WorldWideScience

Sample records for californium 245

  1. Metabolism and toxicity of californium

    International Nuclear Information System (INIS)

    Metabolism of californium can be compared with that of other transplutonium elements. The most important points are as follows: a fast blood clearance and fast bone uptake more important than liver uptake, a relatively high urinary excretion and kidney retention. Blood clearance of californium can be compared with that of americium. Distribution of californium 252 nitrate after intramuscular injection in rats was studied. There are very few experimental data on acute or long term toxicity of californium. (28 references)

  2. Magnetism in californium

    International Nuclear Information System (INIS)

    A SQUID-based magnetic susceptometer has been constructed for studying small radioactive samples at temperatures below 350 K and in magnetic fields up to 50 kilogauss. The device has been used to study californium (element 98) in a number of solid-state forms: the dhcp metal, several oxides (Cf2O3 in both the bcc and monoclinic structures, Cf7O12, CfO2 and BaCfO3), several monopnictides (CfN, CfAs and CfSb) and the trichloride (in both the hexagonal and orthorhombic structures). All of these materials were studied in polycrystalline form, and hexagonal CfCl3 was studied in single-crystal form as well. The susceptometer has the sensitivity to measure samples containing less than 10 micrograms of californium. The magnetic susceptibilities of all of the californium materials at temperatures above about 100 K are described well by the Curie-Weiss relationship. This behavior is consistent with the assumption that the magnetic 5f electrons are localized and that the paramagnetic behavior can be interpreted in terms of the properties of the free ion. The measured values of the effective paramagnetic moment, μ/sub eff/, for all the californium materials that were studied are reasonably consistent with theoretical values based on intermediate coupling models. All of the californium materials showed some indications of cooperative magnetic effects. The dhcp metal was observed to order ferromagnetically at 52 K, and all of the californium compounds studied showed signs of antiferromagnetic ordering, mostly at temperatures below 25 K. 91 refs., 50 figs., 19 tabs

  3. Californium Multiplier (CFX)

    International Nuclear Information System (INIS)

    The availability of 252Cf as an economical high-intensity neutron source has made it possible to construct compact neutron irradiation devices with widespread applications. The simplest such device consists of a single 252Cf source within a moderating and shielding medium. Higher neutron flux levels can be attained either through the use of more 252Cf or through source multiplication by means of a subcritical uranium assembly. Although the use of larger 252Cf sources to achieve higher neutron flux is technically straightforward, an economic penalty is paid as the source strength is increased. Larger californium sources imply larger initial investments to cover the cost of source material and larger operating costs resulting from the decay of the 252Cf source. A Californium Multiplier, the CFX, which produces a flux enhancement of 30 when compared to a conventional moderated 252Cf system has been designed, licensed, built, and tested by IRT Corporation. Such systems are now available on a commercial basis for both neutron radiography and neutron activation analysis. The first commercial CFX system was installed at the Research Laboratories of Eastman Kodak Company in Rochester, NY, in March 1975. This device, using 1 mg of 252Cf, is very stable and the neutron flux generated by the CFX is very reproducible. The performance characteristics of this system are summarized

  4. Californium--palladium metal neutron source material

    Science.gov (United States)

    Dahlen, B.L.; Mosly, W.C. Jr.; Smith, P.K.; Albenesius, E.L.

    1974-01-22

    Californium, as metal or oxide, is uniformly dispersed throughout a noble metal matrix, provided in compact, rod or wire form. A solution of californium values is added to palladium metal powder, dried, blended and pressed into a compact having a uni-form distribution of californium. The californium values are decomposed to californium oxide or metal by heating in an inert or reducing atmosphere. Sintering the compact to a high density closes the matrix around the dispersed californium. The sintered compact is then mechanically shaped into an elongated rod or wire form. (4 claims, no drawings) (Official Gazette)

  5. Californium-252 Neutron Sources for Medical Applications

    International Nuclear Information System (INIS)

    Californium-252 neutron sources are being prepared to investigate the value of this radionuclide in diagnosing and treating diseases. A source resembling a cell-loaded radium needle was developed for neutron therapy. Since therapy needles are normally implanted in the body, very conservative design criteria were established to prevent leakage of radioactive. Methods are being developed to prepare very intense californium sources that could be used eventually for neutron radiography and for diagnosis by neutron activation analysis. This paper discusses these methods

  6. Production of extra pure curium and californium preparations

    International Nuclear Information System (INIS)

    Preparations of curium-244,245,248 and californium-249,252 are used for the production of ionizing radiation sources for different applications and fundamental nuclear-physical investigations, placing high requirements on the radiochemical and chemical purity of the preparations. Extraction chromatography using di-(2-ethylhexyl)phosphoric acid (D2EHPA) as extractant was chosen to prepare extra pure curium and californium preparations. In order to identify the optimal conditions of Cm-Cf separation and to remove impurities from them (reagent and other impurities), investigations were performed into the effect of impurities (Na+, Ca2+, Al3+, Fe2+, Fe3+ taken as example), extractant and eluent concentration and solution flow rate on the efficiency of mutual purification of Cm and Cf. Both theoretical and experimental estimations were made of the maximum concentration at which the impurities do not affect the process. The conditions chosen allow mutual purification of milligram amounts of Cm and Cf from impurity elements at E(pur) =102 - 103 during a single chromatographic cycle (E(pur) =>103) using a column with 5 - 10 cm3 volume. In this case the production yield exceeds 98%. The purification of milligram amounts of curium and californium from fission products (lanthanides in general, cerium in particular) was performed in D2EHPA-decane-PbO2-HNO3 and D2EHPA-decane-DTPA-H3-Cit extraction chromatography systems. In order to establish the optimal conditions, the effect of [D2EHPA] and eluent on the mutual purification of Cm and Cf and on their purification from cerium and impurity elements was studied in the D2EHPA-decane-PbO2-HNO3 system. During a single chromatographic cycle the mutual purification factors of TPE and of their purification from impurity cations achieve 102-103, from cerium - E(pur) > 10. In the D2EHPA-decane-DTPA-H3Cit system, the effect of concentration of extractant and eluent pH on the efficiency of Cm and Cf purification from lanthanides was

  7. Californium Electrodepositions at Oak Ridge National Laboratory

    Energy Technology Data Exchange (ETDEWEB)

    Boll, Rose Ann [ORNL

    2015-01-01

    Electrodepositions of californium isotopes were successfully performed at Oak Ridge National Laboratory (ORNL) during the past year involving two different types of deposition solutions, ammonium acetate (NH4C2H3O2) and isobutanol ((CH3)2CHCH2OH). A californium product that was decay enriched in 251Cf was recovered for use in super-heavy element (SHE) research. This neutron-rich isotope, 251Cf, provides target material for SHE research for the potential discovery of heavier isotopes of Z=118. The californium material was recovered from aged 252Cf neutron sources in storage at ORNL. These sources have decayed for over 30 years, thus providing material with a very high 251Cf-to-252Cf ratio. After the source capsules were opened, the californium was purified and then electrodeposited using the isobutanol method onto thin titanium foils for use in an accelerator at the Joint Institute for Nuclear Research in Dubna, Russia. Another deposition method, ammonium acetate, was used to produce a deposition containing 1.7 0.1 Ci of 252Cf onto a stainless steel substrate. This was the largest single electrodeposition of 252Cf ever prepared. The 252Cf material was initially purified using traditional ion exchange media, such as AG50-AHIB and AG50-HCl, and further purified using a TEVA-NH4SCN system to remove any lanthanides, resulting in the recovery of 3.6 0.1 mg of purified 252Cf. The ammonium acetate deposition was run with a current of 1.0 amp, resulting in a 91.5% deposition yield. Purification and handling of the highly radioactive californium material created additional challenges in the production of these sources.

  8. Historical review of californium-252 discovery and development

    International Nuclear Information System (INIS)

    This paper discusses the discovery and history of californium 252. This isotope may be synthesized by irradiating plutonium 239, plutonium 242, americium 243, or curium 244 with neutrons in a nuclear reactor. Various experiments and inventions involving 252Cf conducted at the Savannah River Plant are discussed. The evolution of radiotherapy using californium 252 is reviewed

  9. SCI 245 Courses /Snaptutorial

    OpenAIRE

    Lucyfier

    2015-01-01

    For more classes visit www.snaptutorial.com   SCI 245 Week 1CheckPoint Study of Earth SCI 245 Week 1 Assignment Minerals SCI 245 Week 2 CheckPoint Fossils and the Geologic Column SCI 245 Week 2 DQ 1 and DQ 2 SCI 245 Week 3 CheckPoint Plate Tectonic Theory SCI 245 Week 3 Assignment Earthquakes SCI 245 Week 4 CheckPoint Igneous Rocks SCI 245 Week 4 DQ 1 and DQ 2 SCI 245 Week 5 CheckPoint Weathering and Erosion SCI 245 Week 5 Assignment Sedime...

  10. Californium-252: a remarkable versatile radioisotope

    Energy Technology Data Exchange (ETDEWEB)

    Osborne-Lee, I.W.; Alexander, C.W.

    1995-10-10

    A product of the nuclear age, Californium-252 ({sup 252}Cf) has found many applications in medicine, scientific research, industry, and nuclear science education. Californium-252 is unique as a neutron source in that it provides a highly concentrated flux and extremely reliable neutron spectrum from a very small assembly. During the past 40 years, {sup 252}Cf has been applied with great success to cancer therapy, neutron radiography of objects ranging from flowers to entire aircraft, startup sources for nuclear reactors, fission activation for quality analysis of all commercial nuclear fuel, and many other beneficial uses, some of which are now ready for further growth. Californium-252 is produced in the High Flux Isotope Reactor (HFIR) and processed in the Radiochemical Engineering Development Center (REDC), both of which are located at the Oak Ridge National Laboratory (ORNL) in Oak Ridge, Tennessee. The REDC/HFIR facility is virtually the sole supplier of {sup 252}Cf in the western world and is the major supplier worldwide. Extensive exploitation of this product was made possible through the {sup 252}Cf Market Evaluation Program, sponsored by the United States Department of Energy (DOE) [then the Atomic Energy Commission (AEC) and later the Energy Research and Development Administration (ERDA)]. This program included training series, demonstration centers, seminars, and a liberal loan policy for fabricated sources. The Market Evaluation Program was instituted, in part, to determine if large-quantity production capability was required at the Savannah River Laboratory (SRL). Because of the nature of the product and the means by which it is produced, {sup 252}Cf can be produced only in government-owned facilities. It is evident at this time that the Oak Ridge research facility can meet present and projected near-term requirements. The production, shipment, and sales history of {sup 252}Cf from ORNL is summarized herein.

  11. Californium-252: a remarkable versatile radioisotope

    International Nuclear Information System (INIS)

    A product of the nuclear age, Californium-252 (252Cf) has found many applications in medicine, scientific research, industry, and nuclear science education. Californium-252 is unique as a neutron source in that it provides a highly concentrated flux and extremely reliable neutron spectrum from a very small assembly. During the past 40 years, 252Cf has been applied with great success to cancer therapy, neutron radiography of objects ranging from flowers to entire aircraft, startup sources for nuclear reactors, fission activation for quality analysis of all commercial nuclear fuel, and many other beneficial uses, some of which are now ready for further growth. Californium-252 is produced in the High Flux Isotope Reactor (HFIR) and processed in the Radiochemical Engineering Development Center (REDC), both of which are located at the Oak Ridge National Laboratory (ORNL) in Oak Ridge, Tennessee. The REDC/HFIR facility is virtually the sole supplier of 252Cf in the western world and is the major supplier worldwide. Extensive exploitation of this product was made possible through the 252Cf Market Evaluation Program, sponsored by the United States Department of Energy (DOE) [then the Atomic Energy Commission (AEC) and later the Energy Research and Development Administration (ERDA)]. This program included training series, demonstration centers, seminars, and a liberal loan policy for fabricated sources. The Market Evaluation Program was instituted, in part, to determine if large-quantity production capability was required at the Savannah River Laboratory (SRL). Because of the nature of the product and the means by which it is produced, 252Cf can be produced only in government-owned facilities. It is evident at this time that the Oak Ridge research facility can meet present and projected near-term requirements. The production, shipment, and sales history of 252Cf from ORNL is summarized herein

  12. Californium-252 Neutron Therapy in China

    International Nuclear Information System (INIS)

    Californium-252 brachytherapy, believed to be the most successful source for neutron therapy, gives most of the cures as well as long-term and complication-free survivals. Chinese radiation oncologists were interested in californium neutron therapy (Cf-NT) in the early 1980s, but 252Cf sources for medical use were not available in China until 1992 when a californium joint venture was established by the China Institute of Atomic Energy (Beijing) and the Research Institute for Nuclear Reactors (Dimitrovgrad) of Russia. In 1995, 25 seeds of 252Cf with a strength of 3 μg each were sent to China for preclinical investigation. Three years later, a high dose rate (HDR) 252Cf source was imported and transferred into a home-made remote after-loader for intracavitary treatment in Chongqing, and a clinical trail was started in February 1999. This is the first time that Cf-NT was performed for cancer patients in China. Since then, Cf-NT in China has developed rapidly. It is estimated that one-tenth of those radiation oncology centers with brachytherapy practice will be equipped with californium units in 5 yr. That means more than 30 units will be in use in hospitals. That is significant compared with other countries, but it is just one, on average, for each province or one per 40 million people in China. Progress also has been achieved in the 252Cf treatment delivery equipment. Preliminary clinical trails showed complete response observed in all cases treated, with a rapid clearance of tumors and mild reactions in normal tissues. The short-term results are quite encouraging. To deal with problems due to the demand for Cf-NT in China, attention should be paid to the following particulars: (1) A high-strength miniature source is needed for HDR/MDR interstitial therapy to extend the Cf-NT coverage. (2) Basic work on radiophysics and radiobiology needs to be done, including source calibration, clinical dosimetry, clinical RBE determination, and Cf-NT quality assurance

  13. Californium-252 sales and loans at Oak Ridge National Laboratory

    International Nuclear Information System (INIS)

    The production and distribution in the United States of 252Cf has recently been consolidated at the Oak Ridge National Laboratory (ORNL). The 252Cf Industrial Sales/Loan Program and the 252Cf University Load Program, which were formerly located at the Savannah River Plant (SRP), have been combined with the californium production and distribution activities of the Transuranium Element Production Program at ORNL. Californium-252 is sold to commercial users in the form of bulk californium oxide, palladium-californium alloy pellets, or alloy wires. Neutron source capsules, which are fabricated for loans to DOE or other US government agencies, are still available in all forms previously available. The consolidation of all 252Cf distribution activities at the production site is expected to result in better service to users. In particular, customers for neutrons sources will be ale to select from a wider range of neutron source forms, including custom designs, through a single contact point

  14. MGT 245 uop Courses/ uophelp

    OpenAIRE

    Uophelp

    2015-01-01

    For more course tutorials visit www.uophelp.com   MGT 245 Assignment: Organizational Culture MGT 245 Capstone Discussion Question MGT 245 Assignment: Effective Teams MGT 245 CheckPoint: Employee Profile MGT 245 CheckPoint 1: Organizational Structure MGT 245 CheckPoint: Conflict Analysis MGT 245 CheckPoint 2: Peer Review MGT 245 CheckPoint: Employee Programs MGT 245 CheckPoint: Performance Evaluation MGT 245 CheckPoint: Change Management ...

  15. MGT 245 Courses/Indigohelp

    OpenAIRE

    charles

    2015-01-01

    For more classes visits www.indigohelp.com   MGT 245 Assignment: Organizational Culture MGT 245 Capstone Discussion Question MGT 245 Assignment: Effective Teams MGT 245 CheckPoint: Employee Profile MGT 245 CheckPoint 1: Organizational Structure MGT 245 CheckPoint: Conflict Analysis MGT 245 CheckPoint 2: Peer Review MGT 245 CheckPoint: Employee Programs MGT 245 CheckPoint: Performance Evaluation MGT 245 CheckPoint: Change Management ...

  16. Californium-252 encapsulation at the Savannah River Laboratory

    International Nuclear Information System (INIS)

    More than 1 g of the neutron-emitting isotope californium-252 has been encapsulated at SRL for worldwide medical, industrial, and research uses. Bulk sales packages have been prepared for the USDOE sales program since 1971. Doubly-encapsulated sources have been prepared for USDOE's market evaluation program since 1968. Californium-252 sources for loan and sales packages satisfy the criteria for Special Form Radioactive Material. Encapsulation is performed in special neutron-shielded containment facilities at SRL. Development of improved source and shipping package designs and processes is continuing. 17 figures

  17. SCI 245 Course Tutorial / indigohelp

    OpenAIRE

    roman8034

    2015-01-01

    SCI 245 Entire Course  For more classes visit www.indigohelp.com   SCI 245 Week 1CheckPoint Study of Earth SCI 245 Week 1 Assignment Minerals SCI 245 Week 2 CheckPoint Fossils and the Geologic Column SCI 245 Week 2 DQ 1 and DQ 2 SCI 245 Week 3 CheckPoint Plate Tectonic Theory SCI 245 Week 3 Assignment Earthquakes SCI 245 Week 4 CheckPoint Igneous Rocks SCI 245 Week 4 DQ 1 and DQ 2 SCI 245 Week 5 CheckPoint Weathering and Erosion SC...

  18. Production, distribution and applications of californium-252 neutron sources

    International Nuclear Information System (INIS)

    The radioisotope 252Cf is routinely encapsulated into compact, portable, intense neutron sources with a 2.6-yr half-life. A source the size of a person's little finger can emit up to 1011 neutrons s-1. Californium-252 is used commercially as a reliable, cost-effective neutron source for prompt gamma neutron activation analysis (PGNAA) of coal, cement and minerals, as well as for detection and identification of explosives, land mines and unexploded military ordnance. Other uses are neutron radiography, nuclear waste assays, reactor start-up sources, calibration standards and cancer therapy. The inherent safety of source encapsulations is demonstrated by 30 yr of experience and by US Bureau of Mines tests of source survivability during explosions. The production and distribution center for the US Department of Energy (DOE) Californium Program is the Radiochemical Engineering Development Center (REDC) at Oak Ridge National Laboratory (ORNL). DOE sells 252Cf to commercial reencapsulators domestically and internationally. Sealed 252Cf sources are also available for loan to agencies and subcontractors of the US government and to universities for educational, research and medical applications. The REDC has established the Californium User Facility (CUF) for Neutron Science to make its large inventory of 252Cf sources available to researchers for irradiations inside uncontaminated hot cells. Experiments at the CUF include a land mine detection system, neutron damage testing of solid-state detectors, irradiation of human cancer cells for boron neutron capture therapy experiments and irradiation of rice to induce genetic mutations

  19. Production, distribution and applications of californium-252 neutron sources.

    Science.gov (United States)

    Martin, R C; Knauer, J B; Balo, P A

    2000-01-01

    The radioisotope 252Cf is routinely encapsulated into compact, portable, intense neutron sources with a 2.6-yr half-life. A source the size of a person's little finger can emit up to 10(11) neutrons s(-1). Californium-252 is used commercially as a reliable, cost-effective neutron source for prompt gamma neutron activation analysis (PGNAA) of coal, cement and minerals, as well as for detection and identification of explosives, land mines and unexploded military ordinance. Other uses are neutron radiography, nuclear waste assays, reactor start-up sources, calibration standards and cancer therapy. The inherent safety of source encapsulations is demonstrated by 30 yr of experience and by US Bureau of Mines tests of source survivability during explosions. The production and distribution center for the US Department of Energy (DOE) Californium Program is the Radiochemical Engineering Development Center (REDC) at Oak Ridge National Laboratory (ORNL). DOE sells 252Cf to commercial reencapsulators domestically and internationally. Sealed 252Cf sources are also available for loan to agencies and subcontractors of the US government and to universities for educational, research and medical applications. The REDC has established the Californium User Facility (CUF) for Neutron Science to make its large inventory of 252Cf sources available to researchers for irradiations inside uncontaminated hot cells. Experiments at the CUF include a land mine detection system, neutron damage testing of solid-state detectors, irradiation of human cancer cells for boron neutron capture therapy experiments and irradiation of rice to induce genetic mutations. PMID:11003521

  20. MGT 245 Course Tutorial/snaptutorial

    OpenAIRE

    roman8034

    2015-01-01

    MGT 245 Entire Course For more classes visit www.snaptutorial.com   MGT 245 Assignment: Organizational Culture MGT 245 Capstone Discussion Question MGT 245 Assignment: Effective Teams MGT 245 CheckPoint: Employee Profile MGT 245 CheckPoint 1: Organizational Structure MGT 245 CheckPoint: Conflict Analysis MGT 245 CheckPoint 2: Peer Review MGT 245 CheckPoint: Employee Programs MGT 245 CheckPoint: Performance Evaluation MGT 245 CheckPo...

