@cimav.edu.mx; Rios-Jara, D. [Instituto Potosino de Investigacion Cientifica y Tecnologica, Camino a la Presa San Jose 2055, Col. Lomas 4a seccion, 78216 San Luis Potosi, S.L.P. (Mexico)

    2008-09-22

    The effect of Fe addition on martensitic transformation temperatures, Curie temperature (T{sub C}), lattice parameters and magnetization saturation was studied in Ni{sub 52.5-X}Mn{sub 23}Ga{sub 24.5}Fe{sub X} alloys fabricated by arc-melting furnace. The characterizations were performed by DSC, X-ray diffraction and magnetometry. Fe replacing Ni sites leads to an increment on lattice parameter and on the magnetization saturation of the austenitic phase at room temperature. Also, T{sub C} increases from 370 K up to 400 K and remains constant for X {>=} 3.1 at.% Fe. In contrast, martensitic transformation temperatures decrease with Fe substituting Ni.

  9. 2.45 GHz Microwave Radiation Impairs Learning and Spatial Memory via Oxidative/Nitrosative Stress Induced p53-Dependent/Independent Hippocampal Apoptosis: Molecular Basis and Underlying Mechanism.

    Science.gov (United States)

    Shahin, Saba; Banerjee, Somanshu; Singh, Surya Pal; Chaturvedi, Chandra Mohini

    2015-12-01

    A close association between microwave (MW) radiation exposure and neurobehavioral disorders has been postulated but the direct effects of MW radiation on central nervous system still remains contradictory. This study was performed to understand the effect of short (15 days) and long-term (30 and 60 days) low-level MW radiation exposure on hippocampus with special reference to spatial learning and memory and its underlying mechanism in Swiss strain male mice, Mus musculus. Twelve-weeks old mice were exposed to 2.45 GHz MW radiation (continuous-wave [CW] with overall average power density of 0.0248 mW/cm(2) and overall average whole body specific absorption rate value of 0.0146 W/Kg) for 2 h/day over a period of 15, 30, and 60 days). Spatial learning and memory was monitored by Morris Water Maze. We have checked the alterations in hippocampal oxidative/nitrosative stress, neuronal morphology, and expression of pro-apoptotic proteins (p53 and Bax), inactive executioner Caspase- (pro-Caspase-3), and uncleaved Poly (ADP-ribose) polymerase-1 in the hippocampal subfield neuronal and nonneuronal cells (DG, CA1, CA2, and CA3). We observed that, short-term as well as long-term 2.45 GHz MW radiation exposure increases the oxidative/nitrosative stress leading to enhanced apoptosis in hippocampal subfield neuronal and nonneuronal cells. Present findings also suggest that learning and spatial memory deficit which increases with the increased duration of MW exposure (15 stress induced p53-dependent/independent activation of hippocampal neuronal and nonneuronal apoptosis associated with spatial memory loss. © The Author 2015. Published by Oxford University Press on behalf of the Society of Toxicology. All rights reserved. For Permissions, please e-mail: journals.permissions@oup.com.

  10. Two Zinc(II) metal-organic frameworks with mixed ligands of 5-amino-tetrazolate and l,2,4,5-benzenetetracarboxylate: Synthesis, structural diversity and photoluminescent properties

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Xiao-Bing [Department of Chemistry, Shaoguan University, Shaoguan, Guangdong 512005 (China); Lu, Wen-Guan, E-mail: lwg@sgu.edu.cn [Department of Chemistry, Shaoguan University, Shaoguan, Guangdong 512005 (China); Zhong, Di-Chang [School of Chemistry and Chemical Engineering, Gannan Normal University, Ganzhou 341000 (China)

    2017-06-15

    The reactions of Zn(NO{sub 3}){sub 2}·6H{sub 2}O with mixed ligands of 5-amino-tetrazole (Hatz) and l,2,4,5-benzenetetracarboxylic acid (H{sub 4}btec) under hydro(solvo)thermal conditions, gave two three-dimensional (3D) porous metal-organic frameworks (MOFs) of ([Zn{sub 3}(atz){sub 2}(btec)(DMF){sub 2}]·DMF·2H{sub 2}O){sub n} (1) and [Zn{sub 2}(Hprz)(atz)(btec)(H{sub 2}O)]{sub n} (2) in the absence and presence of piperazine (prz), respectively. 1 and 2 were characterized by infrared spectra (IR), elemental analyses (EA) and single-crystal/powder X-ray diffraction. In 1, the adjacent 1D [Zn{sub 3}(btec)]{sub n}{sup 2n+} chains are linked together by atz{sup −} ligands to form a 3D porous MOF with 1D tetragonal channels filled with coordinated and guest DMF, and lattice water molecules. In 2, the adjacent 2D [Zn{sub 2}(btec)]{sub n} wavelike sheets are pillared through atz{sup −} ligands to generate a 3D layered-pillared porous MOF with 1D open channels, which are occupied by coordinated Hprz{sup +} cations and coordinated water molecules. Additionally, thermal stabilities and photoluminescent properties of both compounds in the solid-state at room temperature have been investigated and discussed in detail. - Graphical abstract: Two new MOFs constructed from Zn(II) salts with mixed ligands of 5-amino-tetrazole and l,2,4,5-benzenetetracarboxylic acid were synthesized under different reaction conditions. Structural diversities indicate that the reaction solvent system or the presence of organic base play crucial roles in modulating structures of these compounds. And more, their thermal stability and luminescence are also discussed. - Highlights: • Two new Zn(II) MOFs based on mixed ligands were synthesized. • The two Zn(II) MOFs exhibit different structural motifs. • The two Zn(II) MOFs are photoluminscent in the solid state at room temperature.

  11. 2-[4,5-Difluoro-2-(2-Fluorobenzoylamino)-Benzoylamino]Benzoic Acid, an Antiviral Compound with Activity against Acyclovir-Resistant Isolates of Herpes Simplex Virus Types 1 and 2

    Science.gov (United States)

    Islam, Koushikul; Edlund, Karin; Öberg, Christopher T.; Allard, Annika; Bergström, Tomas; Mei, Ya-Fang; Elofsson, Mikael

    2012-01-01

    Herpes simplex viruses 1 and 2 (HSV-1 and HSV-2) are responsible for lifelong latent infections in humans, with periods of viral reactivation associated with recurring ulcerations in the orofacial and genital tracts. In immunosuppressed patients and neonates, HSV infections are associated with severe morbidity and, in some cases, even mortality. Today, acyclovir is the standard therapy for the management of HSV infections. However, the need for novel antiviral agents is apparent, since HSV isolates resistant to acyclovir therapy are frequently isolated in immunosuppressed patients. In this study, we assessed the anti-HSV activity of the antiadenoviral compounds 2-[2-(2-benzoylamino)-benzoylamino]benzoic acid (benzavir-1) and 2-[4,5-difluoro-2-(2-fluorobenzoylamino)-benzoylamino]benzoic acid (benzavir-2) on HSV-1 and HSV-2. Both compounds were active against both viruses. Importantly, benzavir-2 had potency similar to that of acyclovir against both HSV types, and it was active against clinical acyclovir-resistant HSV isolates. PMID:22908173

  12. Microsatellite-based fine mapping of the Van der Woude syndrome locus to an interval of 4.1 cM between D1S245 and D1S414

    Energy Technology Data Exchange (ETDEWEB)

    Sander, A.; Schmelzle, R. [Univ. of Hamburg (Germany); Murray, J.C. [Univ. of Iowa, Iowa City, IA (United States); Scherpbier-Heddema, T.; Buetow, K.H. [Fox Chase Center, Philadelphia, PA (United States); Weissenbach, J. [Institut Pasteur, Paris (France); Ludwig, K.; Zingg, M.

    1995-01-01

    Van der Woude syndrome (VWS) is an autosomal dominant craniofacial disorder characterized by lip pits, clefting of the primary or secondary palate, and hypodontia. The gene has been localized, by RFLP-based linkage studies, to region 1q32-41 between D1S65-REN and D1S65-TGFB2. In this study we report the linkage analysis of 15 VWS families, using 18 microsatellite markers. Multipoint linkage analysis places the gene, with significant odds of 2,344:1, in a 4.1-cM interval flanked by D1S245 and D1S414. Two-point linkage analysis demonstrates close linkage of VWS with D1S205 (lod score [Z] = 24.41 at {theta} = .00) and with D1S491 (Z = 21.23 at {theta} = .00). The results revise the previous assignment of the VWS locus and show in an integrated map of the region 1q32-42 that the VWS gene resides more distally than previously suggested. When information about heterozygosity of the closely linked marker D1S491 in the affected members of the VWS family with a microdeletion is taken into account, the VWS critical region can be further narrowed, to the 3.6-cM interval between D1S491 and D1S414. 38 refs., 3 figs., 2 tabs.

  13. Monoxenic liquid culture with Escherichia coli of the free-living nematode Panagrolaimus sp. (strain NFS 24-5), a potential live food candidate for marine fish and shrimp larvae.

    Science.gov (United States)

    Ayub, Farhana; Seychelles, Laurent; Strauch, Olaf; Wittke, Martina; Ehlers, Ralf-Udo

    2013-09-01

    The free-living, bacterial-feeding nematode Panagrolaimus sp. (strain NFS 24-5) has potential for use as live food for marine shrimp and fish larvae. Mass production in liquid culture is a prerequisite for its commercial exploitation. Panagrolaimus sp. was propagated in monoxenic liquid culture on Escherichia coli and parameters, like nematode density, population dynamics and biomass were recorded and compared with life history table data. A mean maximum nematode density of 174,278 mL(-1) and a maximum of 251,000 mL(-1) were recorded on day 17 after inoculation. Highest average biomass was 40 g L(-1) at day 13. The comparison with life history table data indicated that the hypothetical potential of liquid culture is much higher than documented during this investigation. Nematode development is delayed in liquid culture and egg production per female is more than five times lower than reported from life history trait analysis. The latter assessed a nematode generation time of 7.1 days, whereas the process time at maximum nematode density in liquid culture was 16 days indicating that a reduction of the process time can be achieved by further investigating the influence of nematode inoculum density on population development. The results challenge future research to reduce process time and variability and improve population dynamics also during scale-up of the liquid culture process.

  14. Effect of continuous-wave and amplitude-modulated 2.45 GHz microwave radiation on the liver and brain aminoacyl-transfer RNA synthetases of in utero exposed mice

    Energy Technology Data Exchange (ETDEWEB)

    Kubinyi, G.; Thuroczy, G.; Bakos, J.; Boeloeni, E.; Sinay, H.; Szabo, L.D. [National Frederic Joliot-Curie Research Inst. for Radiobiology and Radiohygiene, Budapest (Hungary)

    1996-12-31

    Investigations have been carried out concerning the effects of microwave (MW) exposure on the aminoacyl-transfer ribonucleic acid (tRNA) synthetase of the progeny of females that were exposed during their entire period of gestation (19 days). The changes caused by continuous-wave (CW) and amplitude-modulated (AM) MW radiation have been compared. CFLP mice were exposed to MW radiation for 100 min each day in an anechoic room. The MW frequency was 2.45 GHz, and the amplitude modulation had a 50 Hz rectangular waveform (on/off ratio, 50/50%). The average power density exposure was 3 mW/cm{sup 2}, and the whole body specific absorption rate (SAR) was 4.23 {+-} 0.63 W/kg. The weight and mortality of the progeny were followed until postnatal day 24. Aminoacyl-tRNA synthetase enzymes and tRNA from the brains and livers of the offspring (461 exposed, 487 control) were isolated. The aminoacyl-tRNA synthetase activities were determined. The postnatal increase of body weight and organ weight was not influenced by the prenatal MW radiation. The activity of enzyme isolated form the brain showed a significant decrease after CW MW exposure, but the changes were not significant after 50 Hz AM MW exposure. The activity of the enzyme isolated from liver increased under CW and 50 Hz modulated MW.

  15. Charged pion form factor between $Q^2$=0.60 and 2.45 GeV$^2$. I. Measurements of the cross section for the ${^1}$H($e,e'\\pi^+$)$n$ reaction

    CERN Document Server

    Blok, H P; Huber, G M; Beise, E J; Gaskell, D; Mack, D J; Tadevosyan, V; Volmer, J; Abbott, D; Aniol, K; Anklin, H; Armstrong, C; Arrington, J; Assamagan, K; Avery, S; Baker, O K; Barrett, B; Bochna, C; Boeglin, W; Brash, E J; Breuer, H; Chang, C C; Chant, N; Christy, M E; Dunne, J; Eden, T; Ent, R; Fenker, H; Gibson, E; Gilman, R; Gustafsson, K; Hinton, W; Holt, R J; Jackson, H; Jin, S; Jones, M K; Keppel, C E; Kim, P H; Kim, W; King, P M; Klein, A; Koltenuk, D; Kovaltchouk, V; Liang, M; Liu, J; Lolos, G J; Lung, A; Margaziotis, D J; Markowitz, P; Matsumura, A; McKee, D; Meekins, D; Mitchell, J; Miyoshi, T; Mkrtchyan, H; Müller, B; Niculescu, G; Niculescu, I; Okayasu, Y; Pentchev, L; Perdrisat, C; Pitz, D; Potterveld, D; Punjabi, V; Qin, L M; Reimer, P; Reinhold, J; Roche, J; Roos, P G; Sarty, A; Shin, I K; Smith, G R; Stepanyan, S; Tang, L G; Tvaskis, V; Van der Meer, R L J; Vansyoc, K; Van Westrum, D; Vidakovic, S; Vulcan, W; Warren, G; Wood, S A; Xu, C; Yan, C; Zhao, W -X; Zheng, X; Zihlmann, B

    2008-01-01

    Cross sections for the reaction ${^1}$H($e,e'\\pi^+$)$n$ were measured in Hall C at Thomas Jefferson National Accelerator Facility (JLab) using the CEBAF high-intensity, continous electron beam in order to determine the charged pion form factor. Data were taken for central four-momentum transfers ranging from $Q^2$=0.60 to 2.45 GeV$^2$ at an invariant mass of the virtual photon-nucleon system of $W$=1.95 and 2.22 GeV. The measured cross sections were separated into the four structure functions $\\sigma_L$, $\\sigma_T$, $\\sigma_{LT}$, and $\\sigma_{TT}$. The various parts of the experimental setup and the analysis steps are described in detail, including the calibrations and systematic studies, which were needed to obtain high precision results. The different types of systematic uncertainties are also discussed. The results for the separated cross sections as a function of the Mandelstam variable $t$ at the different values of $Q^2$ are presented. Some global features of the data are discussed, and the data are co...

  16. Charged pion form factor between $Q^2$=0.60 and 2.45 GeV$^2$. I. Measurements of the cross section for the ${^1}$H($e,e'\\pi^+$)$n$ reaction.

    Energy Technology Data Exchange (ETDEWEB)

    Blok, Henk; Horn, Tanja; Huber, Garth; Beise, Elizabeth; Gaskell, David; Mack, David; Tadevosyan, Vardan; Volmer, Jochen; Abbott, David; Aniol, Konrad; Anklin, Heinz; Armstrong, Christopher; Arrington, John; Assamagan, Ketevi; Avery, Steven; Baker, O; Barrett, Robert; Bochna, Christopher; Boeglin, Werner; Brash, Edward; Breuer, Herbert; Chang, C; Chang, C C; Chant, Nicholas; Christy, Michael; Dunne, James; Eden, Thomas; Ent, Rolf; Fenker, Howard; Gibson, Edward; Gilman, Ronald; Gustafsson, Kenneth; Hinton, Wendy; Holt, Roy; Jackson, Harold; uk Jin, Seong; Jones, Mark; Keppel, Cynthia; Kim, pyunghun; Kim, Wooyoung; King, Paul; Klein, Andreas; Koltenuk, Douglas; Kovaltchouk, Vitali; Liang, Meihua; Liu, Jinghua; Lolos, George; Lung, Allison; Margaziotis, Demetrius; Markowitz, Pete; Matsumura, Akihiko; McKee, David; Meekins, David; Mitchell, Joseph; Miyoshi, Toshinobu; Mkrtchyan, Hamlet; Mueller, Robert; Niculescu, Gabriel; Niculescu, Maria-Ioana; Okayasu, Yuichi; Pentchev, Lubomir; Perdrisat, Charles; Pitz, David; Potterveld, David; Punjabi, Vina; Qin, Liming; Reimer, Paul; Reinhold, Joerg; Roche, Julie; Roos, Philip; Sarty, Adam; Shin, Ilkyoung; Smith, Gregory; Stepanyan, Stepan; Tang, Liguang; Tvaskis, Vladas; van der Meer, Rob; Vansyoc, Kelley; Van Westrum, Derek; Vidakovic, Sandra; Vulcan, William; Warren, Glen; Wood, Stephen; Xu, C; Yan, Chen; Zhao, Wenxia; Zheng, Xiaochao; Zihlmann, Benedikt

    2008-10-01

    DOI: http://dx.doi.org/10.1103/PhysRevC.78.045202
    Cross sections for the reaction 1H(e,e'pi+)n were measured in Hall C at Thomas Jefferson National Accelerator Facility (JLab) using the high-intensity Continuous Electron Beam Accelerator Facility (CEBAF) to determine the charged pion form factor. Data were taken for central four-momentum transfers ranging from Q2=0.60 to 2.45 GeV2 at an invariant mass of the virtual photon-nucleon system of W=1.95 and 2.22 GeV. The measured cross sections were separated into the four structure functions sigmaL,sigmaT,sigmaLT, and sigmaTT. The various parts of the experimental setup and the analysis steps are described in detail, including the calibrations and systematic studies, which were needed to obtain high-precision results. The different types of systematic uncertainties are also discussed. The results for the separated cross sections as a function of the Mandelstam variable t at the different values of Q2 are presented. Some global featu

  17. Publications | Page 245 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    The CHIP surveys. Many of the young scholars relied on data generated by the China Household... "The good work is collaborative". “The Poverty Research Network is a fair amount of work for everyone –... The network evolves. For the 19 young scholars brought together by the Poverty Research Network, the... Information ...

  18. Publications | Page 245 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Malaria epidemics have occurred in the highlands of western Kenya since the late 1980s, often resulting in high rates of illness and death. ... The combination of poverty-related infectious and lifestyle-related non-communicable diseases, both driven by malnutrition including hidden hunger, causes a high burden for South ...

  19. 32 CFR 245.12 - Amplifying instructions.

    Science.gov (United States)

    2010-07-01

    ... air traffic identification and control procedures to the more restrictive identification and control... successful mission completion. (g) The rules/procedures governing Special Use Airspace (SUA) will remain in...

  20. 245 HUMANISM AND THE LAW: TOWARDS AFRICAN ...

    African Journals Online (AJOL)

    Ike Odimegwu

    technology in the manufacture of biological and nuclear weapons of mass destruction. One can therefore argue that much of western humanism is not integral as it is its “survival- of- the- fittest” motto that partly constitutes the bane of the so- called “third world” countries today. Ethical Life Stance. Humanism is also concerned ...

  1. 8 CFR 245a.1 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... attainment of particular functional skills related to communicative ability, subject matter knowledge, and English language competency, and attainment of these skills is measured either by successful completion of...

  2. 48 CFR 53.245 - Government property.

    Science.gov (United States)

    2010-10-01

    ... property and in accounting for this property: (a) SF 120 (GSA), Report of Excess Personal Property, and SF 120-A (GSA), Continuation Sheet (Report of Excess Personal Property). See 45.602-3 and 41 CFR 102-36.215.) (b) SF 126 (GSA), Report of Personal Property for Sale, and SF 126-A (GSA), Report of Personal...

  3. Reference: 245 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available llison R et al. 2005 Aug. Plant Physiol. 138(4):2097-110. Autophagy is an important mechanism for nonselecti...G8/12 conjugation system is important for survival under nitrogen-limiting growth conditions. By reverse-gen...of this fusion in conjunction with atg mutants now provides an important marker to track autophagic vesicles

  4. 48 CFR 245.7309-4 - Payment.

    Science.gov (United States)

    2010-10-01

    ... Contractor in cash or by certified check, cashier's check, traveler's check, bank draft, or postal or express... reserves the right to apply any bid deposits made under this Invitation by a bidder against any amounts due...

  5. 9 CFR 354.245 - Vermin.

    Science.gov (United States)

    2010-01-01

    ... ORGANIZATION AND TERMINOLOGY; MANDATORY MEAT AND POULTRY PRODUCTS INSPECTION AND VOLUNTARY INSPECTION AND... exclude flies, rats, mice, and other vermin from the official plant. Dogs, cats, and other pets shall be...

  6. TMFunction data: 245 [TMFunction[Archive

    Lifescience Database Archive (English)

    Full Text Available istensen LL, Christensen PA, S?rensen ES, Jacobsen C, Moestrup SK, Etzerodt M, Thog... D999N ... YES Ligand binding(Ca binding) ... Low density lipoprotein receptor Homo sapiens Human Andersen OM, Chr

  7. 32 CFR 245.5 - Terms.

    Science.gov (United States)

    2010-07-01

    ... identification, location, and control of airborne vehicles are required. Air defense liaison officer (ADLO). FAA representative at a North American Aerospace Defense Command (NORAD) air defense facility (NORAD Region or NORAD... that there is an emerging air-related problem or incident within the CONUS. ESCAT air traffic priority...

  8. 8 CFR 245a.19 - Interviews.

    Science.gov (United States)

    2010-01-01

    ... bargaining organizations; medical records; school records maintained by a school or school board; or other... application shall be denied for lack of prosecution. Applications for LIFE Legalization adjustment may be...

  9. 8 CFR 245.1 - Eligibility.

    Science.gov (United States)

    2010-01-01

    ... habeas corpus is granted by a Federal court on judicial review. (iii) Exemptions. This prohibition shall... immigration judge or the Board of Immigration Appeals; (D) A petition for review or an action for habeas corpus is granted by a Federal court on judicial review; (E) The alien has resided outside the United...

  10. Does retirement reduce the risk of mental disorders? A national registry-linkage study of treatment for mental disorders before and after retirement of 245,082 Danish residents.

    Science.gov (United States)

    Olesen, Kasper; Rod, Naja Hulvej; Madsen, Ida E H; Bonde, Jens Peter; Rugulies, Reiner

    2015-05-01

    The effect of retirement on mental health is not well understood. We examined the prevalence of hospital treatment for depression and purchase of antidepressant medication before, during and after retirement in a Danish population sample. We hypothesised that retirement was followed by reduced prevalence of hospital treatment for depression and antidepressant purchase. Participants were 245,082 Danish workers who retired between 2000 and 2006. Information on retirement, hospital treatment and antidepressant purchases were obtained from Danish national registers. The yearly prevalence of hospital treatment for depression and antidepressant purchases was estimated in relation to the year of retirement from 5 years prior to the retirement year to 5 years after retirement. Using logistic regressions with generalised estimating equations we analysed the trends in prevalence before, during and after the retirement. Two of 1000 participants were hospitalised with depression in the year of their retirement and 63 of 1000 purchased antidepressant medication during the retirement year. The prevalence of hospital treatment for depression increased before and around retirement, followed by a slight decline from 2 years after retirement with the prevalence of hospitalisation dropping from 0.21%(retirement +2 years) to 0.16% (retirement +5 years). For antidepressants, we observed a steady increase in purchases before retirement (retirement -2 years). This increase levelled off in the years around retirement, but continued after retirement (retirement +2 years). Overall, this study did not confirm the hypothesis that retirement is beneficial for mental health measured by hospitalisation with depression and treatment with antidepressants. Although the temporary levelling off of the increase in antidepressant treatment around time of retirement might indicate a beneficial effect, this possible effect was only short-term. Published by the BMJ Publishing Group Limited

  11. Structural and Catalytic Differences between Two FADH2-Dependent Monooxygenases: 2,4,5-TCP 4-Monooxygenase (TftD from Burkholderia cepacia AC1100 and 2,4,6-TCP 4-Monooxygenase (TcpA from Cupriavidus necator JMP134

    Directory of Open Access Journals (Sweden)

    ChulHee Kang

    2012-08-01

    Full Text Available 2,4,5-TCP 4-monooxygenase (TftD and 2,4,6-TCP 4-monooxygenase (TcpA have been discovered in the biodegradation of 2,4,5-trichlorophenol (2,4,5-TCP and 2,4,6-trichlorophenol (2,4,6-TCP. TcpA and TftD belong to the reduced flavin adenine dinucleotide (FADH2-dependent monooxygenases and both use 2,4,6-TCP as a substrate; however, the two enzymes produce different end products. TftD catalyzes a typical monooxygenase reaction, while TcpA catalyzes a typical monooxygenase reaction followed by a hydrolytic dechlorination. We have previously reported the 3D structure of TftD and confirmed the catalytic residue, His289. Here we have determined the crystal structure of TcpA and investigated the apparent differences in specificity and catalysis between these two closely related monooxygenases through structural comparison. Our computational docking results suggest that Ala293 in TcpA (Ile292 in TftD is possibly responsible for the differences in substrate specificity between the two monooxygenases. We have also identified that Arg101 in TcpA could provide inductive effects/charge stabilization during hydrolytic dechlorination. The collective information provides a fundamental understanding of the catalytic reaction mechanism and the parameters for substrate specificity. The information may provide guidance for designing bioremediation strategies for polychlorophenols, a major group of environmental pollutants.

  12. A 24.5-Year Global Dataset of Direct Normal Irradiance: Result from the Application of a Global-to-Beam Model to the NASA GEWEX SRB Global Horizontal Irradiance

    Science.gov (United States)

    Zhang, T.; Stackhouse, P. W.; Chandler, W.; Hoell, J. M., Jr.; Westberg, D. J.

    2015-12-01

    The DIRINDEX model has previously been applied to the NASA GEWEX SRB Release 3.0 global horizontal irradiances (GHIs) to derive 3-hourly, daily and monthly mean direct normal irradiances (DNIs) for the period from 2000 to 2005 (http://dx.doi.org/10.1016/j.solener.2014.09.006), though the model was originally designed to estimate hourly DNIs from hourly GHIs. Input to the DIRINDEX model comprised 1.) the 3-hourly all-sky and clear-sky GHIs from the GEWEX SRB dataset; 2.) the surface pressure and the atmospheric column water vapor from the GEOS4 dataset; and 3.) daily mean aerosol optical depth at 700 nm derived from the daily mean aerosol data from the Model of Atmospheric Transport and CHemistry (MATCH). The GEWEX SRB data is spatially available on a quasi-equal-area global grid system consisting of 44016 boxes ranging from 1 degree latitude by 1 degree longitude around the Equator to 1 degree latitude by 120 degree longitude next to the poles. The derived DNIs were on the same grid system. Due to the limited availability of the MATCH aerosol data, the model was applied to the years from 2000 to 2005 only. The results were compared with ground-based measurements from 39 sites of the Baseline Surface Radiation Network (BSRN). The comparison statistics show that the results were in better agreement with their BSRN counterparts than the current Surface meteorology and Solar Energy (SSE) Release 6.0 data (https://eosweb.larc.nasa.gov/sse/). In this paper, we present results from the model over the entire time span of the GEWEX SRB Release 3.0 data (July 1983 to December2007) in which the MERRA atmospheric data were substituted for the GEOS4 data, and the Max-Planck Aerosol Climatology Version 1 (MAC-v1) data for the MATCH data. As a consequence, we derived a 24.5-year DNI dataset of global coverage continuous from July 1983 to December 2007. Comparisons with the BSRN data show that the results are comparable in quality with that from the earlier application.