  1. Production, Distribution, and Applications of Californium-252 Neutron Sources

    Energy Technology Data Exchange (ETDEWEB)

    Balo, P.A.; Knauer, J.B.; Martin, R.C.

    1999-10-03

    The radioisotope {sup 252}Cf is routinely encapsulated into compact, portable, intense neutron sources with a 2.6-year half-life. A source the size of a person's little finger can emit up to 10{sup 11} neutrons/s. Californium-252 is used commercially as a reliable, cost-effective neutron source for prompt gamma neutron activation analysis (PGNAA) of coal, cement, and minerals, as well as for detection and identification of explosives, laud mines, and unexploded military ordnance. Other uses are neutron radiography, nuclear waste assays, reactor start-up sources, calibration standards, and cancer therapy. The inherent safety of source encapsulations is demonstrated by 30 years of experience and by U.S. Bureau of Mines tests of source survivability during explosions. The production and distribution center for the U. S Department of Energy (DOE) Californium Program is the Radiochemical Engineering Development Center (REDC) at Oak Ridge National Laboratory (ORNL). DOE sells The radioisotope {sup 252}Cf is routinely encapsulated into compact, portable, intense neutron sources with a 2.6- year half-life. A source the size of a person's little finger can emit up to 10 neutrons/s. Californium-252 is used commercially as a reliable, cost-effective neutron source for prompt gamma neutron activation analysis (PGNAA) of coal, cement, and minerals, as well as for detection and identification of explosives, laud mines, and unexploded military ordnance. Other uses are neutron radiography, nuclear waste assays, reactor start-up sources, calibration standards, and cancer therapy. The inherent safety of source encapsulations is demonstrated by 30 years of experience and by U.S. Bureau of Mines tests of source survivability during explosions. The production and distribution center for the U. S Department of Energy (DOE) Californium Program is the Radiochemical Engineering Development Center (REDC) at Oak Ridge National Laboratory(ORNL). DOE sells {sup 252}Cf to commercial

  2. MGT 245 UOP Course Tutorial / Tutorialoutlet

    OpenAIRE

    karthi

    2015-01-01

    For more course tutorials visit www.tutorialoutlet.com MGT 245 Assignment: Organizational Culture MGT 245 Capstone Discussion Question MGT 245 Assignment: Effective Teams MGT 245 CheckPoint: Employee Profile MGT 245 CheckPoint 1: Organizational Structure MGT 245 CheckPoint: Conflict Analysis MGT 245 CheckPoint 2: Peer Review MGT 245 CheckPoint: Employee Programs MGT 245 CheckPoint: Performance Evaluation MGT 245 CheckPoint: Change Management MGT...

  3. Prompt neutron spectrum of the spontaneous fission of californium-252

    International Nuclear Information System (INIS)

    The californium-252 spontaneous fission neutron spectrum was measured in the energy range of 0.01 to 10 MeV by the time-of-flight technique using various neutron detectors. The measurements of 252Cf neutron spectrum at energies of 0.01 to 5 MeV were performed as a function of fission fragment kinetic energy. The mean neutron spectrum energy in the range of 0.7 to 10 MeV was found from the results of measurements. The irregularity in the 252Cf neutron spectrum in the neutron energy range of less than 0.7 MeV compared to theoretical values is discussed. The mechanism of 252Cf neutron emission is also discussed on the basis of neutron yield angle measurements. 12 references

  4. Separation of californium from actinides and lanthanides in aqueous solution by electrochemical formation of amalgams

    International Nuclear Information System (INIS)

    The electrochemical reduction of transneptunium elements (Pu to Cf) and rare earths (Eu, Tm) from aqueous complexing solutions to amalgams was studied over a wide range of cathodic potentials in order to achieve optimal separation of californium. The reduction in acetate media (pH 4.5-4.6) at potentials around -1.7 to -1.9 V1 leads to a quantitative extraction of californium into the mercury phase, while more negative potentials are required for the reduction of the lighter transuranium elements and of the lanthanides. Hence, the optimal conditions for the separation of californium from the investigated actinides and lanthanides were determined. Separation factors α between 25 and 90 were found except in the case of Cf/Eu, where poor values (α varying from 7 to 12) were observed. More negative cathodic potentials decrease the selectivity of the reduction process. A similar study with lithium citrate solutions (pH ∝6) shows that satisfactory separation of californium from lighter and heavier actinides is achievable. A separation factor of 88 is obtained for Cf/Am at -1.98 V. The anodic stripping of mixed amalgams (Pu, Am, Cm, Bk, Tm and Cf) Hg in nitric and acetic acid soultions at potentials ranging from +0.1 to -0.7 V proceeds slowly and proved to be ineffective for the separation of californium from light actinides under conditions described. (orig.)

  5. On-line slurry analyses by californium-252

    International Nuclear Information System (INIS)

    In chemical processing technology on-line activation methods gain an increasing importance for process monitoring and control. A method is described according to which the different fluorspar contents at various strategic points of a flotation plant are determined through neutron activation by 100 μg californium-252. A continuous analytical system for onstream process control of slurries was designed and constructed. A compact facility, called SUSAC, allows continuous application of the method on an industrial scale. The main components of the SUSAC facility are the irradiation and measurement cells. The cells are equipped with multistage countercurrent stirrers ensuring a proper radial and vertical distribution of the sample. The hollow shaft of the stirrer of the irradiation cell houses the Cf-source. The NaI-detector has been installed in a recess in the bottom of the measuring cell. The volumes are 9 dm3 for the irradiation cell, 7.5 dm3 for the measuring cell, 1/2 dm3 for the vonnection line and 4 dm3 for feed and drainage lines including the pump. Investigations on the following topics are discussed: selection of stirrers, residence time, flow rate, pulp density, calibration measurements. (T.G.)

  6. ShCG 245

    Directory of Open Access Journals (Sweden)

    Hrant M. Tovmassian

    2007-01-01

    Full Text Available Los grupos compactos de galaxias Shakhbazian son las configuraciones más densas que se conocen. Hace algunos años iniciamos un estudio fotométrico y espectroscópico de estos grupos. En este artículo presentamos los resultados de la investigación en los grupos ShCG 104, ShCG 120, ShCG 243 y ShCG 245. Presentamos los corrimientos al rojo de las galaxias miembro, los resultados de la fotometría R, las curvas de brillo superficial-radio efectivo, las masas estimadas, las luminosidades y las razones masa-luminosidad de los grupos, además de algunos parámetros dinámicos como la dispersión de velocidad radial y el tiempo de cruce. Los ShCGs estudiados consisten principalmente de galaxias elípticas y lenticulares. Se muestra que algunas galaxias en estos grupos están en proceso de interacción.

  7. Biomedical neutron research at the Californium User Facility for neutron science

    International Nuclear Information System (INIS)

    The Californium User Facility for Neutron Science has been established at Oak Ridge National Laboratory (ORNL). The Californium User Facility (CUF) is a part of the larger Californium Facility, which fabricates and stores compact 252Cf neutron sources for worldwide distribution. The CUF can provide a cost-effective option for research with 252Cf sources. Three projects at the CUF that demonstrate the versatility of 252Cf for biological and biomedical neutron-based research are described: future establishment of a 252Cf-based neutron activation analysis system, ongoing work to produce miniature high-intensity, remotely afterloaded 252Cf sources for tumor therapy, and a recent experiment that irradiated living human lung cancer cells impregnated with experimental boron compounds to test their effectiveness for boron neutron capture therapy

  8. Biomedical neutron research at the Californium User Facility for neutron science

    Energy Technology Data Exchange (ETDEWEB)

    Martin, R.C. [Oak Ridge National Lab., TN (United States); Byrne, T.E. [Roane State Community College, Harriman, TN (United States); Miller, L.F. [Univ. of Tennessee, Knoxville, TN (United States)

    1997-04-01

    The Californium User Facility for Neutron Science has been established at Oak Ridge National Laboratory (ORNL). The Californium User Facility (CUF) is a part of the larger Californium Facility, which fabricates and stores compact {sup 252}Cf neutron sources for worldwide distribution. The CUF can provide a cost-effective option for research with {sup 252}Cf sources. Three projects at the CUF that demonstrate the versatility of {sup 252}Cf for biological and biomedical neutron-based research are described: future establishment of a {sup 252}Cf-based neutron activation analysis system, ongoing work to produce miniature high-intensity, remotely afterloaded {sup 252}Cf sources for tumor therapy, and a recent experiment that irradiated living human lung cancer cells impregnated with experimental boron compounds to test their effectiveness for boron neutron capture therapy.

  9. Proposed Californium-252 User Facility for Neutron Science at Oak Ridge National Laboratory

    International Nuclear Information System (INIS)

    The Radiochemical Engineering Development Center (REDC) at ORNL has petitioned to establish a Californium-252 User Facility for Neutron Science for academic, industrial, and governmental researchers. The REDC Californium Facility (CF) stores the national inventory of sealed 252Cf neutron source for university and research loans. Within the CF, the 252Cf storage pool and two uncontaminated hot cells currently in service for the Californium Program will form the physical basis for the User Facility. Relevant applications include dosimetry and experiments for neutron tumor therapy; fast and thermal neutron activation analysis of materials; experimental configurations for prompt gamma neutron activation analysis; neutron shielding and material damage studies; and hardness testing of radiation detectors, cameras, and electronics. A formal User Facility simplifies working arrangements and agreements between US DOE facilities, academia, and commercial interests

  10. Emergence of californium as the second transitional element in the actinide series.

    Science.gov (United States)

    Cary, Samantha K; Vasiliu, Monica; Baumbach, Ryan E; Stritzinger, Jared T; Green, Thomas D; Diefenbach, Kariem; Cross, Justin N; Knappenberger, Kenneth L; Liu, Guokui; Silver, Mark A; DePrince, A Eugene; Polinski, Matthew J; Van Cleve, Shelley M; House, Jane H; Kikugawa, Naoki; Gallagher, Andrew; Arico, Alexandra A; Dixon, David A; Albrecht-Schmitt, Thomas E

    2015-01-01

    A break in periodicity occurs in the actinide series between plutonium and americium as the result of the localization of 5f electrons. The subsequent chemistry of later actinides is thought to closely parallel lanthanides in that bonding is expected to be ionic and complexation should not substantially alter the electronic structure of the metal ions. Here we demonstrate that ligation of californium(III) by a pyridine derivative results in significant deviations in the properties of the resultant complex with respect to that predicted for the free ion. We expand on this by characterizing the americium and curium analogues for comparison, and show that these pronounced effects result from a second transition in periodicity in the actinide series that occurs, in part, because of the stabilization of the divalent oxidation state. The metastability of californium(II) is responsible for many of the unusual properties of californium including the green photoluminescence. PMID:25880116

  11. 48 CFR 245.603 - Disposal methods.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Disposal methods. 245.603 Section 245.603 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS SYSTEM, DEPARTMENT... Contractor Inventory 245.603 Disposal methods....

  12. Fissile analysis of Hanford waste using Californium Multiplier/Delayed Neutron Counter system

    International Nuclear Information System (INIS)

    Measurement of low-level (10 ng/g or lower) fissile material (mainly plutonium) in Hanford waste and process samples is becoming increasingly important. A system has been designed consisting of a Californium Multiplier (CFX) and a Delayed Neutron Counter (DNC) to characterize these samples. This report describes hardware and analytical capability of the CFX/DNC system

  13. Study of the shielding for spontaneous fission sources of Californium-252

    International Nuclear Information System (INIS)

    A shielding study is made to attenuate, until maximum permissible levels, the neutrons radiation and photons emitted by spontaneous fission coming from a source of Californium-252. The compound package by a database (Library DLC-23) and the ANISNW code is used, in it version for personal computer. (Author)

  14. BIS 245 Course Tutorial / tutorialrank

    OpenAIRE

    welcome1351

    2015-01-01

    BIS 245 Week 1 Lab 1 Introduction to MS Visio and MS Access For more course tutorials visit www.tutorialrank.com Tutorial Purchased: 2 Times, Rating: A   A. Lab # : BSBA BIS 245A-1 B. Lab 1 of 7 : Introduction to MS Visio and MS Access C. Lab Overview--Scenario/Summary TCOs: 1. Given a business situation in which managers require information from a database, determine, analyze and classify that information so that reports can be designed to meet the requ...

  15. Californium (252Cf) and its use as neutron source in science medicine and technology

    International Nuclear Information System (INIS)

    The application of radionuclides in science and nuclear techniques basically is related to unstable isotopes, which are produced from stable elements in nuclear reactor. Their specifications are various from view point of application . Using of physical and chemical properties of radionuclides in chemistry, for with marking the organic compounds we can exactly explain the mechanism of chemical reactions in medical, biology and bio-chemistry. In these cases the behaviour of radionuclides is very important and the selection of the suitable radionuclides is determined between the elements for investigation aims. The special specification of radio-nuclides analysis such as, half-life, kind of ray and energy should be considered with an special accuracy as well as the laws security regulations from view point of ray-protection should be completely observed mean time working these radio-nuclides. It should be considered that application of radio-isotopes is very important from their special specifications point of view. Applying the radionuclides from technology point of view in sciences and nuclear techniques aren't only limited to three analyses of α, β, and γ, but we can use the share of neutron which are produced from spli ting of heavy nucleus such as Californium252 as a neutron source in the depths of the sea and also determining the concentration of low quantity elements on moon and other spheres. The radioisotope of Californium252 is a neutron useful radiator for investigation in nuclear medical and technology because of automatically rapid split to 3.2% Californium252 radiates 1.34 * 109N/m in each mil/GH which suitable replacement for neutron sources based on (a, n) reaction, for example, Radium-Brellium or Amersium-Brellium. The energy distribution of radiated neutrons from analyzing of Californium252 like the spectrum of neutron which is produced from splitting of U235, Pu239 nucleus has the maximum energy in quantity, En=1 MeV in the range of 1.5 MeV. The

  16. Contribution to clinical dosimetry of californium 252 sources used at Gustave Roussy institute

    International Nuclear Information System (INIS)

    The main characteristics of californium 252 sources are presented in the first part of the report. Dose measurements around Californium sources were performed with a pair of ionization multiplication chambers: the first one has an Aluminium wall and is filled with Argon, the second one a plastic tissue-equivalent gas. A set of experiments was performed in order to investigate the relative influence of beta rays on the response of both chambers. Besides the experimental work a computer program was written to calculate the dose distribution around the actual sources made of a series of small active sources placed in catheters. Theoretical data around small sources can be found in the litterature. The comparison between experimental results and theoretical ones has shown a good agreement. The computer program will be included as a sub-routine in the more general computer program used for patients treated with interstitial therapy

  17. Safety Analysis Report for Packaging (SARP) of the Oak Ridge National Laboratory TRU Californium Shipping Container

    International Nuclear Information System (INIS)

    An analytical evaluation of the Oak Ridge National Laboratory TRU Californium Shipping Container was made in order to demonstrate its compliance with the regulations governing off-site shipment of packages that contain radioactive material. The evaluation encompassed five primary categories: structural integrity, thermal resistance, radiation shielding, nuclear criticality safety, and quality assurance. The results of this evaluation demonstrate that the container complies with the applicable regulations

  18. Emergence of californium as the second transitional element in the actinide series

    OpenAIRE

    Cary, Samantha K.; Vasiliu, Monica; Baumbach, Ryan E.; Stritzinger, Jared T.; GREEN, THOMAS D.; Diefenbach, Kariem; Cross, Justin N.; Knappenberger, Kenneth L.; Liu, Guokui; Silver, Mark A.; DePrince, A. Eugene; Polinski, Matthew J.; Van Cleve, Shelley M.; House, Jane H.; Kikugawa, Naoki

    2015-01-01

    A break in periodicity occurs in the actinide series between plutonium and americium as the result of the localization of 5f electrons. The subsequent chemistry of later actinides is thought to closely parallel lanthanides in that bonding is expected to be ionic and complexation should not substantially alter the electronic structure of the metal ions. Here we demonstrate that ligation of californium(III) by a pyridine derivative results in significant deviations in the properties of the resu...

  19. 24 CFR 245.120 - Meeting space.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Meeting space. 245.120 Section 245... PARTICIPATION IN MULTIFAMILY HOUSING PROJECTS Tenant Organizations § 245.120 Meeting space. (a) Owners of... of any community room or other available space appropriate for meetings that is part of...

  20. 48 CFR 245.7101 - Forms.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Forms. 245.7101 Section 245.7101 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS SYSTEM, DEPARTMENT OF DEFENSE CONTRACT MANAGEMENT GOVERNMENT PROPERTY Plant Clearance Forms 245.7101 Forms. Use the forms...

  1. 7 CFR 245.12 - Fraud penalties.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Fraud penalties. 245.12 Section 245.12 Agriculture... SCHOOLS § 245.12 Fraud penalties. (a) Whoever embezzles, willfully misapplies, steals, or obtains by fraud..., assets, or property have been embezzled, willfully misapplied, stolen, or obtained by fraud, shall...

  2. 32 CFR 245.13 - Responsibilities.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false Responsibilities. 245.13 Section 245.13 National Defense Department of Defense (Continued) OFFICE OF THE SECRETARY OF DEFENSE (CONTINUED) MISCELLANEOUS PLAN FOR THE EMERGENCY SECURITY CONTROL OF AIR TRAFFIC (ESCAT) The ESCAT Plan § 245.13...

  3. 32 CFR 245.3 - Responsibilities.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false Responsibilities. 245.3 Section 245.3 National... PLAN FOR THE EMERGENCY SECURITY CONTROL OF AIR TRAFFIC (ESCAT) General § 245.3 Responsibilities. The Assistant Secretary of Defense for Networks and Information Integration will ensure the responsibilities...

  4. 8 CFR 245a.32 - Ineligible aliens.

    Science.gov (United States)

    2010-01-01

    ... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Ineligible aliens. 245a.32 Section 245a.32 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS ADJUSTMENT OF STATUS TO... IMMIGRATION AND NATIONALITY ACT LIFE Act Amendments Family Unity Provisions § 245a.32 Ineligible aliens....

  5. 8 CFR 245.5 - Medical examination.

    Science.gov (United States)

    2010-01-01

    ... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Medical examination. 245.5 Section 245.5... THAT OF PERSON ADMITTED FOR PERMANENT RESIDENCE § 245.5 Medical examination. Pursuant to section 232(b) of the Act, an applicant for adjustment of status shall be required to have a medical examination...

  6. 8 CFR 245.4 - Documentary requirements.

    Science.gov (United States)

    2010-01-01

    ... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Documentary requirements. 245.4 Section 245.4 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS ADJUSTMENT OF STATUS TO THAT OF PERSON ADMITTED FOR PERMANENT RESIDENCE § 245.4 Documentary requirements....

  7. 33 CFR 117.245 - Smyrna River.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Smyrna River. 117.245 Section 117.245 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Delaware § 117.245 Smyrna River. The draw of the...

  8. 14 CFR 121.245 - Fire walls.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Fire walls. 121.245 Section 121.245 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF TRANSPORTATION (CONTINUED) AIR CARRIERS..., FLAG, AND SUPPLEMENTAL OPERATIONS Special Airworthiness Requirements § 121.245 Fire walls. Each...

  9. Measurements of integral cross sections in the californium-252 fission neutron spectrum

    International Nuclear Information System (INIS)

    In a low-scattering arrangement cross sections averaged over the californium-252 spontaneous fission neutron spectrum were measured. The reactions 27Al(n,α)46Ti, 47Ti, 48Ti(n,p), 54Fe,56Fe(n,p), 58Ni(n,p), 64Zn(n,p), 115In(n,n') were studied in order to obtain a consistent set of threshold detectors used in fast neutron flux density measurements. Overall uncertainties between 2 and 2.5% could be achieved; corrections due to neutron scattering in source and samples are discussed

  10. Measurement of californium-252 gamma photons depth dose distribution in tissue equivalent material. Vol. 4

    International Nuclear Information System (INIS)

    Phantom of tissue equivalent material with and without bone was used measuring depth dose distribution of gamma-rays from californium-252 source. The source was positioned at center of perspex walled phantom. Depth dose measurements were recorded for X, Y and Z planes at different distances from source. TLD 700 was used for measuring the dose distribution. Results indicate that implantation of bone in tissue equivalent medium cause changes in the gamma depth dose distribution which varies according to variation in bone geometry. 9 figs

  11. 20 CFR 627.245 - Work experience.

    Science.gov (United States)

    2010-04-01

    ... PROGRAMS UNDER TITLES I, II, AND III OF THE ACT Program Requirements § 627.245 Work experience. (a) Definition. Work experience means a short-term or part-time training assignment with a public or private... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Work experience. 627.245 Section...

  12. 8 CFR 245a.17 - Citizenship skills.

    Science.gov (United States)

    2010-01-01

    ... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Citizenship skills. 245a.17 Section 245a.17... Citizenship skills. (a) Requirements. Applicants for adjustment under LIFE Legalization must meet the... permanent residence and may be based solely on the failure to pass the basic citizenship skills...

  13. 8 CFR 245a.1 - Definitions.

    Science.gov (United States)

    2010-01-01

    ..., if any, or (2) a crime treated as a misdemeanor under 8 CFR 245a.1(p). For purposes of this... CFR part 245a, the crime shall be treated as a misdemeanor. (q) Subject of an Order to Show Cause... interview to obtain an immigrant visa at a Consulate or Embassy in Canada or Mexico but who subsequently...

  14. 8 CFR 245a.10 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Definitions. 245a.10 Section 245a.10 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS ADJUSTMENT OF STATUS TO THAT... privilege of residing permanently in the United States as an immigrant in accordance with the...

  15. 33 CFR 104.245 - Communications.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Communications. 104.245 Section... MARITIME SECURITY: VESSELS Vessel Security Requirements § 104.245 Communications. (a) The Vessel Security... board the vessel. (b) Communications systems and procedures must allow effective and...

  16. 42 CFR 24.5 - Peer review.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 1 2010-10-01 2010-10-01 false Peer review. 24.5 Section 24.5 Public Health PUBLIC....5 Peer review. An individual may not be considered for appointment into the SBRS unless his/her qualifications have been reviewed by a PHS peer review committee and the committee has recommended appointment...

  17. Spontaneous Partitioning of Californium from Curium: Curious Cases from the Crystallization of Curium Coordination Complexes

    Energy Technology Data Exchange (ETDEWEB)

    Cary, Samantha K.; Silver, Mark A.; Liu, Guokui; Wang, Jamie C.; Bogart, Justin A.; Stritzinger, Jared T.; Arico, Alexandra A.; Hanson, Kenneth; Schelter, Eric J.; Albrecht-Schmitt, Thomas E.

    2015-12-07

    The reaction of 248CmCl3 with excess 2,6-pyridinedicarboxylic acid (DPA) under mild solvothermal conditions results in crystallization of the tris-chelate complex Cm(HDPA)3·H2O. Approximately half of the curium remains in solution at the end of this process, and evaporation of the mother liquor results in crystallization of the bis-chelate complex [Cm(HDPA)- (H2DPA)(H2O)2Cl]Cl·2H2O. 248Cm is the daughter of the α decay of 252Cf and is extracted in high purity from this parent. However, trace amounts of 249,250,251Cf are still present in all samples of 248Cm. During the crystallization of Cm(HDPA)3·H2O and [Cm(HDPA)(H2DPA)(H2O)2Cl]Cl·2H2O, californium(III) spontaneously separates itself from the curium complexes and is found doped within crystals of DPA in the form of Cf(HDPA)3. These results add to the growing body of evidence that the chemistry of californium is fundamentally different from that of earlier actinides.

  18. 48 CFR 245.7310-1 - Demilitarization.

    Science.gov (United States)

    2010-10-01

    ..., DEPARTMENT OF DEFENSE CONTRACT MANAGEMENT GOVERNMENT PROPERTY Sale of Surplus Contractor Inventory 245.7310-1... purpose of the property shall be rendered unusable. The Purchaser agrees to assume all cost incident...

  19. 48 CFR 245.7307-1 - General.

    Science.gov (United States)

    2010-10-01

    ..., DEPARTMENT OF DEFENSE CONTRACT MANAGEMENT GOVERNMENT PROPERTY Sale of Surplus Contractor Inventory 245.7307-1 General. (a) Non-competitive sales include purchases or retention at less than cost by the contractor....

  20. 46 CFR 172.245 - Survival conditions.

    Science.gov (United States)

    2010-10-01

    ... PERTAINING TO BULK CARGOES Special Rules Pertaining to Great Lakes Dry Bulk Cargo Vessels § 172.245 Survival... be weathertight (d) Metacentric height. After flooding, the metacentric height must be at least...

  1. 48 CFR 245.7308 - Antitrust notification.

    Science.gov (United States)

    2010-10-01

    ... Inventory 245.7308 Antitrust notification. (a) When contractor inventory with an estimated fair market value of $3 million or more or any patents, processes, techniques, or inventions, regardless of cost, are...) Proposed sale price (explain if the proposed purchaser was not highest bidder); (3) Acquisition cost...

  2. 48 CFR 245.7307-2 - Justification.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Justification. 245.7307-2... Justification. (a) Conditions justifying non-competitive sales are— (1) Scientific equipment allocated to.../agency will provide the contract administration office the sales justification and any special...

  3. 49 CFR 234.245 - Signs.

    Science.gov (United States)

    2010-10-01

    ... TRANSPORTATION GRADE CROSSING SIGNAL SYSTEM SAFETY AND STATE ACTION PLANS Maintenance, Inspection, and Testing Maintenance Standards § 234.245 Signs. Each sign mounted on a highway-rail grade crossing signal post shall be maintained in good condition and be visible to the highway user. Inspections and Tests...

  4. 8 CFR 245.1 - Eligibility.

    Science.gov (United States)

    2010-01-01

    ... adjustment application. The motion to reopen must be made in accordance with the provisions of 8 CFR 103.5... applying for adjustment of status listed in § 245.1(c), is eligible to receive an immigrant visa, and has an immigrant visa immediately available at the time of filing the application for adjustment...

  5. Fast and efficient charge breeding of the Californium rare isotope breeder upgrade electron beam ion source

    Energy Technology Data Exchange (ETDEWEB)

    Ostroumov, P. N., E-mail: ostroumov@anl.gov; Barcikowski, A.; Dickerson, C. A.; Perry, A.; Sharamentov, S. I.; Vondrasek, R. C.; Zinkann, G. P. [Argonne National Laboratory, Argonne, Illinois 60439 (United States); Pikin, A. I. [Brookhaven National Laboratory, Upton, New York 11973 (United States)

    2015-08-15

    The Electron Beam Ion Source (EBIS), developed to breed Californium Rare Isotope Breeder Upgrade (CARIBU) radioactive beams at Argonne Tandem Linac Accelerator System (ATLAS), is being tested off-line. A unique property of the EBIS is a combination of short breeding times, high repetition rates, and a large acceptance. Overall, we have implemented many innovative features during the design and construction of the CARIBU EBIS as compared to the existing EBIS breeders. The off-line charge breeding tests are being performed using a surface ionization source that produces singly charged cesium ions. The main goal of the off-line commissioning is to demonstrate stable operation of the EBIS at a 10 Hz repetition rate and a breeding efficiency into single charge state higher than 15%. These goals have been successfully achieved and exceeded. We have measured (20% ± 0.7%) breeding efficiency into the single charge state of 28+ cesium ions with the breeding time of 28 ms. In general, the current CARIBU EBIS operational parameters can provide charge breeding of any ions in the full mass range of periodic table with high efficiency, short breeding times, and sufficiently low charge-to-mass ratio, 1/6.3 for the heaviest masses, for further acceleration in ATLAS. In this paper, we discuss the parameters of the EBIS and the charge breeding results in a pulsed injection mode with repetition rates up to 10 Hz.

  6. Fast and efficient charge breeding of the Californium rare isotope breeder upgrade electron beam ion source

    International Nuclear Information System (INIS)

    The Electron Beam Ion Source (EBIS), developed to breed Californium Rare Isotope Breeder Upgrade (CARIBU) radioactive beams at Argonne Tandem Linac Accelerator System (ATLAS), is being tested off-line. A unique property of the EBIS is a combination of short breeding times, high repetition rates, and a large acceptance. Overall, we have implemented many innovative features during the design and construction of the CARIBU EBIS as compared to the existing EBIS breeders. The off-line charge breeding tests are being performed using a surface ionization source that produces singly charged cesium ions. The main goal of the off-line commissioning is to demonstrate stable operation of the EBIS at a 10 Hz repetition rate and a breeding efficiency into single charge state higher than 15%. These goals have been successfully achieved and exceeded. We have measured (20% ± 0.7%) breeding efficiency into the single charge state of 28+ cesium ions with the breeding time of 28 ms. In general, the current CARIBU EBIS operational parameters can provide charge breeding of any ions in the full mass range of periodic table with high efficiency, short breeding times, and sufficiently low charge-to-mass ratio, 1/6.3 for the heaviest masses, for further acceleration in ATLAS. In this paper, we discuss the parameters of the EBIS and the charge breeding results in a pulsed injection mode with repetition rates up to 10 Hz

  7. Design of a homogeneous subcritical nuclear reactor based on thorium with a source of californium 252

    International Nuclear Information System (INIS)

    Full text: One of the energy alternatives to fossil fuels which do not produce greenhouse gases is the nuclear energy. One of the drawbacks of this alternative is the generation of radioactive wastes of long half-life and its relation to the generation of nuclear materials to produce weapons of mass destruction. An option to these drawbacks of nuclear energy is to use Thorium as part of the nuclear fuel which it becomes in U233 when capturing neutrons, that is a fissile material. In this paper Monte Carlo methods were used to design a homogeneous subcritical reactor based on thorium. As neutron reflector graphite was used. The reactor core is homogeneous and is formed of 70% light water as moderator, 12% of enriched uranium UO2(NO3)4 and 18% of thorium Th(NO3)4 as fuel. To start the nuclear fission chain reaction an isotopic source of californium 252 was used with an intensity of 4.6 x 107 s-1. In the design the value of the effective multiplication factor, whose value turned out keff <1 was calculated. Also, the neutron spectra at different distances from the source and the total fluence were calculated, as well as the values of the ambient dose equivalent in the periphery of the reactor. (Author)

  8. Fast and efficient charge breeding of the Californium rare isotope breeder upgrade electron beam ion source.

    Science.gov (United States)

    Ostroumov, P N; Barcikowski, A; Dickerson, C A; Perry, A; Pikin, A I; Sharamentov, S I; Vondrasek, R C; Zinkann, G P

    2015-08-01

    The Electron Beam Ion Source (EBIS), developed to breed Californium Rare Isotope Breeder Upgrade (CARIBU) radioactive beams at Argonne Tandem Linac Accelerator System (ATLAS), is being tested off-line. A unique property of the EBIS is a combination of short breeding times, high repetition rates, and a large acceptance. Overall, we have implemented many innovative features during the design and construction of the CARIBU EBIS as compared to the existing EBIS breeders. The off-line charge breeding tests are being performed using a surface ionization source that produces singly charged cesium ions. The main goal of the off-line commissioning is to demonstrate stable operation of the EBIS at a 10 Hz repetition rate and a breeding efficiency into single charge state higher than 15%. These goals have been successfully achieved and exceeded. We have measured (20% ± 0.7%) breeding efficiency into the single charge state of 28+ cesium ions with the breeding time of 28 ms. In general, the current CARIBU EBIS operational parameters can provide charge breeding of any ions in the full mass range of periodic table with high efficiency, short breeding times, and sufficiently low charge-to-mass ratio, 1/6.3 for the heaviest masses, for further acceleration in ATLAS. In this paper, we discuss the parameters of the EBIS and the charge breeding results in a pulsed injection mode with repetition rates up to 10 Hz. PMID:26329185

  9. Neutron activation analysis at the Californium User Facility for Neutron Science

    International Nuclear Information System (INIS)

    The Californium User Facility (CUF) for Neutron Science has been established to provide 252Cf-based neutron irradiation services and research capabilities including neutron activation analysis (NAA). A major advantage of the CUF is its accessibility and controlled experimental conditions compared with those of a reactor environment The CUF maintains the world's largest inventory of compact 252Cf neutron sources. Neutron source intensities of ≤ 1011 neutrons/s are available for irradiations within a contamination-free hot cell, capable of providing thermal and fast neutron fluxes exceeding 108 cm-2 s-1 at the sample. Total flux of ≥109 cm-2 s-1 is feasible for large-volume irradiation rabbits within the 252Cf storage pool. Neutron and gamma transport calculations have been performed using the Monte Carlo transport code MCNP to estimate irradiation fluxes available for sample activation within the hot cell and storage pool and to design and optimize a prompt gamma NAA (PGNAA) configuration for large sample volumes. Confirmatory NAA irradiations have been performed within the pool. Gamma spectroscopy capabilities including PGNAA are being established within the CUF for sample analysis

  10. Long-term effects of an intracavitary treatment with californium-252 on normal tissue

    International Nuclear Information System (INIS)

    About one hundred fifty swine were exposed to either radium-226 or californium-252 sources in the uterine cervix to determine an RBE for both acute and long-term effects. That value for early changes in the tissues at risk in the treatment of cervical cancer was between 6.2 and 6.8. The incidence of complications increased with time after exposure, especially among animals treated with 252Cf. Analysis of rectal injury showed that ulceration occurred frequently within a year postexposure at doses between 1600 and 2400 rad calculated at 2 cm lateral to the source midline. Fat necrosis and smooth muscle atrophy, resulting in a local rectal stricture, were delayed changes observed in some animals. The lower ureter was the site for a greater frequency of complications than the GI tract. Ureteral stricture often occurred at doses of 1200 rad from 252Cf and 7000 rad from 226Ra. Observation of delayed effects in the uterine-cervix in animals held up to 4 years postexposure indicate that the RBE for 252Cf may be increased to a value as high as 18, while repair may have even decreased it to about 5.6 in the rectum. Fifty swine are still being observed for long-term effects after doses above 800 rad from 252Cf and 5000 rad from 226Ra

  11. Manganese determination om minerals by activation analysis, using the californium-252 as a neutron source

    International Nuclear Information System (INIS)

    Neutron Activation Analysis, using a Californium-252 neutron source, has been applied for the determination of manganese in ores such as pyrolusite, rodonite (manganese silicate)' and blending used in dry-batteries The favorable nuclear properties of manganese, such as high thermal neutron cross-section for the reaction 55Mn (n.gamma)56 Mn, high concentration of manganese in the matrix and short half - life of 56Mn, are an ideal combination for non-destructive analysis of manganese in ores. Samples and standards of manganese dioxide were irradiated for about 20 minutes, followed by a 4 to 15 minutes decay and counted in a single channel pulse-height discrimination using a NaI(Tl) scintillation detector. Counting time was equal to 10 minutes. The interference of nuclear reactions 56Fe(n,p)56Mn and 59 Co (n, α)56 were studied, as well as problems in connection with neutron shadowing during irradiation, gamma-rays attenuation during counting and influence of granulometry of samples. One sample,was also analysed by wet-chemical method (sodium bismuthate) in order to compare results. As a whole, i t was shown that the analytical method of neutron activation for manganese in ores and blending, is a method simple, rapid and with good precision and accuracy. (author)

  12. Five-year cure of cervical cancer treated using californium-252 neutron brachytherapy

    International Nuclear Information System (INIS)

    Female pelvic carcinoma is one of the common malignancies seen at the University of Kentucky Medical Center and often presents in an advanced stage. In 1976, the authors began to test californium-252 neutron brachytherapy (NT) for its efficacy for control of primary and recurrent advanced uterine, cervix, and vaginal cancers. The first protocol used was 5000-5500 rad of whole pelvis irradiation followed by 1-2 Cf-252 insertions using a single tandem placed in the utero-cervico-vaginal region. Of 27 patients with primary carcinomas treated, 10 are alive and well 5 year later (37%). Two of two recurrent tumors were locally controlled but failed later. These patients had advanced cervical, vaginal, or endometrial carcinomas. In 1977, a transitional year, treatment of only unfavorable stages and presentations with NT was initiated. Similar results were obtained with NT as compared to conventional photon therapy (PT). Further improvement in treatment results can be anticipated as NT brachytherapy is used for advanced cancer therapy by more effective treatment schedules and radiation doses. Cf-252 can be used as a radium substitute and achieved similar rates of tumor control and 5-year survivals. 21 references, 2 tables

  13. Dicty_cDB: VHD245 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHD245 (Link to dictyBase) - - - Contig-U16363-1 - (Link to Original site) - - VHD2...45Z 549 - - - - Show VHD245 Library VH (Link to library) Clone ID VHD245 (Link to dicty...iol.tsukuba.ac.jp/CSM/VH/VHD2-B/VHD245Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >VHD245 (VHD245Q) /CSM/VH/VHD2-B/VHD245Q.Seq.d/ XXXXXXXXXXGTTTAGC...ctyostelium discoideum dcd2A mRNA for ceramidase, complete cds. 1066 0.0 1 BU801815 |BU801815.1 SJF2DTD01 SJ

  14. Uptake and distribution of californium-252 chloride administered intraperitoneally, intravenously or intratracheally and the effect of in vivo DTPA chelation on intratracheal instillation in the rat

    International Nuclear Information System (INIS)

    The first phase of this investigation, comprising of three groups of animals, was designed to study the fate of californium-252 chloride administered intraperitoneally, intravenously or intratracheally. The second phase, which consisted of two groups of animals, was designed to examine the effectiveness of DTPA chelation therapy in accelerating the excretion and preventing the deposition of californium-252 chloride instilled into the lungs of rats. Immediately following the dose administration of 2 uCi of californium-252 chloride which was dissolved in 0.2 ml of 0.9% NaCl at pH 3.5, each rat was placed in a metabolism cage. Each rat in the first group of phase II was given intraperitoneal injection of CaNa3 DTPA (50 mg/kg) and each rat in the second group was given intraperitoneal injections of 0.9% NaCl. Injections of the DTPA or the NaCl sham were initiated immediately after the intratracheal administration of californium-252 chloride and were continued every three days until sacrifice. Following intraperitoneal, intravenous or intratracheal administration, the whole body retention of californium as a function of time was described by a three component exponential equation. For each mode of administration the short term component exhibited a biological half-life of between 5 and 10 hours; the intermediate component between 4 and 6 days; and the long term component between 200 and 300 days. The organ data obtained following intraperitoneal and intravenous administration were indistinguishable. On day one, the liver retained about 9% of the administered dose and the kidneys retained 2.4%. Retention for these organs decreased to about 1% by day 32. The femurs maintained an almost constant level of 4.5% of the injected dose over the 32 days. The lungs, spleen, heart, and testes showed significant retention of californium

  15. 46 CFR 170.245 - Foam flotation material.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Foam flotation material. 170.245 Section 170.245... REQUIREMENTS FOR ALL INSPECTED VESSELS Special Installations § 170.245 Foam flotation material. (a... by reference; see 46 CFR 170.015), including the requirements for fire resistance. (3) A...