  13. Neutron Protection Factor Determination and Validation for a Vehicle Surrogate Using a Californium Fission Source

    Science.gov (United States)

    2017-06-01

    a 4 mm x 4 mm (0.157" x 0.157") LiI(Eu) crystal with 96% enrichment of lithium -6. The crystal is connected to a photomultiplier tube (PMT) which...32 Figure 17. Lithium -6 Iodide, Europium Doped Scintillation Detector. Source: [27...Alamos National Laboratory LiI(Eu) Lithium Iodide Europium Doped LLD Low Level Discriminator LLNL Lawrence Livermore National Laboratory MASH Monte

  14. Yeast Interacting Proteins Database: YLR245C, YLR245C [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available in vitro but native RNA substrates have not been identified, localizes to both the nucleus and cytoplasm Row...modification of cytidine to uridine in vitro but native RNA substrates have not been... in vitro but native RNA substrates have not been identified, localizes to both the nucleus and cytoplasm Ro...e; catalyzes the modification of cytidine to uridine in vitro but native RNA substrates have not been identi

  15. 1-Methyl-2-[(E-2,4,5-trimethoxystyryl]pyridinium iodideThis paper is dedicated to the late His Majesty King Chulalongkorn (King Rama V of Thailand for his numerous reforms to modernize the country on the occasion of Chulalongkorn Day (Piyamaharaj Day which fell on the 23rd October.

    Directory of Open Access Journals (Sweden)

    Hoong-Kun Fun

    2010-12-01

    Full Text Available In the title compound, C17H20NO3+·I−, the cation exists in the E configuration. The pyridinium and benzene rings are close to coplanar, with a dihedral angle of 7.43 (12° between them. The three methoxy groups of 2,4,5-trimethoxyphenyl are essentially coplanar with the benzene plane, with C—O—C—C torsion angles of 1.0 (3, −1.9 (3 and 3.6 (3°. A weak intramolecular C—H...O interaction generates an S(6 ring motif. In the crystal, the cations are stacked in columns in an antiparallel manner along the a axis through π–π interactions, with a centroid–centroid distance of 3.7714 (16 Å. The iodide anion is situated between the columns and linked to the cation by a weak C—H...I interaction.

  16. 49 CFR 192.245 - Repair or removal of defects.

    Science.gov (United States)

    2010-10-01

    ... NATURAL AND OTHER GAS BY PIPELINE: MINIMUM FEDERAL SAFETY STANDARDS Welding of Steel in Pipelines § 192... weld must be removed if it has a crack that is more than 8 percent of the weld length. (b) Each weld...) Repair of a crack, or of any defect in a previously repaired area must be in accordance with written weld...

  17. Dicty_cDB: VHB245 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available D460729 |ED460729.1 AUAC-aao05g05.g1 Ascaris suum whole genome shotgun library (PMAJ_4 GSS) Ascaris suum gen...omic, genomic survey sequence. 50 0.11 1 ED450392 |ED450392.1 AUAC-aan56c12.g1 Ascaris... suum whole genome shotgun library (PMAJ_4 GSS) Ascaris suum genomic, genomic survey sequence. 50 0.11 ...1 ED393242 |ED393242.1 AUAC-aai25f10.g1 Ascaris suum whole genome shotgun library (PMAJ_4 GSS) Ascaris suum ...genomic, genomic survey sequence. 50 0.11 1 ED186094 |ED186094.1 AUAC-aah66a04.g1 Ascaris

  18. All projects related to | Page 245 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Topic: SOCIAL BEHAVIOUR, SMOKING, TAXATION, SOCIAL CONTROL, SURVEYS, STATISTICAL ANALYSIS, HEALTH POLICY, POLICY MAKING. Region: Peru, South America, North and Central America. Program: Food, Environment, and Health. Total Funding: CA$ 149,600.00. Development of a New Tobacco Tax ...

  19. Dicty_cDB: VFN245 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available EQQRNDEKEQGLFVGGG GSGMHVHGISFPVDSDASTAVSNFINKKFNYIELSVNVDDEKIIFSSSSNIDIEAISSKI SSTEPSFHFFRYSHQHEGENL...EQQRNDEKEQGLFVGGG GSGMHVHGISFPVDSDASTAVSNFINKKFNYIELSVNVDDEKIIFSSSSNIDIEAISSKI SSTEPSFHFFRYSHQHEGENL

  20. 48 CFR 52.245-1 - Government Property.

    Science.gov (United States)

    2010-10-01

    ... equipment, and real property. Government property does not include intellectual property and software..., damage or destruction cases; physically inventorying all property upon termination or completion of this... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Government Property. 52...

  1. 7 CFR 58.245 - Method of sample analysis.

    Science.gov (United States)

    2010-01-01

    ... Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Standards, Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE (CONTINUED) REGULATIONS AND STANDARDS UNDER THE AGRICULTURAL MARKETING ACT OF 1946 AND THE EGG PRODUCTS INSPECTION ACT (CONTINUED) GRADING AND INSPECTION...

  2. Dicty_cDB: AFG245 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available snygklnlvpslti*ssptlskklkispkrpllptkkpkr kclttskppklkrerkltkn*lpkkllkkkpkklmkkkkkslkki*lklmtkkkksknqp kkli...mtnfkxnk*iikknk*kktr Frame B: fiiisflfnkkeript*dfycv*fs*flfsilhyqqfiskiplitignqdgll

  3. Dicty_cDB: AFH245 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available KEIRTGDVQKQLICSDHNKVLATFHQANAELLKLAVENSMESKAQWESLPFEARSAVFLK AADLLNTKYRYDVLASTMLGQGKTVWQAEIDAAAEGIDFLRFNVKYAQEIYQQQPPANSA...KEIRTGDVQKQLICSDHNKVLATFHQANAELLKLAVENSMESKAQWESLPFEARSAVFLK AADLLNTKYRYDVLASTMLGQGKTVWQAEIDAAAEGIDFLRFNVKYAQEIYQQQPPANSA

  4. 245-IJBCS-Article-Dr Obodai E A

    African Journals Online (AJOL)

    RHUMSIKI

    The study was conducted in the White Volta River at Nawuni to identify the fishing gears used by the fishermen, assess fish species composition and their relative abundance. The results indicated that fishing gears such as gill nets, traps and hook-and-line were used. Most of the net mesh sizes used by the fishermen did ...

  5. 40 CFR 61.245 - Test methods and procedures.

    Science.gov (United States)

    2010-07-01

    ...)) (English units) Ci = Concentration of sample component “i” in ppm, as measured by Method 18 of appendix A... specified in § 61.18). Hi = net heat of combustion of sample component “i” at 25 °C and 760 mm Hg (77 °F and... units) = 28.56 ft/sec (English units) K2 = 0.7084 m4/(MJ-sec) (metric units) = 0.087 ft4/(Btu-sec...

  6. 8 CFR 245a.13 - During pendency of application.

    Science.gov (United States)

    2010-01-01

    ... States submits a prima facie application for adjustment of status under LIFE Legalization during the... inadmissibility, an application for adjustment of status shall be treated as a prima facie application during the... eligible alien who submits a prima facie application for adjustment of status under this Subpart B shall be...

  7. Dicty_cDB: SHH245 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available DQIRKKNMMINKEEKKRNY*nfn* rmvvvvvvekkmiiai*iilmtmkmmnmimmtkmvlmkmifqmqfmmdqilkmk*chqki npkpqrnqll*nlqklllllcsskstt...DQIRKKNMMINKEEKKRNY*nfn* rmvvvvvvekkmiiai*iilmtmkmmnmimmtkmvlmkmifqmqfmmdqilkmk*chqki npkpqrnqll*nlqklllllcsskstt

  8. 32 CFR 245.21 - ESCAT air traffic priority list.

    Science.gov (United States)

    2010-07-01

    ..., interceptors, air refueling tanker aircraft, and airborne early-warning and control aircraft (e.g., E-3, E-2, P-3). (3) Military retaliatory aircraft, including direct tanker support aircraft, executing strategic missions. (4) Airborne command elements which provide backup to command and control systems for the combat...

  9. Dicty_cDB: AFK245 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available NHLIKKE INKVETDQLTHQYTLVISPDNTYKVLVDNKEIQAGNLADDWELLPSKQIKDPKQSKPVDW VDVKEIDDPEDVKPAGHDDIPASIVDPEAAK...NHLIKKE INKVETDQLTHQYTLVISPDNTYKVLVDNKEIQAGNLADDWELLPSKQIKDPKQSKPVDW VDVKEIDDPEDVKPAGHDDIPASIVDPEAAK

  10. 1935 15' Quad #245 Aerial Photo Mosaic Index

    Data.gov (United States)

    Earth Data Analysis Center, University of New Mexico — Aerial Photo Reference Mosaics contain aerial photographs that are retrievable on a frame by frame basis. The inventory contains imagery from various sources that...

  11. Family II. Leptospiraceae Hovind-Hougen 1979, 245AL

    Science.gov (United States)

    Bacteria within the Family Leptospiraceae comprise a diverse group of three bacterial genera, Leptospira, Leptonema, and Turneriella. These bacteria are aerobes that consume long-chain fatty acids and alcohols as carbon and energy sources. Some members of this Family cause serious infections in ani...

  12. 48 CFR 245.7204 - Preparing inventory disposal report.

    Science.gov (United States)

    2010-10-01

    ..., for each completed plant clearance case. For terminated contracts, prepare a consolidated Inventory...-explanatory except: (1) Item 12—Insert net change due to shortages, overages, errors, pricing, or withdrawals...) Item 16—Insert the acquisition cost for all transfers accomplished. For lines 16A and 16B, insert...

  13. 245-IJBCS-Article-Dr Obodai E A

    African Journals Online (AJOL)

    RHUMSIKI

    Keywords: Fishing gear, species composition, live weight, relative abundance, mesh size, fish families. ... importance of fish to coastal countries has ..... Ecology of. Fishes in Tropical Waters. Studies in. Biology No. 76. Edward Arnold Ltd; 62p. National Marine Fisheries Service (NMFS). (1995a). Fisheries of the United States ...

  14. 24 CFR 245.15 - Notice to tenants.

    Science.gov (United States)

    2010-04-01

    ... notice must be served by delivery, except, for a high-rise project, the notice may be served either by delivery or by posting. If service is made by delivery, a copy of the notice must be delivered directly to each unit in the project or mailed to each tenant. If service is made by posting, the notice must be...

  15. (E-4-Chloro-N′-(2,4,5-trifluorobenzylidenebenzohydrazide

    Directory of Open Access Journals (Sweden)

    R. Maheswari

    2016-03-01

    Full Text Available The title compound, C14H8ClF3N2O, is approximately planar, with a dihedral angle of 4.73 (6° between the planes of the chlorophenyl and trifluorobenzylidene rings. In the crystal, molecules are stacked in a column along the b axis through π–π interactions [centroid–centroid distances = 3.7097 (12 and 3.7191 (12 Å].

  16. 48 CFR 1552.245-70 - Government property.

    Science.gov (United States)

    2010-10-01

    ...-related purpose of the property. e. Explanation of negative impact if property is not provided by the... systems with a unit acquisition cost of $25,000 or more. The second line shall include the total... notification and the following language must be displayed on the form: “Note to CO: Reimbursement to the EPA...

  17. 50 CFR 216.245 - Requirements for monitoring and reporting.

    Science.gov (United States)

    2010-10-01

    ... to categorize in any way, the observed behavior of the animals (such as animal closing to bow ride... explosive detonations. The Navy shall provide NMFS with species or description of the animal(s), the condition of the animal(s) (including carcass condition if the animal is dead), location, time of first...

  18. Результаты бактериологических исследований «Оленьих культур» из штаммов B. suis 45 и B. suis 245 в организме морских свинок

    OpenAIRE

    Слепцов, Е.; Искандаров, М.; Винокуров, Н.; Евграфов, Г.; Евграфова, А.

    2013-01-01

    При введении агаровой культуры из «оленьих культур» штаммов B.suis 45 и B.suis 245 в организм морских свинок по результатам бактериологического исследования видно, что штамм 245 обладает высокой степенью антигенности и вирулентности, что является основой для изготовления инактивированной вакцины против бруцеллеза домашних северных оленей....

  19. A retrospective study of californium-252 neutron brachytherapy combined with EBRT versus 3D-CRT in the treatment of esophageal squamous cell cancer.

    Science.gov (United States)

    Wang, Qifeng; Li, Tao; Lang, Jinyi; Wang, Jie; Wang, Jian; Liu, Huiming; Jia, Xitang; Liu, Bo; Wang, C-K Chris

    2015-10-24

    We conducted a retrospective analysis on 884 patients who were diagnosed with esophageal squamous cell carcinoma (ESCC) and treated with either the neutron brachytherapy in combination with external beam radiotherapy (NBT + EBRT) or 3-dimensional conformal radiation therapy (3D-CRT) to determine the differences in efficacy and morbidity between the two treatment groups. The 884 ESCC patients treated with either NBT + EBRT or 3D-CRT between 2002 and 2012 were retrospectively reviewed and analyzed. Multivariable Cox regression was used to compare oncologic outcomes of the two groups of patients in the context of other clinically relevant variables. The acute and chronic toxicities associated with the two groups were compared using Fisher exact and log-rank tests, respectively. Among the 884 patients, 545 received NBT + EBRT and 339 received 3D-CRT (i.e. EBRT-only). The age range is 39-95 years (median 66). The follow-up time range is 3-145 months (median 32). The analysis shows that the NBT + EBRT group has higher overall survival rate and local control rate than that of the 3D-CRT group. The acute toxicity effects were acceptable for both groups of patients with the NBT + EBRT group showing higher rates of leukopenia and thrombocytopenia and the 3D-CRT group showing higher rates on fistula and massive bleeding. The patients treated with NBT + EBRT showed better oncologic outcomes than those treated with 3D-CRT. The toxicity effects were acceptable for both groups with the NBT + EBRT group showing higher rates on the acute effects and the 3D-CRT group showing higher rates on the late effects.

  20. Accurate determination of Curium and Californium isotopic ratios by inductively coupled plasma quadrupole mass spectrometry (ICP-QMS) in 248Cm samples for transmutation studies

    Energy Technology Data Exchange (ETDEWEB)

    Gourgiotis, A.; Isnard, H.; Aubert, M.; Dupont, E.; AlMahamid, I.; Cassette, P.; Panebianco, S.; Letourneau, A.; Chartier, F.; Tian, G.; Rao, L.; Lukens, W.

    2011-02-01

    The French Atomic Energy Commission has carried out several experiments including the mini-INCA (INcineration of Actinides) project for the study of minor-actinide transmutation processes in high intensity thermal neutron fluxes, in view of proposing solutions to reduce the radiotoxicity of long-lived nuclear wastes. In this context, a Cm sample enriched in {sup 248}Cm ({approx}97 %) was irradiated in thermal neutron flux at the High Flux Reactor (HFR) of the Laue-Langevin Institute (ILL). This work describes a quadrupole ICP-MS (ICP-QMS) analytical procedure for precise and accurate isotopic composition determination of Cm before sample irradiation and of Cm and Cf after sample irradiation. The factors that affect the accuracy and reproducibility of isotopic ratio measurements by ICP-QMS, such as peak centre correction, detector dead time, mass bias, abundance sensitivity and hydrides formation, instrumental background, and memory blank were carefully evaluated and corrected. Uncertainties of the isotopic ratios, taking into account internal precision of isotope ratio measurements, peak tailing, and hydrides formations ranged from 0.3% to 1.3%. This uncertainties range is quite acceptable for the nuclear data to be used in transmutation studies.

  1. Radiological Characterization Technical Report on Californium-252 Sealed Source Transuranic Debris Waste for the Off-Site Source Recovery Project at Los Alamos National Laboratory

    Energy Technology Data Exchange (ETDEWEB)

    Feldman, Alexander [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2014-04-24

    This document describes the development and approach for the radiological characterization of Cf-252 sealed sources for shipment to the Waste Isolation Pilot Plant. The report combines information on the nuclear material content of each individual source (mass or activity and date of manufacture) with information and data on the radionuclide distributions within the originating nuclear material. This approach allows for complete and accurate characterization of the waste container without the need to take additional measurements. The radionuclide uncertainties, developed from acceptable knowledge (AK) information regarding the source material, are applied to the summed activities in the drum. The AK information used in the characterization of Cf-252 sealed sources has been qualified by the peer review process, which has been reviewed and accepted by the Environmental Protection Agency.

  2. Metal chloride hydrates as Lewis acid catalysts in multicomponent synthesis of 2,4,5-triarylimidazoles or 2,4,5-triaryloxazoles

    Energy Technology Data Exchange (ETDEWEB)

    Marques, Marcelo V. [Departamento de Engenharia de Processos, Fundacao de Ciencia e Tecnologia, Cachoeirinha, RS (Brazil); Russowsky, Dennis, E-mail: dennis@iq.ufrgs.br [Laboratorio de Sinteses Organicas, Instituto de Quimica, Universidade Federal do Rio Grande do Sul, Porto Alegre-RS (Brazil); Ruthner, Marcelo M.; Fontoura, Luiz A.M. [Curso de Quimica, Universidade Luterana do Brasil, Canoas, RS (Brazil)

    2012-07-01

    A series of nine metal chloride hydrates (ZnCl{sub 2}.2H{sub 2}O, SnCl{sub 2}.2H{sub 2}O, CdCl{sub 2}.2H{sub 2}O, MnCl{sub 2}.4H{sub 2}O, CoCl{sub 2}.6H{sub 2}O, SrCl{sub 2}.6H{sub 2}O, NiCl{sub 2}.6H{sub 2}O, CrCl{sub 3}.6H{sub 2}O and CeCl{sub 3}.7H{sub 2}O) was investigated as mild and inexpensive Lewis acid catalysts to promote the multicomponent synthesis of triarylimidazoles. Reactions starting from benzil showed the best results when SnCl{sub 2}.2H{sub 2}O was used, while for benzoin as the starting material, CeCl{sub 3}.7H{sub 2}O was more efficient. All reactions were performed in EtOH as solvent. These catalysts were also successfully employed in the synthesis of triaryloxazoles. (author)

  3. Report to the DOE nuclear data committee. [EV RANGE 10-100; CROSS SECTIONS; PHOTONEUTRONS; NEUTRONS; GAMMA RADIATION; COUPLED CHANNEL THEORY; DIFFERENTIAL CROSS SECTIONS; MEV RANGE 01-10; ; CAPTURE; GAMMA SPECTRA; THERMAL NEUTRONS; COMPUTER CALCULATIONS; DECAY; FISSION PRODUCTS; FISSION YIELD; SHELL MODELS; NUCLEAR DATA COLLECTIONS

    Energy Technology Data Exchange (ETDEWEB)

    Struble, G.L.; Haight, R.C.

    1981-03-01

    Topics covered include: studies of (n, charged particle) reactions with 14 to 15 MeV neutrons; photoneutron cross sections for /sup 15/N; neutron radiative capture; Lane-model analysis of (p,p) and (n,n) scattering on the even tin isotopes; neutron scattering cross sections for /sup 181/Ta, /sup 197/Au, /sup 209/Bi, /sup 232/Th, and /sup 238/U inferred from proton scattering and charge exchange cross sections; neutron-induced fission cross sections of /sup 245/Cm and /sup 242/Am; fission neutron multiplicities for /sup 245/Cm and /sup 242/Am; the transport of 14 MeV neutrons through heavy materials 150 < A < 208; /sup 249/Cm energy levels from measurement of thermal neutron capture gamma rays; /sup 231/Th energy levels from neutron capture gamma ray and conversion electron spectroscopy; new measurements of conversion electron binding energies in berkelium and californium; nuclear level densities; relative importance of statistical vs. valence neutron capture in the mass-90 region; determination of properties of short-lived fission products; fission yield of /sup 87/Br and /sup 137/I from 15 nuclei ranging from /sup 232/Th to /sup 249/Cf; evaluation of charged particle data for the ECPL library; evaluation of secondary charged-particle energy and angular distributions for ENDL; and evaluated nuclear structure libraries derived from the table of isotopes. (GHT)

  4. 48 CFR 245.7309-2 - Condition and location of property.

    Science.gov (United States)

    2010-10-01

    ... REGULATIONS SYSTEM, DEPARTMENT OF DEFENSE CONTRACT MANAGEMENT GOVERNMENT PROPERTY Sale of Surplus Contractor...) The description is based on the best available information. However, the Contractor makes no warranty...

  5. Amberlyst A-15: Reusable catalyst for the synthesis of 2,4,5 ...

    Indian Academy of Sciences (India)

    reactions decomposition of reactants took place. 2.1 Experimental. A domestic microwave oven (Bajaj, ET-B at ... 47-503/08(WRO), dated 15.01.2009 and thanks are also due to the Principal, Padmashri Vikhe Patil College ... (a) Bartlett M, Shaw M and Smith J W 1992 J. Med. Chem. Chim. Ther. 36 779; (b) Ghudamassi M, ...

  6. 47 CFR 24.245 - Reimbursement under the Cost-Sharing Plan.

    Science.gov (United States)

    2010-10-01

    ... should be based on the actual cost of replacing the incumbent's system with comparable facilities and... pays a microwave incumbent a monetary sum to relocate its own facilities, the PCS relocator must...

  7. G.J. Joubert Suid-Afrikaanse Wolraad,Privaatsak X245, Pretoria

    African Journals Online (AJOL)

    Waar ons pas die Nasionale Wolskaapveldtog van stapel gestuur het in 'n poging om ons wolboere en potensiele wolboere aan te moedig om, deur beter bestuurspraktyke, meer wol (en dus ook goeie skaap- vleis) te produseer met deeglike inagneming van die beperkinge van ons natuurlike hulpbronne, is dit gepas.

  8. Effect of axial magnetic field on a 2.45 GHz permanent magnet ECR ion source

    Energy Technology Data Exchange (ETDEWEB)

    Nakamura, T., E-mail: tsubasa@oshima-k.ac.jp; Wada, H.; Furuse, M. [National Institute of Technology, Oshima College, 1091-1 Komatsu, Suouoshima, Oshima, Yamaguchi 742-2193 (Japan); Asaji, T. [National Institute of Technology, Toyama College, 13 Hongo, Toyama 939-8630 (Japan)

    2016-02-15

    Herein, we conduct a fundamental study to improve the generation efficiency of a multi-charged ion source using argon. A magnetic field of our electron cyclotron resonance ion source is composed of a permanent magnet and a solenoid coil. Thereby, the axial magnetic field in the chamber can be tuned. Using the solenoid coil, we varied the magnetic field strength in the plasma chamber and measured the ion beam current extracted at the electrode. We observed an approximately three times increase in the Ar{sup 4+} ion beam current when the magnetic field on the extractor-electrode side of the chamber was weakened. From our results, we can confirm that the multi-charged ion beam current changes depending on magnetic field intensity in the plasma chamber.

  9. Yeast Interacting Proteins Database: YPL070W, YLR245C [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available YPL070W MUK1 Cytoplasmic protein of unknown function containing a Vps9 domain; computational... name MUK1 Bait description Cytoplasmic protein of unknown function containing a Vps9 domain; computationa

  10. Reported Disposal of 2,4,5-T on Ottawa National Wildlife Refuge

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — In March, 1986 Mr. Dornbusch supplied us with an old sample of the herbicide that he thought was buried. He said he had taken some of the material home before the...

  11. 32 CFR 245.11 - General description of the ESCAT plan.

    Science.gov (United States)

    2010-07-01

    ... procedures to identify and control air traffic within a specified air defense area during air defense... control jurisdiction by international agreement—Commander, U.S. Pacific Command (USPACOM) or designated... control of both civil and military air traffic. It is intended to meet threat situations such as: (1) An...

  12. short communication one-pot synthesis of 2,4,5-trisubstituted

    African Journals Online (AJOL)

    Imidazole derivatives are an important class of heterocycles because of their applications in chemical processes and ..... Shen, M.; Cai, C.; Yi, W. Ytterbium perfluorooctanesulfonate as an efficient and recoverable catalyst for the synthesis of trisubstituted imidazoles. J. Fluorine Chem. 2008,. 129, 541-544. 11. Sharma, S.D. ...

  13. Gas spectroscopy system with 245 GHz transmitter and receiver in SiGe BiCMOS

    Science.gov (United States)

    Schmalz, Klaus; Rothbart, Nick; Borngräber, Johannes; Yilmaz, Selahattin Berk; Kissinger, Dietmar; Hübers, Heinz-Wilhelm

    2017-02-01

    The implementation of an integrated mm-wave transmitter (TX) and receiver (RX) in SiGe BiCMOS or CMOS technology offers a path towards a compact and low-cost system for gas spectroscopy. Previously, we have demonstrated TXs and RXs for spectroscopy at 238 -252 GHz and 495 - 497 GHz using external phase-locked loops (PLLs) with signal generators for the reference frequency ramps. Here, we present a more compact system by using two external fractional-N PLLs allowing frequency ramps for the TX and RX, and for TX with superimposed frequency shift keying (FSK) or reference frequency modulation realized by a direct digital synthesizer (DDS) or an arbitrary waveform generator. The 1.9 m folded gas absorption cell, the vacuum pumps, as well as the TX and RX are placed on a portable breadboard with dimensions of 75 cm x 45 cm. The system performance is evaluated by high-resolution absorption spectra of gaseous methanol at 13 Pa for 241 - 242 GHz. The 2f (second harmonic) content of the absorption spectrum of the methanol was obtained by detecting the IF power of RX using a diode power sensor connected to a lock-in amplifier. The reference frequency modulation reveals a higher SNR (signal-noise-ratio) of 98 within 32 s acquisition compared to 66 for FSK. The setup allows for jumping to preselected frequency regions according to the spectral signature thus reducing the acquisition time by up to one order of magnitude.

  14. 7 CFR 245.9 - Special assistance certification and reimbursement alternatives.

    Science.gov (United States)

    2010-01-01

    ... when the claims review suggests the likelihood of lunch count problems. When a school elects to operate... and economic planning office; unemployment data; local Food Stamp Program certification data including... measure whether the income level of the school's population, as adjusted for inflation, has remained...

  15. 29 CFR 779.245 - Conditions for coverage of retail or service enterprises.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 3 2010-07-01 2010-07-01 false Conditions for coverage of retail or service enterprises... service enterprises. (a) Retail or service enterprises may be covered under section 3(s)(1) of the prior Act or section 3(s)(1) of the amended Act although the latter is not limited to retail or service...

  16. 8 CFR 245a.5 - Temporary disqualification of certain newly legalized aliens from receiving benefits from...

    Science.gov (United States)

    2010-01-01

    ...) of Public Law 96-422, as in effect on April 1, 1983), or in the case of assistance (other than aid to..., wages, loan, loan guarantees, or otherwise, which is furnished by the Federal Government directly, or... Department of Education: Patricia Roberts Harris Fellowships (Graduate and Professional Study; Graduate and...

  17. Yeast Interacting Proteins Database: YLR291C, YLR245C [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available by phosphorylated eIF2; first identified as a negative regulator of GCN4 expression Rows with this bait...by phosphorylated eIF2; first identified as a negative regulator of GCN4 expression Rows with this bait

  18. 26 CFR 1.245-1 - Dividends received from certain foreign corporations.

    Science.gov (United States)

    2010-04-01

    ... holding company as defined in section 552) which is subject to taxation under chapter 1 of the Code if... personal holding company as defined in section 552) which is subject to taxation under Chapter 1 of the... group of corporations to elect multiple surtax exemptions, is effective for either the taxable year of...