  16. 48 CFR 245.608-2 - Standard screening.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Standard screening. 245.608-2 Section 245.608-2 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS SYSTEM... Contractor Inventory 245.608-2 Standard screening. (b)(1) For the first 30 days, property screening will...

  17. ENEA results in the international comparison organized by BIPM for the measurament of neutron fluxes of a Californium source

    International Nuclear Information System (INIS)

    During the period between May 1978 and August 1984 under the auspices of Section III of CCEMRI of CIPM it has been carried out the international intercomparison of Californium neutron source emission rate. The previous intercomparison was based on Ra-Be (α -n) source measuraments, which took place between 1959 and 1965, and the results showed a total spread of +- 3%. Owing to the better accuracy achived over the following decade the Ra-Be intercomparison was no longer representative of the state of the art, therefore it was decided to arrange the intercomparison based on Californium which in the meantime reached a wide use in the world. Contributions to the intercomparison were received from fourteen laboratories representative of twelve Nations plus the BIPM. The results put into evidence a considerable advance on accuracy in the neutron source emission rate measuraments. The standard deviation of the residuals obtained from least square fit of normalized data resulted +- 0,57%. In the present report it is widely described the Manganese bath method used at ENEA, CRE Casaccia in Roma, and the experimental procedure followed for its absolute calibration. All measuraments are reported and analysed, including those effectuated for corrective factors determination. The final results obtained at ENEA for the circulated Californium source is (3,457 +- 0,013) 10*H7 neutron/s. The analysis of data from all partecipantes has been effectuated and concluded by J. Axton in March 1986 and the conclusions which have been showed in the present report put in evidence the satisfactory results achived by the ENEA

  18. Feasibility and market potential of protein determination of wheat using californium-252

    International Nuclear Information System (INIS)

    To evaluate the feasibility of protein determination by capture gamma-ray analysis using californium-252 neutrons, an in-situ protein analysis system for use by grain handlers has been examined. Three 227 kilogram (approximately) lots of wheat were used to determine the amount of nitrogen present. Protein analyses by the Kjeldahl method were obtained from samples taken before and after the capture gamma-ray analyses. The 5.267-MeV gamma-ray was selected for use in this study as a compromise between efficiency and interference from other elements. The associated counting equipment was a multichannel analyzer with pulse shaping electronic and analysis computing equipment. A linear regression program was used to compare the regions of interest to the Kjeldahl protein averages. The counts composing each peak were summed and normalized using the total count of the hydrogen peak. The normalized nitrogen percentages indicate a significant correlation between the spectral regions and the Kjeldahl analyses. To a first approximation, the value of wheat is the wheat protein. At the present time, protein testing of wheat is destructive, cumbersome, and time-consuming as compared to the potential for capture gamma-ray analysis testing. Assuming that such a protein analysis unit can analyze 42 tonne of wheat per hour, over 120 units would be needed to monitor one-half the U.S. annual wheat production. A 0.5% improvement in processor realizations and grain throughput value of $167.00 per tonne will result in a projected savings of $150,000 per year per unit

  19. Oxygen enhancement ratio (OER) and therapeutic gain factor (GF) for californium-252 at low dose rate

    International Nuclear Information System (INIS)

    The potential benefit of the introduction of californium-252 in interstitial and intracavitary therapy is related to the greater efficiency of its neutron emission against anoxic cancer cells. In that respect, the oxygen enhancement ratio (OER) of the 252Cf emission has been determined for a continuous low dose rate irradiation. The biological system is growth inhibition in Vicia faba bean roots. A new Vicia faba ''BelB'' strain has been used, which better tolerates long periods (up to about 10 hours) of anoxia. In a first series of experiments, for a 252Cf (Dsub(n+γ)) dose rate of 0.11 Gy.h-1, an OER of 1.4+-0.1 was observed (the γ contribution Dγ to the total absorbed dose Dsub(n+γ) was 0.35 at the position of the root tips). In a second series of experiments, in somewhat different geometrical conditions with a 252Cf (Dsub(n+γ)) dose rate of 0.13 Gy.h-1, an OER of 1.5+-0.1 was observed (Dγ/Dsub(n+γ)=0.42). The OER values observed for similar irradiation times, with iridium-192 γ-rays, were 2.3+-0.2 and 2.6+-0.1 respectively, which leads to therapeutic gain factors (GF) of 1.6 and 1.7 respectively. These GF values are slightly lower than those previously obtained (GF=1.8) on the same system, with d(50)-Be p(75)-Be and 15 MeV neutron beams

  20. Application of TSH bioindicator for studying the biological efficiency of neutrons from californium-252 source

    International Nuclear Information System (INIS)

    The effectiveness of neutrons from a Californium-252 source in the induction of various abnormalities in the Tradescantia clone 4430 stamen hair cells (TSH-assay) was studied. The special attention was paid to check whether any enhancement in effects caused by process of boron neutron capture is visible in the cells enriched with boron ions. Two chemicals (borax and BSH) were applied to introduce boron-10 ions into cells. Inflorescence, normal or pretreated with chemicals containing boron, were irradiated in the air with neutrons from a Cf-252 source at KAERI, Taejon, Korea. To estimate the relative biological effectiveness (RBE) in the induction of gene mutations of the neutron beam under the study, Tradescantia inflorescences, without any chemical pretreatment, were irradiated with various doses of X-rays. The ranges of radiation doses used were 0-0.1 Gy in neutrons and 0-0.5 Gy in X-rays. After the time needed to complete the postirradiation repair Tradescantia cuttings were transferred to Cracow, where screening of gene and lethal; mutations, cell cycle alterations in somatic cells have been done, and dose response relationships were figured. The maximal RBE values were estimated in the range of 4.6-6.8. Alterations of RBE value were observed; from 6.8 to 7.8 in the case of plants pretreated with 240 ppm of B-10 from borax, and 4.6 to 6.1 in the case of 400 ppm of B-10 from BSH. Results showed a slight, although statistically insignificant increase in biological efficacy of radiation from the Cf-252 source in samples pretreated with boron containing chemicals. (author)

  1. Divalent and trivalent gas-phase coordination complexes of californium: evaluating the stability of Cf(ii).

    Science.gov (United States)

    Dau, Phuong D; Shuh, David K; Sturzbecher-Hoehne, Manuel; Abergel, Rebecca J; Gibson, John K

    2016-08-01

    The divalent oxidation state is increasingly stable relative to the trivalent state for the later actinide elements, with californium the first actinide to exhibit divalent chemistry under moderate conditions. Although there is evidence for divalent Cf in solution and solid compounds, there are no reports of discrete complexes in which Cf(II) is coordinated by anionic ligands. Described here is the divalent Cf methanesulfinate coordination complex, Cf(II)(CH3SO2)3(-), prepared in the gas phase by reductive elimination of CH3SO2 from Cf(III)(CH3SO2)4(-). Comparison with synthesis of the corresponding Sm and Cm complexes reveals reduction of Cf(III) and Sm(III), and no evidence for reduction of Cm(III). This reflects the comparative 3+/2+ reduction potentials: Cf(3+) (-1.60 V) ≈ Sm(3+) (-1.55 V) ≫ Cm(3+) (-3.7 V). Association of O2 to the divalent complexes is attributed to formation of superoxides, with recovery of the trivalent oxidation state. The new gas-phase chemistry of californium, now the heaviest element to have been studied in this manner, provides evidence for Cf(II) coordination complexes and similar chemistry of Cf and Sm. PMID:27424652

  2. Hypoxic versus normoxic external-beam irradiation of cervical carcinoma combined with californium-252 neutron brachytherapy. Comparative treatment results of a 5-year randomized study

    Czech Academy of Sciences Publication Activity Database

    Tačev, T.; Vacek, Antonín; Ptáčková, B.; Strnad, V.

    2005-01-01

    Roč. 181, č. 5 (2005), s. 273-284. ISSN 0179-7158 Institutional research plan: CEZ:AV0Z50040507 Keywords : cervical carcinoma * hypoxyradiotherapy * californium-252 Subject RIV: BO - Biophysics Impact factor: 3.490, year: 2005

  3. Solving the Hydration Structure of the Heaviest Actinide Aqua Ion Known: The Californium(III) Case

    Energy Technology Data Exchange (ETDEWEB)

    Den Auwer, Ch.; Guillaumont, D. [CEA Marcoule, Nucl Energy Div, Radiochem Proc Dept, SCPS LILA, 30 (France); Galbis, E.; Pappalardo, Rafael R.; Marcos Sanchez, E. [Univ Seville, Dept Quim Fis, E-41012 Seville (Spain); Hernandez-Cobos, J. [Inst Ciencias Fis, Cuernavaca 62251, Morelos (Mexico); Le Naour, C.; Simoni, E. [Univ Paris Sud, Inst Phys Nucl Orsay, Paris (France)

    2010-07-01

    In summary, the first MC simulation of the trivalent cation of californium, based on an exchangeable hydrated ion-water intermolecular potential, has been shown to extend and improve the hydrated ion model. Likewise, the CfL{sub III}-edge EXAFS spectrum of an acidic 1 mm Cf(ClO{sub 4}){sub 3} aqueous solution recorded under optimized experimental conditions has greatly improved the signal/noise ratio of the only previously recorded spectrum. The comparison of the experimental EXAFS spectrum with the two computed ones, obtained from two different intermolecular potentials that predict eight (BP86) or nine (MP2) water molecules in the first coordination shell, leads to the conclusion that the lowest hydration number is preferred. Then, as Cf{sup III} is the heaviest actinide aqua ion for which there is experimental information, the actinide contraction is supported by the present study. (For U{sup III}, R{sub U-O}=2.56 Angstroms, and CN=9{+-}1; for Pu{sup III}, R{sub Pu-O}=2.51 Angstroms and CN=9{+-}1; for Cm{sup III}, R{sub Cm-O}=2.47 Angstroms and CN=9{+-}1). The role of the second hydration shell is important in defining the structure and dynamics of the Cf{sup III} aqua ion, but the contribution of second-shell water molecules to the EXAFS signal as back-scatters is marginal. Finally, this work gives an illustrative example of the benefits which can be achieved from the combination of experimental X-ray absorption spectroscopy and computer simulations. The usefulness of the simultaneous analysis of the results as well as the importance of the structural statistical average has been clearly demonstrated herein. Each technique independently was not adequate. We believe that this study traces out a still poorly explored combined methodology which may be extremely useful for many other complexes and chemical problems. A systematic theoretical and experimental examination of the other known actinide cations on the same basis should be undertaken to confirm the

  4. Design, construction, and characterization of a facility for neutron capture gamma ray analysis of sulfur in coal using californium-252

    International Nuclear Information System (INIS)

    A study of neutron capture gamma ray analysis of sulfur in coal using californium-252 as a neutron source is reported. Both internal and external target geometries are investigated. The facility designed for and used in this study is described. The external target geometry is found to be inappropriate because of the low thermal neutron flux at the sample location, which must be outside the biological shielding. The internal target geometry is found to have a sufficient thermal neutron flux, but an excessive gamma ray background. A water filled plastic facility, rather than the paraffin filled steel one used in this study, is suggested as a means of increasing flexibility and decreasing the beackground in the internal target geometry

  5. 48 CFR 1852.245-75 - Title to equipment.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Title to equipment. 1852.245-75 Section 1852.245-75 Federal Acquisition Regulations System NATIONAL AERONAUTICS AND SPACE... description, manufacturer and model number, date acquired, cost, and condition information, and shall...

  6. Dicty_cDB: CHB245 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHB245 (Link to dictyBase) - - - Contig-U16455-1 CHB245P (Link to Original ... 2e-91 4 CO483664 |CO483664.1 GQ0206.B3_A14 GQ020: Clean ... ROOTS systems -Diurnal cycle Picea glauca cDNA clo ...

  7. Dicty_cDB: CHP245 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHP245 (Link to dictyBase) - - - Contig-U16361-1 CHP245P (Link to Original ... 1-47.b_041.ab1 Whole-genome shotgun library of the elephant ... shark (aka elephant ... fish) Callorhinchus milii geno ...

  8. 24 CFR 245.100 - Right of tenants to organize.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Right of tenants to organize. 245... HOUSING AND URBAN DEVELOPMENT MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES TENANT PARTICIPATION IN MULTIFAMILY HOUSING PROJECTS Tenant Organizations § 245.100 Right...

  9. 7 CFR 245.10 - Action by local educational agencies.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Action by local educational agencies. 245.10 Section 245.10 Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE... documentation obtained from the State or local agency responsible for the Food Stamp, FDPIR or TANF Program,...

  10. 48 CFR 245.610-3 - Proceeds of sale.

    Science.gov (United States)

    2010-10-01

    ... Contractor Inventory 245.610-3 Proceeds of sale. (1) Unless otherwise provided in the contract, the proceeds... settlement agreement; (ii) Credited to the price or cost of the contract; (iii) Applied as otherwise...

  11. Network Analysis of Plasmidomes: The Azospirillum brasilense Sp245 Case

    OpenAIRE

    Valerio Orlandini; Giovanni Emiliani; Marco Fondi; Isabel Maida; Elena Perrin; Renato Fani

    2014-01-01

    Azospirillum brasilense is a nitrogen-fixing bacterium living in association with plant roots. The genome of the strain Sp245, isolated in Brazil from wheat roots, consists of one chromosome and six plasmids. In this work, the A. brasilense Sp245 plasmids were analyzed in order to shed some light on the evolutionary pathways they followed over time. To this purpose, a similarity network approach was applied in order to identify the evolutionary relationships among all the A. brasilense plasmi...

  12. Operational experience with the Argonne National Laboratory Californium Rare Ion Breeder Upgrade facility and electron cyclotron resonance charge breeder

    Science.gov (United States)

    Vondrasek, R.; Clark, J.; Levand, A.; Palchan, T.; Pardo, R.; Savard, G.; Scott, R.

    2014-02-01

    The Californium Rare Ion Breeder Upgrade (CARIBU) of the Argonne National Laboratory Argonne Tandem Linac Accelerator System (ATLAS) facility provides low-energy and accelerated neutron-rich radioactive beams to address key nuclear physics and astrophysics questions. A 350 mCi 252Cf source produces fission fragments which are thermalized and collected by a helium gas catcher into a low-energy particle beam with a charge of 1+ or 2+. An electron cyclotron resonance (ECR) ion source functions as a charge breeder in order to raise the ion charge sufficiently for acceleration in the ATLAS linac. The ECR charge breeder has achieved stable beam charge breeding efficiencies of 10.1% for 23Na7+, 17.9% for 39K10+, 15.6% for 84Kr17+, and 12.4% for 133Cs27+. For the radioactive beams, a charge breeding efficiency of 11.7% has been achieved for 143Cs27+ and 14.7% for 143Ba27+. The typical breeding times are 10 ms/charge state, but the source can be tuned such that this value increases to 100 ms/charge state with the best breeding efficiency corresponding to the longest breeding times—the variation of efficiencies with breeding time will be discussed. Efforts have been made to characterize and reduce the background contaminants present in the ion beam through judicious choice of q/m combinations. Methods of background reduction are being investigated based upon plasma chamber cleaning and vacuum practices.

  13. Long-term effects of an intracavitary treatment with californium-252 on normal tissue. [Swine, /sup 226/Ra

    Energy Technology Data Exchange (ETDEWEB)

    Sullivan, M.F.; Beamer, J.L.; Mahony, T.D.; Cross, F.T.; Lund, J.E.; Endres, G.W.R.

    1976-01-01

    About one hundred fifty swine were exposed to either radium-226 or californium-252 sources in the uterine cervix to determine an RBE for both acute and long-term effects. That value for early changes in the tissues at risk in the treatment of cervical cancer was between 6.2 and 6.8. The incidence of complications increased with time after exposure, especially among animals treated with /sup 252/Cf. Analysis of rectal injury showed that ulceration occurred frequently within a year postexposure at doses between 1600 and 2400 rad calculated at 2 cm lateral to the source midline. Fat necrosis and smooth muscle atrophy, resulting in a local rectal stricture, were delayed changes observed in some animals. The lower ureter was the site for a greater frequency of complications than the GI tract. Ureteral stricture often occurred at doses of 1200 rad from /sup 252/Cf and 7000 rad from /sup 226/Ra. Observation of delayed effects in the uterine-cervix in animals held up to 4 years postexposure indicate that the RBE for /sup 252/Cf may be increased to a value as high as 18, while repair may have even decreased it to about 5.6 in the rectum. Fifty swine are still being observed for long-term effects after doses above 800 rad from /sup 252/Cf and 5000 rad from /sup 226/Ra.

  14. 8 CFR 245.23 - Adjustment of aliens in T nonimmigrant classification.

    Science.gov (United States)

    2010-01-01

    ... pursuant to 8 CFR 214.11(s); (2) The alien is described in sections 212(a)(3), 212(a)(10)(C), or 212(a)(10...-entered using an advance parole document issued under 8 CFR 245.2(a)(4)(ii)(B), the date that the alien...) Inapplicability of 8 CFR 245.1 and 245.2. Sections 245.1 and 245.2 of this chapter do not apply to aliens...

  15. Results with the electron cyclotron resonance charge breeder for the 252Cf fission source project (Californium Rare Ion Breeder Upgrade) at Argonne Tandem Linac Accelerator System

    International Nuclear Information System (INIS)

    The construction of the Californium Rare Ion Breeder Upgrade, a new radioactive beam facility for the Argonne Tandem Linac Accelerator System (ATLAS), is nearing completion. The facility will use fission fragments from a 1 Ci 252Cf source; thermalized and collected into a low-energy particle beam by a helium gas catcher. In order to reaccelerate these beams, an existing ATLAS electron cyclotron resonance (ECR) ion source was redesigned to function as an ECR charge breeder. Thus far, the charge breeder has been tested with stable beams of rubidium and cesium achieving charge breeding efficiencies of 9.7% into 85Rb17+ and 2.9% into 133Cs20+.

  16. Dicty_cDB: VFB245 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFB245 (Link to dictyBase) - G23239 DDB0167842 Contig-U05988-1 VFB245Z (Lin ... i strain CBS... 70 3e-11 (Q9ESF1) RecName: Full=Otofer lin; AltName: Full=Fer -1-like prote... 70 6e-11 (Q9 ... ERC5) RecName: Full=Otofer lin; AltName: Full=Fer -1-like prote... 70 6e-11 AK0 ...

  17. 33 CFR 245.20 - Determination of hazard to navigation.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false Determination of hazard to..., DEPARTMENT OF DEFENSE REMOVAL OF WRECKS AND OTHER OBSTRUCTIONS § 245.20 Determination of hazard to navigation... Coast Guard district to jointly determine whether the obstruction poses a hazard to navigation....

  18. 48 CFR 3053.245-70 - Report of Government property.

    Science.gov (United States)

    2010-10-01

    ... 3053.245-70 Report of Government property. The following form is prescribed for use by contractors to report Government property, as specified in (HSAR) 48 CFR 3045.505-14: DHS Form 0700-05, Contractor's... 48 Federal Acquisition Regulations System 7 2010-10-01 2010-10-01 false Report of...

  19. 48 CFR 245.608-5 - Special items screening.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Special items screening... Disposal of Contractor Inventory 245.608-5 Special items screening. (a) Special test equipment with... screening of the composite STE unit. (A) If the contracting department/agency and the requiring...