  19. Electrostatic Vibration Energy Harvester Pre-charged Wirelessly at 2.45 GHz

    Science.gov (United States)

    Saddi, Z.; Takhedmit, H.; Karami, A.; Basset, P.; Cirio, L.

    2016-11-01

    This paper reports the design, fabrication and experiments of an electrostatic vibration harvester (e-VEH), pre-charged wirelessly for the first time by using an electromagnetic waves harvester at 2.4 GHz. The rectenna uses the Cockcroft-Walton voltage doubler rectifier. It is designed and optimized to operate at low power densities and provides high voltage levels: 0.5 V at 0.5 μW/cm2 and 0.8 V at 1 μW/cm2 The e-VEH uses the Bennet doubler as conditioning circuit. Experiments show 23 V voltage across the transducer terminal when the harvester is excited at 25 Hz by 1.5 g of external acceleration. An accumulated energy of 275 μJ and a maximum power of 0.4 μW are available for the load.

  20. 8 CFR 245a.18 - Ineligibility and applicability of grounds of inadmissibility.

    Science.gov (United States)

    2010-01-01

    ..., religion, nationality, membership in a particular social group, or political opinion is ineligible for... individual aliens for humanitarian purposes, to ensure family unity, or when the granting of such a waiver is... aged, blind, or disabled individual (as defined in section 1614(a)(1) of the Social Security Act). If a...

  1. : tous les projets | Page 245 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Sujet: WATER RESOURCES, WATER MANAGEMENT, WATER SUPPLY, Climate change, ADAPTATION TO CHANGE, URBAN AREAS. Région: Burkina Faso, North of Sahara, South of Sahara. Programme: ... un élément clé de toute résolution juste et durable du conflit israélo-palestinien. Date de début : 31 mars 2011.

  2. Article Synthesis and Trypanocidal Activity of Novel 2,4,5-Triaryl-N-Hydroxylimidazole Derivatives

    Directory of Open Access Journals (Sweden)

    Edson Ferreira da Silva

    2013-03-01

    Full Text Available Herein, we report the design, synthesis and trypanocidal activity of some novel trisubstituted imidazole derivatives. These heterocyclic derivatives were structurally planned by exploring the concept of molecular hybridisation between two arylhydrazones derived from megazol, which has potent trypanocidal activity. The trypanocidal activity of these triarylimidazole derivatives was evaluated against infective trypomastigote forms of T. cruzi and the derivative 2'-(4-bromophenyl-1-methyl-5'-phenyl-1H,3'H-2,4'-biimidazol-3'-ol showed moderate biological activity (IC50 = 23.9 µM when compared to benznidazole, a standard trypanocidal drug. These compounds did not present cytotoxic effects at concentrations near the trypanocidal IC50, being considered a good starting point for the development of new anti-Chagas drug candidates.

  3. Helicopter spraying with 2,4,5-T to release young white pines

    Science.gov (United States)

    Thomas W. McConkey

    1958-01-01

    When forest fires swept over southwestern Maine in 1947, some 130,000 acres of forest land were burned over. This was mostly white pine land--sites too poor to grow good hardwood stands. After the fire, white pine reproduction became established on 5,000 to 6,000 acres of this land. But by 1954 most of the young pine was suppressed or at least was in competition with...

  4. 40 CFR 1068.245 - What temporary provisions address hardship due to unusual circumstances?

    Science.gov (United States)

    2010-07-01

    ... CONTROL INFORMATION”. (2) Your corporate name and trademark. (3) Engine displacement (in liters or cubic... PROTECTION AGENCY (CONTINUED) AIR POLLUTION CONTROLS GENERAL COMPLIANCE PROVISIONS FOR ENGINE PROGRAMS...? (a) After considering the circumstances, we may permit you to introduce into U.S. commerce engines...

  5. Space-Time Uncertainty and Cosmology: a Proposed Quantum Model of the Universe [ 245Kb

    Directory of Open Access Journals (Sweden)

    Tosto S.

    2013-10-01

    Full Text Available The paper introduces a cosmological model of the quantum universe. The aim of the model is (i to identify the possible mechanism that governs the matter/antimatter ratio existing in the universe and concurrently to propose (ii a reasonable growth mechanism of the universe and (iii a possible explanation of the dark energy. The concept of timespace uncertainty, on which is based the present quantum approach, has been proven able to bridge quantum mechanics and relativity.

  6. EPA Method 245.1: Determination of Mercury in Water by Cold Vapor Atomic Absorption Spectrometry

    Science.gov (United States)

    SAM lists this method for preparation and analysis of aqueous liquid and drinking water samples. This method will determine mercuric chloride and methoxyethylmercuric acetate as total mercury using cold vapor atomic absorption spectrometry.

  7. Short-duration exposure to 2.45 GHz microwave radiation induces ...

    African Journals Online (AJOL)

    OBEMBE

    . (control), 0.48, 0.95, 1.43, 1.91, ... with single cell gel electrophoresis (SCGE) comet assay for same cells at SAR 2.39 Wkg-1. Potential damage at the ... Panagopoulos et al., 2010) and plants (Roux et al., 2008;. Tkalec et al., 2009; Vian et al., ...

  8. Page 1 Polycrystalline silicon and ZnO ceramic . - 245 Figure 2. a ...

    Indian Academy of Sciences (India)

    This decreases the free carrier density in the bulk polysilicon and creates a space charge (or depletion) layer on both sides of a grain boundary (in one- dimensional model). The space charge layer in turn results in the creation of potential barrier at the GB. The nature of the potential barrier is such that it opposes the flow of.

  9. Histopathological analysis of 2,4,5-trinitrobenzene sulphonic acid (TNBS-induced mouse colitis

    Directory of Open Access Journals (Sweden)

    Kang-Ho Choi

    2016-09-01

    Full Text Available Ulcerative colitis is one of the chronic diseases that results in inflammation of colon in humans. In this Visual experiment we demonstrate the histopathology of TNBS induced colitis model of mouse. The experiment involves following steps: a Selection of mouse model, b Induction of colitis, c Paraffin sectioning of colon tissue, d Hematoxylin and Eosin staining, and d Microscopic observation.

  10. Antibacterial activity of synthesized 2,4,5-trisubstituted imidazole derivatives

    Digital Repository Service at National Institute of Oceanography (India)

    Khan, M.S.; Siddiqui, S.A.; Siddiqui, M.S.R.A.; Goswami, U.; Srinivasan, K.V.; Khan, M.I.

    different bacteria. These compounds showed variation in activity and were found to be active against Gram-positive as well as Gram-negative bacteria. Compound 4-(4,5-diphenyl-1H-imidazol-2-yl)-phenol, 3d was the only compound which showed activity against...

  11. Antennas for over-body-surface communication at 2.45 GHz

    NARCIS (Netherlands)

    Conway, G.A.; Scanlon, W.G.

    Modeling of on-body propagation channels is of paramount importance to those wishing to evaluate radio channel performance for wearable devices in body area networks (BANs). Difficulties in modeling arise due to the highly variable channel conditions related to changes in the user's state and local

  12. Education and Conflict in Haiti: Rebuilding the Education Sector after the 2010 Earthquake. Special Report 245

    Science.gov (United States)

    Luzincourt, Ketty; Gulbrandson, Jennifer

    2010-01-01

    In Haiti, education both promotes and ameliorates conflict. This report describes the education sector before the 2010 earthquake, then presents recommendations on how Haiti and the international community can increase access to and the quality of Haitian schools and modernize the organization and function of the national education sector.…

  13. 48 CFR 1652.245-70 - Government property (negotiated benefits contracts).

    Science.gov (United States)

    2010-10-01

    ... OF PERSONNEL MANAGEMENT FEDERAL EMPLOYEES HEALTH BENEFITS ACQUISITION REGULATION CLAUSES AND FORMS... acceptable to the Contracting Officer, inventory schedules covering all items of Government property... Carrier shall prepare for shipment, deliver f.o.b. origin, or dispose of the Government property as may be...

  14. 8 CFR 245a.3 - Application for adjustment from temporary to permanent resident status.

    Science.gov (United States)

    2010-01-01

    ... applicant unable to acquire the four language skills of speaking, understanding, reading, and writing... basic citizenship skills may be demonstrated for purposes of complying with paragraph (b)(4)(i)(A) of... California State Department of Education with the Comprehensive Adult Student Assessment System (CASAS). The...

  15. (E-4-Methoxy-N′-(2,4,5-trifluorobenzylidenebenzohydrazide monohydrate

    Directory of Open Access Journals (Sweden)

    R. Maheswari

    2016-05-01

    Full Text Available The title Schiff base compound, C15H11F3N2O2·H2O, crystallized as a monohydrate. The conformation about the C=N bond is E. The molecule is almost planar, with the dihedral angle between the planes of the methoxybenzene and trifluorobenzylidene rings being 7.46 (6°. In the crystal, molecules are linked by bifurcated Owater—H...(O,N hydrogen bonds and N—H...Owater and Owater—H...O and C—H...O hydrogen bonds, forming chains along [100]. The chains are linked by C—H...Owater hydrogen bonds, forming slabs parallel to the bc plane. Within the slabs there are offset π–π interactions present [intercentroid distance = 3.7883 (7 Å].

  16. Sanitary Norms of the Design of Industrial Enterprises. SN 245-71.

    Science.gov (United States)

    1979-07-09

    processing/treatment of natural resins and their residue/remainders (coal-tar pitch, etc.). 7. production calcined soda using ammonium soda process in...small content of volatile hydrocarbons. QOC 79069402 PAGE 2. Enterprises for yield of rocks of VI-VII category: dolomite , magnesite, asbestos, *ars...quantity of more than 150,000 t/yr. 2. Production of magnesite, dolomite and fireclay vith firing in shaft, rotary and other kilns. Class II. Sanitary

  17. Multicellular algae from lower Proterozoic (2.45 Ga) weathering crusts of the Kola Peninsula

    Science.gov (United States)

    Astafieva, Marina M.; Rozanov, Alexei Y.; Hoover, Richard B.

    2011-10-01

    Microbiological analysis of several cold-preserved tissue samples from the Siberian baby mammoth known as Lyuba revealed a number of culturable bacterial strains that were grown on anaerobic media at 3 oC. Lactic acid produced by LAB (lactic acid bacteria) group, usually by members of the genera Carnobacterium and Lactosphera, appears to be a wonderful preservative that keeps other bacteria from colonizing a system. Permafrost and lactic acid preserved the body of this one month-old baby mammoth and kept it in exceptionally good condition, resulting in this mammoth being the most complete sample of the species ever recovered. The diversity of novel psychrophilic anaerobic isolates was expressed on morphological, physiological and phylogenetic levels. Here, we discuss the specifics of the isolation of new psychrophilic strains, differentiation from trivial contamination, and preliminary results for characterization of the cultures

  18. Design of a seismic energy dissipator for an interruptor type 3AS2-45; Diseno de un disipador de energia sismica para un interruptor tipo 3AS2-45

    Energy Technology Data Exchange (ETDEWEB)

    Castro Felix, Jaime

    2004-02-15

    With the aid of the theory behind seismically isolated structures and the bi-linear behavior of an isolated system of Multiple Degrees of Freedom (MDOF), the information obtained on the spectral analysis is complemented with the purpose of simulating one itself for the design of a dissipator of seismic energy. The seismicity in the world is briefly explained, (in Mexico in special for the Geothermal Field of Cerro Prieto), the types of earthquakes, etc., to give way to a documentation of the state-of-the-art in advanced seismic resistant systems and to a procedure to establish the level of seismic qualification of electrical equipment from the level of seismic performance for the Mexican Republic. [Spanish] Con la ayuda de la teoria detras de estructuras aisladas sismicamente y el comportamiento bilineal de un sistema de aislamiento de Multiples Grados de Libertad (MDOF), se complementa la informacion recabada sobre el analisis espectral con el fin de simular uno propio para el diseno de un disipador de energia sismica. Se explica brevemente la sismicidad en el mundo, en Mexico, en especial el Campo Geotermico de Cerro Prieto, los tipos de sismos, etc., para dar paso a una documentacion del estado del arte en sistemas sismorresistentes avanzados y a un procedimiento para establecer el nivel de calificacion sismica de equipos electricos a partir del Nivel de desempeno sismico para la Republica Mexicana.

  19. Phylogeny, resistome and mobile genetic elements of emergent OXA-48 and OXA-245 Klebsiella pneumoniae clones circulating in Spain

    NARCIS (Netherlands)

    Perez-Vazquez, Maria; Oteo, Jesus; Garcia-Cobos, Silvia; Aracil, Belen; Harris, Simon R.; Ortega, Adriana; Fontanals, Dionisia; Manuel Hernandez, Juan; Solis, Sonia; Campos, Jose; Dougan, Gordon; Kingsley, Robert A.

    The global emergence of OXA-48-producing Klebsiella pneumoniae clones is a significant threat to public health. We used WGS and phylogenetic analysis of Spanish isolates to investigate the population structure of bla(OXA-48-like)-expressing K. pneumoniae ST11 and ST405 and to determine the

  20. Phylogeny, resistome and mobile genetic elements of emergent OXA-48 and OXA-245 Klebsiella pneumoniae clones circulating in Spain

    Science.gov (United States)

    Pérez-Vázquez, María; Oteo, Jesús; García-Cobos, Silvia; Aracil, Belén; Harris, Simon R.; Ortega, Adriana; Fontanals, Dionisia; Hernández, Juan Manuel; Solís, Sonia; Campos, José; Dougan, Gordon; Kingsley, Robert A.

    2016-01-01

    Objectives The global emergence of OXA-48-producing Klebsiella pneumoniae clones is a significant threat to public health. We used WGS and phylogenetic analysis of Spanish isolates to investigate the population structure of blaOXA-48-like-expressing K. pneumoniae ST11 and ST405 and to determine the distribution of resistance genes and plasmids encoding blaOXA-48-like carbapenemases. Methods SNPs identified in whole-genome sequences were used to reconstruct phylogenetic trees, identify resistance determinants and de novo assemble the genomes of 105 blaOXA-48-like-expressing K. pneumoniae isolates. Results Genome variation was generally lower in outbreak-associated isolates compared with those associated with sporadic infections. The relatively limited variation observed within the outbreak-associated isolates was on average 7–10 SNPs per outbreak. Of 24 isolates from suspected sporadic infections, 7 were very closely related to isolates causing hospital outbreaks and 17 were more diverse and therefore probably true sporadic cases. On average, 14 resistance genes were identified per isolate. The 17 ST405 isolates from sporadic cases of infection had four distinct resistance gene profiles, while the resistance gene profile differed in all ST11 isolates from sporadic cases. Sequence analysis of 94 IncL/M plasmids carrying blaOXA-48-like genes revealed an average of two SNP differences, indicating a conserved plasmid clade. Conclusions Whole-genome sequence analysis enabled the discrimination of outbreak and sporadic isolates. Significant inter-regional spread within Spain of highly related isolates was evident for both ST11 and ST405 K. pneumoniae. IncL/M plasmids carrying blaOXA-48-like carbapenemase genes were highly conserved geographically and across the outbreaks, sporadic cases and clones. PMID:26769896

  1. SU-E-T-245: MR Guided Focused Ultrasound Increased PARP Related Apoptosis On Prostate Cancer in Vivo

    Energy Technology Data Exchange (ETDEWEB)

    Chen, L; Chen, X; Cvetkovic, D; Gupta, R; Yang, D; Ma, C [Fox Chase Cancer Center, Philadelphia, PA (United States)

    2014-06-01

    Purpose: Our previous study demonstrated that significant tumor growth delay was observed in the mice treated with pulsed high intensity focused ultrasound (pHIFU). The purpose of this study is to understand the cell killing mechanisms of pHIFU. Methods: Prostate cancer cells (LNCaP), were grown orthotopically in 17 nude mice. Tumor-bearing mice were treated using pHIFU with an acoustic power of 25W, pulse width 100msec and 300 pulses in one sonication under MR guidance. Mutiple sonications were used to cover the whole tumor volume. Temperature (less than 40 degree centigrade in the focal spot) was monitored using MR thermometry. Animals were euthanized at pre-determined time points (n=2) after treatment: 0 hours; 6 hrs; 24 hrs; 48 hrs; 4 days and 7 days. Two tumorbearing mice were used as control. Three tumor-bearing mice were treated with radiation (RT, 2 Gy) using 6 MV photon beams. RT treated mice were euthanized at 0 hr, 6 hrs and 24 hrs. The tumors were processed for immunohistochemical (IHC) staining for PARP (a surrogate of apoptosis). A multispectral imaging analysis system was used to quantify the expression of PARP staining. Cell apoptosis was calculated based on the PARP expression level, which is the intensity of the DAB reaction. Results: Our data showed that PARP related apoptosis peaked at 48 hrs and 7 days in pHIFU treated mice, which is comparable to that for the RT group at 24 hrs. The preliminary results from this study were consistent with our previous study on tumor growth delay using pHIFU. Conclusion: Our results demonstrated that non-thermal pHIFU increased apoptotic tumor cell death through the PARP related pathway. MR guided pHIFU may have a great potential as a safe, noninvasive treatment modality for cancer therapy. This treatment modality might be able to synergize with PARP inhibitors to achieve better result.

  2. 8 CFR 245.7 - Adjustment of status of certain Soviet and Indochinese parolees under the Foreign Operations...

    Science.gov (United States)

    2010-01-01

    ... Indochinese parolees under the Foreign Operations Appropriations Act for Fiscal Year 1990 (Pub. L. 101-167... certain Soviet and Indochinese parolees under the Foreign Operations Appropriations Act for Fiscal Year...)(2) of this section. (f) No offset in number of visas available. When an alien is granted the status...

  3. The Characteristics of Columniform Surface Wave Plasma Excited Around a Quartz Rod by 2.45 GHz Microwaves

    Science.gov (United States)

    Wu, Zhonghang; Liang, Rongqing; Nagatsu, Masaaki; Chang, Xijiang

    2016-10-01

    A novel surface wave plasma (SWP) source excited with cylindrical Teflon waveguide has been developed in our previous work. The plasma characteristics have been simply studied. In this work, our experimental device has been significantly improved by replacing the Teflon waveguide with a quartz rod, and then better microwave coupling and higher gas purity can be obtained during plasma discharge. The plasma spatial distributions, both in radial and axial directions, have been measured and the effect of gas pressure has been investigated. Plasma density profiles indicate that this plasma source can produce uniform plasma in an axial direction at low pressure, which shows its potential in plasma processing on a curved surface such as an inner tube wall. A simplified circular waveguide model has been used to explain the principle of plasma excitation. The distinguishing features and potential application of this kind of plasma source with a hardware improvement have been shown. supported in part by National Natural Science of Foundation of China (Nos. 11005021, 51177017 and 11175049), the Grants-in-Aid for Scientific Research of Japan Society for the Promotion of Science (No. 21110010) and the Fudan University Excellent Doctoral Research Program (985 project) and the Ph.D Programs Foundation of Ministry of Education of China (No. 20120071110031)

  4. SU-F-T-245: The Investigation of Failure Mode and Effects Analysis and PDCA for the Radiotherapy Risk Reduction

    Energy Technology Data Exchange (ETDEWEB)

    Xie, J; Wang, J; P, J; Chen, J; Hu, W [Fudan University Shanghai Cancer Center, Shanghai, Shanghai (China)

    2016-06-15

    Purpose: To optimize the clinical processes of radiotherapy and to reduce the radiotherapy risks by implementing the powerful risk management tools of failure mode and effects analysis(FMEA) and PDCA(plan-do-check-act). Methods: A multidiciplinary QA(Quality Assurance) team from our department consisting of oncologists, physicists, dosimetrists, therapists and administrator was established and an entire workflow QA process management using FMEA and PDCA tools was implemented for the whole treatment process. After the primary process tree was created, the failure modes and Risk priority numbers(RPNs) were determined by each member, and then the RPNs were averaged after team discussion. Results: 3 of 9 failure modes with RPN above 100 in the practice were identified in the first PDCA cycle, which were further analyzed to investigate the RPNs: including of patient registration error, prescription error and treating wrong patient. New process controls reduced the occurrence, or detectability scores from the top 3 failure modes. Two important corrective actions reduced the highest RPNs from 300 to 50, and the error rate of radiotherapy decreased remarkably. Conclusion: FMEA and PDCA are helpful in identifying potential problems in the radiotherapy process, which was proven to improve the safety, quality and efficiency of radiation therapy in our department. The implementation of the FMEA approach may improve the understanding of the overall process of radiotherapy while may identify potential flaws in the whole process. Further more, repeating the PDCA cycle can bring us closer to the goal: higher safety and accuracy radiotherapy.

  5. 8 CFR 245.15 - Adjustment of status of certain Haitian nationals under the Haitian Refugee Immigrant Fairness...

    Science.gov (United States)

    2010-01-01

    ... other contact that the applicant knows to be contained or reflected in Service records. (3) Evidence....13(d) of this chapter. Nothing in this section shall preclude an applicant for adjustment of status... eligibility for adjustment of status under section 902 of HRIFA. During such proceedings, all parties are...

  6. 7 CFR 245.6 - Application, eligibility and certification of children for free and reduced price meals and free...

    Science.gov (United States)

    2010-01-01

    ... that its children are eligible for free or reduced price meals or for free milk. Nothing in this... eligible for free and reduced price meals or free milk to any party without parental notification and.... Program operators may include contractors, to the extent those persons have a need to know the information...

  7. Pulse pressure monitoring through non-contact cardiac motion detection using 2.45 GHz microwave Doppler radar.

    Science.gov (United States)

    Singh, Aditya; Lubecke, Victor; Boric-Lubecke, Olga

    2011-01-01

    The use of a Continuous Wave (CW) quadrature Doppler radar is proposed here for continuous non-invasive Pulse Pressure monitoring. A correspondence between the variation in systemic pulse and variation in the displacement of the chest due to heart is demonstrated, establishing feasibility for the approach. Arctangent demodulation technique was used to process baseband data from radar measurements on two test subjects, in order to determine the absolute cardiac motion. An Omron digital Blood pressure cuff was used to measure the systolic and diastolic blood pressures from which the pulse pressure was calculated. Correlation between pulse pressure and cardiac motion was observed through changes induced due to different postures of the body.

  8. 8 CFR 245.20 - Adjustment of status of Syrian asylees under Public Law 106-378.

    Science.gov (United States)

    2010-01-01

    ... apply to adjust status under Public Law 106-378 if the alien is: (1) A Jewish national of Syria; (2... applicant is the spouse of a principal alien applying for adjustment, he or she must submit a marriage certificate, if available, or other evidence to demonstrate the marriage; and (5) If the applicant is the...

  9. Design and Implementation of 2.45 GHz Passive SAW Temperature Sensors with BPSK Coded RFID Configuration

    Directory of Open Access Journals (Sweden)

    Chen Fu

    2017-08-01

    Full Text Available A surface acoustic wave based passive temperature sensor capable of multiple access is investigated. Binary Phase Shift Keying (BPSK codes of eight chips were implemented using a reflective delay line scheme on a Y-Z LiNbO3 piezoelectric substrate. An accurate simulation based on the combined finite- and boundary element method (FEM/BEM was performed in order to determine the optimum design parameters. The scaling factor ‘s’ and time delay factor ‘τ’ were extracted using signal processing techniques based on the wavelet transform of the correlation function, and then evaluated at various ambient temperatures. The scaling factor ‘s’ gave a more stable and reliable response to temperature than the time delay factor ‘τ’. Preliminary results show that the sensor response is fast and consistent subject to ambient temperature and it exhibits good linearity of 0.9992 with temperature varying from 0 to 130 °C.

  10. Design and Implementation of 2.45 GHz Passive SAW Temperature Sensors with BPSK Coded RFID Configuration.

    Science.gov (United States)

    Fu, Chen; Ke, Yabing; Li, Min; Luo, Jingting; Li, Honglang; Liang, Guangxing; Fan, Ping

    2017-08-10

    A surface acoustic wave based passive temperature sensor capable of multiple access is investigated. Binary Phase Shift Keying (BPSK) codes of eight chips were implemented using a reflective delay line scheme on a Y-Z LiNbO₃ piezoelectric substrate. An accurate simulation based on the combined finite- and boundary element method (FEM/BEM) was performed in order to determine the optimum design parameters. The scaling factor 's' and time delay factor 'τ' were extracted using signal processing techniques based on the wavelet transform of the correlation function, and then evaluated at various ambient temperatures. The scaling factor 's' gave a more stable and reliable response to temperature than the time delay factor 'τ'. Preliminary results show that the sensor response is fast and consistent subject to ambient temperature and it exhibits good linearity of 0.9992 with temperature varying from 0 to 130 °C.

  11. 8 CFR 245.3 - Adjustment of status under section 13 of the Act of September 11, 1957, as amended.

    Science.gov (United States)

    2010-01-01

    ..., any alien who is prima facie eligible for adjustment of status to that of a lawful permanent resident... Act who performed diplomatic or semi-diplomatic duties and to their immediate families, and who... residence would be in the national interest. Aliens whose duties were of a custodial, clerical, or menial...

  12. Income, Poverty, and Health Insurance Coverage in the United States: 2012. Current Population Reports P60-245

    Science.gov (United States)

    DeNavas-Walt, Carmen; Proctor, Bernadette D.; Smith, Jessica C.

    2013-01-01

    This report presents data on income, poverty, and health insurance coverage in the United States based on information collected in the 2013 and earlier Current Population Survey Annual Social and Economic Supplements (CPS ASEC) conducted by the U.S. Census Bureau. For most groups, the 2012 income, poverty, and health insurance estimates were not…

  13. (E)-4-Meth-oxy-N'-(2,4,5-tri-meth-oxy-benzyl-idene)benzohydrazide hemihydrate.

    Science.gov (United States)

    Chantrapromma, Suchada; Boonnak, Nawong; Horkaew, Jirapa; Quah, Ching Kheng; Fun, Hoong-Kun

    2014-02-01

    The title compound crystallizes as a hemihydrate, C18H20N2O5·0.5H2O. The mol-ecule exists in an E conformation with respect to the C=N imine bond. The 4-meth-oxy-phenyl unit is disordered over two sets of sites with a refined occupancy ratio of 0.54 (2):0.46 (2). The dihedral angles between the benzene rings are 29.20 (9) and 26.59 (9)°, respectively, for the major and minor components of the 4-meth-oxy-substituted ring. All meth-oxy substituents lie close to the plane of the attached benzene rings [the Cmeth-yl-O-C-C torsion angles range from -4.0 (12) to 3.9 (2)°]. In the crystal, the components are linked into chains propagating along [001] via N-H⋯O and O-H⋯O hydrogen bonds and weak C-H⋯O inter-actions.

  14. 8 CFR 245a.4 - Adjustment to lawful resident status of certain nationals of countries for which extended...

    Science.gov (United States)

    2010-01-01

    ...) (narcotics) except for a single offense of simple possession of thirty grams or less of marijuana; (C... whose appeal period has ended is no longer considered to be an Eligible Legalized Alien for the purposes...