  20. 48 CFR 245.607-2 - Recovering precious metals.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Recovering precious metals... Disposal of Contractor Inventory 245.607-2 Recovering precious metals. (b) Precious metals are silver, gold... office with disposition instructions for certain categories of precious metals-bearing...

  1. 48 CFR 245.7310-3 - Liability and insurance.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Liability and insurance... SYSTEM, DEPARTMENT OF DEFENSE CONTRACT MANAGEMENT GOVERNMENT PROPERTY Sale of Surplus Contractor Inventory 245.7310-3 Liability and insurance. When the work to be performed by the purchaser warrants,...

  2. 40 CFR 180.245 - Streptomycin; tolerances for residues.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 23 2010-07-01 2010-07-01 false Streptomycin; tolerances for residues...) PESTICIDE PROGRAMS TOLERANCES AND EXEMPTIONS FOR PESTICIDE CHEMICAL RESIDUES IN FOOD Specific Tolerances § 180.245 Streptomycin; tolerances for residues. (a) General. (1) Tolerances are established...

  3. Ab initio full-potential study of mechanical properties and magnetic phase stability of californium monopnictides (CfN and CfP)

    Science.gov (United States)

    Amari, S.; Bouhafs, B.

    2016-09-01

    Based on the first-principles methods, the structural, elastic, electronic, properties and magnetic ordering of californium monopnictides CfX (X = P) have been studied using the full-potential augmented plane wave plus local orbitals (FP-L/APW + lo) method within the framework of density functional theory (DFT). The electronic exchange correlation energy is described by generalized gradient approximation GGA and GGA+U (U is the Hubbard correction). The GGA+U method is applied to the rare-earth 5f states. We have calculated the lattice parameters, bulk modulii and the first pressure derivatives of the bulk modulii. The elastic properties of the studied compounds are only investigated in the most stable calculated phase. In order to gain further information, we have calculated Young's modulus, shear modulus, anisotropy factor and Kleinman parameter by the aid of the calculated elastic constants. The results mainly show that californium monopnictides CfX (X = P) have an antiferromagnetic spin ordering. Density of states (DOS) and charge densities for both compounds are also computed in the NaCl (B1) structure.

  4. 48 CFR 252.245-7000 - Government-furnished mapping, charting, and geodesy property.

    Science.gov (United States)

    2010-10-01

    ... mapping, charting, and geodesy property. 252.245-7000 Section 252.245-7000 Federal Acquisition Regulations..., charting, and geodesy property. As prescribed in 245.107-70, use the following clause: Government-Furnished Mapping, Charting, and Geodesy Property (DEC 1991) (a) Definition—Mapping, charting, and geodesy...

  5. 17 CFR 245.101 - Prohibition of insider trading during pension fund blackout periods.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Prohibition of insider trading during pension fund blackout periods. 245.101 Section 245.101 Commodity and Securities Exchanges...-Blackout Trading Restriction) § 245.101 Prohibition of insider trading during pension fund blackout...

  6. 48 CFR 245.7205 - Reporting excess and surplus contractor inventory.

    Science.gov (United States)

    2010-10-01

    ... purchases or retention at cost). (3) Line 3—Insert total excess inventory reported by contractors during the... surplus contractor inventory. 245.7205 Section 245.7205 Federal Acquisition Regulations System DEFENSE... Instructions 245.7205 Reporting excess and surplus contractor inventory. (a) Contract administration...

  7. 48 CFR 245.608-7 - Reimbursement of cost for transfer of contractor inventory.

    Science.gov (United States)

    2010-10-01

    ... Reporting, Redistribution, and Disposal of Contractor Inventory 245.608-7 Reimbursement of cost for transfer... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Reimbursement of cost for transfer of contractor inventory. 245.608-7 Section 245.608-7 Federal Acquisition Regulations...

  8. 48 CFR 245.7101-4 - DD Form 1640, Request for Plant Clearance.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false DD Form 1640, Request for Plant Clearance. 245.7101-4 Section 245.7101-4 Federal Acquisition Regulations System DEFENSE... Forms 245.7101-4 DD Form 1640, Request for Plant Clearance. Use to request plant clearance assistance...

  9. 48 CFR 245.7101-2 - DD Form 1149, Requisition and Invoice Shipping Document.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false DD Form 1149, Requisition and Invoice Shipping Document. 245.7101-2 Section 245.7101-2 Federal Acquisition Regulations System... Plant Clearance Forms 245.7101-2 DD Form 1149, Requisition and Invoice Shipping Document. Use...

  10. 27 CFR 28.245 - Shipment to foreign-trade zone.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Shipment to foreign-trade zone. 28.245 Section 28.245 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE... Consignment § 28.245 Shipment to foreign-trade zone. Where distilled spirits (including specially...

  11. 27 CFR 24.245 - Use of carbon dioxide in still wine.

    Science.gov (United States)

    2010-04-01

    ... still wine. 24.245 Section 24.245 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY LIQUORS WINE Storage, Treatment and Finishing of Wine § 24.245 Use of carbon dioxide in still wine. The addition of carbon dioxide to (and retention in) still...

  12. Miniature microwave plasma antenna at 2.45 GHz

    Science.gov (United States)

    Vachkov, Vasil; Kiss'ovski, Zhivko

    2015-12-01

    New unique miniature plasma antenna driven by a one microwave signal at frequency of 2.45 GHz is constructed and tested. The length of the antenna (l = 16 mm) is much shorter than the free space wavelength of the signal. The parameters of the plasma column (n = 2.6±0.4×1018 m-3, Te = 3.1±0.2 eV) are obtained from argon emission spectrum by applying the line ratio method. The simulations of this monopole antenna reveal that in the standing wave regime the plasma antenna is effective transmitter at a frequency of 2.45 GHz. The results we obtained show that the shape of the radiation pattern of the plasma antenna depends on the plasma density, the exciter and the distance above the grounded plane.

  13. Anatomy of a controversy: Application of the Langevin technique to the analysis of the Californium-252 Source-Driven Noise Analysis method for subcriticality determination

    International Nuclear Information System (INIS)

    The expressions for the power spectral density of the noise equivalent sources have been calculated explicitly for the (a) stochastic transport equation, (b) the one-speed transport equaton, (c) the one-speed P1 equations, (d) the one-speed diffusion equation and (e) the point kinetic equation. The stochastic nature of Fick's law in (d) has been emphasized. The Langevin technique has been applied at various levels of approximation to the interpretation of the Californium-252 Source-Driven Noise Analysis (CSDNA) experiment for determining the reactivity in subcritical media. The origin of the controversy surrounding this method has been explained. The foundations of the CSDNA method as a viable experimental technique to infer subcriticality from a measured ratio of power spectral densities of the outputs of two neutron detectors and a third external source detector has been examined by solving the one-speed stochastic diffusion equation for a point external Californium-252 source and two detectors in an infinite medium. The expression relating reactivity to the measured ratio of PSDs was found to depend implicitly on k itself. Through a numerical analysis fo this expression, the authors have demonstrated that for a colinear detector-source-detector configuration for neutron detectors far from the source, the expression for the subcritical multiplication factor becomes essentially insensitive to k, hence, demonstrating some possibility for the viability of this technique. However, under more realistic experimental conditions, i.e., for finite systems in which diffusion theroy is not applicable, the measurement of the subcritical multiplication factor from a single measured ratio of PSDs, without extensive transport calculations, remains doubtful

  14. Application of SCGE assay, classical cytogenetics and FISH for studying in vitro californium-252 neutrons irradiations and BSH pretreatment on human lymphocytes

    International Nuclear Information System (INIS)

    Recently, there has been observed a tendency to apply various energy neutrons for tumor therapy and particularly low energy neutrons from various sources, including californium-252 source, for cancer radiotherapy based on the neutron capture. In this study peripheral blood lymphocytes were used as a model for human cells and three methods were applied to assess the effectiveness of californium-252 neutrons irradiations in vitro in normal cells or pre-treated with compound enriched in B-10 ion. Human blood samples or isolated lymphocytes were irradiated with neutrons from isotopic 252Cf source at the Faculty of Nuclear Physics and Technics at University of Mining and Metallurgy (both neutron source and samples were placed in polyethylene block). Chemical pretreatment with BSH (Na210B12H11SH) was done to introduce boron-10 ion into cells in order to check any enhancement effect due to the process of boron neutron capture. Comet assay was done to investigate the DNA damage. Classical cytogenetics was applied to assess the frequencies of unstable aberrations (dicentrics and rings). Fluorescence in situ hybridization (FISH) with probes for chromosomes 1, 4 (14.3% of whole genome) and pancentromeric probe was performed to evaluate the frequencies of stable aberrations. Linear (or close to linear) increase of DNA damage and aberration frequency was observed with dose of radiation both for lymphocytes untreated or pre-treated with BSH. Very little differences (statistically insignificant) due to radiation dose and BSH pretreatment were observed in the frequencies of SCEs detected in the second mitosis. There is no significant difference between boron pre-treated and not treated cells, and even slightly higher effects were observed in case of the highest dose without BSH pretreatment. The level of translocations observed is comparable with the frequencies of dicentrics and rings. (author)

  15. Californium-252 neutron sources

    International Nuclear Information System (INIS)

    Major production programs for the Savannah River reactors and the High Flux Isotopes Reactor at Oak Ridge have made 252Cf one of the most available and, at the USAEC's sales price of $10/μg, one of the least-expensive isotopic neutron sources. Reactor production has totaled approximately 2 g, and, based on expected demand, an additional 10 g will be produced in the next decade. The approximately 800 mg chemically separated to date has been used to prepare over 600 neutron sources. Most, about 500, have been medical sources containing 1 to 5 μg of 252Cf plated in needles for experimental cancer therapy studies. The remainder have generally been point sources containing 10 μg to 12 mg of oxide for activation, well logging, or radiography uses. Bulk sources have also been supplied to the commercial encapsulators. The latest development has been the production of 252Cf cermet wire which can be cut into almost contamination-free lengths of the desired 252Cf content. Casks are available for transport of sources up to 50 mg. Subcritical assemblies have been developed to multiply the source neutrons by a factor of 10 to 40, and collimators and thermalizers have also been extensively developed to shape the neutron flux and energy distributions for special applications. (U.S.)

  16. Calculations of Nuclear Astrophysics and Californium Fission Neutron Spectrum Averaged Cross Section Uncertainties Using ENDF/B-VII.1, JEFF-3.1.2, JENDL-4.0 and Low-fidelity Covariances

    International Nuclear Information System (INIS)

    Nuclear astrophysics and californium fission neutron spectrum averaged cross sections and their uncertainties for ENDF materials have been calculated. Absolute values were deduced with Maxwellian and Mannhart spectra, while uncertainties are based on ENDF/B-VII.1, JEFF-3.1.2, JENDL-4.0 and Low-Fidelity covariances. These quantities are compared with available data, independent benchmarks, EXFOR library, and analyzed for a wide range of cases. Recommendations for neutron cross section covariances are given and implications are discussed

  17. [Biofilm Formation by the Nonflagellated flhB1 Mutant of Azospirillum brasilense Sp245].

    Science.gov (United States)

    Shelud'ko, A V; Filip'echeva, Yu A; Shumiliva, E M; Khlebtsov, B N; Burov, A M; Petrova, L P; Katsy, E I

    2015-01-01

    Azospirillum brasilense Sp245 with mixed flagellation are able to form biofilms on various surfaces. A nonflagellated mutant of this strain with inactivated chromosomal copy of the flhB gene (flhB1) was shown to exhibit specific traits at the later stages of biofilm formation on a hydrophilic (glass) surface. Mature biofilms of the flhB1::Omegon-Km mutant Sp245.1063 were considerably thinner than those of the parent strain Sp245. The biofilms of the mutant were more susceptible to the forces of hydrodynamic shear. A. brasilense Sp245 cells in biofilms were not found to possess lateral flagella. Cells with polar flagella were, however, revealed by atomic force microscopy of mature native biofilms of strain Sp245. Preservation of a polar flagellum (probably nonmotile) on the cells of A. brasilense Sp245 may enhance the biofilm stability. PMID:26263623

  18. Comparing R1233zd And R245fa For Low Temperature ORC Applications

    OpenAIRE

    Datla, Bala V.; Brasz, Joost J.

    2014-01-01

    The majority of recently introduced ORC systems use R245fa as working fluid. The lower saturation pressures of R245fa versus R134a allowed the use of existing HVAC electric motors, compressors, evaporators and condensers after minor modifications as ORC electric generators, turbines/expanders, boilers and condensers. At elevated saturation temperatures R245fa turbine/expander equipment matches the power density of R134a HVAC compressors equipment. Refrigerants with still lower saturation pres...

  19. 27 CFR 19.245 - Bonds and penal sums of bonds.

    Science.gov (United States)

    2010-04-01

    ... bonds. 19.245 Section 19.245 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE...) Distiller The amount of tax on spirits produced during a period of 15 days $5,000 $100,000 (ii) Warehouseman... gallons ......do 5,000 50,000 (iii) Distiller and warehouseman The amount of tax on spirits...

  20. 48 CFR 245.603-71 - Disposal of contractor inventory for NATO cooperative projects.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Disposal of contractor inventory for NATO cooperative projects. 245.603-71 Section 245.603-71 Federal Acquisition Regulations... inventory for NATO cooperative projects. (a) North Atlantic Treaty Organization (NATO) cooperative...

  1. 8 CFR 245a.37 - Termination of Family Unity Program benefits.

    Science.gov (United States)

    2010-01-01

    ... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Termination of Family Unity Program... UNDER SECTION 245A OF THE IMMIGRATION AND NATIONALITY ACT LIFE Act Amendments Family Unity Provisions § 245a.37 Termination of Family Unity Program benefits. (a) Grounds for termination. The Service...

  2. 7 CFR 245.7 - Hearing procedure for families and local educational agencies.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Hearing procedure for families and local educational agencies. 245.7 Section 245.7 Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS DETERMINING ELIGIBILITY FOR FREE...

  3. 48 CFR 245.302 - Contracts with foreign governments or international organizations.

    Science.gov (United States)

    2010-10-01

    ... governments or international organizations. 245.302 Section 245.302 Federal Acquisition Regulations System... international organizations. (1) General. (i) Approval. A contractor may use Government property on work for foreign governments and international organizations only when approved in writing by the...

  4. CLONING AND CHARACTERIZATION OF A CHROMOSOMAL DNA REGION REQUIRED FOR GROWTH ON 2,4,5-T BY PSEUDOMONAS CEPACIA AC1100

    Science.gov (United States)

    A series of spontaneous 2,4,5-trichlorophenoxyacetic acid (2,4,5-T) nonmetabolizing mutants of Pseudomonas cepacia AC1100 were characterized to be defective in either 2,4,5-T uptake or conversion of this compound to 2,4,5-trichlorophenol (2,4,5-TCP). Two of these mutants, RHC22 a...

  5. Californium interrogation prompt neutron (CIPN) instrument for non-destructive assay of spent nuclear fuel-Design concept and experimental demonstration

    Science.gov (United States)

    Henzlova, D.; Menlove, H. O.; Rael, C. D.; Trellue, H. R.; Tobin, S. J.; Park, Se-Hwan; Oh, Jong-Myeong; Lee, Seung-Kyu; Ahn, Seong-Kyu; Kwon, In-Chan; Kim, Ho-Dong

    2016-01-01

    This paper presents results of the first experimental demonstration of the Californium Interrogation Prompt Neutron (CIPN) instrument developed within a multi-year effort launched by the Next Generation Safeguards Initiative Spent Fuel Project of the United States Department of Energy. The goals of this project focused on developing viable non-destructive assay techniques with capabilities to improve an independent verification of spent fuel assembly characteristics. For this purpose, the CIPN instrument combines active and passive neutron interrogation, along with passive gamma-ray measurements, to provide three independent observables. This paper describes the initial feasibility demonstration of the CIPN instrument, which involved measurements of four pressurized-water-reactor spent fuel assemblies with different levels of burnup and two initial enrichments. The measurements were performed at the Post-Irradiation Examination Facility at the Korea Atomic Energy Institute in the Republic of Korea. The key aim of the demonstration was to evaluate CIPN instrument performance under realistic deployment conditions, with the focus on a detailed assessment of systematic uncertainties that are best evaluated experimentally. The measurements revealed good positioning reproducibility, as well as a high degree of insensitivity of the CIPN instrument's response to irregularities in a radial burnup profile. Systematic uncertainty of individual CIPN instrument signals due to assembly rotation was found to be orientation in the instrument.

  6. 48 CFR 952.245-5 - Government property (cost-reimbursement, time-and-materials, or labor-hour contracts.)

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Government property (cost-reimbursement, time-and-materials, or labor-hour contracts.) 952.245-5 Section 952.245-5 Federal Acquisition... Provisions and Clauses 952.245-5 Government property (cost-reimbursement, time-and-materials, or...

  7. Biodegradation of 2,4,5-trichlorophenoxyacetic acid by a pure culture of Pseudomonas cepacia.

    OpenAIRE

    Kilbane, J J; Chatterjee, D K; Karns, J S; Kellogg, S T; Chakrabarty, A M

    1982-01-01

    A pure culture of Pseudomonas cepacia, designated AC1100, that can utilize 2,4,5-trichlorophenoxyacetic acid (2,4,5-T) as its sole source of carbon and energy was isolated. An actively growing culture of AC1100 was able to degrade more than 97% of 2,4,5-T, present at 1 mg/ml, within 6 days as determined by chloride release, gas chromatographic, and spectrophotometric analyses. The ability of AC1100 to oxidize a variety of chlorophenols and related compounds is also reported.

  8. Biological Efficiency of Californium-252 Source Evaluated by Comet Assay, Classical Cytogenetics and FISH in Human Lymphocytes Irradiated without and with BSH Pretreatment

    International Nuclear Information System (INIS)

    Biological effectiveness of californium-252 source was evaluated after irradiations in vitro of normal or pre-treated with compound enriched in B-10 ion cells. Peripheral blood lymphocytes were used as a model for human cells. DNA and chromosomal damage were studied to compare biological effectiveness of irradiation. Human blood samples or isolated lymphocytes were irradiated with the isotopic source of 252Cf, at the Faculty of Physics and Nuclear Techniques at the University of Mining and Metallurgy (both neutron source and samples were placed in ''infinite'' polyethylene block). Chemical pretreatment with Na210B12H11SH (BSH) was performed to introduce boron-10 ion into cells in order to check any enhancement effect due to the process of boron neutron capture. Single cell gel electrophoresis also known as the Comet assay was done to investigate the DNA damage. Classical cytogenetic analysis was applied to assess the frequencies of unstable aberrations (dicentrics, rings and a centric fragments). To evaluate the frequencies of stable aberrations the fluorescence in situ hybridisation (FISH) with probes for chromosomes 1, 4 (14.3% of the whole genome) was performed. Linear (or close to linear) increase with radiation dose were observed for the DNA damage and aberration frequencies in lymphocytes both untreated or pre-treated with BSH. Levels of translocations evaluated for the whole genome were comparable with the frequencies of dicentrics and rings. No significant differences were detected due to radiation dose in the frequencies of sister chromatid exchanges (SCE) detected in the second mitosis. No statistically significant differences were observed in various biological end-points between normal or boron pre-treated cells. (author)

  9. 8 CFR 245a.3 - Application for adjustment from temporary to permanent resident status.

    Science.gov (United States)

    2010-01-01

    ... of public schools. These textbooks may otherwise be purchased from the Superintendent of Documents...) Evidence of recognition under 8 CFR 245a.3(b)(5)(i)(A), (B), or (C) (e.g., certification from a...

  10. First results of the 2.45 GHz Oshima electron cyclotron resonance ion source

    Science.gov (United States)

    Asaji, T.; Nakamura, T.; Furuse, M.; Hitobo, T.; Uchida, T.; Muramatsu, M.; Kato, Y.