  15. SU-E-T-245: Detection of the Photon Target Damage in Varian Linac Based On Periodical Quality Assurance Measurements

    Energy Technology Data Exchange (ETDEWEB)

    Gao, S; Balter, P; Wang, X; Sadagopan, R; Pollard, J [UT MD Anderson Cancer Center, Houston, TX (United States)

    2015-06-15

    Purpose: To determine the best dosimetric metric measured by our routine QA devices for diagnosing photon target failure on a Varian C-series linac. Methods: We have retrospectively reviewed and analyzed the dosimetry data from a Varian linac with a target degradation that was undiagnosed for one year. A failure in the daily QA symmetry tests was the first indication of an issue. The beam was steered back to a symmetric shape and water scans indicated the beam energy had changed but stayed within the manufacturer’s specifications and agreed reasonably with our treatment planning system data. After the problem was identified and the target was replaced, we retrospectively analyzed our QA data including diagonals normalized flatness (F-DN) from the daily device (DQA3), profiles from an ionization chamber array (IC Profiler), as well as profiles and PDDs from a 3D water Scanner (3DS). These metrics were cross-compared to determine which was the best early indicator of target degradation. Results: A 3% change in FDN measured by the DQA3 was found to be an early indicator of target degradation. It is more sensitive than changes in output, symmetry, flatness or PDD. All beam shape metrics (flatness at dmax and 10 cm depth, and F-DN) indicated an energy increase while the PDD indicated an energy decrease. This disagreement between the beam-shape based energy metrics (F-DN and flatness) and PDD based energy metric may indicate target failure as opposed to an energy change resulting from changes in the incident electron energy. Conclusion: Photon target degradation has been identified as a failure mode for linacs. The manufacturer’s test for this condition is highly invasive and requires machine down time. We have demonstrated that the condition could be caught early based upon data acquired during routine QA activities, such as the F-DN.

  16. Monte Carlo modeling and analyses of YALINA-booster subcritical assembly part 1: analytical models and main neutronics parameters.

    Energy Technology Data Exchange (ETDEWEB)

    Talamo, A.; Gohar, M. Y. A.; Nuclear Engineering Division

    2008-09-11

    This study was carried out to model and analyze the YALINA-Booster facility, of the Joint Institute for Power and Nuclear Research of Belarus, with the long term objective of advancing the utilization of accelerator driven systems for the incineration of nuclear waste. The YALINA-Booster facility is a subcritical assembly, driven by an external neutron source, which has been constructed to study the neutron physics and to develop and refine methodologies to control the operation of accelerator driven systems. The external neutron source consists of Californium-252 spontaneous fission neutrons, 2.45 MeV neutrons from Deuterium-Deuterium reactions, or 14.1 MeV neutrons from Deuterium-Tritium reactions. In the latter two cases a deuteron beam is used to generate the neutrons. This study is a part of the collaborative activity between Argonne National Laboratory (ANL) of USA and the Joint Institute for Power and Nuclear Research of Belarus. In addition, the International Atomic Energy Agency (IAEA) has a coordinated research project benchmarking and comparing the results of different numerical codes with the experimental data available from the YALINA-Booster facility and ANL has a leading role coordinating the IAEA activity. The YALINA-Booster facility has been modeled according to the benchmark specifications defined for the IAEA activity without any geometrical homogenization using the Monte Carlo codes MONK and MCNP/MCNPX/MCB. The MONK model perfectly matches the MCNP one. The computational analyses have been extended through the MCB code, which is an extension of the MCNP code with burnup capability because of its additional feature for analyzing source driven multiplying assemblies. The main neutronics parameters of the YALINA-Booster facility were calculated using these computer codes with different nuclear data libraries based on ENDF/B-VI-0, -6, JEF-2.2, and JEF-3.1.

  17. CCDC 782643: Experimental Crystal Structure Determination : tetrakis(mu~2~-4,5-imidazoledicarboxylato)-tetrakis(1,2-propanediamine)-tetra-cobalt octacosahydrate

    KAUST Repository

    Wang, Shuang

    2011-01-01

    An entry from the Cambridge Structural Database, the world’s repository for small molecule crystal structures. The entry contains experimental data from a crystal diffraction study. The deposited dataset for this entry is freely available from the CCDC and typically includes 3D coordinates, cell parameters, space group, experimental conditions and quality measures.

  18. Contribución a la caracterización espacial de canales con sistemas MIMO-OFDM en la banda de 2,45 Ghz

    OpenAIRE

    Mora Cuevas, Jonathan

    2015-01-01

    La tecnología de múltiples antenas ha evolucionado para dar soporte a los actuales y futuros sistemas de comunicaciones inalámbricas en su afán por proporcionar la calidad de señal y las altas tasas de transmisión que demandan los nuevos servicios de voz, datos y multimedia. Sin embargo, es fundamental comprender las características espaciales del canal radio, ya que son las características del propio canal lo que limita en gran medida las prestaciones de los sistemas de comunicación actuales...

  19. 4-[(E-(2,4,5-Trimethoxybenzylideneamino]-1,5-dimethyl-2-phenyl-1H-pyrazol-3(2H-one

    Directory of Open Access Journals (Sweden)

    Hoong-Kun Fun

    2010-07-01

    Full Text Available The title compound, C21H23N3O4, adopts an E configuration about the central C=N double bond and the pyrazolone ring is almost planar, with a maximum deviation of 0.042 (1 Å. The central pyrazolone ring makes dihedral angles of 51.96 (5 and 3.82 (5° with the attached phenyl and the trimethoxy-substituted benzene rings, respectively. The dihedral angle between the phenyl ring and the trimethoxy-substituted benzene ring is 50.19 (5° and an intramolecular C—H...O hydrogen bond generates an S(6 ring motif. The crystal structure is stabilized by intermolecular C—H...O and C—H...N hydrogen bonds.

  20. 8 CFR 245.13 - Adjustment of status of certain nationals of Nicaragua and Cuba under Public Law 105-100.

    Science.gov (United States)

    2010-01-01

    ... under other provisions of the law. Nothing in this section shall be deemed to allow any alien who is in... applicant sought on his or her own behalf, or some other party sought on the applicant's behalf, a benefit... dates of such correspondence or other contact that the applicant knows to be contained or reflected in...

  1. Quaternary shortening in the central Puna Plateau of NW Argentina: Preliminary results from the Salar de Pocitos, Salta province (24.5° S, 67° W)

    Science.gov (United States)

    Freymark, Jessica; Strecker, Manfred R.; Bookhagen, Bodo; Bekeschus, Benjamin; Eckelmann, Felix; Alonso, Ricardo

    2013-04-01

    Active tectonism in Cenozoic orogenic plateaus is often characterized by a combination of active extensional and strike-slip faulting subsequent to protracted phases of shortening and the build-up of high topography. In the Puna Plateau of NW Argentina, the southern part of the world's second largest orogenic plateau, the changeover from shortening to extensional tectonics is thought to have occured between 7 and 5 Ma along the southeastern plateau margin, while the central and northern plateau areas apparently changed into an extensional regime between 9 and 6 Ma (Cladouhos et al., 1994). Despite these observations of extensional structures we report on new data from the Salar de Pocitos that show sustained shortening in the south-central part of the plateau. The south-central Puna Plateau is characterized by an average elevation of about 3700 m with low relief and internally drained basins, which are bordered by reverse-fault bounded ranges. The N-S oriented Salar de Pocitos is an integral part of these contractional structures and covers an area of ~435 km². The western border of the basin constitutes the eastern flank of an anticline involving Tertiary and Quaternary sediments, while the eastern border is delimited by a N-S striking reverse fault, bounding the range front of the Sierra Qda. Honda. In the north of the Salar de Pocitos the three Miocene volcanoes Tultul, Delmedio and Pocitos form a barrier with the Salar del Rincón, and the south of the basin is bordered by fault blocks involving Ordovician lithologies that have left only a narrow valley that may have provided an outlet of the basin in the past. Multiple terraces generated during Late Pleistocene and Holocene lake highstands straddle the Pocitos Basin and serve as excellent strain markers to assess neotectonic deformation. We surveyed the terraces along N-S and E-W transects using a differential GPS. The E-W surveys are perpendicular to the structures that bound the basin and record differential basin-wide deformation. Although it is not possible yet to develop a reliable terrace chronology, taken together, the western terraces are higher than possibly equivalent terraces in the east, suggesting ongoing tilting related to protracted folding of the anticline in the west. In addition, orientations of faults, joints and tilted deposits were measured and analyzed. We show (preliminary) results and interpretations of these measurements. Tilted volcanic ash and sediment deposits have different dips and it appears that a distinct deformation stage is related to the regional anticline west of the Salar. A tectonic joint system and various small reverse faults also indicate active shortening in the area of the Salar de Pocitos from the Tertiary to the present-day. Reference: Cladouhos, T.T.; Allmendinger, R.W.; Coira, B. and Farrar, E. (1994): Late Cenozoic deformation in the Central Andes: fault kinematics from the northern Puna, northwestern Argentina and southwestern Bolivia (Journal of South American Earth Sciences, Vol. 7, No. 2., pp. 209-228)

  2. The effects of 2.45 GHz radio frequency energy on neurological tissue genes using an unrestrained murine model in vivo

    Science.gov (United States)

    Stevens, Brandon William

    The effects that radio frequency (RF) energy has on the body is currently an inconclusive and controversial topic. This is in part due to the differences and issues that can be found in previous studies. This thesis describes a study on the effect of continuous RF energy on the genome of in vivo mouse brain tissue for a duration of 31 days. To address the issues found in previous studies a new standardized procedure was followed. The genome of the brain tissue was quantified using RNA-seq and then analyzed using statistical combinations and empirical p-values. Transcripts with their respective p-values were uploaded into Integrity Pathway Analysis® to determine genes associated disease and function within the brain tissue. The results from this study provided evidence that supports RF energy induces changes in the genome. Additionally, the results provided evidence of the first reported case of a potential RF-controlled genetic transistor.

  3. Coupled Simulation-Measurements Platform for the Evaluation of Frequency Reuse in the 2.45 GHz ISM Band for Multimode Nodes with Multiple Antennas

    Directory of Open Access Journals (Sweden)

    Verdier Jacques

    2010-01-01

    Full Text Available We address the problem of efficiently evaluating performance of concurrent radio links on overlapped channels. In complex network topologies with various standards and frequency channels, simulating a realistic PHY layer communication is a key point. The presented coupled simulation-measurement platform offers a very promising way of rapidly modelling and validating effective performance of multimode, multichannel and multiantenna radio nodes. An accurate analysis of radio channel is performed and then realistic performance with or without antenna processing is shown, verifying theoretical performance. Finally, available performance of concurrent communications on overlapped channels is exposed, showing that this approach is viable to enhance network capacity.

  4. Simulation and Experimental Studies of a 2.45GHz Magnetron Source for an SRF Cavity with Field Amplitude and Phase Controls

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Haipeng [Thomas Jefferson National Accelerator Facility (TJNAF), Newport News, VA (United States); Plawski, Tomasz E. [Thomas Jefferson National Accelerator Facility (TJNAF), Newport News, VA (United States); Rimmer, Robert A. [Thomas Jefferson National Accelerator Facility (TJNAF), Newport News, VA (United States); Dudas, A. [Muons Inc., Batavia, IL (United States); Neubauer, M. L. [Muons Inc., Batavia, IL (United States)

    2016-06-01

    Phase lock to an SRF cavity by using injection signal through output waveguide of a magnetron has been demonstrated [1, 3]. Amplitude control using magnetic field trimming and anode voltage modulation has been studied using MATLAB/Simulink simulations [2]. Based on these, we are planning to use an FPGA based digital LLRF system, which allows applying various types of control algorithms in order to achieve the required accelerating field stability. Since the 1497 MHz magnetron is still in the design stage, the proof of principle measurements of a commercial 2450 MHz magnetron are carried out to characterize the anode I-V curve, output power (the tube electronic efficiency), frequency dependence on the anode current (frequency pushing) and the Rieke diagram (frequency pulling by the reactive load). Based on early Simulink simulation, experimental data and extension of the Adler equation governing injection phase stability by Chen’s model, the specification of the new LLRF control chassis for both 2450 and 1497MHz systems are presented in this paper.

  5. Charged pion form factor between Q^2=0.60 and 2.45 GeV^2. II. Determination of, and results for, the pion form factor

    CERN Document Server

    Huber, G M; Horn, T; Beise, E J; Gaskell, D; Mack, D J; Tadevosyan, V; Volmer, J; Abbott, D; Aniol, K; Anklin, H; Armstrong, C; Arrington, J; Assamagan, K; Avery, S; Baker, O K; Barrett, B; Bochna, C; Boeglin, W; Brash, E J; Breuer, H; Chang, C C; Chant, N; Christy, M E; Dunne, J; Eden, T; Ent, R; Gibson, E; Gilman, R; Gustafsson, K; Hinton, W; Holt, R J; Jackson, H; Jin, S; Jones, M K; Keppel, C E; Kim, P H; Kim, W; King, P M; Klein, A; Koltenuk, D; Kovaltchouk, V; Kiang, M; Liu, J; Lolos, G J; Lung, A; Margaziotis, D J; Markowitz, P; Matsumura, A; McKee, D; Meekins, D; Mitchell, J; Miyoshi, T; Mkrtchyan, H; Müller, B; Niculescu, G; Niculescu, I; Okayasu, Y; Pentchev, L; Perdrisat, C; Pitz, D; Potterveld, D; Punjabi, V; Qin, L M; Reimer, P; Reinhold, J; Roche, J; Roos, P G; Sarty, A; Shin, I K; Smith, G R; Stepanyan, S; Tang, L G; Tvaskis, V; Van der Meer, R L J; Vansyoc, K; Van Westrum, D; Vidakovic, S; Vulcan, W; Warren, G; Wood, S A; Xu, C; Yan, C; Zhao, W -X; Zheng, X; Zihlmann, B

    2008-01-01

    The charged pion form factor, Fpi(Q^2), is an important quantity which can be used to advance our knowledge of hadronic structure. However, the extraction of Fpi from data requires a model of the 1H(e,e'pi+)n reaction, and thus is inherently model dependent. Therefore, a detailed description of the extraction of the charged pion form factor from electroproduction data obtained recently at Jefferson Lab is presented, with particular focus given to the dominant uncertainties in this procedure. Results for Fpi are presented for Q^2=0.60-2.45 GeV^2. Above Q^2=1.5 GeV^2, the Fpi values are systematically below the monopole parameterization that describes the low Q^2 data used to determine the pion charge radius. The pion form factor can be calculated in a wide variety of theoretical approaches, and the experimental results are compared to a number of calculations. This comparison is helpful in understanding the role of soft versus hard contributions to hadronic structure in the intermediate Q^2 regime.

  6. Corrigendum to "Geant4 validation of neutron production on thick targets bombarded with 120 GeV protons" [Nucl. Instr. Meth. B 358 (2015) 245-250

    Science.gov (United States)

    Sabra, Mohammad S.

    2016-09-01

    In the paper by Mohammad S. Sabra, due to a mixup, wrong calculations for NEPR ratios, normalized to 20 cm-thick copper, for 40 cm and 60 cm-thick copper at 30° for QGSP-BIC, QGSP-BERT, QGSP-INCLXX, and SHIELDING were published in Table 2. The correct values are listed in the revised Table 2 as below.

  7. Investigation of an experimental ejector refrigeration machine operating with refrigerant R245fa at design and off-design working conditions. Part 1. Theoretical analysis

    KAUST Repository

    Shestopalov, K.O.

    2015-07-01

    © 2015 Elsevier Ltd and IIR.All rights reserved. The ejector refrigeration machine (ERM) offers several advantages over other heat-driven refrigeration machine, including simplicity in design and operation, high reliability and low installation cost, which enable its wide application in the production of cooling. In this paper the theoretical analysis of ejector design and ejector refrigeration cycle performance is presented. It is shown that ERM performance characteristics depend strongly on the operating conditions, the efficiency of the ejector used, and the thermodynamic properties of the refrigerant used. A 1-D model for the prediction of the entrainment ratio ω, and an optimal design for ejectors with cylindrical and conical-cylindrical mixing chambers are presented in this paper. In order to increase ERM performance values, it is necessary first of all to improve the performance of the ejector.

  8. Charged pion form factor between $Q^2$=0.60 and 2.45 GeV$^2$. II. Determination of, and results for, the pion form factor

    Energy Technology Data Exchange (ETDEWEB)

    Huber, Garth; Blok, Henk; Horn, Tanja; Beise, Elizabeth; Gaskell, David; Mack, David; Tadevosyan, Vardan; Volmer, Jochen; Abbott, David; Aniol, Konrad; Anklin, Heinz; Armstrong, Christopher; Arrington, John; Assamagan, Ketevi; Avery, Steven; Baker, O.; Barrett, Robert; Bochna, Christopher; Boeglin, Werner; Brash, Edward; Breuer, Herbert; Chang, C.; Chang, C.C.; Chant, Nicholas; Christy, Michael; Dunne, James; Eden, Thomas; Ent, Rolf; Fenker, Benjamin; Gibson, Edward; Gilman, Ronald; Gustafsson, Kenneth; Hinton, Wendy; Holt, Roy; Jackson, Harold; uk Jin, Seong; Jones, Mark; Keppel, Cynthia; Kim, pyunghun; Kim, Wooyoung; King, Paul; Klein, Andreas; Koltenuk, Douglas; Kovaltchouk, Vitali; Liang, Meihua; Liu, Jinghua; Lolos, George; Lung, Allison; Margaziotis, Demetrius; Markowitz, Pete; Matsumura, Akihiko; McKee, David; Meekins, David; Mitchell, Joseph; Miyoshi, Toshinobu; Mkrtchyan, Hamlet; Mueller, Robert; Niculescu, Gabriel; Niculescu, Maria-Ioana; Okayasu, Yuichi; Pentchev, Lubomir; Perdrisat, Charles; Pitz, David; Potterveld, David; Punjabi, Vina; Qin, Liming; Reimer, Paul; Reinhold, Joerg; Roche, Julie; Roos, Philip; Sarty, Adam; Shin, Ilkyoung; Smith, Gregory; Stepanyan, Stepan; Tang, Liguang; Tvaskis, Vladas; van der Meer, Rob; Vansyoc, Kelley; Van Westrum, Derek; Vidakovic, Sandra; Vulcan, William; Warren, Glen; Wood, Stephen; Xu, Chen; Yan, Chen; Zhao, Wenxia; Zheng, Xiaochao; Zihlmann, Benedikt

    2008-10-01

    DOI: http://dx.doi.org/10.1103/PhysRevC.78.045203
    The charged pion form factor, Fpi(Q2), is an important quantity that can be used to advance our knowledge of hadronic structure. However, the extraction of Fpi from data requires a model of the 1H(e,e'pi+)n reaction and thus is inherently model dependent. Therefore, a detailed description of the extraction of the charged pion form factor from electroproduction data obtained recently at Jefferson Lab is presented, with particular focus given to the dominant uncertainties in this procedure. Results for Fpi are presented for Q2=0.60-2.45 GeV2. Above Q2=1.5 GeV2, the Fpi values are systematically below the monopole parametrization that describes the low Q2 data used to determine the pion charge radius. The pion form factor can be calculated in a wide variety of theoretical approaches, and the experimental results are compared to a number of calculations. This comparison is helpful in understanding the role of soft versus hard c

  9. Production and action pattern of inulinase from Aspergillus Niger-245: hydrolysis of inulin from several sources Produção e mecanismo de ação de inulinase de Aspergillus niger-245: hidrólise de inulinas de diferentes origens

    Directory of Open Access Journals (Sweden)

    Vinícius D’Arcadia Cruz

    1998-10-01

    Full Text Available A strain of Aspergillus niger isolated from soil samples showed great capacity to produce extracellular inulinase. Although the enzyme has been synthesized in presence of monosaccharides, sucrose and sugar cane molasse, the productivity was significantly higher (pUma linhagem de Aspergillus niger isolada de amostras de solo mostrou grande capacidade de produzir inulinase extracelular. Embora a enzima tenha sido sintetizada na presença de monossacarídeos, sacarose e melaço de cana, a produtividade foi significativamente maior (p<0.01 quando o microrganismo foi inoculado em meios formulados com extrato de dália e inulina pura, como fontes de carbono. Em relação à fonte de nitrogênio, os melhores resultados foram obtidos com caseína e outras fontes de nitrogênio proteico, comparativamente ao nitrogênio mineral. Entretanto, somente foi encontrada significância (p<0.01 entre a produtividade obtida nos meios preparados com caseína e sulfato de amônia. O pH ótimo da enzima purificada foi localizado entre 4.0 e 4.5 e a temperatura ótima a 60ºC. Quando tratada por 30 minutos nesta temperatura nenhuma perda de atividade foi observada. A enzima mostrou capacidade de hidrolisar sacarose, rafinose e inulina, da qual liberou apenas unidades de frutose, mostrando, portanto, um mecanismo de exo-ação. Atuando sobre inulinas de diversas fontes, a enzima mostrou maior velocidade de hidrólise sobre o polissacarídeo da chicória, comparativamente, às inulinas de raízes de dalia e alcachofra.

  10. Effect of electromagnetic fields at 2.45 GHz on the levels of cellular stress proteins HSP-90 and 70 in the rat thyroid; Efecto de los campos electromagneticos a 2,45 GHz sobre los niveles de proteinas de estres celular HSP-90 y 70 en el toroides de rata

    Energy Technology Data Exchange (ETDEWEB)

    Misa Agustino, M. J.; Alvarez-Folgueras, M.; Jorge-Mora, M. T.; Jorge Barreiro, F. J.; Ares Pena, F. J.; Lleiro, J.; Lopez Martin, M. E.

    2011-07-01

    In this study we analyzed the cellular stress levels achieved by heat shock proteins (HSP) 90 and 70 in rat thyroid tissue after exposure to radio waves in TWG experimental system. Parallel measurements of body stress in animals by rectal temperature probes allow us to determine whether there is any interaction between temperature increases and cellular stress.

  11. Polinização por Apis mellifera em soja transgênica [Glycine max (L. Merrill] Roundup Ready™ cv. BRS 245 RR e convencional cv. BRS 133 = Pollination by Apis mellifera in transgenic soy (Glycine max (L. Merrill Roundup Ready™ cv. BRS 245 RR and conventional cv. BRS 133

    Directory of Open Access Journals (Sweden)

    Tais da Silva Lopes

    2008-04-01

    Full Text Available O objetivo deste estudo foi verificar a influência de Apis mellifera na produção de grãos e qualidade de sementes da soja transgênica Glycine max (L. Merrill Roundup Ready™ e convencional. A soja transgênica foi plantada intercalada com a convencional, em 18 parcelas, em três tratamentos: gaiolas com abelhas A. mellifera, gaiolas sem abelhas e áreas descobertas, com livre visitação de insetos. Na soja transgênica, em três parcelas de cada tratamento, foi aplicado glifosato, 30 dias após a emergência. Os parâmetros analisados foram: produção de grãos; número de vagens por planta; peso de 100 sementes e porcentagem de germinação das sementes. Não houve diferença entre as cultivares, entretanto a produção de 2.757,40 kg ha-1 obtida na área coberta por gaiola com abelhas, e2.828,47 kg ha-1 na área livre para visitação de insetos foram superiores a 2.000,53 kg ha-1 da área coberta por gaiola sem abelhas. O número de vagens por planta foi maior na área coberta por gaiola com abelhas (38,28 e área livre (32,65, quando comparado com o daárea coberta por gaiola sem abelhas (21,19. O peso médio de 100 sementes e a germinação das sementes não foram diferentes entre as cultivares e nem entre os tratamentos. Concluise que, para as cultivares estudadas, houve benefício na produção de grãos de 37,84%,quando foi permitida a visita de abelhas.This research was carried out to evaluate the influence of Africanized honeybees in grain production and seed quality of Glycine max (L. Merrill Roundup Ready™ transgenic soy, as well as of conventional soy. Transgenic soy was interposed with conventional soybean, in 18 plots and three treatments: covered area with Africanized honeybees, covered area without honeybees, and uncovered area with free insect visitation. The herbicide Glyphosate was applied on three plots of each treatment of transgenic soy, 30 days after emergence. Grain production, number of pods/plant, weight per 100 seeds, and seed germination percentage were evaluated. There was no difference among cultivars; however, the production in the covered area with honeybees (2757.4 kg ha-1 and in the uncovered area (2828.47 kg ha-1 were higher than in the covered area without honeybees (2000.53 kg ha-1. The number of pods/plant was greater than in the covered area with honeybees (38.28 and in the uncovered area (32.65 as compared to the covered area without honeybees (21.19. The weight per 100 seeds seed germination did not differ among cultivars or treatments. It can be concluded that, for these cultivars, there was a rise in grain production of 37.84% when honeybee visits were allowed.

  12. CCDC 782644: Experimental Crystal Structure Determination : tetrakis(mu~2~-4,5-imidazoledicarboxylato)-tetrakis(1,2-propanediamine)-tetra-indium tri-potassium trinitrate acetonitrile solvate hydrate

    KAUST Repository

    Wang, Shuang

    2011-01-01

    An entry from the Cambridge Structural Database, the world’s repository for small molecule crystal structures. The entry contains experimental data from a crystal diffraction study. The deposited dataset for this entry is freely available from the CCDC and typically includes 3D coordinates, cell parameters, space group, experimental conditions and quality measures.

  13. Multibeam collection for TN245: Multibeam data collected aboard Thomas G. Thompson from 2009-12-14 to 2010-01-09, departing from Seattle, WA and returning to Punta Arenas, Chile

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set is part of a larger set of data called the Multibeam Bathymetry Database (MBBDB) where other similar data can be found at...

  14. Manuel Pérez, Los cuentos del predicador. Historias y ficciones para la reforma de costumbres en la Nueva España, Madrid, Frankfurt am Main, Mexico D.F., Universidad de Navarra, Iberoamericana, Vervuert, 2011, 245

    OpenAIRE

    Argouse, Aude

    2012-01-01

    Pláticas, sermones, panegíricos, ejemplares forman parte, entre otros, de los documentos más utilizados para conocer los mecanismos de cristianización de los pueblos de América. Más allá del proceso de evangelización, las escrituras misionales permiten explorar con detalle la percepción del mundo que se desplegaba en las sociedades de la monarquía hispano-católica. Al igual que cualquier actividad de escritura pública, la actuación escrituraria de los curas y misioneros convoca por lo tanto a...

  15. Evaluation of the Protective Role of Vitamin C on the Metabolic and Enzymatic Activities of the Liver in the Male Rats After Exposure to 2.45 GHz Of Wi-Fi Routers

    OpenAIRE

    Shekoohi-Shooli F.; Mortazavi S. M. J.; Shojaei-fard M. B.; Nematollahi S.; Tayebi M.

    2016-01-01

    Background: The use of devices emitted microwave radiation such as mobile phones, wireless fidelity (Wi-Fi) routers, etc. is increased rapidly. It has caused a great concern; the researchers should identify its effects on people’s health. We evaluated the protective role of Vitamin C on the metabolic and enzymatic activities of the liver after exposure to Wi-Fi routers. Material and Methods: 70 male Wistar rats weighing 200-250 g were randomly divided into 7 groups (10 rats in each group).The...

  16. Evaluation of the Protective Role of Vitamin C on the Metabolic and Enzymatic Activities of the Liver in the Male Rats After Exposure to 2.45 GHz Of Wi-Fi Routers.

    Science.gov (United States)

    Shekoohi-Shooli, F; Mortazavi, S M J; Shojaei-Fard, M B; Nematollahi, S; Tayebi, M

    2016-09-01

    The use of devices emitted microwave radiation such as mobile phones, wireless fidelity (Wi-Fi) routers, etc. is increased rapidly. It has caused a great concern; the researchers should identify its effects on people's health. We evaluated the protective role of Vitamin C on the metabolic and enzymatic activities of the liver after exposure to Wi-Fi routers. 70 male Wistar rats weighing 200-250 g were randomly divided into 7 groups (10 rats in each group).The first stage one -day test: Group A (received vitamin C 250 mg/kg/day orally together with 8- hour/day Wi-Fi exposure).Group B (exposed to Wi-Fi radiation). Group C (received vitamin C). Group D or Control (was neither exposed to radiation of Wi-Fi modem nor did receive vitamin C). The second phase of experiment had done for five consecutive days. It involved Group E (received vitamin C), Group F (exposed to Wi-Fi radiation), Group G (received vitamin C together with Wi-Fi radiation). The distance between animals' restrainers was 20 cm away from the router antenna. Finally, blood samples were collected and assayed the level of hepatic enzymes including alkaline phosphatase(ALP), alanine amino transferase(ALT) aspartate amino transferase (ASL), gamma glutamyl transferase (GGT) and the concentration of Blood Glucose, Cholesterol , Triglyceride(TG),High density lipoprotein (HDL)and low density lipoprotein (LDL). Data obtained from the One day test showed an increase in concentration of blood glucose, decrease in Triglyceride level and GGT factor (PWiFi exposure may exert alternations on the metabolic parameters and hepatic enzymes activities through stress oxidative and increasing of free radicals, but the use of vitamin C protects them from changing induced. Also taking optimum dose of vitamin C is essential for radioprotective effect and maintaining optimum health.

  17. Urich Rebstock, unter Mitarbeit von Tobias Mayer, Maurische Literaturgeschichte, I-III, Würzburg, Ergon Verlag. Dr. H.-J. Dietrich, 2001, 17,5x24,5, XLVII+1788 p.

    Directory of Open Access Journals (Sweden)

    Claude Gilliot

    2011-08-01

    Full Text Available L’idée d’un « Brockelmann mauritanien », pour reprendre l’expression de Gernot Rotter (d’après U.R., I, p. XI, professeur à l’Université de Hambourg, organisateur de ce projet de recherche, malgré les difficultés de l’entreprise, est désormais incarnée dans la réalité. En effet, l’Institut oriental de l’Université de Fribourg en Brisgau (Orientalisches Seminar der Freiburger Albert-Ludwigs-Universität dispose d’une banque de données unique sur la «littérature maure». U. Rebstock, professeur...

  18. A Review of the Literature on Social and Emotional Learning for Students Ages 3-8: Characteristics of Effective Social and Emotional Learning Programs (Part 1 of 4). REL 2017-245

    Science.gov (United States)

    O'Conner, Rosemarie; De Feyter, Jessica; Carr, Alyssa; Luo, Jia Lisa; Romm, Helen

    2017-01-01

    Social and emotional learning (SEL) is the process by which children and adults learn to understand and manage emotions, maintain positive relationships, and make responsible decisions. This is the first in a series of four related reports about what is known about SEL programs for students ages 3-8. The report series addresses four issues raised…

  19. Evaluation of the Protective Role of Vitamin C on the Metabolic and Enzymatic Activities of the Liver in the Male Rats After Exposure to 2.45 GHz Of Wi-Fi Routers

    Directory of Open Access Journals (Sweden)

    Shekoohi-Shooli F.

    2016-09-01

    Full Text Available Background: The use of devices emitted microwave radiation such as mobile phones, wireless fidelity (Wi-Fi routers, etc. is increased rapidly. It has caused a great concern; the researchers should identify its effects on people’s health. We evaluated the protective role of Vitamin C on the metabolic and enzymatic activities of the liver after exposure to Wi-Fi routers. Material and Methods: 70 male Wistar rats weighing 200-250 g were randomly divided into 7 groups (10 rats in each group.The first stage one –day test: Group A (received vitamin C 250 mg/kg/day orally together with 8- hour/day Wi-Fi exposure. Group B (exposed to Wi-Fi radiation. Group C (received vitamin C. Group D or Control (was neither exposed to radiation of Wi-Fi modem nor did receive vitamin C. The second phase of experiment had done for five consecutive days. It involved Group E (received vitamin C, Group F (exposed to Wi-Fi radiation, Group G (received vitamin C together with Wi-Fi radiation. The distance between animals’ restrainers was 20 cm away from the router antenna. Finally, blood samples were collected and assayed the level of hepatic enzymes including alkaline phosphatase(ALP, alanine amino transferase(ALT aspartate amino transferase (ASL, gamma glutamyl transferase (GGT and the concentration of Blood Glucose, Cholesterol , Triglyceride(TG,High density lipoprotein (HDLand low density lipoprotein (LDL. Results: Data obtained from the One day test showed an increase in concentration of blood glucose, decrease in Triglyceride level and GGT factor (P<0.05, however no observed significant difference on the Cholesterol , HDL , LDL level and hepatic enzymes activities in compare to control group. Groups of the five-day test showed reduction in the amount of blood glucose, elevation of cholesterol level and LDL relative to control group(P<0.05. Conclusion: WiFi exposure may exert alternations on the metabolic parameters and hepatic enzymes activities through stress oxidative and increasing of free radicals, but the use of vitamin C protects them from changing induced. Also taking optimum dose of vitamin C is essential for radioprotective effect and maintaining optimum health.

  20. CCDC 1404074: Experimental Crystal Structure Determination : (2-((4,5-diphenyl-3H-benzo[e]indol-2-yl)(phenyl)methylene)-4,5-diphenyl-2H-benzo[g]indolato)(difluoro)borate

    KAUST Repository

    Chua, Ming Hui

    2015-01-01

    An entry from the Cambridge Structural Database, the world’s repository for small molecule crystal structures. The entry contains experimental data from a crystal diffraction study. The deposited dataset for this entry is freely available from the CCDC and typically includes 3D coordinates, cell parameters, space group, experimental conditions and quality measures.

  1. Abu-Rabia, S. (1996. Attitudes and cultural background and their relationship to reading comprehension in a second language: A comparison of three different social contexts. International Journal of Applied Linguistics24(5, 711-721. Afflerbach, P. (1986

    Directory of Open Access Journals (Sweden)

    Inayatullah Kakepoto

    2012-09-01

    Full Text Available This study investigated the effect of content familiarity and test format on Iranian English learners. The participants of this were advanced students studying at different language institutes in Isfahan, Iran. To sample the subjects of this study, the latest version of Oxford Placement Test was administered to 428 students studying at advanced level in 6 different language institutes. Based on the results of the OPT test and for the sake of homogeneity 70 students were considered as the target participants of the study. Each participant was given a test of reading comprehension with familiar content and unfamiliar content. Each test contained multiple choice, true/false, and fill in the blanks test items. Factorial design results indicated that test takers had a significantly better performance on content familiar tests and sub tests. It also became clear that their performance on multiple choice section either in content familiar and content unfamiliar test was superior to that of true/false and fill in the blanks. It will be of endless help to test makers and language teachers to be aware of the role test format and content of the test can play on test takers’ performance.

  2. Activity of chalcones derived from 2,4,5-trimethoxybenzaldehyde against Meloidogyne exigua and in silico interaction of one chalcone with a putative caffeic acid 3-O-methyltransferase from Meloidogyne incognita.

    Science.gov (United States)

    Nunes, Alexandro Silva; Campos, Vicente Paulo; Mascarello, Alessandra; Stumpf, Taisa Regina; Chiaradia-Delatorre, Louise Domenghini; Machado, Alan Rodrigues Teixeira; Santos Júnior, Helvécio Martins; Yunes, Rosendo Augusto; Nunes, Ricardo José; Oliveira, Denilson Ferreira

    2013-12-01

    Meloidogyne exigua is a parasitic nematode of plants that causes great losses to coffee farmers. In an effort to develop parasitic controls, 154 chalcones were synthesized and screened for activity against this nematode. The best results were obtained with (2E)-1-(4'-nitrophenyl)-3-(2,4,5-trimethoxyphenyl)prop-2-en-1-one (6) with a 50% lethal concentration (LC50) of 171 μg/ml against M. exigua second-stage juveniles, in comparison to the commercially-available nematicide carbofuran which had an LC50 of 260 μg/ml under the same conditions. When coffee plants were used, 6 reduced the nematode population to ~50% of that observed in control plants. To investigate the mechanism of action of 6, an in silico study was carried out, which indicated that 6 may act against M. exigua through inhibition of a putative caffeic acid 3-O-methyltransferase homodimer, the amino acid sequence of which was determined by examining the genome of Meloidogyne incognita. Copyright © 2013 Elsevier Inc. All rights reserved.

  3. Crystal structure of ethyl 2-{4-[(5-chloro-1-benzo-furan-2-yl)meth-yl]-3-methyl-6-oxo-1,6-di-hydro-pyridazin-1-yl}acetate.

    Science.gov (United States)

    Boukharsa, Youness; El Ammari, Lahcen; Taoufik, Jamal; Saadi, Mohamed; Ansar, M'hammed

    2015-05-01

    In the title compound, C18H17ClN2O4, the dihedral angle between the benzofuran ring system [maximum deviation 0.014 (2) Å] and the oxopyradizine ring is 73.33 (8)°. The structure is characterized by disorder of the ethyl group, which is split into two parts, with a major component of 0.57 (3), and the acetate carbonyl O atom, which is statistically disordered. In the crystal, the molecules are linked by C-H⋯O inter-actions, forming a three-dimensional network.

  4. Corrigendum to "Crater functions for compound materials: A route to parameter estimation in coupled-PDE models of ion bombardment" [Nucl. Instr. Meth. Phys. Res. B 318B (2014) 245-252

    Science.gov (United States)

    Norris, Scott A.; Samela, Juha; Vestberg, Matias; Nordlund, Kai; Aziz, Michael J.

    2015-04-01

    Because Eq. (1) is independent of the details of the crater function Δh, updated formulae for { A, C,A‧,C‧ } that account for the curvature dependence are obtained simply by inserting Harrison and Bradley's expressions (2) into Eq. (1). As those authors show, at normal incidence the added terms are expected to have positive values, increasing estimates of C (which is a sum of SX,YZ, type terms), while producing a less noticable effect on the value of C‧ (which is a difference of SX,YZ, type terms). These modifications therefore do not alter the primary physical conclusions of our study, which are that for the GaSb system both C and (A‧ C -C‧ A) appear to be positive.

  5. Discovery of isotopes of the transuranium elements with 93≤Z≤98

    Energy Technology Data Exchange (ETDEWEB)

    Fry, C.; Thoennessen, M., E-mail: thoennessen@nscl.msu.edu

    2013-01-15

    One hundred and five isotopes of the transuranium elements neptunium, plutonium, americium, curium, berkelium, and californium have been observed so far; the discovery of these isotopes is described. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  6. Separation of Transplutonium Elements from Neutron Irradiated Americium-241

    National Research Council Canada - National Science Library

    UENO, Kaoru; WATANABE, Kenju; SAGAWA, Chiaki; ISHIMORI, Tomitaro

    1974-01-01

    .... The ratios of the amounts present of these isotopes were determined by mass spectrometry. It was not possible to identify 249Bk in the berkelium fraction owing to the interference from other β-ray emitting nuclides. In the californium fraction, both spontaneous fission and a-activities due to 250, 252 were observed.

  7. Neutron-Activated Gamma-Emission: Technology Review

    Science.gov (United States)

    2012-01-01

    flux sources developed for boron neutron capture therapy ( BNCT ), found to be an experimental success in cancer treatment (26). 30 Improved flux on...achievable Am americium API associated particle imaging B boron Be beryllium BNCT boron neutron capture therapy C carbon Cf californium Cl

  8. ORF Alignment: NC_004741 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available PQEEVDEDAEYWAQFEA 180 ... Query: 245 MERDGREYVLIDTAGVRKRGKITDAVEKFSVIKTLQAIEDANVVMLVIDAREGISDQDLS 304 ... ... ... MERDGREYVLIDTAGVRKRGKITDAVEKFSVIKTLQAIEDANVVMLVIDAREGISDQDLS Sbjct: 241 MERDGREYVLIDTAGVRKRGKITDAVEKFSVIKTLQAIEDANVVMLVIDARE

  9. ORF Alignment: NC_005126 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ry: 245 IYIPMERDGREYILIDTAGVRKRGKITETVEKFSVIKTLQAIEDANVVLLVIDAREGISD 304 ... IYIPMERDGREYILIDTAGVRKRG...KITETVEKFSVIKTLQAIEDANVVLLVIDAREGISD Sbjct: 241 IYIPMERDGREYILIDTAGVRKRGKITETVEKFSVIKTLQAIEDANVVLLVIDARE

  10. ORF Alignment: NC_004337 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available PQEEVDEDAEYWAQFEA 180 ... Query: 245 MERDGREYVLIDTAGVRKRGKITDAVEKFSVIKTLQAIEDANVVMLVIDAREGISDQDLS 304 ... ... ... MERDGREYVLIDTAGVRKRGKITDAVEKFSVIKTLQAIEDANVVMLVIDAREGISDQDLS Sbjct: 241 MERDGREYVLIDTAGVRKRGKITDAVEKFSVIKTLQAIEDANVVMLVIDARE

  11. ORF Alignment: NC_006370 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available IDLSSVEDIE 180 ... Query: 245 IPMERDGQEYVLIDTAGVRRRKNMNQVVEKFSVIQTLKAVEDANVVLLIIDARENISDQD 304 ... IPMER...DGQEYVLIDTAGVRRRKNMNQVVEKFSVIQTLKAVEDANVVLLIIDARENISDQD Sbjct: 241 IPMERDGQEYVLIDTAGVRRRKNMNQVVEKFSVIQTLKAVEDANVVLLIIDARE

  12. ORF Alignment: NC_006905 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ... Query: 245 MERDEREYVLIDTAGVRKRGKITDAVEKFSVIKTLQAIEDANVVLLVIDAREGISDQDLS 304 ... MERDEREYVLIDTAGVRKR...GKITDAVEKFSVIKTLQAIEDANVVLLVIDAREGISDQDLS Sbjct: 241 MERDEREYVLIDTAGVRKRGKITDAVEKFSVIKTLQAIEDANVVLLVIDARE

  13. Solid-State Neutron Multiplicity Counting System Using Commercial Off-the-Shelf Semiconductor Detectors

    Energy Technology Data Exchange (ETDEWEB)

    Rozhdestvenskyy, S. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

    2017-08-09

    This work iterates on the first demonstration of a solid-state neutron multiplicity counting system developed at Lawrence Livermore National Laboratory by using commercial off-the-shelf detectors. The system was demonstrated to determine the mass of a californium-252 neutron source within 20% error requiring only one-hour measurement time with 20 cm2 of active detector area.

  14. Cold valleys in the radioactive decay of 248−254Cf isotopes

    Indian Academy of Sciences (India)

    Geiger–Nuttal plots of log10(T1/2) vs. Q−1/2 for 48−52Ca emitting from various californium isotopes. Acknowledgement. One of the authors (KPS) would like to thank University Grants Commis- sion, Govt. of India for the financial support under project No. MRP(S)-. 352/2005(X Plan)/KLKA 002/UGC-SWRO. References.

  15. Directed evolution of the periodic table: probing the electronic structure of late actinides.

    Science.gov (United States)

    Marsh, M L; Albrecht-Schmitt, T E

    2017-07-25

    Recent investigations of the coordination chemistry and physical properties of berkelium (Z = 97) and californium (Z = 98) have revealed fundamental differences between post-curium elements and lighter members of the actinide series. This review highlights these developments and chronicles key findings and concepts from the last half-century that have helped usher in a new understanding of the evolution of electronic structure in the periodic table.

  16. Open Source: Potential in Latin America for Radiological Weapons

    Science.gov (United States)

    2010-03-01

    terrorist group would need to acquire a radioactive isotope with a relatively short half-life. 36,37 As an aside, the IAEA verified that depleted...cns.miis.edu/npr/pdfs/123salama.pdf (accessed March 3, 2010), Useful RDD isotopes include cobalt-60, strontium-90, yttrium-90, iridium-192, cesium-137...plutonium-238, radium -226, americium-241, and californium-252. 37 Hansell and Salama, “Does intent equal capability?,” 640-641. 38 Internation Atomic

  17. Comment on 'degradation of polychlorinated dibenzo-p-dioxin and dibenzofuran contaminants in 2,4,5-T by photoassisted iron-catalyzed hydrogen peroxide by J.J. Pignatello and L.Q. Huang, Wat. Res. 27, 1731-1736 (1993)'

    Digital Repository Service at National Institute of Oceanography (India)

    Sarkar, A.

    A doubt has been raised on the use of a salts as catalyst for the degradation process. The impact of H@d2@@ O@d2@@ on degradation of PCDD and PCDF is not well defined. The observed variation in the concentration of the different congeners of PCDDs...

  18. Krishna, Dr Kolluru Sree

    Indian Academy of Sciences (India)

    Specialization: Marine Geophysics, Lithospheric Dynamics, Tectonics, Plate Tectonics Address: JC Bse National Fellow & Chief Scientist,, Geological Oceanography Division, National Institute of Oceanography, Dona Paula 403 004, Goa Contact: Office: (0832) 245 0384. Residence: (0832) 245 2438. Mobile: 97654 94935

  19. Pseudorca crassidens (Owen), ein Beitrag zur vergleichenden Anatomie der Cetaceen

    NARCIS (Netherlands)

    Slijper, E.J.

    1939-01-01

    INHALTSÜ BERSICHT Abschnitt 1 Einleitung; Material .... 243 I Strandung .... 243 II Material .... 244 Abschnitt 2 Nomenklatur; Geographische Verbreitung; Lebensweise .... 245 I Nomenklatur .... 245 II Geographische Verbreitung .... 246 III Lebensweise .... 249 Abschnitt 3 Äussere Form; Wachstum ....

  20. Researching Identity and Interculturality

    DEFF Research Database (Denmark)

    Lønsmann, Dorte

    2016-01-01

    Review of: Researching Identity and Interculturality / by F. Dervin and K. Risager (eds.). Routledge 2015, 245 pp.......Review of: Researching Identity and Interculturality / by F. Dervin and K. Risager (eds.). Routledge 2015, 245 pp....

  1. 76 FR 64353 - Request for Public Comment on Draft Document: “Criteria for a Recommended Standard: Occupational...

    Science.gov (United States)

    2011-10-18

    ... was posted on the Internet at: http://www.cdc.gov/niosh/docket/review/docket245/ for Docket number... page at http://www.cdc.gov/niosh/docket/archive/docket245.html and comments will be available in...

  2. 77 FR 21777 - Expanded Charge for Peer Review of the NIOSH document Titled: “Criteria for a Recommended...

    Science.gov (United States)

    2012-04-11

    ... draft document and all public comments received are posted on the Internet at: http://www.cdc.gov/niosh/docket/archive/docket245.html for Docket number NIOSH-245. After consultation with the Occupational...

  3. ORF Alignment: NC_004459 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available LIERALDPFFDNLLSANNEGEIEDLTDMEDE 180 ... Query: 245 SIYIPMERDGREYVLIDTAGVRRRGKVHETVEKFSVVKTLKAVEDANVVLLVIDARENIS... 304 ... SIYIPMERDGREYVLIDTAGVRRRGKVHETVEKFSVVKTLKAVEDANVVLLVIDARENIS Sbjct: 241 SIYIPMERDGREYVLIDTAG...VRRRGKVHETVEKFSVVKTLKAVEDANVVLLVIDARENIS 300 ... Query: 365 GVGHLFESVQEAYRSATTRVGTSV

  4. ORF Alignment: NC_004347 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available SACAEFWSLGLGEVYQMAAAQGRGVTNMIEYALTPYAEAMGIERQGEEEEVDERQYTE 180 ... Query: 245 GREYVIIDTAGVRRRSKVHEVIEKFSVIKTLKAVEDANVVLLIIDARE...GVAEQDLGLLGF 304 ... GREYVIIDTAGVRRRSKVHEVIEKFSVIKTLKAVEDANVVLLIIDAREGVAEQDLGLLGF Sbjc...t: 241 GREYVIIDTAGVRRRSKVHEVIEKFSVIKTLKAVEDANVVLLIIDAREGVAEQDLGLLGF 300 ... Query: 3

  5. Protein (Cyanobacteria): 647668022 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available :605 ... hypothetical protein Prochlorococcus sp. scB245a_518A17 MNNLFLERNCLISANKLYRWSLSYRISKSKKEIIFIGLNPSLSD...EVFLDNTTKKIIKISKNNNYGKVKLINLFALISSKPEKLFKHKNPVGYRNNNHIYKNLKHWSENKNCDLWLGWGNKGKFLNRNKRISKKIMQYNSIRKNNFDNPLGPLLIKKTIKDNPIHPLYCSDNSILKAVKTI

  6. 76 FR 52139 - Defense Federal Acquisition Regulation Supplement; Government; Property (DFARS Case 2009-D008)

    Science.gov (United States)

    2011-08-19

    ... consider experience, training, education, business acumen, judgment, character, and ethics. PART 245... Clearance. 245.7001-5 DD Form 1641, Disposal Determination/Approval. 245.7001-6 Defense Logistics Agency... trade journals or magazines and local newspapers. (8) The plant clearance officer or representative will...

  7. PROCEEDINGS OF THE SYMPOSIUM COMMEMORATING THE 25th ANNIVERSARY OF ELEMENTS 97 and 98 HELD ON JAN. 20, 1975

    Energy Technology Data Exchange (ETDEWEB)

    Seaborg, Glenn T.; Street Jr., Kenneth; Thompson, Stanley G.; Ghiorso, Albert

    1976-07-01

    This volume includes the talks given on January 20, 1975, at a symposium in Berkeley on the occasion of the celebration of the 25th anniversary of the discovery of berkelium and californium. Talks were given at this symposium by the four people involved in the discovery of these elements and by a number of people who have made significant contributions in the intervening years to the investigation of their nuclear and chemical properties. The papers are being published here, without editing, in the form in which they were submitted by the authors in the months following the anniversary symposium, and they reflect rather faithfully the remarks made on that occasion.

  8. Composition containing transuranic elements for use in the homeopathic treatment of aids

    Energy Technology Data Exchange (ETDEWEB)

    Lustig, D.

    1996-04-18

    A homeopathic remedy consisting of a composition containing one or more transuranic elements, particularly plutonium, for preventing and treating acquired immunodeficiency syndrome (AIDS) in humans, as well as seropositivity for human immunodeficiency virus (HIV). Said composition is characterized in that it uses any chemical or isotopic form of one or more transuranic elements (neptunium, plutonium, americium, curium, berkelium, californium or einsteinium), particularly plutonium, said form being diluted and dynamized according to conventional homeopathic methods, particularly the so-called Hahnemann and Korsakov methods, and provided preferably but not exclusively in the form of lactose and/or saccharose globules or granules impregnated with the active principle of said composition. (author).

  9. Advanced development of the spectrum sciences Model 5005-TF, single-event test fixture

    Energy Technology Data Exchange (ETDEWEB)

    Ackermann, M.R.; Browning, J.S. (Sandia National Labs., Albuquerque, NM (USA)); Hughlock, B.W. (Boeing Aerospace and Electronics Co., Seattle, WA (USA)); Lum, G.K. (Lockheed Missiles and Space Co., Sunnyvale, CA (USA)); Tsacoyeanes, W.C. (Draper (Charles Stark) Lab., Inc., Cambridge, MA (USA)); Weeks, M.D. (Spectrum Sciences, Inc., Santa Clara, CA (USA))

    1990-09-01

    This report summarizes the advanced development of the Spectrum Sciences Model 5005-TF, Single-Event Test Fixture. The Model 5005-TF uses a Californium-252 (Cf-252) fission-fragment source to test integrated circuits and other devices for the effects of single-event phenomena. Particle identification methods commonly used in high-energy physics research and nuclear engineering have been incorporated into the Model 5005-TF for estimating the particle charge, mass, and energy parameters. All single-event phenomena observed in a device under test (DUT) are correlated with an identified fission fragment, and its linear energy transfer (LET) and range in the semiconductor material of the DUT.

  10. TOWARD AN IMPROVED UNDERSTANDING OF STRUCTURE AND MAGNETISM IN NEPTUNIUM AND PLUTONIUM PHOSPHONATES AND SULFONATES

    Energy Technology Data Exchange (ETDEWEB)

    Albrecht-Schmitt, Thomas

    2012-03-01

    This grant supported the exploratory synthesis of new actinide materials with all of the actinides from thorium to californium with the exceptions of protactinium and berkelium. We developed detailed structure-property relationships that allowed for the identification of novel materials with selective ion-exchange, selective oxidation, and long-range magnetic ordering. We found novel bonding motifs and identified periodic trends across the actinide series. We identified structural building units that would lead to desired structural features and novel topologies. We also characterized many different spectroscopic trends across the actinide series. The grant support the preparation of approximately 1200 new compounds all of which were structurally characterized.

  11. Detection of rare earth elements in Powder River Basin sub-bituminous coal ash using laser-induced breakdown spectroscopy (LIBS)

    Energy Technology Data Exchange (ETDEWEB)

    Tran, Phuoc [National Energy Technology Lab. (NETL), Pittsburgh, PA, (United State; Mcintyre, Dustin [National Energy Technology Lab. (NETL), Pittsburgh, PA, (United State

    2015-10-01

    We reported our preliminary results on the use of laser-induced breakdown spectroscopy to analyze the rare earth elements contained in ash samples from Powder River Basin sub-bituminous coal (PRB-coal). We have identified many elements in the lanthanide series (cerium, europium, holmium, lanthanum, lutetium, praseodymium, promethium, samarium, terbium, ytterbium) and some elements in the actinide series (actinium, thorium, uranium, plutonium, berkelium, californium) in the ash samples. In addition, various metals were also seen to present in the ash samples

  12. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFC245 (Link to dictyBase) - - - Contig-U16269-1 VFC245P (Link... to Original site) VFC245F 480 VFC245Z 530 VFC245P 1010 - - Show VFC245 Library VF (Link to library) Clone ID VFC245 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16269-1 Original site URL http://dict...gnments: (bits) Value N AC115612 |AC115612.2 Dictyostelium discoideum chromosome 2 map 6245135-6357017 strai...: mitochondrial 20.0 %: cytoplasmic 16.0 %: Golgi 16.0 %: nuclear 12.0 %: endoplasmic reticulum >> predictio

  13. ORF Alignment: NC_002947 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available [Pseudomonas putida KT2440] ... Length = 245 ... Query: 7 ... LTQHIARRPQRIALLQHIAEQGSITRXXXXXXXXXXXXWDAIDEL...NNLASQPLVKRSTXX 66 ... LTQHIARRPQRIALLQHIAEQGSITR ... WDAIDELNNLA...SQPLVKRST ... Sbjct: 1 ... LTQHIARRPQRIALLQHIAEQGSITRAAKAAGISYKAAWDAIDELNNLASQPLVKRSTGG 60 ... Query: 127 GLRPEGRYD

  14. Vinegar identification by ultraviolet spectrum technology and pattern recognition method

    National Research Council Canada - National Science Library

    Huali, Zhao; Zhixi, Li; Xuemei, Yang; Baoan, Chen

    2009-01-01

    Some kinds of vinegars are studied for identification. First, their ultraviolet spectrum curves are obtained by evaporation and ultraviolet spectrum scanning under the conditions of wavelength at 245...