    2016-02-01

    A new electron cyclotron resonance ion source has been constructed at Oshima College with a 2.45 GHz magnetron microwave source and permanent magnets employed as the main components. In addition, a solid-state power amplifier with a frequency range of 2.5-6.0 GHz was installed to study two-frequency plasma heating. Three solenoid coils were set up for adjusting the axial magnetic fields. Argon plasma generation and ion beam production have been conducted during the first year of operation. Ion current densities in the ECR plasma were measured using a biased disk. For 2.45 and 4.65 GHz two-frequency plasma heating, the ion density was approximately 1.5 times higher than that of 2.45 GHz single-frequency heating.

  11. First results of the 2.45 GHz Oshima electron cyclotron resonance ion source

    Energy Technology Data Exchange (ETDEWEB)

    Asaji, T., E-mail: asaji@nc-toyama.ac.jp [National Institute of Technology, Toyama College, 13 Hongo, Toyama 939-8630 (Japan); Nakamura, T.; Furuse, M. [National Institute of Technology, Oshima College, 1091-1 Komatsu, Suouoshima, Oshima, Yamaguchi 742-2193 (Japan); Hitobo, T. [Tateyama Machine Co., Ltd., 30 Shimonoban, Toyama 930-1305 (Japan); Uchida, T. [Graduate School of Engineering, Toyo University, 2100 Kujirai, Kawagoe, Saitama 350-8585 (Japan); Muramatsu, M. [National Institute of Radiological Sciences (NIRS), 4-9-1 Anagawa, Inage-ku, Chiba 263-8555 (Japan); Kato, Y. [Graduate School of Engineering, Osaka University, 2-1 Yamada-oka, Suita, Osaka 565-0871 (Japan)

    2016-02-15

    A new electron cyclotron resonance ion source has been constructed at Oshima College with a 2.45 GHz magnetron microwave source and permanent magnets employed as the main components. In addition, a solid-state power amplifier with a frequency range of 2.5–6.0 GHz was installed to study two-frequency plasma heating. Three solenoid coils were set up for adjusting the axial magnetic fields. Argon plasma generation and ion beam production have been conducted during the first year of operation. Ion current densities in the ECR plasma were measured using a biased disk. For 2.45 and 4.65 GHz two-frequency plasma heating, the ion density was approximately 1.5 times higher than that of 2.45 GHz single-frequency heating.

  12. First results of the 2.45 GHz Oshima electron cyclotron resonance ion source

    International Nuclear Information System (INIS)

    A new electron cyclotron resonance ion source has been constructed at Oshima College with a 2.45 GHz magnetron microwave source and permanent magnets employed as the main components. In addition, a solid-state power amplifier with a frequency range of 2.5–6.0 GHz was installed to study two-frequency plasma heating. Three solenoid coils were set up for adjusting the axial magnetic fields. Argon plasma generation and ion beam production have been conducted during the first year of operation. Ion current densities in the ECR plasma were measured using a biased disk. For 2.45 and 4.65 GHz two-frequency plasma heating, the ion density was approximately 1.5 times higher than that of 2.45 GHz single-frequency heating

  13. Microwave ablation at 915 MHz vs 2.45 GHz: A theoretical and experimental investigation

    International Nuclear Information System (INIS)

    Purpose: The relationship between microwave ablation system operating frequency and ablation performance is not currently well understood. The objective of this study was to comparatively assess the differences in microwave ablation at 915 MHz and 2.45 GHz. Methods: Analytical expressions for electromagnetic radiation from point sources were used to compare power deposition at the two frequencies of interest. A 3D electromagnetic-thermal bioheat transfer solver was implemented with the finite element method to characterize power deposition and thermal ablation with asymmetrical insulated dipole antennas (single-antenna and dual-antenna synchronous arrays). Simulation results were validated against experiments in ex vivo tissue. Results: Theoretical, computational, and experimental results indicated greater power deposition and larger diameter ablation zones when using a single insulated microwave antenna at 2.45 GHz; experimentally, 32 ± 4.1 mm and 36.3 ± 1.0 mm for 5 and 10 min, respectively, at 2.45 GHz, compared to 24 ± 1.7 mm and 29.5 ± 0.6 mm at 915 MHz, with 30 W forward power at the antenna input port. In experiments, faster heating was observed at locations 5 mm (0.91 vs 0.49 °C/s) and 10 mm (0.28 vs 0.15 °C/s) from the antenna operating at 2.45 GHz. Larger ablation zones were observed with dual-antenna arrays at 2.45 GHz; however, the differences were less pronounced than for single antennas. Conclusions: Single- and dual-antenna arrays systems operating at 2.45 GHz yield larger ablation zone due to greater power deposition in proximity to the antenna, as well as greater role of thermal conduction

  14. Microwave ablation at 915 MHz vs 2.45 GHz: A theoretical and experimental investigation

    Energy Technology Data Exchange (ETDEWEB)

    Curto, Sergio; Taj-Eldin, Mohammed; Fairchild, Dillon; Prakash, Punit, E-mail: prakashp@ksu.edu [Department of Electrical and Computer Engineering, Kansas State University, Manhattan, Kansas 66506 (United States)

    2015-11-15

    Purpose: The relationship between microwave ablation system operating frequency and ablation performance is not currently well understood. The objective of this study was to comparatively assess the differences in microwave ablation at 915 MHz and 2.45 GHz. Methods: Analytical expressions for electromagnetic radiation from point sources were used to compare power deposition at the two frequencies of interest. A 3D electromagnetic-thermal bioheat transfer solver was implemented with the finite element method to characterize power deposition and thermal ablation with asymmetrical insulated dipole antennas (single-antenna and dual-antenna synchronous arrays). Simulation results were validated against experiments in ex vivo tissue. Results: Theoretical, computational, and experimental results indicated greater power deposition and larger diameter ablation zones when using a single insulated microwave antenna at 2.45 GHz; experimentally, 32 ± 4.1 mm and 36.3 ± 1.0 mm for 5 and 10 min, respectively, at 2.45 GHz, compared to 24 ± 1.7 mm and 29.5 ± 0.6 mm at 915 MHz, with 30 W forward power at the antenna input port. In experiments, faster heating was observed at locations 5 mm (0.91 vs 0.49 °C/s) and 10 mm (0.28 vs 0.15 °C/s) from the antenna operating at 2.45 GHz. Larger ablation zones were observed with dual-antenna arrays at 2.45 GHz; however, the differences were less pronounced than for single antennas. Conclusions: Single- and dual-antenna arrays systems operating at 2.45 GHz yield larger ablation zone due to greater power deposition in proximity to the antenna, as well as greater role of thermal conduction.

  15. 48 CFR 1852.245-73 - Financial reporting of NASA property in the custody of contractors.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Financial reporting of NASA... CONTRACT CLAUSES Texts of Provisions and Clauses 1852.245-73 Financial reporting of NASA property in the custody of contractors. As prescribed in 1845.106-70(d), insert the following clause: Financial...

  16. 47 CFR 24.245 - Reimbursement under the Cost-Sharing Plan.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 2 2010-10-01 2010-10-01 false Reimbursement under the Cost-Sharing Plan. 24... 1850-1990 Mhz Band § 24.245 Reimbursement under the Cost-Sharing Plan. (a) Registration of... should be based on the actual cost of replacing the incumbent's system with comparable facilities...

  17. 48 CFR 245.7206 - Transmitting DD Form 1342, DoD Property Record.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Transmitting DD Form 1342... Instructions 245.7206 Transmitting DD Form 1342, DoD Property Record. As a minimum, the plant clearance officer will provide the following information in a letter forwarding DD Forms 1342 to DSCR— (a) Number of...

  18. 8 CFR 245.11 - Adjustment of aliens in S nonimmigrant classification.

    Science.gov (United States)

    2010-01-01

    ... supporting documents specified in the instructions to Form I-485 and described in 8 CFR 245.2. Secondary... in 8 CFR 103.2(b)(2). The S nonimmigrant applying to adjust must complete Part 2 of Form I-485 by... unavailable, affidavits may be submitted as provided in 8 CFR 103.2(b)(2). (e) Priority date. The...

  19. 5 CFR 531.245 - Computing locality rates and special rates for GM employees.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Computing locality rates and special... Gm Employees § 531.245 Computing locality rates and special rates for GM employees. Locality rates and special rates are computed for GM employees in the same manner as locality rates and special...

  20. 7 CFR 2.45 - Deputy Under Secretary for Rural Economic and Community Development.

    Science.gov (United States)

    2010-01-01

    ... the Under Secretary for Rural Development § 2.45 Deputy Under Secretary for Rural Economic and... Under Secretary for Rural Economic and Community Development, to be exercised only during the absence or... may hereafter be delegated to the Under Secretary for Rural Economic and Community Development....

  1. Tannic acid Catalyzed an Efficient Synthesis of 2,4,5-Triaryl-1H-Imidazole

    Directory of Open Access Journals (Sweden)

    Shitole Nana Vikram

    2013-05-01

    Full Text Available Tannic acid (C76H52O46 has been found to be an efficient catalyst for one-pot synthesis of 2,4,5-triaryl substituted imidazoles by the reaction of an arylaldehyde, benzyl/benzoin and an ammonium acetate. The short reaction time and excellent yields making this protocol practical and economically attractive.

  2. 48 CFR 245.606-70 - Instructions for completing DD Form 1342, DoD Property Record.

    Science.gov (United States)

    2010-10-01

    ... completing DD Form 1342, DoD Property Record. 245.606-70 Section 245.606-70 Federal Acquisition Regulations... completing DD Form 1342, DoD Property Record. (a) The contractor shall list excess industrial plant equipment (IPE) on DD Form 1342, DoD Property Record, and submit it to the Government property administrator...

  3. High-Frequency Wireless Communications System: 2.45-GHz Front-End Circuit and System Integration

    Science.gov (United States)

    Chen, M.-H.; Huang, M.-C.; Ting, Y.-C.; Chen, H.-H.; Li, T.-L.

    2010-01-01

    In this article, a course on high-frequency wireless communications systems is presented. With the 145-MHz baseband subsystem available from a prerequisite course, the present course emphasizes the design and implementation of the 2.45-GHz front-end subsystem as well as system integration issues. In this curriculum, the 2.45-GHz front-end…

  4. 8 CFR 245.12 - What are the procedures for certain Polish and Hungarian parolees who are adjusting status to...

    Science.gov (United States)

    2010-01-01

    ... Immigration Reform and Immigrant Responsibility Act of 1996? 245.12 Section 245.12 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS ADJUSTMENT OF STATUS TO THAT OF PERSON ADMITTED FOR... adjusting status to that of permanent resident under the Illegal Immigration Reform and...

  5. 7 CFR 245.6 - Application, eligibility and certification of children for free and reduced price meals and free...

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Application, eligibility and certification of children for free and reduced price meals and free milk. 245.6 Section 245.6 Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS DETERMINING ELIGIBILITY FOR...

  6. 7 CFR 245.8 - Nondiscrimination practices for children eligible to receive free and reduced price meals and...

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Nondiscrimination practices for children eligible to receive free and reduced price meals and free milk. 245.8 Section 245.8 Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS DETERMINING ELIGIBILITY...

  7. Californium Recovery from Palladium Wire

    Energy Technology Data Exchange (ETDEWEB)

    Burns, Jon D. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States)

    2014-08-01

    The recovery of 252Cf from palladium-252Cf cermet wires was investigated to determine the feasibility of implementing it into the cermet wire production operation at Oak Ridge National Laboratory’s Radiochemical Engineering Development Center. The dissolution of Pd wire in 8 M HNO3 and trace amounts of HCl was studied at both ambient and elevated temperatures. These studies showed that it took days to dissolve the wire at ambient temperature and only 2 hours at 60°C. Adjusting the ratio of the volume of solvent to the mass of the wire segment showed little change in the kinetics of dissolution, which ranged from 0.176 mL/mg down to 0.019 mL/mg. A successful chromatographic separation of 153Gd, a surrogate for 252Cf, from Pd was demonstrated using AG 50x8 cation exchange resin with a bed volume of 0.5 mL and an internal diameter of 0.8 cm.

  8. Evaluation of various tests for the diagnosis of soil contamination by 2,4,5-trichlorophenol (2,4,5-TCP)

    International Nuclear Information System (INIS)

    Soil response to contamination with 2,4,5-triclorophenol was studied to test the validity of the concept of Generic Reference Levels (GRL), the main criterion used to define soil contamination. Soil samples were artificially contaminated with doses between 0 and 5000 mg kg-1 of 2,4,5-triclorophenol, and analysed by various tests. Where possible, the response of soils to the contaminant was modelled by a sigmoidal dose-response curve in order to estimate the ED50 values. The tests provided different responses, but only microbial biomass-C and dehydrogenase and urease activities demonstrated soil deterioration in response to contamination. The results suggest that the diagnosis of soil contamination has been greatly simplified in the legislation by the provision of a single figure for each compound, and that the GRL concept could perhaps be substituted by measurement of ED50 values, which better reflect the alteration of a soil due to the presence of a xenobiotic substance. - The concentration of a toxic substance present in a soil cannot be considered as the only criteria to classify such soil as contaminated

  9. 48 CFR 245.7101-3 - DD Form 1348-1, DoD Single Line Item Release/Receipt Document.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false DD Form 1348-1, DoD Single Line Item Release/Receipt Document. 245.7101-3 Section 245.7101-3 Federal Acquisition Regulations... PROPERTY Plant Clearance Forms 245.7101-3 DD Form 1348-1, DoD Single Line Item Release/Receipt...

  10. CHARACTERIZATION AND NUCLEOTIDE SEQUENCE DETERMINATION OF A REPEAT ELEMENT ISOLATED FROM A 2,4,5,-T DEGRADING STRAIN OF PSEUDOMONAS CEPACIA

    Science.gov (United States)

    Pseudomonas cepacia strain AC1100, capable of growth on 2,4,5-trichlorophenoxyacetic acid (2,4,5-T), was mutated to the 2,4,5-T− strain PT88 by a ColE1 :: Tn5 chromosomal insertion. Using cloned DNA from the region flanking the insertion, a 1477-bp sequence (designated RS1100) wa...

  11. BIODEGRATION OF 2,4,5-TRICHLOROPHENOXYACETIC ACID IN LIQUID CULTURE AND IN SOIL BY THE WHITE ROT FUNGUS PHANEROCHAETE CHRYSOSPORIUM

    Science.gov (United States)

    Extensive biodegradation of [14C]-2,4,5-trichlorophenoxyacetic acid ([[14C]-2,4,5-T) by the white rot fungus Phanerochaete chrysosporium was demonstrated in nutrient nitrogen-limited aqueous cultures and in [14C]-2,4,5-T-contaminated soil inoculat...

  12. Which neuro-physiologic effects at low level 2.45 GHz RF exposure?

    International Nuclear Information System (INIS)

    The LS electromagnetic band (1-4 GHz) is widely used both in domestic and industrial domains. Several studies suggested that the biological systems would exhibit a specific sensitivity to the 2.45 GHz microwaves (water resonance frequency). Potential human health hazards and especially a disruption of the cholinergic system have been reported, due to exposure to microwaves even at low power density. This work presents a multi-parametric study of freely moving rat where neuro-physiology was investigated during 70 hours using neurochemical (micro-dialysis technique), electrophysiological, behavioral (vigilance stages quantification) and thermo-physiological approaches. The rats were exposed 24 hours to a 2.45 GHz pulsed electromagnetic field at low power density. In this exposure conditions, no significant effect have been reported. (authors)

  13. Structure of human Rack1 protein at a resolution of 2.45 Å

    International Nuclear Information System (INIS)

    The crystal structure of human Rack1 protein is reported at 2.45 Å resolution. The crystal structure of human receptor for activated C-kinase 1 (hRack1) protein is reported at 2.45 Å resolution. The crystals belongs to space group P41212, with three molecules per asymmetric unit. The hRack1 structure features a sevenfold β-propeller, with each blade housing a sequence motif that contains a strictly conserved Trp, the indole group of which is embedded between adjacent blades. In blades 1–5 the imidazole group of a His residue is wedged between the side chains of a Ser residue and an Asp residue through two hydrogen bonds. The hRack1 crystal structure forms a starting basis for understanding the remarkable scaffolding properties of this protein

  14. A flat-field type 2.45 GHz ECR ion source for material science

    International Nuclear Information System (INIS)

    A compact 2.45 GHz ECR ion source has been developed as an etching device for diffusion experiments in the solid- state matter. This source has some specific features different from those of a usual industrial ECR device, that is , to extract high intensity beams fron a relatively small single hole with low emittance under the extraction voltage of several kV at high vacuum degree. Summary of the design, manufacture and beam extraction tests are described. (author)

  15. 8 CFR 245.24 - Adjustment of aliens in U nonimmigrant status.

    Science.gov (United States)

    2010-01-01

    ... section if the alien's U nonimmigrant status has been revoked pursuant to 8 CFR 214.14(h). (d) Application... member or the principal U-1 alien, would suffer extreme hardship as described in 8 CFR 245.24(g) (to the... either a U-1, U-2, U-3, U-4 or U-5 nonimmigrant, as defined in 8 CFR 214.1(a)(2), and (ii) Continues...