  15. ORF Alignment: NC_004432 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ... [Mycoplasma penetrans HF-2] ... Length = 245 ... Query: 8 ... PLGGMDENEKACYVLEIDGDFYLINLGISVPVYKVLGIKKIIPYME...WVKKNEKNIKGIFV 67 ... PLGGMDENEKACYVLEIDGDFYLINLGISVPVYKVLGIKKIIPYMEW...VKKNEKNIKGIFV Sbjct: 1 ... PLGGMDENEKACYVLEIDGDFYLINLGISVPVYKVLGIKKIIPYMEWVKKNEKNIKGIFV 60 ... Query: 128 TVSVGKI

  16. ORF Alignment: NC_003413 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available TVLIRRECFKKAGLFDPKLPSSQDWDM 183 ... VSQQNERIIGKRLPRFRGNVYGELLKENFIGSPTVLIRRECFKKAGLFDPKLPSSQDWDM Sbjc...t: 121 VSQQNERIIGKRLPRFRGNVYGELLKENFIGSPTVLIRRECFKKAGLFDPKLPSSQDWDM 180 ... Query: 244 GL 245 ... GL Sbjct: 241 GL 242 ...TVSVIIPTHNRAKLLKRAIISVLNQTFEDFEIIVVDDASSDNTPNIIESIKDSRIRYIR 60 ... Query: 124 VSQQNERIIGKRLPRFRGNVYGELLKENFIGSP

  17. ORF Alignment: NC_004547 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available LGMGEVYAIAASHGRGVTSLLETVLLPFVQDEIEEPVELTEEEENAAYWA 180 ... Query: 245 SIYIPMVRDEREYILIDTAGVRKRGKVTETVEKFSVIKTLQAIEDANVVLLVIDARE...GIS 304 ... SIYIPMVRDEREYILIDTAGVRKRGKVTETVEKFSVIKTLQAIEDANVVLLVIDAREGIS Sbjct: 241 S...IYIPMVRDEREYILIDTAGVRKRGKVTETVEKFSVIKTLQAIEDANVVLLVIDAREGIS 300 ... Query: 365 GVGNL

  18. Protein (Cyanobacteria): 661285139 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 15 ... UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase, partial Prochlorococcus sp. scB245...a_519D13 MEFSLSELNNVLGDIKNLSEGERDFLNFKNISIDSRTLLKNDLFIAIKGKNFDGHSFLPDVLDKGVKSVVIKKGMQRLLPCNFPYWVVNDTLVAFQKLALLKRKKLNIPIIAITGSVGKTTTKEMI

  19. Unigene BLAST: CBRC-CELE-05-0029 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CELE-05-0029 gnl|UG|Cel#S5711809 Caenorhabditis elegans Serpentine Receptor, c...lass H family member (srh-245) (srh-245) mRNA, complete cds /cds=p(1,993) /gb=NM_070880 /gi=17563409 /ug=Cel.29220 /len=993 0.0 98% ...

  20. Non-typhoidal salmonella (NTS) bacteraemia in Malawian adults: a ...

    African Journals Online (AJOL)

    Anaemia was associated with inpatient death, and several features of AIDS were associated with poor outpatient survival. Among survivors, 43% (19/44) had a first recurrence of NTS bacteraemia at 23-186 days. Among these, 26% (5/19) developed multiple recurrences up to 245 days. No recurrence was seen after 245 ...

  1. Geologic Mapping of the Summit and Western Flank of Alba Mons, Mars

    Science.gov (United States)

    Crown, D. A.; Berman, D. C.; Platz, T.; Scheidt, S. P.; Hauber, E.; Weitz, C. M.

    2017-06-01

    This investigation employs imaging and topographic datasets to produce two 1:1M-scale geologic maps covering the Alba Mons summit (245-255°E, 32.5-47.5°N) and western flank (230-245°E, 37.5-47.5°N).

  2. Journal of Chemical Sciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    August 2004, pages 245-300. pp 245-250. Synthesis, characterization and emission properties of quinolin-8-olato chelated ruthenium organometallics ... Synthesis of spiro[indolo-1,5-benzodiazepines] from 3-acetyl coumarins for use as possible antianxiety agents · Raviraj A Kusanur Manjunath Ghate Manohar V Kulkarni.

  3. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education. Flowering Trees. Articles in Resonance – Journal of Science Education. Volume 7 Issue 6 June 2002 pp 97-97 ..... Abstract Fulltext PDF. Volume 23 Issue 2 February 2018 pp 245-245 Flowering Trees. Gymnosporia montana Benth. (Mountain Spike Thorn).

  4. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 23; Issue 2. Gymnosporia montana Benth. (Mountain Spike Thorn). Flowering Trees Volume 23 Issue 2 February 2018 pp 245-245. Fulltext. Click here to view fulltext PDF. Permanent link: http://www.ias.ac.in/article/fulltext/reso/023/02/0245-0245 ...

  5. Reduction of subacute uterine inversion by Haultain's method: A ...

    African Journals Online (AJOL)

    2017-12-08

    Dec 8, 2017 ... and attempted the Huntington manoeuvre [2,4,5] during which the round ligaments are identified and upward traction is applied on them, while a cupped hand in the vagina pushes the inverted uterus upwards. Unfortunately, this attempt was unsuccessful. The. Haultain[2,4,5] procedure was then performed ...

  6. 76 FR 6003 - Defense Federal Acquisition Regulation Supplement; Marking of Government-Furnished Property

    Science.gov (United States)

    2011-02-02

    .... G. Applicability to international and FMS contracts Comment: One respondent asked if the rule applies to foreign Government and international contracts under 48 CFR (DFARS) 245.3. DoD Response: The rule applies to contracts with foreign Governments and international organizations under DFARS 245.3...

  7. 75 FR 75444 - Defense Federal Acquisition Regulation Supplement; Government Property (DFARS Case 2009-D008)

    Science.gov (United States)

    2010-12-03

    ... Defense Logistics Agency Form 1822, End Use Certificate. Subpart 245.70--Plant Clearance Forms 245.7001... Defense Logistics Agency Form 1822, End Use Certificate. Use when directed by the plant clearance officer....cfm . Instructions for completing the form are provided on the reverse side of the form. (i) SF 1428...

  8. Errata to: Characteristics of humic acid fluvic acids in Arabian Sea sediments

    Digital Repository Service at National Institute of Oceanography (India)

    Sardessai, S.

    stream_size 1 stream_content_type text/plain stream_name Indian_J_Mar_Sci_24_245.pdf.txt stream_source_info Indian_J_Mar_Sci_24_245.pdf.txt Content-Encoding ISO-8859-1 Content-Type text/plain; charset=ISO-8859-1 ...

  9. VizieR Online Data Catalog: MIR brightness contrast of Saturn's rings (Fujiwara+, 2017)

    Science.gov (United States)

    Fujiwara, H.; Morishima, R.; Fujiyoshi, T.; Yamashita, T.

    2016-11-01

    Brightness maps for Saturn's rings at 8.8, 9.7, 10.5, 11.7, 12.5, 17.7, 18.8, 20.5, and 24.5 micron observed with Subaru Telescope/COMICS in 2008 and at 12.5 and 24.5 micron in 2005 are provides as fits files. (2 data files).

  10. 78 FR 51729 - Board of Scientific Counselors, National Institute for Occupational Safety and Health (BSC, NIOSH)

    Science.gov (United States)

    2013-08-21

    ... Institute for Occupational Safety and Health (BSC, NIOSH) In accordance with section 10(a) (2) of the...://www.cdc.gov/niosh/bsc/ ) or call (202) 245-0625 or (202) 245-0626 for building access information.../niosh/bsc/ ). Contact Person for More Information: John Decker, Executive Secretary, BSC, NIOSH, CDC...

  11. Gclust Server: 23279 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available Cluster Sequences Related Sequences(283) 245 dop-3: DOPamine receptor family member (dop-3) 4 1.00e-28 0.0...Sequence length 245 Representative annotation dop-3: DOPamine receptor family member (dop-3) Number of Sequences

  12. 78 FR 14272 - Department of Defense Task Force on the Care, Management, and Transition of Recovering Wounded...

    Science.gov (United States)

    2013-03-05

    ....m.-2:45 p.m.--Break 2:45 p.m.-3:45 p.m.--Center for Deployment Psychology 3:45 p.m.-4:00 p.m.--Break... Committee Act of 1972, the public or interested organizations may submit written statements to the...

  13. A neural network based seafloor classification using acoustic backscatter

    Digital Repository Service at National Institute of Oceanography (India)

    Chakraborty, B.

    stream_size 9 stream_content_type text/plain stream_name Adv_Soft_Comput_AFSS_2002_245.pdf.txt stream_source_info Adv_Soft_Comput_AFSS_2002_245.pdf.txt Content-Encoding ISO-8859-1 Content-Type text/plain; charset=ISO-8859-1 ...

  14. Measurements of the neutron capture cross sections and incineration potentials of minor-actinides in high thermal neutron fluxes: Impact on the transmutation of nuclear wastes; Mesures des sections efficaces de capture et potentiels d'incineration des actinides mineurs dans les hauts flux de neutrons: Impact sur la transmutation des dechets

    Energy Technology Data Exchange (ETDEWEB)

    Bringer, O

    2007-10-15

    This thesis comes within the framework of minor-actinide nuclear transmutation studies. First of all, we have evaluated the impact of minor actinide nuclear data uncertainties within the cases of {sup 241}Am and {sup 237}Np incineration in three different reactor spectra: EFR (fast), GT-MHR (epithermal) and HI-HWR (thermal). The nuclear parameters which give the highest uncertainties were thus highlighted. As a result of fact, we have tried to reduce data uncertainties, in the thermal energy region, for one part of them through experimental campaigns in the moderated high intensity neutron fluxes of ILL reactor (Grenoble). These measurements were focused onto the incineration and transmutation of the americium-241, the curium-244 and the californium-249 isotopes. Finally, the values of 12 different cross sections and the {sup 241}Am isomeric branching ratio were precisely measured at thermal energy point. (author)

  15. A gas secondary electron detector

    CERN Document Server

    Drouart, A; Alamanos, N; Auger, F; Besson, P; Bougamont, E; Bourgeois, P; Lobo, G; Pollacco, E C; Riallot, M

    2002-01-01

    A new Secondary Electron gas Detector (SED) is under development to be used in conjunction with an emissive foil to detect low energy heavy ions as an alternative to micro-channel plates. It could measure position and time of flight. Secondary electrons are accelerated to 10 keV so that they can cross through the 0.9 mu m Mylar entrance window. The electrons then are multiplied in the isobutane gas of the detector at 4-10 Torr. A time resolution of 150 ps and a spatial resolution of 3 mm have been obtained by using californium fission fragments on a prototype detector of 7x7 cm sup 2. The advantage of the SED against MCP is that its size is not limited. Our final goal is to build a large size detector (15x40 cm sup 2) that will operate at the focal plane of the VAMOS magnetic spectrometer at GANIL.

  16. Environmental assessment of the thermal neutron activation explosive detection system for concourse use at US airports

    Energy Technology Data Exchange (ETDEWEB)

    Jones, C.G.

    1990-08-01

    This document is an environmental assessment of a system designed to detect the presence of explosives in checked airline baggage or cargo. The system is meant to be installed at the concourse or lobby ticketing areas of US commercial airports and uses a sealed radioactive source of californium-252 to irradiate baggage items. The major impact of the use of this system arises from direct exposure of the public to scattered or leakage radiation from the source and to induced radioactivity in baggage items. Under normal operation and the most likely accident scenarios, the environmental impacts that would be created by the proposed licensing action would not be significant. 44 refs., 19 figs., 18 tabs.

  17. Chelation and stabilization of berkelium in oxidation state +IV

    Science.gov (United States)

    Deblonde, Gauthier J.-P.; Sturzbecher-Hoehne, Manuel; Rupert, Peter B.; An, Dahlia D.; Illy, Marie-Claire; Ralston, Corie Y.; Brabec, Jiri; de Jong, Wibe A.; Strong, Roland K.; Abergel, Rebecca J.

    2017-09-01

    Berkelium (Bk) has been predicted to be the only transplutonium element able to exhibit both +III and +IV oxidation states in solution, but evidence of a stable oxidized Bk chelate has so far remained elusive. Here we describe the stabilization of the heaviest 4+ ion of the periodic table, under mild aqueous conditions, using a siderophore derivative. The resulting Bk(IV) complex exhibits luminescence via sensitization through an intramolecular antenna effect. This neutral Bk(IV) coordination compound is not sequestered by the protein siderocalin—a mammalian metal transporter—in contrast to the negatively charged species obtained with neighbouring trivalent actinides americium, curium and californium (Cf). The corresponding Cf(III)-ligand-protein ternary adduct was characterized by X-ray diffraction analysis. Combined with theoretical predictions, these data add significant insight to the field of transplutonium chemistry, and may lead to innovative Bk separation and purification processes.

  18. The CARIBU EBIS control and synchronization system

    Science.gov (United States)

    Dickerson, Clayton; Peters, Christopher

    2015-01-01

    The Californium Rare Isotope Breeder Upgrade (CARIBU) Electron Beam Ion Source (EBIS) charge breeder has been built and tested. The bases of the CARIBU EBIS electrical system are four voltage platforms on which both DC and pulsed high voltage outputs are controlled. The high voltage output pulses are created with either a combination of a function generator and a high voltage amplifier, or two high voltage DC power supplies and a high voltage solid state switch. Proper synchronization of the pulsed voltages, fundamental to optimizing the charge breeding performance, is achieved with triggering from a digital delay pulse generator. The control system is based on National Instruments realtime controllers and LabVIEW software implementing Functional Global Variables (FGV) to store and access instrument parameters. Fiber optic converters enable network communication and triggering across the platforms.

  19. Off-line commissioning of EBIS and plans for its integration into ATLAS and CARIBU

    Energy Technology Data Exchange (ETDEWEB)

    Ostroumov, P. N., E-mail: ostroumov@anl.gov; Barcikowski, A.; Dickerson, C. A.; Mustapha, B.; Perry, A.; Sharamentov, S. I.; Vondrasek, R. C.; Zinkann, G. [Argonne National Laboratory, Argonne, Illinois 60439 (United States)

    2016-02-15

    An Electron Beam Ion Source Charge Breeder (EBIS-CB) has been developed at Argonne to breed radioactive beams from the CAlifornium Rare Isotope Breeder Upgrade (CARIBU) facility at Argonne Tandem Linac Accelerator System (ATLAS). The EBIS-CB will replace the existing ECR charge breeder to increase the intensity and significantly improve the purity of reaccelerated radioactive ion beams. The CARIBU EBIS-CB has been successfully commissioned offline with an external singly charged cesium ion source. The performance of the EBIS fully meets the specifications to breed rare isotope beams delivered from CARIBU. The EBIS is being relocated and integrated into ATLAS and CARIBU. A long electrostatic beam transport system including two 180° bends in the vertical plane has been designed. The commissioning of the EBIS and the beam transport system in their permanent location will start at the end of this year.

  20. Populations of selected microbial and fungal species growing on the surface of rape seeds following treatment with desiccants or plant growth regulators.

    Science.gov (United States)

    Frac, Magdalena; Jezierska-Tys, Stefania; Tys, Jerzy

    2010-01-01

    The aim of this study was to determine the effects of desiccants and plant growth regulators on selected microbial species affecting rape seeds, with special emphasis on the growth of fungi and identification of the genus and species composition. The experimental material in the study was seeds of winter rape cv. Californium that were collected from the field during combine harvest. The chemical agents applied, both desiccants and growth regulators, generally decreased the populations of bacteria occurring on the surface of rape seeds. The responses of fungi depended upon the type of agent applied and were manifested as either stimulation or inhibition of the growth of the fungal species. The fungi isolated from the surface of rape seeds were characteristic of those found in the field environment (Cladosporium and Penicillium) and typical for those present on the surface of rape seeds (Alternaria).

  1. Reliability of semiconductor and gas-filled diodes for over-voltage protection exposed to ionizing radiation

    Directory of Open Access Journals (Sweden)

    Stanković Koviljka

    2009-01-01

    Full Text Available The wide-spread use of semiconductor and gas-filled diodes for non-linear over-voltage protection results in a variety of possible working conditions. It is therefore essential to have a thorough insight into their reliability in exploitation environments which imply exposure to ionizing radiation. The aim of this paper is to investigate the influence of irradiation on over-voltage diode characteristics by exposing the diodes to californium-252 combined neutron/gamma radiation field. The irradiation of semiconductor over-voltage diodes causes severe degradation of their protection characteristics. On the other hand, gas-filled over-voltage diodes exhibit a temporal improvement of performance. The results are presented with the accompanying theoretical interpretations of the observed changes in over-voltage diode behaviour, based on the interaction of radiation with materials constituting the diodes.

  2. Triton and alpha-particle contribution from LiF converter for neutron dosimeter

    CERN Document Server

    Camacho, M E; Balcazar, M

    1999-01-01

    A personnel neutron dosimeter prototype based on chemical and electrochemical etched CR-39 detector, combined with LiF converter, has been calibrated using an ICRP-like phantom, under a heavy-water moderated Californium source neutron spectra; A conversion factor of 1.052+-126 spots cm sup - sup 2 mSv sup - sup 1 was obtained. The sealing properties of the detector holder showed a ten-fold reduction in radon background when it was tested in a high radon atmosphere. A convenient mechanical shock resistance was achieved in LiF converters by sintering to 11 tons pressure LiF powder at 650 deg. C, during one hour.

  3. Study of reproducibility of measurements with the spectrometer of Bonner multispheres

    Energy Technology Data Exchange (ETDEWEB)

    Azevedo, G.A.; Pereira, W.W.; Patrao, K.C.S.; Fonseca, E.S., E-mail: geisadeazevedo@gmail.com, E-mail: walsan@ird.gov.br, E-mail: karla@ird.gov.br, E-mail: evaldo@ird.gov.br [Instituto de Radionprotecao e Dosimetria (IRD/CNEN-RJ), Rio de Janeiro, RJ (Brazil)

    2013-07-01

    This work aims to study the metrological behavior of the Bonner Multisphere Spectrometer (BMS) of the LN / LNMRI / IRD - Laboratorio Metrologia de Neutrons / Laboratorio Nacional de Metrologia e Radiacao Ionizante / Instituto de Radioprotecao e Dosimetria, for measurements in repeatability and reproducibility conditions. Initially, a simulation was done by applying the Monte Carlo method, using the MCNP code and respecting the ISO 8529-1 (2001), using the sources of Californium ({sup 252} Cf), Americium-Beryllium ({sup 241} AmBe) and californium in heavy water (Cf + D{sub 2}O), all located at a distance of 100 cm from the neutron detector ({sup 6}Li (Eu) - crystal scintillator). In this program, the counting of neutrons that are captured by the detector was made. The source is located in the center of a sphere of radius 300 cm. Analyzes the impact of these neutrons in a point of the sphere wall, which in this case acted as a neutron detector and from there, it is estimated the number of neutrons that collide in the whole sphere. The purpose is to obtain the neutron count for different energy bands in a solid field of neutrons, since they have a spectrum ranging from a low to a high energy that can also vary within a particular environment. Wishes to obtain new fields with different sources and moderators materials to be used as new reference fields. Measurements are being conducted for these fields, with the aim of analyzing the variability conditions of the measurement (repeatability and reproducibility) in LEN - Laboratorio de Espectrometria de Neutrons of the LN/LMNRI/IRD. Thus, the spectrometer will be used to improve both the knowledge of the spectrum as the standard of neutrons of the lab, proving that a spectrometry is essential for correct measurement.

  4. The Coast Artillery Journal. Volume 91, Number 3, May-June 1948

    Science.gov (United States)

    1948-06-01

    on the 28th of April 1943 on the Army Transport Edmund B. Alexander , skippered by Captain Edwin L. Cline. Off at last on the great adventure, no one...the Sixth Army staff: Colonel Daniel C. Nutting, Brigade Commander. Colonel Alexand ~ Young, Brigade Executive. Lieutenant Colonel John W. Pomeroy...Plays of Pushkin 2.45 & 1.25 Anna Karenina (Tolstoy) 2.45 War and Peace (Tolstoy) 2.45 Best Russian Short Stories 1.25 Crime and Punishment (Dostoyevsky

  5. Drug: D00979 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available ing individual organs 24 Hormones 245 Adrenal hormone preparations 2456 Prednisolones D00979 Methylprednisol...ts, Stimulant/Replacement/Modifying (Adrenal) Methylprednisolone D00979 Methylprednisolone acetate (JAN/USP)

  6. Drug: D00986 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available l organs 24 Hormones 245 Adrenal hormone preparations 2452 Cortisones D00986 Fludrocortisone acetate (JP16/U... (JP16/USP) USP drug classification [BR:br08302] Hormonal Agents, Stimulant/Replacement/Modifying (Adrenal

  7. Disease: H00045 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available lity of Ki-67 as a prognostic marker in pancreatic endocrine neoplasms. Am J Clin Pathol 109:245-7 (1998) (drug) Skeel RT (ed). Handb...ook of Cancer Chemotherapy, Sixth Edition Lippincott Williams & Wilkins (2003) ...

  8. Investigations on a large collection of cosmic dust from the central Indian Ocean.

    Digital Repository Service at National Institute of Oceanography (India)

    Parashar, K.; ShyamPrasad, M.; Chauhan, S.S.S.

    We collected 1,245 spherules from the Central Indian Ocean basin by Magnetic cosmic dust collection (MACDUC) experiment raking the deep sea floor. This collection ranks among the large deep sea collections of cosmic dust. For this study, 168...

  9. 76 FR 77914 - Energy Conservation Program for Certain Commercial and Industrial Equipment: Test Procedures for...

    Science.gov (United States)

    2011-12-15

    ... voltage waveshape requirements. \\19\\ RMS--is the root-mean-square and comes from a mathematical formula... 245 was published in the Official Journal of the European Union. This document included both energy...

  10. Microwave Plasma System: PVA Tepla 300

    Data.gov (United States)

    Federal Laboratory Consortium — Description:CORAL Name: Microwave AsherA tool using microwave oxygen plasma to remove organics on the surfacesSpecifications / Capabilities:Frequency: 2.45 GHzPower:...

  11. NIHSeniorHealth

    Medline Plus

    Full Text Available ... 30+ more This item has been hidden Complementary Health Approaches Play all 2:45 Play next Play now Yoga is a wonderful form of exercise: Dr. Marie A. Bernard, NIA Deputy Director - Duration: ...

  12. 36 CFR 7.29 - Gateway National Recreation Area.

    Science.gov (United States)

    2010-07-01

    ... issuance of such permits, operators must show compliance with Federal and State regulations and applicable...) Public lewdness. Section 245.00 of the New York Penal Code is hereby adopted and incorporated into the...

  13. Dvě ontologie české demokracie: T. G. Masaryk a J. L. Fischer

    Czech Academy of Sciences Publication Activity Database

    Pauza, Miroslav

    2015-01-01

    Roč. 63, č. 2 (2015), s. 233-245 ISSN 0015-1831 Institutional support: RVO:67985955 Keywords : Masaryk * Fischer * democracy * providence * order * structure * function * individuality * sociality * crisis Subject RIV: AA - Philosophy ; Religion

  14. Eesti Energia sõlmis lepingu kahjumis USA kindlustusseltsiga / Kaisa Tahlfeld

    Index Scriptorium Estoniae

    Tahlfeld, Kaisa

    2008-01-01

    Eesti Energia sõlmis 33,5 miljoni kroonise lepingu USA riigi poolt pankrotist päästetud ja kolmandas kvartalis 24,5 miljardit dollarit kahjumit teeninud kindlustusfirmaga AIG. Diagramm: USA kindlustusfirma AIG kvartalikasum

  15. NIHSeniorHealth

    Medline Plus

    Full Text Available ... 03 Play next Play now Eating for Your Health - Duration: 5 minutes, 3 seconds. 6,862 views ... 30+ more This item has been hidden Complementary Health Approaches Play all 2:45 Play next Play ...

  16. Novel polyvinyl alcohol-bioglass 45S5 based composite nanofibrous membranes as bone scaffolds.

    Science.gov (United States)

    Shankhwar, Nisha; Kumar, Manishekhar; Mandal, Biman B; Srinivasan, A

    2016-12-01

    Composite nanofibrous membranes based on sol-gel derived 45SiO2 24.5CaO 24.5 Na2O 6 P2O5 (bioglass, BG) and 43SiO2 24.5CaO 24.5 Na2O 6 P2O5 2Fe2O3 (magnetic bioglass, MBG) blended with polyvinyl alcohol (PVA) have been electrospun. These low cost membranes were mostly amorphous in structure with minor crystalline (sodium calcium phosphate) precipitates. All membranes were biodegradable. Among these, the composites exhibited higher tensile strength, better proliferation of human osteosarcoma MG63 cells and higher alkaline phosphatase enzyme activity than the bare PVA membrane, indicating their potential in bone tissue engineering. The magnetic PVA-MBG scaffold was also found to be a promising candidate for magnetic hyperthermia application. Copyright © 2016 Elsevier B.V. All rights reserved.

  17. 76 FR 17424 - President's National Security Telecommunications Advisory Committee

    Science.gov (United States)

    2011-03-29

    ... SECURITY President's National Security Telecommunications Advisory Committee AGENCY: National Protection... Committee Meeting. SUMMARY: The President's National Security Telecommunications Advisory Committee (NSTAC... Communications System, National Protection and Programs Directorate, Department of Homeland Security, 245 Murray...

  18. 77 FR 6813 - President's National Security Telecommunications Advisory Committee

    Science.gov (United States)

    2012-02-09

    ... SECURITY President's National Security Telecommunications Advisory Committee AGENCY: National Protection... Committee Teleconference. SUMMARY: The President's National Security Telecommunications Advisory Committee..., National Protection and Programs Directorate, Department of Homeland Security, 245 Murray Lane, Mail Stop...

  19. 75 FR 3913 - President's National Security Telecommunications Advisory Committee

    Science.gov (United States)

    2010-01-25

    ... SECURITY National Communications System President's National Security Telecommunications Advisory Committee...: The President's National Security Telecommunications Advisory Committee (NSTAC) will be meeting by... or write the Deputy Manager, National Communications System, Department of Homeland Security, 245...

  20. Zero-ODP Refrigerants for Low Tonnage Centrifugal Chiller Systems

    National Research Council Canada - National Science Library

    Gui, Fulin

    1996-01-01

    ..., HFC-236cb, HFC-236fa, HFC-245cb, and HFC-254cb, for centrifugal chiller applications. We took into account the thermodynamic properties of the refrigerant and aerodynamic properties of the impeller compression process to this evaluation...

  1. Comparing Aphidius colemani and Aphidius matricariae on Myzus persicae ssp. nicotianae in sweet pepper

    NARCIS (Netherlands)

    Schelt, van J.; Hoogerbrugge, H.; Becker, N.; Messelink, G.J.; Bolckmans, K.

    2011-01-01

    Working Group “Integrated Control in Protected crops, Temperate Climate”. Preceedings of the Meeting at Sutton Scotney (United Kingdom), 18 – 22 September, 2011. Editor: Irene Vänninen. ISBN 978-92-9067-245-6 [VIII + 198 pp.].

  2. Survey of tarsonemid mites in greenhouse grown gerberas in The Netherlands

    NARCIS (Netherlands)

    Pijnakker, J.; Leman, A.

    2011-01-01

    Working Group “Integrated Control in Protected crops, Temperate Climate”. Preceedings of the Meeting at Sutton Scotney (United Kingdom), 18 – 22 September, 2011. Editor: Irene Vänninen. ISBN 978-92-9067-245-6 [VIII + 198 pp.].

  3. Biological control of tarsonemid mites in greenhouse grown gerberas

    NARCIS (Netherlands)

    Pijnakker, J.; Leman, A.

    2011-01-01

    Working Group “Integrated Control in Protected crops, Temperate Climate”. Preceedings of the Meeting at Sutton Scotney (United Kingdom), 18 – 22 September, 2011. Editor: Irene Vänninen. ISBN 978-92-9067-245-6 [VIII + 198 pp.].

  4. Combined use of a mulch layer and the soil-dwelling predatory mite Macrocheles robustulus (Berlese) enhance the biological control of sciarids in potted plants

    NARCIS (Netherlands)

    Grosman, A.H.; Messelink, G.J.; Groot, de E.B.

    2011-01-01

    Working Group “Integrated Control in Protected crops, Temperate Climate”. Preceedings of the Meeting at Sutton Scotney (United Kingdom), 18 – 22 September, 2011. Editor: Irene Vänninen. ISBN 978-92-9067-245-6 [VIII + 198 pp.].

  5. Generalist predatory bugs control aphids in sweet pepper

    NARCIS (Netherlands)

    Messelink, G.J.; Bloemhard, C.M.J.; Kok, L.W.; Janssen, A.

    2011-01-01

    Working Group “Integrated Control in Protected crops, Temperate Climate”. Preceedings of the Meeting at Sutton Scotney (United Kingdom), 18 – 22 September, 2011. Editor: Irene Vänninen. ISBN 978-92-9067-245-6 [VIII + 198 pp.].

  6. 76 FR 9786 - NIOSH Dose Reconstruction Program Ten-Year Review-Phase I Report on Customer Service; Request for...

    Science.gov (United States)

    2011-02-22

    ..., Robert A. Taft Laboratories, 4676 Columbia Parkway, MS-C34, Cincinnati, Ohio 45226. All material... INFORMATION CONTACT: Chia Chang, NIOSH, 395 E St SW., Washington, DC 20201, 202-245-0625. John Howard...

  7. Effectiveness of pesticides and potential for biological control of the tomato leaf minerTuta absoluta (Meyrick) (Lepidoptera: Gelechiidae) in Europe

    NARCIS (Netherlands)

    Linden, van der A.; Staaij, van der M.

    2011-01-01

    Working Group “Integrated Control in Protected crops, Temperate Climate”. Preceedings of the Meeting at Sutton Scotney (United Kingdom), 18 – 22 September, 2011. Editor: Irene Vänninen. ISBN 978-92-9067-245-6 [VIII + 198 pp.].

  8. Disease: H01646 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available e the first-line antidepressant drug treatment of depression and replaced tricyclic antidepressants (TCA) an... randomized clinical trials of SSRI treatment of depression. ... JOURNAL ... BMC Psychiatry 14:245 (2014) DOI:10

  9. NIHSeniorHealth

    Medline Plus

    Full Text Available ... 03 Play next Play now Eating for Your Health - Duration: 5 minutes, 3 seconds. 6,822 views ... 30+ more This item has been hidden Complementary Health Approaches Play all 2:45 Play next Play ...

  10. How fat works

    National Research Council Canada - National Science Library

    Wood, Philip A. (Philip Allen)

    2006-01-01

    ... for Making Good Decisions 192 IV. The Environment 17. Nutrient Labeling 203 18. 209 Alternative Medicine and Fad Diets 19. 214 Media Coverage of Health Research 225 Glossary 231 References Index 245 Ackn...

  11. Pramana – Journal of Physics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    maximally entangled state · M Genovese G Brida C .... pp 245-265 Quantum optics, coherent states and geometric phases. Operator properties of .... Quantum entanglement and quantum computational algorithms · Arvind · More Details Abstract ...

  12. 76 FR 59186 - Renewal of Rail Energy Transportation Advisory Committee

    Science.gov (United States)

    2011-09-23

    ... FURTHER INFORMATION CONTACT: Scott M. Zimmerman, Designated Federal Official, at (202) 245-0386..., 2011. By the Board. Rachel D. Campbell, Director, Office of Proceedings. Andrea Pope-Matheson...

  13. 77 FR 71478 - Notice of Rail Energy Transportation Advisory Committee Vacancies

    Science.gov (United States)

    2012-11-30

    ... INFORMATION CONTACT: Scott M. Zimmerman at 202-245-0386. [Assistance for the hearing impaired is available.... 11121. By the Board. Decided: November 26, 2012. Rachel D. Campbell, Director, Office of Proceedings...

  14. 77 FR 8947 - Notice of Rail Energy Transportation Advisory Committee Meeting

    Science.gov (United States)

    2012-02-15

    ... Street SW., Washington, DC 20423. FOR FURTHER INFORMATION CONTACT: Scott M. Zimmerman (202) 245-0386....C. 11101; 49 U.S.C. 11121. Decided: February 10, 2012. By the Board, Rachel D. Campbell, Director...

  15. 77 FR 54659 - Notice of Rail Energy Transportation Advisory Committee Meeting

    Science.gov (United States)

    2012-09-05

    ...., Washington, DC 20423. FOR FURTHER INFORMATION CONTACT: Scott M. Zimmerman (202) 245-0386. [Assistance for the.... 11101; 49 U.S.C. 11121. Decided: August 29, 2012. By the Board, Rachel D. Campbell, Director, Office of...

  16. 75 FR 10551 - Notice of Rail Energy Transportation Advisory Committee Meeting

    Science.gov (United States)

    2010-03-08

    ... INFORMATION CONTACT: Scott M. Zimmerman (202) 245-0202. Assistance for the hearing impaired is available.... 721, 49 U.S.C. 11101; 49 U.S.C. 11121. Decided: March 3, 2010. By the Board, Rachel D. Campbell...

  17. 77 FR 73114 - BNSF Railway Company-Temporary Trackage Rights Exemption-Union Pacific Railroad Company

    Science.gov (United States)

    2012-12-07

    ... FURTHER INFORMATION CONTACT: Scott M. Zimmerman, (202) 245-0386. ] [Assistance for the hearing impaired is..., 2012. By the Board, Rachel D. Campbell, Director, Office of Proceedings. Jeffrey Herzig, Clearance...

  18. 76 FR 16036 - Notice of Rail Energy Transportation Advisory Committee Meeting

    Science.gov (United States)

    2011-03-22

    ...-0001. FOR FURTHER INFORMATION CONTACT: Scott M. Zimmerman (202) 245-0386. Assistance for the hearing....C. 11101; 49 U.S.C. 11121. Decided: March 16, 2011. By the Board, Rachel D. Campbell, Director...

  19. Full Data of Yeast Interacting Proteins Database (Annotation Updated Version) - Yeast Interacting Proteins Database | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available ast two-hybrid method. (Fields, S. & Song, O. K. (1989) Nature (London) 340, 245-246.) Data analysis method As the indicator of relia...bility of the interactions obtained by the experiment, t

  20. Core Data of Yeast Interacting Proteins Database (Annotation Updated Version) - Yeast Interacting Proteins Database | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available hod As the indicator of reliability of the interactions obtained by the experiment, the literature informati...(Fields, S. & Song, O. K. (1989) Nature (London) 340, 245-246.) Data analysis met

  1. About Military Sexual Trauma

    Medline Plus

    Full Text Available ... the types of incidents that constitute MST, the effects of MST on survivors and the services available ... Health Administration 2,673 views 2:14 Prolonged Exposure for PTSD - Duration: 2:45. Veterans Health Administration ...

  2. 276----14 Dec 2009 [Final version].indd

    African Journals Online (AJOL)

    2009-12-14

    Dec 14, 2009 ... He argues, however, that this 'is a concept that unites an understanding of ...... of masculinity when the Roman and Greek understandings .... potentially undermine the colonizing hegemony' (Holmberg & Winninge 2008:245).

  3. psychosocial aspect of anterior tooth discoloration among

    African Journals Online (AJOL)

    color can lead to such problem especially if it affects anterior teeth. Objective: This study ... four (24.5%) participants perceived that their anterior teeth were discolored, 65 ... Negative emotions such as fear, anxiety, depression and timidity are ...

  4. NIHSeniorHealth

    Medline Plus

    Full Text Available ... 03 Play next Play now Eating for Your Health - Duration: 5 minutes, 3 seconds. 6,909 views ... 30+ more This item has been hidden Complementary Health Approaches Play all 2:45 Play next Play ...

  5. NIHSeniorHealth

    Medline Plus

    Full Text Available ... 03 Play next Play now Eating for Your Health - Duration: 5 minutes, 3 seconds. 6,902 views ... 30+ more This item has been hidden Complementary Health Approaches Play all 2:45 Play next Play ...

  6. Gclust Server: 89129 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available Sequences(245) 460 Constituent of 66S pre-ribosomal particles, required for maturation of the large ribosomal...Representative annotation Constituent of 66S pre-ribosomal particles, required for maturation of the large ribosomal

  7. Pharmaceuticals, benzene, toluene and chlorobenzene removal from contaminated groundwater by combined UV/H2O2 photo-oxidation and aeration

    Czech Academy of Sciences Publication Activity Database

    Lhotský, O.; Krákorová, Eva; Mašín, P.; Žebrák, R.; Linhartová, Lucie; Křesinová, Zdena; Kašlík, J.; Steinová, J.; Rodsand, T.; Filipová, Alena; Petrů, K.; Kroupová, K.; Cajthaml, Tomáš

    2017-01-01

    Roč. 120, SEP 1 2017 (2017), s. 245-255 ISSN 0043-1354 Institutional support: RVO:61388971 Keywords : Pharmaceuticals * BTEX * Chlorobenzene Subject RIV: EE - Microbiology, Virology Impact factor: 6.942, year: 2016

  8. 76 FR 64885 - Defense Federal Acquisition Regulation Supplement: Reporting of Government-Furnished Property...

    Science.gov (United States)

    2011-10-19

    ... items subject to reporting, the intent of the rule is to move away from strict reporting by dollar value... FAR 52.245-1: (1) Parent UII. (2) Category code, if applicable (``ST'' for special tooling, ``STE...

  9. 2005 Puget Sound LiDAR Consortium (PSLC) Topographic LiDAR: Olympic Peninsula

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Terrapoint collected Light Detection and Ranging (LiDAR) data for the Olympic Peninsula project of 2005, totaling approximately 114.59 sq mi: 24.5 for Clallam...

  10. NIHSeniorHealth

    Medline Plus

    Full Text Available ... 03 Play next Play now Eating for Your Health - Duration: 5 minutes, 3 seconds. 6,904 views ... 30+ more This item has been hidden Complementary Health Approaches Play all 2:45 Play next Play ...

  11. NIHSeniorHealth

    Medline Plus

    Full Text Available ... 03 Play next Play now Eating for Your Health - Duration: 5 minutes, 3 seconds. 6,747 views ... 30+ more This item has been hidden Complementary Health Approaches Play all 2:45 Play next Play ...

  12. Serious games for higher education: a framework for reducing design complexity

    OpenAIRE

    Westera, Wim; Nadolski, Rob; Hummel, Hans; Wopereis, Iwan

    2008-01-01

    Westera, W., Nadolski, R., Hummel, H. G. K., & Wopereis, I. (2008). Serious games for higher education: a framework for reducing design complexity. Journal of Computer Assisted Learning, 24(5), 420-432.

  13. NIHSeniorHealth

    Medline Plus

    Full Text Available ... 03 Play next Play now Eating for Your Health - Duration: 5 minutes, 3 seconds. 6,816 views ... 30+ more This item has been hidden Complementary Health Approaches Play all 2:45 Play next Play ...

  14. Processing of the insulin-like growth factor-II-mannose 6-phosphate receptor in isolated liver subcellular fractions

    National Research Council Canada - National Science Library

    Tahiri K; Cam L; Desbuquois B; Chauvet G

    2001-01-01

    .... The receptor in plasma membrane fractions differed from that in Golgi-endosomal fractions by: (i) a lower molecular size upon reducing polyacrylamide gel electrophoresis (245 vs. 255 kDa); (ii...

  15. The impact of information quantity and strength of relationship ...

    African Journals Online (AJOL)

    ONOS

    2010-01-25

    2009). Genomic selection: prediction of accuracy and maximization of long term response. Genetica 136:245-257. Goddard ME, Hayes BJ (2007). Genomic selection. J. Anim. Breed. Genet. 124: 323-330. Habier D, Fernando RL, ...

  16. NIHSeniorHealth

    Medline Plus

    Full Text Available ... 03 Play next Play now Eating for Your Health - Duration: 5 minutes, 3 seconds. 6,837 views ... 30+ more This item has been hidden Complementary Health Approaches Play all 2:45 Play next Play ...

  17. Main: TACBBFNTEAS4 [PLACE

    Lifescience Database Archive (English)

    Full Text Available ty; EAS is involved in sesquiterpene phytoalexin biosynthesis; Found between -245 and -232; Appears to function as a silence...cBBF; sesquiterpene; phytoalexin; silencer; repressor; tobacco (Nicotiana tabacum) ACTCTACAGTACTC ...

  18. in northern Guinea Savannah of Nigeria

    African Journals Online (AJOL)

    In field trials conducted at Samaru (11 11 07 36'E) in 2003 and 2004 wet seasons in Northern Guinea Savannah of Nigeria, Variety B301 and derivatives of its crosses with IT84S 2246-4 (IT90K-59 and IT90K-76 did not support Alectra emergence. Varieties IT89KD-245-1 and IT89KD 245, both of which are derivatives of ...

  19. Drug: D09388 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D09388 Drug Tasimelteon (USAN/INN) C15H19NO2 245.1416 245.3169 D09388.gif Sleep dis... 1A [HSA:4543] [KO:K04285] Tasimelteon D09388 Tasimelteon (USAN/INN) melatonin receptor 1B [HSA:4544] [KO:K04286] Tasimelt...eon D09388 Tasimelteon (USAN/INN) CAS: 609799-22-6 PubChem: 96026068 LigandBox: D09388 ATOM 18

  20. Window for Optimal Frequency Operation and Reliability of 3DEG and 2DEG Channels for Oxide Microwave MESFETs and HFETs

    Science.gov (United States)

    2016-04-01

    integrator and boxcar averager module (Stanford Research Systems) SR240A – quad fast amplifier (Stanford Research Systems) SR245 – computer interface... average 1 hour per response, including the time for reviewing instructions, searching existing data sources, gathering and maintaining the data...integrator and boxcar module SR250, Quad fast amplifier SR240A, and computer interface module SR245). Cascaded wideband (DC–350 MHz) SR240A

  1. 75 FR 5681 - Airworthiness Directives; Bell Helicopter Textron, Inc. Model 205B and 212 Helicopters

    Science.gov (United States)

    2010-02-04

    ... stations 24.5 and 40.0 for an edge void, corrosion, or a crack, using a 3x power or higher magnifying glass... blade stations 24.5 and 40.0 for any corrosion or a crack using a 3x power or higher magnifying glass. If a crack is found in the paint finish, removing the paint and re-inspecting the M/R blade is...

  2. Dicty_cDB: SHJ402 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ): 0 length of query: 245 length of database: 80,480,566 effective HSP length: 17 effective length of query: 228 effective... length of database: 78,821,179 effective search space: 17971228812 effective search space use...n 10.0: 0 length of query: 245 length of database: 61,770,833,749 effective HSP length: 22 effective... length of query: 223 effective length of database: 60,514,794,943 effective search space: 13494799272289 effectiv

  3. The Strategist and the Web: A Guide to Internet Resources.

    Science.gov (United States)

    1996-02-20

    author of more than fifty articles and monographs on world politics and national security affairs. He can be contacted at (717) 245- 3822, FAX 245...specifically with think tanks and research organizations focusing on world politics and security policy. International Security Network and IANWeb are...keep up with key academic journals covering world politics and security issues. A number of them have home pages providing subscription information

  4. AcEST: BP915306 [AcEST

    Lifescience Database Archive (English)

    Full Text Available mona... 29 9.6 sp|Q9N2H0|CY24A_TURTR Cytochrome b-245 light chain OS=Tursiops t... 29 9.6 >sp|Q00681|STCJ_EM...EF 238 >sp|Q9N2H0|CY24A_TURTR Cytochrome b-245 light chain OS=Tursiops truncatus

  5. ALENCE OF DIABETES LITUS AND IMPAIRED GLUCOSE ...

    African Journals Online (AJOL)

    e 2.45% and 2.7% respectively. The age-adjusted valences using a standard world population were 4.5% nfidence interval (CI) 1.54 -7.42) and 5.1% (CI 2.45- 5.51) diabetes ... majority of the adult male population(> 20 years of age) work .... Age and sex distribution of subjects with diabetes and impaired glucose tolerance.

  6. Above-threshold structure in {sup 244}Cm neutron-induced fission cross section

    Energy Technology Data Exchange (ETDEWEB)

    Maslov, V.M. [Radiation Physics and Chemistry Problems Inst., Minsk-Sosny (Belarus)

    1997-03-01

    The quasi-resonance structure appearing above the fission threshold in neutron-induced fission cross section of {sup 244}Cm(n,f) is interpreted. It is shown to be due to excitation of few-quasiparticle states in fissioning {sup 245}Cm and residual {sup 244}Cm nuclides. The estimate of quasiparticle excitation thresholds in fissioning nuclide {sup 245}Cm is consistent with pairing gap and fission barrier parameters. (author)

  7. ALENCE OF DIABETES LITUS AND IMPAIRED GLUCOSE ...

    African Journals Online (AJOL)

    Its. The crude prevalences for diabetes mellitus and IGT e 2.45% and 2.7% respectively. The age-adjusted valences using a standard world population were 4.5% nfidence interval (CI) 1.54 -7.42) and 5.1% (CI 2.45- 5.51) diabetes and IGT respectively. The prevalence of diabetes similar in male and female workers (P ...

  8. Dicty_cDB: VHN631 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available l=Elongation factor 2; Short=EF-2;... 243 6e-63 AF240828_1( AF240828 |pid:none) Scolopendra polymorpha elong..... 249 1e-64 AY305513_1( AY305513 |pid:none) Nebalia hessleri voucher Nhe elong... 245 2e-63 AY310293_1( AY310293 |pid:none) Scolopen...dra viridis voucher Svi el... 245 2e-63 AF240831_1( AF240831 |pid:none) Tanystylum

  9. Chemosensing ability of hydroxynaphthylidene derivatives of ...

    Indian Academy of Sciences (India)

    For absorption titrations, the effective concentration of receptors was maintained at 33 μM. 2.2 Synthesis and characterization of L1. To a solution of 2-acetyl pyrrole (2.5 mL, 24.5 mmol) in 50mL methanol, hydrazine hydrate (1.14mL,. 24.5 mmol) was added and the reaction mixture was stirred and heated under reflux for 12h ...

  10. Bush control in grassland by aerial spraying | F | African Journal of ...

    African Journals Online (AJOL)

    The results are reported of three trials in which chemicals were applied from an aircraft to control bush on severely infested natural grassland in Mozambique. Acacia nilotica, A. borleae and Dichrostachys cinerea were killed by a mixture of 2,4-D and 2,4,5-T at 1,8 kg/ha, by 2,4,5-T alone at 1,8 kg/ha and by silvex at 0,5 ...

  11. OSSOS. IV. Discovery of a Dwarf Planet Candidate in the 9:2 Resonance with Neptune

    Science.gov (United States)

    Bannister, Michele T.; Alexandersen, Mike; Benecchi, Susan; Chen, Ying-Tung; Delsanti, Audrey; Fraser, Wesley C.; Gladman, Brett; Granvik, Mikael; Grundy, Will M.; Guilbert-Lepoutre, Aurelie; hide

    2016-01-01

    We report the discovery and orbit of a new dwarf planet candidate, 2015 RR245, by the Outer Solar System Origins Survey (OSSOS). The orbit of 2015 RR245 is eccentric (e 0.586), with a semimajor axis near 82 au, yielding a perihelion distance of 34 au. 2015 RR245 has g - r 0.59 +/- 0.11 and absolute magnitude Hr 3.6 +/- 0.1; for an assumed albedo of pV 12, the object has a diameter of approximately 670 km. Based on astrometric measurements from OSSOS and Pan-STARRS1, we find that 2015 RR245 is securely trapped on ten-megayear timescales in the 9:2 mean-motion resonance with Neptune. It is the first trans-Neptunian object (TNO) identied in this resonance. On hundred-megayear timescales, particles in 2015 RR245-like orbits depart and sometimes return to the resonance, indicating that 2015 RR245 likely forms part of the long-lived metastable population of distant TNOs that drift between resonance sticking and actively scattering via gravitational encounters with Neptune. The discovery of a 9:2 TNO stresses the role of resonances in the long-term evolution of objects in the scattering disk and reinforces the view that distant resonances are heavily populated in the current solar system. This object further motivates detailed modeling of the transient sticking population.

  12. Compensated bismuth-loaded plastic scintillators for neutron detection using low-energy pseudo-spectroscopy

    Energy Technology Data Exchange (ETDEWEB)

    Dumazert, Jonathan, E-mail: jonathan.dumazert@cea.fr [CEA, LIST, Laboratoire Capteurs Architectures Electroniques, 91191 Gif-sur-Yvette (France); Coulon, Romain; Bertrand, Guillaume H.V.; Normand, Stéphane [CEA, LIST, Laboratoire Capteurs Architectures Electroniques, 91191 Gif-sur-Yvette (France); Méchin, Laurence [CNRS, UCBN, Groupe de Recherche en Informatique, Image, Automatique et Instrumentation de Caen, 14050 Caen (France); Hamel, Matthieu [CEA, LIST, Laboratoire Capteurs Architectures Electroniques, 91191 Gif-sur-Yvette (France)

    2016-05-21

    Gadolinium-covered modified plastic scintillators show a high potential for the deployment of cost-effective neutron detectors. Taking advantage of the low-energy photon and electron signature of thermal neutron captures in gadolinium-155 and gadolinium-157 however requires a background correction. In order to display a trustable rate, dual compensation schemes appear as an alternative to Pulse Shape Discrimination. This paper presents the application of such a compensation scheme to a two-bismuth loaded plastic scintillator system. A detection scintillator interacts with incident photon and fast neutron radiations and is covered with a gadolinium converter to become thermal neutron-sensitive as well. In the meantime, an identical compensation scintillator, covered with terbium, solely interacts with the photon and fast neutron part of incident radiations. After the acquisition and the treatment of the counting signals from both sensors, a hypothesis test determines whether the resulting count rate after subtraction falls into statistical fluctuations or provides a robust image of neutron activity. A laboratory prototype is tested under both photon and neutron radiations, allowing us to investigate the performance of the overall compensation system. The study reveals satisfactory results in terms of robustness to a cesium-137 background and in terms of sensitivity in presence of a californium-252 source.

  13. Systematic studies of the fundamental chemistry of pyrochlore oxides. An{sub 2}Zr{sub 2}O{sub 7} [An=Pu, Am, Cm, Bk and Cf

    Energy Technology Data Exchange (ETDEWEB)

    Haire, R.G.; Assefa, Z. [Oak Ridge National Laboratory, Oak Ridge, TN (United States); Raison, P.E. [Commissariat a l' Energie Atomique, CEA-Cadarache DRN/DEC/SPUA/LACA (France)

    2002-11-01

    Our efforts to pursue the fundamental science of actinide pyrochlore oxides, An{sub 2}Zr{sub 2}O{sub 7}, (An=plutonium through californium), are presented. We have addressed their structural and chemical behavior via X-ray diffraction, Raman spectroscopy and by considering the pseudo-oxidation potentials of the actinides. The structure, fundamental chemistry, ionic radii and the electronic configuration of the specific actinide involved in these oxide systems all have a significant impact on their science. We are also exploring a calculational approach based on valence-bond relationships to assess the position of the oxygen atoms located at the general crystallographic position. The oxygen position is important regarding the chemical behavior and thermal stability of these materials. Also considered is the structural stability of the materials regarding self-irradiation, and with some compounds, their resistance towards oxidation. These aspects will be discussed using a systematic evaluation of the five-actinide systems together with comparable lanthanide systems studied. (author)

  14. 1982 US-CEC neutron personnel dosimetry intercomparison study

    Energy Technology Data Exchange (ETDEWEB)

    Swaja, R.E.; Sims, C.S.; Greene, R.T.; Schraube, H.; Burger, G.

    1983-11-01

    A neutron personnel dosimetry intercomparison study was conducted during April 19-23, 1982, as a joint effort between the United States and the Commission of European Communities. Dosimeters from 48 participating agencies were mounted on cylindrical phantoms and exposed to a range of low-level dose equivalents (0.48-13.91 mSv neutron and 0.02-1.32 mSv gamma) in nine different radiation fields. Exposure conditions considered in this study included four mixed-field spectra produced using the Health Physics Research Reactor, four monoenergetic neutron fields generated by accelerators, and one 15-cm D/sub 2/O-moderated californium source spectrum. In general, neutron results reported by the participating agencies were consistent with expected dosimeter performance based on energy response characteristics of the detection systems. Albedo dosimeters, which were the most popular neutron monitoring systems used in this study, provided the best overall accuracy for all exposure conditions. Film, Cr-39 recoil track, and Th-232 fission track systems generally underestimated dose equivalents relative to reference values. Associated gamma measurements showed that TLD monitors produced more accurate results than film dosimeters although both systems overestimated gamma dose equivalents in mixed radiation fields. 24 references, 10 figures, 19 tables.

  15. Application of the backward extrapolation method to pulsed neutron sources

    Energy Technology Data Exchange (ETDEWEB)

    Talamo, Alberto; Gohar, Yousry

    2018-01-01

    Particle detectors operated in pulse mode are subjected to the dead-time effect. When the average of the detector counts is constant over time, correcting for the dead-time effect is simple and can be accomplished by analytical formulas. However, when the average of the detector counts changes over time it is more difficult to take into account the dead-time effect. When a subcritical nuclear assembly is driven by a pulsed neutron source, simple analytical formulas cannot be applied to the measured detector counts to correct for the dead-time effect because of the sharp change of the detector counts over time. This work addresses this issue by using the backward extrapolation method. The latter can be applied not only to a continuous (e.g. californium) external neutron source but also to a pulsed external neutron source (e.g. by a particle accelerator) driving a subcritical nuclear assembly. The backward extrapolation method allows to obtain from the measured detector counts both the dead-time value and the real detector counts.

  16. The cross sections of fusion-evaporation reactions: the most promising route to superheavy elements beyond Z=118

    Science.gov (United States)

    Jadambaa, Khuyagbaatar

    2017-11-01

    The synthesis of superheavy elements beyond oganesson (Og), which has atomic number Z = 118, is currently one of the main topics in nuclear physics. An absence of sufficient amounts of target material with atomic numbers heavier than californium (Z = 98) forces the use of projectiles heavier than 48Ca (Z = 20), which has been successfully used for the discoveries of elements with Z = 114 - 118 in complete fusion reactions. Experimental cross sections of 48Ca with actinide targets behave very differently to "cold" and "hot" fusion-evaporation reactions, where doubly-magic lead and deformed actinides are used as targets, respectively. The known cross sections of these reactions have been analysed compared to calculated fission barriers. It has been suggested that observed discrepancies between the cross sections of 48Ca-induced and other fusionevaporation reactions originate from the shell structure of the compound nucleus, which lies in the island of the stability. Besides scarcely known data on other reactions involving heavier projectiles, the most promising projectile for the synthesis of the elements beyond Og seems to be 50Ti. However, detailed studies of 50Ti, 54Cr, 58Fe and 64Ni-induced reactions are necessary to be performed in order to fully understand the complexities of superheavy element formation.