  16. Cell investigations simultaneously with exposure to 2.45 GHz microwaves.

    Science.gov (United States)

    Martin, Diana; Cinca, Sabin; Margaritescu, Irina; Neagu, Monica; Iacob, Nicusor; Ighigeanu, Daniel; Matei, Constantin; Craciun, Gabriela; Manaila, Elena; Chirita, Doru Aurel; Moisescu, Mihaela

    2009-01-01

    The paper presents two microwave (MW) exposure systems (MWESs) that permit observations and measurements on cell cultures during their exposure to MW of 2.45 GHz: MWES-1 and MWES-2. MWES-1 is designed for the measurement of the cell membrane fluorescence anisotropies (MFA) simultaneously with MW exposure. MWES-2 is designed for the cells culture exploration under an inverted microscope before, during and after MW exposure. MWES-1 consists mainly of a 2.45 GHz microwave generator (MWG-2.45 GHz-SAIREM) of 0-25 W, equipped with forward power and reflected power displaying, and an adjustable coaxial antenna immersed directly into the cuvette with the cells-suspension of a Spex type spectrofluorometer. The MW effect on membrane fluidity of B16F10 malignant melanoma (B16F10-MM) cells in suspension were investigated with MWES-1, by MFA measurements. We observed a MW induced transition temperature (ITT) rising strongly during the MW exposure as compared with ITT obtained by classical heating (CH). The MWES-2 consists of the MWG-2.45 GHz-SAIREM generator and a rectangular waveguide applicator with traveling wave placed between the condenser and the objective of a Zeiss Axiovert 200 microscope, equipped with a fluorescence device and image acquisition. The MW effects on shape and apoptosis of the B16F10-MM cells were investigate with MWES-2. The B16F10-MM cells exhibited visible shape changes during MW exposure up to 37 degrees C. The MW exposure induced cells apoptosis/necrosis in several seconds after that MW are applied, beginning with SAR = 1.5 W/sample, compared to CH controls exposed at the same temperature dynamics. PMID:21384706

  17. The Influence of Irganox 245 on Crystallinity and Mechanics Stability of Polypropylene-Natural Rubber Poly blends

    International Nuclear Information System (INIS)

    The influence of irganox 245 on crystallinity and mechanics stability of polyethylene (PP)- Natural Rubber (NR) poly blends exposure by sunlight for 12 weeks has been studied. For optimalization of antioxidant function to reduce oxidation in PP-NR (4:1) poly blends irganox 245 with variation concentration of 4 %, 6 %, 8 % and 10 % vol were added. Poly blends was made by blending method at 170oC for 10 minutes with form an 30 rpm. The result showed that irganox 245 could not increasing adhesion at the interface between PP-NR, so PP-NR still immiscible blends. The optimal concentrations of irganox 245 as antioxidant on PP-NR poly blends is 8 % vol. PP-NR-irganox 245 8 % vol have decreasing tensile strength up to 6 % and increasing elongation at break up to 50 % in exposure by sunlight at long time 8 weeks but for 12 weeks tensile strength and elongation at break very weaks. Crystallinity and mechanics stability of PP-NR-irganox 245 8 % vol better than PP-NR poly blends, it is showed by slowly defects and decreasing crystallinity up to 9 % for exposure 12 weeks. (author)

  18. Design of a homogeneous subcritical nuclear reactor based on thorium with a source of californium 252; Diseno de un reactor nuclear subcritico homogeneo a base de Torio con una fuente de Californio 252

    Energy Technology Data Exchange (ETDEWEB)

    Delgado H, C. E.; Vega C, H. R. [Universidad Autonoma de Zacatecas, Unidad Academica de Estudios Nucleares, Cipres No. 10, Fracc. La Penuela, 98068 Zacatecas, Zac. (Mexico); Sajo B, L., E-mail: ce_delgado89@hotmail.com [Universidad Simon Bolivar, Laboratorio de Fisica Nuclear, Apdo. 89000, 1080A Caracas (Venezuela, Bolivarian Republic of)

    2015-10-15

    Full text: One of the energy alternatives to fossil fuels which do not produce greenhouse gases is the nuclear energy. One of the drawbacks of this alternative is the generation of radioactive wastes of long half-life and its relation to the generation of nuclear materials to produce weapons of mass destruction. An option to these drawbacks of nuclear energy is to use Thorium as part of the nuclear fuel which it becomes in U{sup 233} when capturing neutrons, that is a fissile material. In this paper Monte Carlo methods were used to design a homogeneous subcritical reactor based on thorium. As neutron reflector graphite was used. The reactor core is homogeneous and is formed of 70% light water as moderator, 12% of enriched uranium UO{sub 2}(NO{sub 3}){sub 4} and 18% of thorium Th(NO{sub 3}){sub 4} as fuel. To start the nuclear fission chain reaction an isotopic source of californium 252 was used with an intensity of 4.6 x 10{sup 7} s{sup -1}. In the design the value of the effective multiplication factor, whose value turned out k{sub eff} <1 was calculated. Also, the neutron spectra at different distances from the source and the total fluence were calculated, as well as the values of the ambient dose equivalent in the periphery of the reactor. (Author)

  19. Manganese determination om minerals by activation analysis, using the californium-252 as a neutron source; Determinacao de manganes em minerios, por analise por ativacao, usando californio-252 como fonte de neutrons

    Energy Technology Data Exchange (ETDEWEB)

    Cardoso, Antonio

    1976-07-01

    Neutron Activation Analysis, using a Californium-252 neutron source, has been applied for the determination of manganese in ores such as pyrolusite, rodonite (manganese silicate)' and blending used in dry-batteries The favorable nuclear properties of manganese, such as high thermal neutron cross-section for the reaction {sup 55}Mn (n.gamma){sup 56} Mn, high concentration of manganese in the matrix and short half - life of {sup 56}Mn, are an ideal combination for non-destructive analysis of manganese in ores. Samples and standards of manganese dioxide were irradiated for about 20 minutes, followed by a 4 to 15 minutes decay and counted in a single channel pulse-height discrimination using a NaI(Tl) scintillation detector. Counting time was equal to 10 minutes. The interference of nuclear reactions {sup 56}Fe(n,p){sup 56}Mn and {sup 59} Co (n, {alpha}){sup 56} were studied, as well as problems in connection with neutron shadowing during irradiation, gamma-rays attenuation during counting and influence of granulometry of samples. One sample,was also analysed by wet-chemical method (sodium bismuthate) in order to compare results. As a whole, i t was shown that the analytical method of neutron activation for manganese in ores and blending, is a method simple, rapid and with good precision and accuracy. (author)

  20. [Isolation and purification of Mn-peroxidase from Azospirillum brasilense Sp245].

    Science.gov (United States)

    Kupriashina, M A; Selivanov, N Iu; Nikitina, V E

    2012-01-01

    Homogenous Mn-peroxidase of a 26-fold purity grade was isolated from a culture of Azospirillum brasilense Sp245 cultivated on a medium containing 0.1 mM pyrocatechol. The molecular weight of the enzyme is 43 kD as revealed by electrophoresis in SDS-PAAG. It was shown that the use of pyrocatechol and 2,2'-azino-bis(3-ethylbenzotiazoline-6-sulfonate) at concentrations of 0.1 and I mM as inductors increased the Mn-peroxidase activity by a factor of 3. PMID:22567881

  1. Review on high current 2.45 GHz electron cyclotron resonance sources (invited)

    International Nuclear Information System (INIS)

    The suitable source for the production of intense beams for high power accelerators must obey to the request of high brightness, stability, and reliability. The 2.45 GHz off-resonance microwave discharge sources are the ideal device to generate the requested beams, as they produce multimilliampere beams of protons, deuterons, and monocharged ions, remaining stable for several weeks without maintenance. A description of different technical designs will be given, analyzing their strength, and weakness, with regard to the extraction system and low energy beam transport line, as the presence of beam halo is detrimental for the accelerator.

  2. Resolved 24.5 micron emission from massive young stellar objects

    Science.gov (United States)

    de Wit, W. J.; Hoare, M. G.; Fujiyoshi, T.; Oudmaijer, R. D.; Honda, M.; Kataza, H.; Miyata, T.; Okamoto, Y. K.; Onaka, T.; Sako, S.; Yamashita, T.

    2009-01-01

    Context: Massive young stellar objects (MYSO) are surrounded by massive dusty envelopes, whose physical structure and geometry are determined by the star formation process. Aims: Our principal aim is to establish the density structure of MYSO envelopes on scales of ~1000 AU. This constitutes an increase of a factor ~10 in angular resolution compared to similar studies performed in the (sub)mm. Methods: We have obtained diffraction-limited (0.6´´) 24.5 μm images (field of view of 40 arcsec×30 arcsec) of 14 well-known massive star formation regions with the COMICS instrument mounted on the 8.2 m Subaru telescope. We construct azimuthally averaged intensity profiles of the resolved MYSO envelopes and build spectral energy distributions (SEDs) from archival data and the COMICS 24.5 μm flux density. The SEDs range from near-infrared to millimeter wavelengths. Self-consistent 1-D radiative transfer models described by a density dependence of the form n(r) ∝ r-p are used to simultaneously compare the intensity profiles and SEDs to model predictions. Results: The images reveal the presence of discrete MYSO sources which are resolved on arcsecond scales, and, to first-order, the observed emission is circular on the sky. For many sources, the spherical models are capable of satisfactorily reproducing the 24.5 μm intensity profile, the 24.5 μm flux density, the 9.7 μm silicate absorption feature, and the submm emission. They are described by density distributions with p =1.0±0.25. Such distributions are shallower than those found on larger scales probed with single-dish (sub)mm studies. Other sources have density laws that are shallower/steeper than p=1.0 and there is evidence that these are viewed near edge-on or near face-on respectively. In these cases spherical models fail to provide good fits to the data. The images also reveal a diffuse component tracing somewhat larger scale structures, particularly visible in the regions S 140, AFGL 2136, IRAS 20126

  3. Breakdown transient study of plasma distributions in a 2.45 GHz hydrogen discharge

    Energy Technology Data Exchange (ETDEWEB)

    Cortázar, O.D., E-mail: daniel.cortazar@uclm.es [Universidad de Castilla-La Mancha, ETSII-INEI, Applied Mechanics and Projects Department, C.J. Cela s/n, 13170 Ciudad Real (Spain); Megía-Macías, A. [ESS Bilbao Consortium, Polígono Ugaldeguren-III Pol. A 7B, 48170-Zamudio, Vizcaya (Spain); Tarvainen, O.; Koivisto, H. [University of Jyväskylä, Department of Physics, PO Box 35 (YFL), 40500 Jyväskylä (Finland)

    2015-05-01

    Plasma distribution transients associated with the breakdown of a 2.45 GHz hydrogen discharge similar to high current microwave ion sources are studied by means of an ultra-fast frame image acquisition system in visible light range. Eight different plasma distributions have been studied by photographing the 2D projections of the discharge through a transparent plasma electrode. The temporal evolution of images in Balmer-alpha and Fulcher band wavelengths have been recorded associated to atomic and molecular excitation and ionization processes. Some unexpected plasma distributions transient behaviors during breakdown are reported.

  4. Evaluation of isopentane, R-245fa and their mixtures as working fluids for organic Rankine cycles

    International Nuclear Information System (INIS)

    Low grade thermal energy from sources such as solar, geothermal and industrial waste heat in the temperature range of 380–425 K can be converted to electrical energy with reasonable efficiency using isopentane and R-245fa. While the former is flammable and the latter has considerable global warming potential, their mixture in 0.7/0.3 mole fraction is shown to obviate these disadvantages and yet retain dominant merits of each fluid. A realistic thermodynamic analysis is carried out wherein the possible sources of irreversibilities such as isentropic efficiencies of the expander and the pump and entropy generation in the regenerator, boiler and condenser are accounted for. The performance of the system in the chosen range of heat source temperatures is evaluated. A technique of identifying the required source temperature for a given output of the plant and the maximum operating temperature of the working fluid is developed. This is based on the pinch point occurrence in the boiler and entropy generation in the boiling and superheating regions of the boiler. It is shown that cycle efficiencies of 10–13% can be obtained in the range investigated at an optimal expansion ratio of 7–10. -- Highlights: ► Non-water based working fluids and their mixtures for power generation. ► Results for isopentane, R-245fa and their mixtures. ► Appropriation of irreversibilities in cycle components. ► Entropy generation based identification of heat source temperature

  5. Evidence of an irradiated accretion disc in XTE J1818-245*

    International Nuclear Information System (INIS)

    The X-ray transient source XTE J1818-245 went through an outburst in 2005 that was observed during a multiwavelength campaign from radio to soft γ-rays. Observations in V and R optical bands with the 1-m Swope telescope allowed the discovery of a new bright source. As we aimed to reveal the nature of the companion star, we performed new optical observations with the ESO/NTT telescope at La Silla, both in photometry and spectroscopy. We confirm the optical counterpart found by the Swope telescope, but the spectral type of the secondary star could not be identified. The spectrum showed a blue-dominated shape and an Hα emission line was detected, indicating that the optical emission was dominated by the presence of an accretion disc. The broad-band spectral energy distribution revealed that the outer parts of the accretion disc had to be irradiated by its inner parts to explain the optical emission. New observations of XTE J1818-245 in quiescence are needed to find the nature of the companion star. Moreover, radio-to-X-ray strictly simultaneous observations of transient black holes are needed to disentangle the importance of jets and irradiated accretion discs in the infrared-optical-ultraviolet domain. (authors)

  6. Adsorption and photodegradation kinetics of herbicide 2,4,5-trichlorophenoxyacetic acid with MgFeTi layered double hydroxides.

    Science.gov (United States)

    Nguyen, Thi Kim Phuong; Beak, Min-wook; Huy, Bui The; Lee, Yong-Ill

    2016-03-01

    The calcined layered double hydroxides (cLDHs) Ti-doped and undoped MgFe for this study were prepared by co-precipitation method followed by calcination at 500 °C. The as-prepared samples were characterized by scanning electron microscopy (SEM), X-ray diffraction (XRD), Brunauer Emmett Teller (BET) and UV-Vis diffuse reflectance spectrum (DRS) techniques and tested for adsorption and photodegradation (including photocatalytic and photo-Fenton-like) of 2,4,5-trichlorophenoxyacetic acid (2,4,5-T) in aqueous solutions under visible light irradiation. In the range of studied operating conditions, the as-prepared samples exhibited excellent photo-Fenton-like activity, leading to more than 80-95% degradation of 2,4,5-T at initial concentration of 100 mg L(-1) with 4 g calcined LDHs per liter, was accomplished in 360 min, while 2,4,5-T half-life time was as short as 99-182 min. The kinetics of adsorption and photodegradation of 2,4,5-T were also discussed. These results offered a green, low cost and high efficiency photocatalyst for environmental remediation. PMID:26706931

  7. VUV irradiance measurement of a 2.45 GHz microwave-driven hydrogen discharge

    CERN Document Server

    Komppula, J; Kalvas, T; Koivisto, H; Kronholm, R; Laulainen, J; Myllyperkiö, P

    2015-01-01

    Absolute values of VUV-emission of a 2.45 GHz microwave-driven hydrogen discharge are reported. The measurements were performed with a robust and straightforward method based on a photodiode and optical filters. It was found that the volumetric photon emission rate in the VUV-range (80-250 nm) is $10^{16}$-$10^{17}$ 1/cm$^3$s, which corresponds to approximately 8% dissipation of injected microwave power by VUV photon emission. The volumetric emission of characteristic emission bands was utilized to diagnostics of molecular plasma processes including volumetric rates of ionization, dissociation and excitation to high vibrational levels and metastable states. The estimated reaction rates imply that each injected molecule experiences several inelastic electron impact collisions. The upper limit for the total density of metastable neutrals ($2S$ atoms and $c^3\\Pi_u$ molecules) was estimated to be approximately 0.5% of the neutral gas density.

  8. VUV irradiance measurement of a 2.45 GHz microwave-driven hydrogen discharge

    Science.gov (United States)

    Komppula, J.; Tarvainen, O.; Kalvas, T.; Koivisto, H.; Kronholm, R.; Laulainen, J.; Myllyperkiö, P.

    2015-09-01

    Absolute values of VUV-emission of a 2.45 GHz microwave-driven hydrogen discharge are reported. The measurements were performed with a robust and straightforward method based on a photodiode and optical filters. It was found that the volumetric photon emission rate in the VUV-range (80-250 nm) is 1016-1017 cm-3 s-1, which corresponds to approximately 8% dissipation of injected microwave power by VUV photon emission. The volumetric emission of characteristic emission bands was utilized to diagnostics of molecular plasma processes including volumetric rates of ionization, dissociation and excitation to high vibrational levels and metastable states. The estimated reaction rates imply that each injected molecule experiences several inelastic electron impact collisions. The upper limit for the total density of metastable neutrals (2S atoms and {{c}3}{{\\Pi}u} molecules) was estimated to be approximately 0.5% of the neutral gas density.

  9. 12 CFR 24.5 - Public welfare investment after-the-fact notice and prior approval procedures.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 1 2010-01-01 2010-01-01 false Public welfare investment after-the-fact notice... OTHER PUBLIC WELFARE INVESTMENTS § 24.5 Public welfare investment after-the-fact notice and prior... outstanding public welfare investments and commitments, including the investment that is the subject of...

  10. 30 CFR 250.245 - What hydrogen sulfide (H2S) information must accompany the DPP or DOCD?

    Science.gov (United States)

    2010-07-01

    ... analysis must be consistent with the EPA's risk management plan methodologies outlined in 40 CFR part 68. ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false What hydrogen sulfide (H2S) information must... Documents (docd) § 250.245 What hydrogen sulfide (H2S) information must accompany the DPP or DOCD?...

  11. 8 CFR 245.7 - Adjustment of status of certain Soviet and Indochinese parolees under the Foreign Operations...

    Science.gov (United States)

    2010-01-01

    ... adjustment is filed, (3) Is admissible to the United States as an immigrant, except as provided in paragraph... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Adjustment of status of certain Soviet and... ADJUSTMENT OF STATUS TO THAT OF PERSON ADMITTED FOR PERMANENT RESIDENCE § 245.7 Adjustment of status...

  12. 24 CFR 245.417 - Initial submission of materials to HUD: Conversion of residential units to a nonresidential use...

    Science.gov (United States)

    2010-04-01

    ... HUD: Conversion of residential units to a nonresidential use, or to cooperative housing or... Covered Action § 245.417 Initial submission of materials to HUD: Conversion of residential units to a nonresidential use, or to cooperative housing or condominiums. In the case of a conversion of residential...

  13. 49 CFR 40.245 - What is the procedure for an alcohol screening test using a saliva ASD or a breath tube ASD?

    Science.gov (United States)

    2010-10-01

    ... test using a saliva ASD or a breath tube ASD? 40.245 Section 40.245 Transportation Office of the... a breath tube ASD? (a) As the STT or BAT, you must take the following steps when using the saliva ASD: (1) Check the expiration date on the device or on the package containing the device and show...

  14. USP2-45 Is a Circadian Clock Output Effector Regulating Calcium Absorption at the Post-Translational Level.

    Directory of Open Access Journals (Sweden)

    Daniel Pouly

    Full Text Available The mammalian circadian clock influences most aspects of physiology and behavior through the transcriptional control of a wide variety of genes, mostly in a tissue-specific manner. About 20 clock-controlled genes (CCGs oscillate in virtually all mammalian tissues and are generally considered as core clock components. One of them is Ubiquitin-Specific Protease 2 (Usp2, whose status remains controversial, as it may be a cogwheel regulating the stability or activity of core cogwheels or an output effector. We report here that Usp2 is a clock output effector related to bodily Ca2+ homeostasis, a feature that is conserved across evolution. Drosophila with a whole-body knockdown of the orthologue of Usp2, CG14619 (dUsp2-kd, predominantly die during pupation but are rescued by dietary Ca2+ supplementation. Usp2-KO mice show hyperabsorption of dietary Ca2+ in small intestine, likely due to strong overexpression of the membrane scaffold protein NHERF4, a regulator of the Ca2+ channel TRPV6 mediating dietary Ca2+ uptake. In this tissue, USP2-45 is found in membrane fractions and negatively regulates NHERF4 protein abundance in a rhythmic manner at the protein level. In clock mutant animals (Cry1/Cry2-dKO, rhythmic USP2-45 expression is lost, as well as the one of NHERF4, confirming the inverse relationship between USP2-45 and NHERF4 protein levels. Finally, USP2-45 interacts in vitro with NHERF4 and endogenous Clathrin Heavy Chain. Taken together these data prompt us to define USP2-45 as the first clock output effector acting at the post-translational level at cell membranes and possibly regulating membrane permeability of Ca2+.

  15. Two approaches for $H^{-}$ ion production with 245 GHz ion sources

    CERN Document Server

    Gobin, R; Bacal, M; Breton, J; Delferrière, O; Harrault, F; Ivanov, A A; Svarnas, P; Tuske, O

    2006-01-01

    Over the last few years, the accelerator community requested the development of improved negative hydrogen ion sources. For spallation sources, like SNS or ESS, pulsed high intensity H/sup negative ion beams of a few tens of milliamperes, with a duty cycle close to 10%, are required. New facilities like CERN also ask for high performance negative ion beams. Since CEA undertook an electron cyclotron resonance (ECR)-based ion source programme, a European network devoted to high performance negative ion source development has been created. In this group, several laboratories developing 2.45 GHz ECR sources follow different approaches to increase the extracted ion current. At Saclay, with a solenoidal magnetic structure based on coils, close to 3 mA H/sup negative ion beam is now extracted in pulsed mode (2 ms/100 ms). A metallic biased grid separates the plasma bulk from the H/sup negative ion production zone and significantly improves the H/sup negative extracted current. At Ecole Polytechnique, the source Came...