  17. Activation analysis of ITER blanket first wall

    Energy Technology Data Exchange (ETDEWEB)

    Lopatkin, A.; Muratov, V. [RDIPE (NIKIET), Moscow (Russian Federation)

    1998-09-01

    To analyze the activation of ITER blanket structural components, the authors have prepared the AUCDAS code that calculates changes in nuclide concentrations and radioactivity characteristics during neutron irradiation and during cooling. UCDAS takes into account all neutron reactions and decay types, the prepared library of constants contains nuclear data of nuclides from hydrogen to californium. A comparative analysis of the results as obtained using UCDAS code and the widely known FISPACT code is given. The analysis of decay heat, gas generation and activity of ITER blanket first wall`s structural components was carried out. The beryllium coating, copper alloy and stainless steel were analysed. Calculations were performed for the first plasma burning pulse, 6 months and 1 year of operation in accordance with the ITER scenario. The materials recommended by ITER central team and their Russian analogs were considered: TGR and B1 (beryllium coating), GlidCop AL-25 Ds and Br-MKX (copper alloy), 316LN-IG and 12Cr18Ni10Ti (stainless steel). It has been demonstrated that there is a difference in all of the considered characteristics between the above materials. It is caused by impurities which are present in the materials. The report also considers the accumulation of gases (H, D, T, He{sup 3}, He{sup 4}) in the above materials. Besides, the change in the activity of irradiated materials during the cooling of up to 10{sup 7} years was calculated. (orig.) 7 refs.

  18. Toward achieving flexible and high sensitivity hexagonal boron nitride neutron detectors

    Science.gov (United States)

    Maity, A.; Grenadier, S. J.; Li, J.; Lin, J. Y.; Jiang, H. X.

    2017-07-01

    Hexagonal boron nitride (h-BN) detectors have demonstrated the highest thermal neutron detection efficiency to date among solid-state neutron detectors at about 51%. We report here the realization of h-BN neutron detectors possessing one order of magnitude enhancement in the detection area but maintaining an equal level of detection efficiency of previous achievement. These 3 mm × 3 mm detectors were fabricated from 50 μm thick freestanding and flexible 10B enriched h-BN (h-10BN) films, grown by metal organic chemical vapor deposition followed by mechanical separation from sapphire substrates. Mobility-lifetime results suggested that holes are the majority carriers in unintentionally doped h-BN. The detectors were tested under thermal neutron irradiation from californium-252 (252Cf) moderated by a high density polyethylene moderator. A thermal neutron detection efficiency of ˜53% was achieved at a bias voltage of 200 V. Conforming to traditional solid-state detectors, the realization of h-BN epilayers with enhanced electrical transport properties is the key to enable scaling up the device sizes. More specifically, the present results revealed that achieving an electrical resistivity of greater than 1014 Ωṡcm and a leakage current density of below 3 × 10-10 A/cm2 is needed to fabricate large area h-BN detectors and provided guidance for achieving high sensitivity solid state neutron detectors based on h-BN.

  19. Design of the low energy beam transport line between CARIBU and the EBIS charge breeder

    Energy Technology Data Exchange (ETDEWEB)

    Perry, A., E-mail: aperry4@hawk.iit.edu [Argonne National Laboratory, Argonne, IL 60439, USA and Illinois Institute of Technology, Chicago, IL 60616 (United States); Ostroumov, P. N.; Barcikowski, A.; Dickerson, C.; Kondrashev, S. A.; Mustapha, B.; Savard, G. [Argonne National Laboratory, Argonne, IL 60439 (United States)

    2015-01-09

    An Electron Beam Ion Source Charge Breeder (EBIS-CB) has been developed to breed radioactive beams from the CAlifornium Rare Isotope Breeder Upgrade (CARIBU) facility at ATLAS. The EBIS-CB will replace the existing ECR charge breeder to increase the intensity and improve the purity of reaccelerated radioactive ion beams. The EBIS-CB is in the final stage of off-line commissioning. Currently, we are developing a low energy beam transport (LEBT) system to transfer CARIBU beams to the EBIS-CB. As was originally planned, an RFQ cooler-buncher will precede the EBIS-CB. Recently, it was decided to include a multi-reflection time-of-flight (MR-TOF) mass-spectrometer following the RFQ. MR-TOF is a relatively new technology used to purify beams with a mass-resolving power up to 3×10{sup 5} as was demonstrated in experiments at CERN/ISOLDE. Very high purity singly-charged radioactive ion beams will be injected into the EBIS for charge breeding and due to its inherent properties, the EBIS-CB will maintain the purity of the charge bred beams. Possible contamination of residual gas ions will be greatly suppressed by achieving ultra-high vacuum in the EBIS trap. This paper will present and discuss the design of the LEBT and the overall integration of the EBIS-CB into ATLAS.

  20. Analysis of patents on mining technology

    Energy Technology Data Exchange (ETDEWEB)

    Menyailo, N.I.; Grishchenko, A.N.; Ratner, M.V.; Kobylyanskii, A.Ya.; Tyshlek, E.G.

    1987-09-01

    Analyses the current work being carried out with the aim of developing and perfecting coal mining technology with regard to improving safety and working conditions (equipment is currently responsible for 6.3% of all hazards in coal mines) by examining patents of class ES 21 S produced in the USSR, USA, UK, FRG, Japan and France between 1970-1984. By far the majority of patents is concerned with improving technology and productivity and a disappointing number deals with safety matters (only 7.2% of the patents for new cutter loader designs deal with dust suppression systems and most of these come from the FRG; no patents for powered mining complexes deal with the problem of noise and vibration reduction). The patents with the most direct relevance to health and safety concern remote control devices for mining equipment, in particular, devices based on radioactive isotopes (e.g. cesium-137, americum-241, selenium-75, californium-252) but measures for monitoring them and protecting against them are not found.

  1. MinT: Middleware for Cooperative Interaction of Things

    Directory of Open Access Journals (Sweden)

    Soobin Jeon

    2017-06-01

    Full Text Available This paper proposes an Internet of Things (IoT middleware called Middleware for Cooperative Interaction of Things (MinT. MinT supports a fully distributed IoT environment in which IoT devices directly connect to peripheral devices easily construct a local or global network, and share their data in an energy efficient manner. MinT provides a sensor abstract layer, a system layer and an interaction layer. These enable integrated sensing device operations, efficient resource management, and active interconnection between peripheral IoT devices. In addition, MinT provides a high-level API to develop IoT devices easily for IoT device developers. We aim to enhance the energy efficiency and performance of IoT devices through the performance improvements offered by MinT resource management and request processing. The experimental results show that the average request rate increased by 25% compared to Californium, which is a middleware for efficient interaction in IoT environments with powerful performance, an average response time decrease of 90% when resource management was used, and power consumption decreased by up to 68%. Finally, the proposed platform can reduce the latency and power consumption of IoT devices.

  2. MinT: Middleware for Cooperative Interaction of Things

    Science.gov (United States)

    Jeon, Soobin; Jung, Inbum

    2017-01-01

    This paper proposes an Internet of Things (IoT) middleware called Middleware for Cooperative Interaction of Things (MinT). MinT supports a fully distributed IoT environment in which IoT devices directly connect to peripheral devices easily construct a local or global network, and share their data in an energy efficient manner. MinT provides a sensor abstract layer, a system layer and an interaction layer. These enable integrated sensing device operations, efficient resource management, and active interconnection between peripheral IoT devices. In addition, MinT provides a high-level API to develop IoT devices easily for IoT device developers. We aim to enhance the energy efficiency and performance of IoT devices through the performance improvements offered by MinT resource management and request processing. The experimental results show that the average request rate increased by 25% compared to Californium, which is a middleware for efficient interaction in IoT environments with powerful performance, an average response time decrease of 90% when resource management was used, and power consumption decreased by up to 68%. Finally, the proposed platform can reduce the latency and power consumption of IoT devices. PMID:28632182

  3. An Account of Oak Ridge National Laboratory's Thirteen Research Reactors

    Energy Technology Data Exchange (ETDEWEB)

    Rosenthal, Murray Wilford [ORNL

    2009-08-01

    The Oak Ridge National Laboratory has built and operated 13 nuclear reactors in its 66-year history. The first was the graphite reactor, the world's first operational nuclear reactor, which served as a plutonium production pilot plant during World War II. It was followed by two aqueous-homogeneous reactors and two red-hot molten-salt reactors that were parts of power-reactor development programs and by eight others designed for research and radioisotope production. One of the eight was an all-metal fast burst reactor used for health physics studies. All of the others were light-water cooled and moderated, including the famous swimming-pool reactor that was copied dozens of times around the world. Two of the reactors were hoisted 200 feet into the air to study the shielding needs of proposed nuclear-powered aircraft. The final reactor, and the only one still operating today, is the High Flux Isotope Reactor (HFIR) that was built particularly for the production of californium and other heavy elements. With the world's highest flux and recent upgrades that include the addition of a cold neutron source, the 44-year-old HFIR continues to be a valuable tool for research and isotope production, attracting some 500 scientific visitors and guests to Oak Ridge each year. This report describes all of the reactors and their histories.

  4. Neutron Detector Signal Processing to Calculate the Effective Neutron Multiplication Factor of Subcritical Assemblies

    Energy Technology Data Exchange (ETDEWEB)

    Talamo, Alberto [Argonne National Lab. (ANL), Argonne, IL (United States). Nuclear Engineering Division; Gohar, Yousry [Argonne National Lab. (ANL), Argonne, IL (United States). Nuclear Engineering Division

    2016-06-01

    This report describes different methodologies to calculate the effective neutron multiplication factor of subcritical assemblies by processing the neutron detector signals using MATLAB scripts. The subcritical assembly can be driven either by a spontaneous fission neutron source (e.g. californium) or by a neutron source generated from the interactions of accelerated particles with target materials. In the latter case, when the particle accelerator operates in a pulsed mode, the signals are typically stored into two files. One file contains the time when neutron reactions occur and the other contains the times when the neutron pulses start. In both files, the time is given by an integer representing the number of time bins since the start of the counting. These signal files are used to construct the neutron count distribution from a single neutron pulse. The built-in functions of MATLAB are used to calculate the effective neutron multiplication factor through the application of the prompt decay fitting or the area method to the neutron count distribution. If the subcritical assembly is driven by a spontaneous fission neutron source, then the effective multiplication factor can be evaluated either using the prompt neutron decay constant obtained from Rossi or Feynman distributions or the Modified Source Multiplication (MSM) method.

  5. Fast neutron tomography with real-time pulse-shape discrimination in organic scintillation detectors

    Energy Technology Data Exchange (ETDEWEB)

    Joyce, Malcolm J., E-mail: m.joyce@lancaster.ac.uk [Department of Engineering, Lancaster University, Lancaster, Lancashire LA1 4YW (United Kingdom); Agar, Stewart [Department of Engineering, Lancaster University, Lancaster, Lancashire LA1 4YW (United Kingdom); Aspinall, Michael D. [Hybrid Instruments Ltd., Gordon Manley Building, Lancaster Environment Centre, Lancaster University, Lancaster LA1 4YW (United Kingdom); Beaumont, Jonathan S.; Colley, Edmund; Colling, Miriam; Dykes, Joseph; Kardasopoulos, Phoevos; Mitton, Katie [Department of Engineering, Lancaster University, Lancaster, Lancashire LA1 4YW (United Kingdom)

    2016-10-21

    A fast neutron tomography system based on the use of real-time pulse-shape discrimination in 7 organic liquid scintillation detectors is described. The system has been tested with a californium-252 source of dose rate 163 μSv/h at 1 m and neutron emission rate of 1.5×10{sup 7} per second into 4π and a maximum acquisition time of 2 h, to characterize two 100×100×100 mm{sup 3} concrete samples. The first of these was a solid sample and the second has a vertical, cylindrical void. The experimental data, supported by simulations with both Monte Carlo methods and MATLAB®, indicate that the presence of the internal cylindrical void, corners and inhomogeneities in the samples can be discerned. The potential for fast neutron assay of this type with the capability to probe hydrogenous features in large low-Z samples is discussed. Neutron tomography of bulk porous samples is achieved that combines effective penetration not possible with thermal neutrons in the absence of beam hardening.

  6. Report on the workshop "Decay spectroscopy at CARIBU: advanced fuel cycle applications, nuclear structure and astrophysics". 14-16 April 2011, Argonne National Laboratory, USA.

    Energy Technology Data Exchange (ETDEWEB)

    Kondev, F.; Carpenter, M.P.; Chowdhury, P.; Clark, J.A.; Lister, C.J.; Nichols, A.L.; Swewryniak, D. (Nuclear Engineering Division); (Univ. of Massachusetts); (Univ. of Surrey)

    2011-10-06

    A workshop on 'Decay Spectroscopy at CARIBU: Advanced Fuel Cycle Applications, Nuclear Structure and Astrophysics' will be held at Argonne National Laboratory on April 14-16, 2011. The aim of the workshop is to discuss opportunities for decay studies at the Californium Rare Isotope Breeder Upgrade (CARIBU) of the ATLAS facility with emphasis on advanced fuel cycle (AFC) applications, nuclear structure and astrophysics research. The workshop will consist of review and contributed talks. Presentations by members of the local groups, outlining the status of relevant in-house projects and availabile equipment, will also be organized. time will also be set aside to discuss and develop working collaborations for future decay studies at CARIBU. Topics of interest include: (1) Decay data of relevance to AFC applications with emphasis on reactor decay heat; (2) Discrete high-resolution gamma-ray spectroscopy following radioactive decya and related topics; (3) Calorimetric studies of neutron-rich fission framgents using Total ABsorption Gamma-Ray Spectrometry (TAGS) technique; (4) Beta-delayed neutron emissions and related topics; and (5) Decay data needs for nuclear astrophysics.

  7. The cross sections of fusion-evaporation reactions: the most promising route to superheavy elements beyond Z=118

    Directory of Open Access Journals (Sweden)

    Jadambaa Khuyagbaatar

    2017-01-01

    Full Text Available The synthesis of superheavy elements beyond oganesson (Og, which has atomic number Z = 118, is currently one of the main topics in nuclear physics. An absence of sufficient amounts of target material with atomic numbers heavier than californium (Z = 98 forces the use of projectiles heavier than 48Ca (Z = 20, which has been successfully used for the discoveries of elements with Z = 114 - 118 in complete fusion reactions. Experimental cross sections of 48Ca with actinide targets behave very differently to “cold” and “hot” fusion-evaporation reactions, where doubly-magic lead and deformed actinides are used as targets, respectively. The known cross sections of these reactions have been analysed compared to calculated fission barriers. It has been suggested that observed discrepancies between the cross sections of 48Ca-induced and other fusionevaporation reactions originate from the shell structure of the compound nucleus, which lies in the island of the stability. Besides scarcely known data on other reactions involving heavier projectiles, the most promising projectile for the synthesis of the elements beyond Og seems to be 50Ti. However, detailed studies of 50Ti, 54Cr, 58Fe and 64Ni-induced reactions are necessary to be performed in order to fully understand the complexities of superheavy element formation.

  8. Intracavitary moderator balloon combined with (252)Cf brachytherapy and boron neutron capture therapy, improving dosimetry in brain tumour and infiltrations.

    Science.gov (United States)

    Brandão, S F; Campos, T P R

    2015-07-01

    This article proposes a combination of californium-252 ((252)Cf) brachytherapy, boron neutron capture therapy (BNCT) and an intracavitary moderator balloon catheter applied to brain tumour and infiltrations. Dosimetric evaluations were performed on three protocol set-ups: (252)Cf brachytherapy combined with BNCT (Cf-BNCT); Cf-BNCT with a balloon catheter filled with light water (LWB) and the same set-up with heavy water (HWB). Cf-BNCT-HWB has presented dosimetric advantages to Cf-BNCT-LWB and Cf-BNCT in infiltrations at 2.0-5.0 cm from the balloon surface. However, Cf-BNCT-LWB has shown superior dosimetry up to 2.0 cm from the balloon surface. Cf-BNCT-HWB and Cf-BNCT-LWB protocols provide a selective dose distribution for brain tumour and infiltrations, mainly further from the (252)Cf source, sparing the normal brain tissue. Malignant brain tumours grow rapidly and often spread to adjacent brain tissues, leading to death. Improvements in brain radiation protocols have been continuously achieved; however, brain tumour recurrence is observed in most cases. Cf-BNCT-LWB and Cf-BNCT-HWB represent new modalities for selectively combating brain tumour infiltrations and metastasis.

  9. Intracavitary moderator balloon combined with 252Cf brachytherapy and boron neutron capture therapy, improving dosimetry in brain tumour and infiltrations

    Science.gov (United States)

    Brandão, S F

    2015-01-01

    Objective: This article proposes a combination of californium-252 (252Cf) brachytherapy, boron neutron capture therapy (BNCT) and an intracavitary moderator balloon catheter applied to brain tumour and infiltrations. Methods: Dosimetric evaluations were performed on three protocol set-ups: 252Cf brachytherapy combined with BNCT (Cf-BNCT); Cf-BNCT with a balloon catheter filled with light water (LWB) and the same set-up with heavy water (HWB). Results: Cf-BNCT-HWB has presented dosimetric advantages to Cf-BNCT-LWB and Cf-BNCT in infiltrations at 2.0–5.0 cm from the balloon surface. However, Cf-BNCT-LWB has shown superior dosimetry up to 2.0 cm from the balloon surface. Conclusion: Cf-BNCT-HWB and Cf-BNCT-LWB protocols provide a selective dose distribution for brain tumour and infiltrations, mainly further from the 252Cf source, sparing the normal brain tissue. Advances in knowledge: Malignant brain tumours grow rapidly and often spread to adjacent brain tissues, leading to death. Improvements in brain radiation protocols have been continuously achieved; however, brain tumour recurrence is observed in most cases. Cf-BNCT-LWB and Cf-BNCT-HWB represent new modalities for selectively combating brain tumour infiltrations and metastasis. PMID:25927876

  10. Investigation of Workplace-like Calibration Fields via a Deuterium-Tritium (D-T) Neutron Generator.

    Science.gov (United States)

    Mozhayev, Andrey V; Piper, Roman K; Rathbone, Bruce A; McDonald, Joseph C

    2017-04-01

    Radiation survey meters and personal dosimeters are typically calibrated in reference neutron fields based on conventional radionuclide sources, such as americium-beryllium (Am-Be) or californium-252 (Cf), either unmodified or heavy-water moderated. However, these calibration neutron fields differ significantly from the workplace fields in which most of these survey meters and dosimeters are being used. Although some detectors are designed to yield an approximately dose-equivalent response over a particular neutron energy range, the response of other detectors is highly dependent upon neutron energy. This, in turn, can result in significant over- or underestimation of the intensity of neutron radiation and/or personal dose equivalent determined in the work environment. The use of simulated workplace neutron calibration fields that more closely match those present at the workplace could improve the accuracy of worker, and workplace, neutron dose assessment. This work provides an overview of the neutron fields found around nuclear power reactors and interim spent fuel storage installations based on available data. The feasibility of producing workplace-like calibration fields in an existing calibration facility has been investigated via Monte Carlo simulations. Several moderating assembly configurations, paired with a neutron generator using the deuterium tritium (D-T) fusion reaction, were explored.

  11. Production of medical radioisotopes in the ORNL High Flux Isotope Reactor (HFIR) for cancer treatment and arterial restenosis therapy after PTCA

    Energy Technology Data Exchange (ETDEWEB)

    Knapp, F.F. Jr.; Beets, A.L.; Mirzadeh, S.; Alexander, C.W.; Hobbs, R.L.

    1998-06-01

    The High Flux Isotope Reactor (HFIR) at the Oak Ridge National Laboratory (ORNL) represents an important resource for the production of a wide variety of medical radioisotopes. In addition to serving as a key production site for californium-252 and other transuranic elements, important examples of therapeutic radioisotopes which are currently routinely produced in the HFIR for distribution include dysprosium-166 (parent of holmium-166), rhenium-186, tin-117m and tungsten-188 (parent of rhenium-188). The nine hydraulic tube (HT) positions in the central high flux region permit the insertion and removal of targets at any time during the operating cycle and have traditionally represented a major site for production of medical radioisotopes. To increase the irradiation capabilities of the HFIR, special target holders have recently been designed and fabricated which will be installed in the six Peripheral Target Positions (PTP), which are also located in the high flux region. These positions are only accessible during reactor refueling and will be used for long-term irradiations, such as required for the production of tin-117m and tungsten-188. Each of the PTP tubes will be capable of housing a maximum of eight HT targets, thus increasing the total maximum number of HT targets from the current nine, to a total of 57. In this paper the therapeutic use of reactor-produced radioisotopes for bone pain palliation and vascular brachytherapy and the therapeutic medical radioisotope production capabilities of the ORNL HFIR are briefly discussed.

  12. Photo-triggered solvent-free metamorphosis of polymeric materials.

    Science.gov (United States)

    Honda, Satoshi; Toyota, Taro

    2017-09-11

    Liquefaction and solidification of materials are the most fundamental changes observed during thermal phase transitions, yet the design of organic and polymeric soft materials showing isothermal reversible liquid-nonliquid conversion remains challenging. Here, we demonstrate that solvent-free repeatable molecular architectural transformation between liquid-star and nonliquid-network polymers that relies on cleavage and reformation of a covalent bond in hexaarylbiimidazole. Liquid four-armed star-shaped poly(n-butyl acrylate) and poly(dimethyl siloxane) with 2,4,5-triphenylimidazole end groups were first synthesized. Subsequent oxidation of the 2,4,5-triphenylimidazoles into 2,4,5-triphenylimidazoryl radicals and their coupling with these liquid star polymers to form hexaarylbiimidazoles afforded the corresponding nonliquid network polymers. The resulting nonliquid network polymers liquefied upon UV irradiation and produced liquid star-shaped polymers with 2,4,5-triphenylimidazoryl radical end groups that reverted to nonliquid network polymers again by recoupling of the generated 2,4,5-triphenylimidazoryl radicals immediately after terminating UV irradiation.The design of organic and polymeric soft materials showing isothermal reversible liquid-nonliquid conversion is challenging. Here, the authors show solvent-free repeatable molecular architectural transformation between liquid-star and non-liquid-network polymers by the cleavage and reformation of covalent bonds in the polymer chain.

  13. Modelling batch microwave heating of water

    Science.gov (United States)

    Yeong, S. P.; Law, M. C.; Lee, C. C. Vincent; Chan, Y. S.

    2017-07-01

    A numerical model of the microwave heating of distilled water is developed using COMSOL Multiphysics software to investigate the microwave effects on the heating rate. Three frequencies (0.915GHz, 2GHz and 2.45 GHz) have been applied in the model in order to study their influences on the water temperature. It is found that the water heats up at 2GHz and 2.45GHz, however, there is no sign of heating at 915MHz. This is supported with the figures of the electric field distribution in the microwave cavity. The results shown in the developed model is validated with the experimental results obtained at 2.45 GHz.

  14. Body-Worn Spiral Monopole Antenna for On-Body Communications (Invited Paper)

    DEFF Research Database (Denmark)

    Kammersgaard, Nikolaj Peter Iversen; Kvist, Søren Helstrup; Thaysen, Jesper

    2015-01-01

    A novel body-worn spiral monopole antenna is presented. The antenna consists of a ground plane and a spiral monopole. The antenna was designed for Ear-to-Ear (E2E) communication between In-the-Ear (ITE) hearing instruments at 2.45 GHz and has been simulated, prototyped, and measured. The antenna ...... yielded a measured and simulated E2E path gain at 2.45 GHz of –82.1 dB and –85.9 dB, respectively. The radiation pattern of the antenna when mounted in the ear is presented and discussed....

  15. Body-Worn Spiral Monopole Antenna for Body-Centric Communications

    DEFF Research Database (Denmark)

    Kammersgaard, Nikolaj Peter Iversen; Kvist, Søren H.; Thaysen, Jesper

    2015-01-01

    A novel body-worn spiral monopole antenna is presented. The antenna consists of a ground plane and a spiral monopole. The antenna is designed for Ear-to-Ear (E2E) communication between In-the-Ear (ITE) Hearing Instruments (HIs) at 2.45 GHz and has been simulated, prototyped and measured....... The antenna yields a measured and simulated Ear-toEar path gain at 2.45 GHz of –82.1 dB and –85.9 dB, respectively. The radiation pattern of the antenna when mounted in the ear is presented and discussed....

  16. Organic Rankine Cycle System Analysis for Low GWP Working Fluids

    OpenAIRE

    Datla, Bala Varma; Brasz, Joost

    2012-01-01

    The last decade has seen a substantial increase in Organic Rankine Cycle system installations for low temperature waste heat power recovery. The availability of HFC245fa has played a major role in this recent surge in ORC systems since it allows the use of existing HVAC hardware (heat exchangers and compressors) to be used as ORC components (turbines, boilers and condensers) with minimal redesign. The environmental drawback of HFC245fa is its relatively high GWP value of 950. The advent of a ...

  17. Developing Mist-Annular Flow of R134a/PAG 46 Oil on Inclined Tubes at Compressor Discharge

    OpenAIRE

    Zimmermann, Augusto Jose Pereira; Hrnjak, Predrag S.; Wujek, Scott S.

    2012-01-01

    The last decade has seen a substantial increase in Organic Rankine Cycle system installations for low temperature waste heat power recovery. The availability of HFC245fa has played a major role in this recent surge in ORC systems since it allows the use of existing HVAC hardware (heat exchangers and compressors) to be used as ORC components (turbines, boilers and condensers) with minimal redesign. The environmental drawback of HFC245fa is its relatively high GWP value of 950. The advent of a ...

  18. A Balanced-Fed Dual Inverted-F Antenna with Reduced Human Body Effects

    OpenAIRE

    Wang-Sang Lee; Hyun-Sung Tae; Kyoung-Sub Oh; Jong-Won Yu

    2013-01-01

    A balanced-fed dual inverted-F antenna with reduced human body effects for WLAN applications at 2.45 GHz is presented. In order to reduce the influence by a close proximity or a touch of a human body, the proposed antenna employs an impedance matching using a lumped LC-balun which has the simple and compact structure applying for mobile handsets. The resonant frequency of the proposed antenna is fixed at 2.45 GHz regardless of the close proximity of a human body. By applying for the L-shape g...

  19. A peroxide-bridged imidazole dimer formed from a photochromic naphthalene-bridged imidazole dimer.

    Science.gov (United States)

    Hatano, Sayaka; Abe, Jiro

    2012-04-28

    2,4,5-Triphenylimidazole (lophine) is known as the first chemiluminescence substrate, and its oxidized derivative, the 2,4,5-triphenylimidazolyl radical, corresponds to the coloured species in the photochromic reaction of hexaarylbiimidazole (HABI). We report the first direct observation of the O(2) adduct of the imidazolyl radical that forms the end-on peroxide-bridged imidazole dimer. The ring-opening reaction of the peroxide-bridged imidazole dimer leading to the formation of an N-benzoylbenzamidine derivative supports the presence of the 4,5-epidioxide of lophine as a reaction intermediate of its chemiluminescence. This journal is © the Owner Societies 2012

  20. Body-Worn Spiral Monopole Antenna for Body-Centric Communications

    DEFF Research Database (Denmark)

    Kammersgaard, Nikolaj Peter Iversen; Kvist, Søren H.; Thaysen, Jesper

    A novel body-worn spiral monopole antenna is presented. The antenna consists of a ground plane and a spiral monopole. The antenna is designed for Ear-to-Ear (E2E) communication between In-the-Ear (ITE) Hearing Instruments (HIs) at 2.45 GHz and has been simulated, prototyped and measured. The ante......A novel body-worn spiral monopole antenna is presented. The antenna consists of a ground plane and a spiral monopole. The antenna is designed for Ear-to-Ear (E2E) communication between In-the-Ear (ITE) Hearing Instruments (HIs) at 2.45 GHz and has been simulated, prototyped and measured...