  16. Plasma studies and beam emittance measurements of 2.45 GHz microwave ion source at VECC

    International Nuclear Information System (INIS)

    A 2.45 GHz microwave ion source operating at VECC is able to produce a total beam current of ∼ 12 mA at a beam energy of 75 KeV with a microwave power of 400 W as described in. In order to optimize the performance of the ion source, we have conducted systematic studies with the variation of ion source gas flow rate, magnetic field, extraction voltage, suppressor voltage, microwave power etc. The total extracted beam current was recorded as a function of each of the earlier mentioned parameters. Moreover, we have studied the effect on extracted beam current and its transmission in the beam transport line due to dielectric and water introduction into the plasma chamber. In the best setting, we have found a total extracted beam current of 12.5 mA with a beam transmission of 70 %. Furthermore, we have also studied the extracted beam current and its transmission in the beam transport line using aluminum plasma chamber of different diameters. Finally, we have estimated the beam emittance by solenoid scan technique of a neutralized 75 KeV, 5 mA proton beam by measuring beam profile using a non-interceptive residual gas fluorescence monitor. The measured normalized rms emittance of the neutralized beam is 0.05 mm-mrad, which seems to be quite reasonable. (author)

  17. Flexible indium-gallium-zinc-oxide Schottky diode operating beyond 2.45 GHz

    Science.gov (United States)

    Zhang, Jiawei; Li, Yunpeng; Zhang, Binglei; Wang, Hanbin; Xin, Qian; Song, Aimin

    2015-07-01

    Mechanically flexible mobile phones have been long anticipated due to the rapid development of thin-film electronics in the last couple of decades. However, to date, no such phone has been developed, largely due to a lack of flexible electronic components that are fast enough for the required wireless communications, in particular the speed-demanding front-end rectifiers. Here Schottky diodes based on amorphous indium-gallium-zinc-oxide (IGZO) are fabricated on flexible plastic substrates. Using suitable radio-frequency mesa structures, a range of IGZO thicknesses and diode sizes have been studied. The results have revealed an unexpected dependence of the diode speed on the IGZO thickness. The findings enable the best optimized flexible diodes to reach 6.3 GHz at zero bias, which is beyond the critical benchmark speed of 2.45 GHz to satisfy the principal frequency bands of smart phones such as those for cellular communication, Bluetooth, Wi-Fi and global satellite positioning.

  18. Flexible indium-gallium-zinc-oxide Schottky diode operating beyond 2.45 GHz.

    Science.gov (United States)

    Zhang, Jiawei; Li, Yunpeng; Zhang, Binglei; Wang, Hanbin; Xin, Qian; Song, Aimin

    2015-01-01

    Mechanically flexible mobile phones have been long anticipated due to the rapid development of thin-film electronics in the last couple of decades. However, to date, no such phone has been developed, largely due to a lack of flexible electronic components that are fast enough for the required wireless communications, in particular the speed-demanding front-end rectifiers. Here Schottky diodes based on amorphous indium-gallium-zinc-oxide (IGZO) are fabricated on flexible plastic substrates. Using suitable radio-frequency mesa structures, a range of IGZO thicknesses and diode sizes have been studied. The results have revealed an unexpected dependence of the diode speed on the IGZO thickness. The findings enable the best optimized flexible diodes to reach 6.3 GHz at zero bias, which is beyond the critical benchmark speed of 2.45 GHz to satisfy the principal frequency bands of smart phones such as those for cellular communication, Bluetooth, Wi-Fi and global satellite positioning. PMID:26138510

  19. Status of the high current permanent magnet 2.45 GHz ECR ion source at Peking University

    International Nuclear Information System (INIS)

    Several compact 2.45 GHz Electron Cyclotron Resonance Ion Sources (ECRIS) have been developed at Peking University for ion implantation, for the Separated Function Radio Frequency Quadrupole project (SFRFQ) and for the Peking University Neutron Imaging Facility project (PKUNIFTY). Studies on 2.45 GHz ECR ion sources are concentrated on methods of microwave coupling and microwave window design, magnetic field generation and configuration, as well as the extraction electrodes structure. Investigation also covers the influence of the size of plasma chamber on the discharge efficiency and species factor. Up to now, our sources have produced 25 mA of O+ ions, 40 mA of He+ ions, 10 mA of N+ ions, 100 mA of H+ ions and 83 mA of D+ ions, respectively. The paper is followed by the slides of the presentation. (authors)

  20. Fate of the herbicides 2,4,5-T, atrazine, and DNOC in a shallow, anaerobic aquifer investigated by in situ passive diffusive emitters and laboratory batch experiments

    DEFF Research Database (Denmark)

    Arildskov, N.P.; Pedersen, Philip Grinder; Albrechtsen, Hans-Jørgen

    2001-01-01

    from 3 to 3.5 rubs, only 27% to 52% of the 2,4,5-T remained after 196 days. 2,4,5-trichlorophenol was identified as the major metabolite. A lag period of at least 50 days was observed, and no degradation occurred in HgCl2 amended controls, verifying that the process was microbially mediated. In the...... other 2,4,5-T incubations and all the atrazine incubations, concentrations decreased linearly, but less than 25% was removed within 200 to 250 days. No degradation products could be detected, and slow sorption was the likely explanation. In all the laboratory incubations DNOC was degraded, following...

  1. Experimental evidence of E × B plasma rotation in a 2.45 GHz hydrogen discharge

    International Nuclear Information System (INIS)

    An experimental observation of a rotating plasma structure in a 2.45 GHz microwave-driven hydrogen discharge is reported. The rotation is presumably produced by E × B drift. The formation of the rotating plasma structure is sensitive to the strength of the off-resonance static magnetic field. The rotation frequency is on the order of 10 kHz and is affected by the neutral gas pressure and applied microwave power

  2. RRS "Discovery" Cruise D279, 04 Apr - 10 May 2004. A Transatlantic hydrography section at 24.5N

    OpenAIRE

    Cunningham, S. A.

    2005-01-01

    The cruise report describes the acquisition and processing of transatlantic hydrographic, velocity, chemistry and other measurements made during three cruises in Spring 2004 at 24.5°N. Measurements were made from shallow water near Africa to shallow water just off Palm Springs beach on the eastern seaboard of the USA. During the principal cruise, RRS Discovery Cruise D279 (4 April to 10 May 2004), 125 full depth CTD and lowered acoustic Doppler current profiler (LADP) stations were complete...

  3. Analysis of PIFA antenna coupling in nearby traces and reduction with CSRRs in PCB at 2.45 GHz

    OpenAIRE

    Gil Galí, Ignacio; Fernández García, Raúl

    2015-01-01

    The electromagnetic coupling of a conventional planar inverted-F antenna (PIFA) antenna in the nearby layout traces is investigated in the 2.45 GHz industrial, scientific and medical radio band. The impact of a complementary split-ring resonator (CSRR) to reduce the coupling as well as the overall antenna performance after perturbing the ground plane is reported. 2.5D and 3D full electromagnetic simulations are used to design and analyze the proposed layouts. Experimental...

  4. Polarization of Unbalanced Antennas for Ear-to-Ear On-Body Communications at 2.45 GHz

    DEFF Research Database (Denmark)

    Kvist, Søren Helstrup; Thaysen, Jesper; Jakobsen, Kaj Bjarne

    2011-01-01

    The impact of antenna polarization on the earto- ear transmission channel at 2.45 GHz is investigated. Two antenna configurations have been considered for monopole antennas operated on small ground planes that are placed next to the human head. The two setups provide different current distributions...... on the ground planes, which has a drastic impact on the antenna polarization. Their performances are compared in terms of maximum path gain (|S21|) and obtainable bandwidth of the antenna structures....

  5. A novel polymeric catalyst for the one-pot synthesis of 2,4,5-triaryl-1H-imidazoles

    Indian Academy of Sciences (India)

    Ali Mohammadi; Hossein Keshvari; Reza Sandaroos; Hamed Rouhi; Zeinalabedin Sepehr

    2012-05-01

    An efficient synthesis of 2,4,5-trisubstituted imidazoles is achieved by three component cyclocondensation of benzil or benzoin, aldehyde and ammonium acetate by using novel polymeric catalyst [poly(AMPS-co-AA)] under solvent-free conditions. The key advantages of this process are high yields, shorter reaction times, easy work-up, purification of products by non-chromatographic method and the reusability of the catalyst.

  6. Bit error rate analysis of Wi-Fi and bluetooth under the interference of 2.45 GHz RFID

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    IEEE 802.11b WLAN (Wi-Fi) and IEEE 802.15.1 WPAN (bluetooth) are prevalent nowadays, and radio frequency identification (RFID) is an emerging technology which has wider applications. 802.11b occupies unlicensed industrial, scientific and medical (ISM) band (2.4-2.483 5 GHz) and uses direct sequence spread spectrum (DSSS) to alleviate the narrow band interference and fading. Bluetooth is also one user of ISM band and adopts frequency hopping spread spectrum (FHSS) to avoid the mutual interference. RFID can operate on multiple frequency bands, such as 135 KHz, 13.56 MHz and 2.45 GHz. When 2.45 GHz RFID device, which uses FHSS, collocates with 802.11b or bluetooth, the mutual interference is inevitable. Although DSSS and FHSS are applied to mitigate the interference, their performance degradation may be very significant. Therefore, in this article, the impact of 2.45 GHz RFID on 802.11b and bluetooth is investigated. Bit error rate (BER) of 802.11b and bluetooth are analyzed by establishing a mathematical model, and the simula-tion results are compared with the theoretical analysis to justify this mathematical model.

  7. Purification and characterization of β-Fructosidase with inulinase activity from Aspergillus niger - 245

    Directory of Open Access Journals (Sweden)

    Vinícius D'Arcadia Cruz

    1998-01-01

    Full Text Available Aspergillus niger - 245, a strain isolated from soil samples showed good β-fructosidase activity when inoculated in medium formulated with dahlia extract tubers. The enzyme was purified by precipitation in ammonium sulphate and percolated in DEAE-Sephadex A-50 and CM-cellulose columns, witch showed a single peack in all the purification steps, maintaining the I/S ratio between 0.32 to, 0.39. Optimum pH for inulinase activity (I was between 4.0 - 4.5 and for invertase activity (S between 2.5 and 5.0. The optimum temperature was 60O.C for both activities and no loss in activity was observed when it was maintained at this temperature for 30 min. The Km value was 1.44 and 5.0, respectively, for I and S and Vm value 10.48 and 30.55, respectively. The I activity was strongly inhibited by Hg2+ and Ag+ and 2 x 10-3 M of glucose, but not by fructose at the same concentration. The enzyme showed an exo-action mechanism, acting on the inulin of different origins. In assay conditions total hydrolysis of all the frutans was obtained, although it has shown larger activity on the chicory inulin than that one from artichoke Jerusalem and dahlia, in the first 30 min. The obtained results suggested that the enzyme presented good potential for industrial application in the preparing the fructose syrupsAspergillus niger - 245, isolado do solo mostrou boa atividade de b-frutosidase meio formulado com extrato de tubérculos de dahlia. A enzima foi purificada por precipitação em sulfato de amônia e percolada em colunas de DEAE-Sephadex A-50 e CM-celulose, produzindo um único pico em todas as fases de purificação e mantendo a relação I/S entre 0,32 a 0,39. O pH ótimo para a atividade de inulinase (I foi encontrado entre 4,0 - 4.5 e para a atividade de invertase (S em 2,5 e 5,0. A temperatura ótima foi de 60O.C para ambas as atividades e nenhuma perda foi observada quando mantida nesta temperatura por 30 min. Os valores de Km foram de 1,44 e 5

  8. The reticulin algorithm for adrenocortical tumor diagnosis: a multicentric validation study on 245 unpublished cases.

    Science.gov (United States)

    Duregon, Eleonora; Fassina, Ambrogio; Volante, Marco; Nesi, Gabriella; Santi, Raffaella; Gatti, Gaia; Cappellesso, Rocco; Dalino Ciaramella, Paolo; Ventura, Laura; Gambacorta, Marcello; Dei Tos, Angelo Paolo; Loli, Paola; Mannelli, Massimo; Mantero, Franco; Berruti, Alfredo; Terzolo, Massimo; Papotti, Mauro

    2013-09-01

    The pathologic diagnosis of adrenocortical carcinoma (ACC) still needs to be improved, because the renowned Weiss Score (WS) system has a poor reproducibility of some parameters and is difficult to apply in borderline cases and in ACC variants. The "reticulin algorithm" (RA) defines malignancy through an altered reticulin framework associated with 1 of the 3 following parameter: necrosis, high mitotic rate, and vascular invasion. This study aimed at validating the interobserver reproducibility of reticulin stain evaluation in an unpublished series of 245 adrenocortical tumors (61 adenomas and 184 carcinomas) from 5 Italian centers, classified according to the WS. Eight pathologists reviewed all reticulin-stained slides. After training, a second round of evaluation on discordant cases was performed 10 weeks later. The RA reclassified 67 cases (27%) as adenomas, including 44 with no reticulin alterations and 23 with an altered reticulin framework but lacking the subsequent parameters of the triad. The other 178 cases (73%) were carcinomas according to the above-mentioned criteria. A complete (8/8 pathologists) interobserver agreement was reached in 75% of cases (κ=0.702), irrespective of case derivation, pathologists' experience, and histologic variants, and was further improved when only those cases with high WS and clinically malignant behavior were considered. After the training, the overall agreement increased to 86%. We conclude that reticulin staining is a reliable technique and an easy-to-interpret system in adrenocortical tumors; moreover, it has a high interobserver reproducibility, which supports the notion of using such a method in the proposed 2-step RA approach for ACC diagnosis. PMID:23774167

  9. Preparation, ionic conductivity and thermochemistry of new Bi12.5Lu1.5ReO24.5 phase

    International Nuclear Information System (INIS)

    Highlights: • We synthesized new phase Bi12.5Lu1.5ReO24.5. • We measured ion conductivity of Bi12.5Lu1.5ReO24.5. • We measured formation enthalpy of Bi12.5Lu1.5ReO24.5. • The phase is thermodynamically stable with respect to decomposition into binary oxides. -- Abstract: The substitution of Re into Bi2O3 allows stabilization of the δ-Bi2O3 structure by additional substitution of lutetium ion to give phase of composition Bi12.5Lu1.5ReO24.5. The phase was synthesized for the first time. Structural analysis performed by neutron diffraction showed that space group was Fm3m with lattice parameter a = 5.5591(2) A. The phase has been found to show high ion conductivity at moderate temperature. The conductivity was measured in the temperature range of 600–800 K. The conductivity of Bi12.5Lu1.5ReO24.5 at 800 K is the same as the conductivity of BiCuVOx, Bi12.5Ln1.5ReO24.5 (Ln = Eu, La, Nd) phases. In this connection the Bi12.5Lu1.5ReO24.5 phase offers excellent potential for moderate temperature application. Solution calorimetry, using 2.0 M HCl (T = 298.15 K) as a solvent, was used to study the thermochemistry of Bi12.5Lu1.5ReO24.5. For the first time, the standard formation enthalpy of this phase has been determined as follows: ΔfH∘ (Bi12.5Lu1.5ReO24.5, s, 298.15 K) = −5819.4 ± 8.2 kJ/mol. The thermodynamic stability at room temperature has been assessed. The results show that investigated phase is thermodynamically stable with respect to binary oxides. Comparing the formation enthalpies from binary oxides for Bi12.5R1.5ReO24.5 (R = Y, La, Nd, Gd, Dy, Lu) phases shown that Bi12.5Lu1.5ReO24.5 is the most thermodynamically stable

  10. Composites of surface imprinting polymer capped Mn-doped ZnS quantum dots for room-temperature phosphorescence probing of 2,4,5-trichlorophenol

    International Nuclear Information System (INIS)

    In this paper, a simple procedure for the determination of 2,4,5-trichlorophenol (2,4,5-TCP) is reported. Mn-doped ZnS quantum dots (QDs) capped by molecularly imprinted polymers (MIPs) were prepared. MIPs were characterized by spectrofluorometer, UV–vis spectrophotometer, X-ray diffraction (XRD), Fourier transform infrared spectroscopy (FTIR), transmission electron microscope (TEM) and scanning electron microscope (SEM). Meanwhile, spectrofluorometer was used to the evaluation of optical stability, the effect of pH, and the selective and sensitive determination of 2,4,5-TCP. Under optical conditions, MIPs-capped Mn-doped ZnS QDs were successfully applied to the detection of 2,4,5-TCP in water selectively and sensitively, and a linear relationship was obtained to cover the concentration range of 5.0–50 μmol L−1 with a correlation coefficient of 0.9913. Moreover, 2,4,5-TCP could quench the room temperature phosphorescence of MIPs-capped Mn-doped ZnS QDs in a concentration-dependent manner, which was best described by a Stern–Volmer-type equation. - Highlights: • Molecularly imprinted polymers (MIPs)-capped Mn-doped ZnS quantum dots (QDs) were prepared. • The composite materials integrated the advantages of the high selectivity of the molecular imprinting and strong RTP property of the QDs. • The composite materials was successfully applied to selectively and sensitively detect 2,4,5-TCP in water

  11. Model of the expansion process for R245fa in an Organic Rankine Cycle (ORC)

    International Nuclear Information System (INIS)

    An Organic Rankine Cycle (ORC) is considered as one of the most environmental-friendly ways to convert different kinds of low temperature energies, i.e. solar, geothermal, biomass and thermal energy of exhaust gases into electrical energy. Two important facts about the ORC must be considered: An organic fluid is selected as the working fluid and a high expansion ratio is usually presented in the machinery due to thermodynamic and efficiency factors. In the past, the pre-design of turbomachinery has been based on the usage of ideal fluid laws, but the real gas effects have a significant influence in the ORC working condition, due to its proximity to the saturation vapor line. In this article, the Equations of State (EoS) (Ideal gas, Redlich-Kwong-Soave and Peng–Robinson) have been evaluated in a typical ORC expansion in order to observe the inaccuracies of the ideal gas model with different thermodynamic variables. Finally an isothermal process followed by an isochoric process is proposed to reproduce the thermodynamic process of the organic fluid expansion by means of simpler equations. In the last point of this paper, several examples of this expansion process have been calculated, in order to analyze the proposed methodologies. It has been concluded that in typical expansion process of ORC (2.5 MPa-0.1 MPa and 1.6MPa-0.1 MPa), the PR and RKS equations show deviations between 6% and 8% in specific energy. These deviations are very low compared with the ideal gas equation whose deviations are above 100%. - Highlights: ► Evaluate the ideal gas behaviour of R245fa in typical working conditions of an Organic Rankine Cycle (ORC). ► Compare the ideal behaviour with other simple equations of state for real gas. ► Decide which equation of state has the highest precision in typical working conditions of an ORC. ► Derive the most important thermodynamic variables in each equation of state and decide the most accurate equation. ► Evaluate the specic output energy

  12. Mixed Signal Generation System Based on C8051F206 and FT245R USB%基于C8051F206和FT245R USB的混合信号生成系统

    Institute of Scientific and Technical Information of China (English)

    虞文胜; 温倩

    2014-01-01

    In order to generate self-check signal and speed instruction of radar antenna system test signals, design a kind of mixed signal generation system based on C8051F206 and FT245R.The system uses FT245R USB chip to realize the communication of upper machine, and rely on C8051F206 high SPC and C language to response the instructions of upper machine in a reliable way and send real-time measured parts required for the self-check instruction ,speed instruction,etc.This paper introduces the principle of hardware design and software design of mixed signal systems. Practical application shows that the system can accurately generate radar antenna system self-check signal, speed signal and real-time feedback test results.%为了产生雷达天线系统测试时所需的自检信号、速度指令等信号,设计了一种基于基于 C8051F206和FT245R的混合信号生成系统。该系统利用FT245R USB接口芯片实现与上位机通信,并依靠C8051F206高程控性和C语言的高灵活性,可靠地响应上位机指令并实时发送被测件所需的自检信号、速度指令等信号源。介绍了混合信号生成系统硬件设计和软件设计的原理。实际应用表明,该系统能准确地生成被测件雷达天线系统所需的自检信号、速度指令信号,并实时地反馈测试结果。

  13. EVALUACIÓN EXPERIMENTAL DE CAPACIDAD MIMO DE ARREGLOS DE ANTENAS PIFA COMPACTOS EN BANDA DE 2.45 GHz EXPERIMENTAL EVALUATION OF MIMO CHANNEL CAPACITY FOR COMPACT ARRAYS OF PIFA ANTENNAS AT 2.45 GHz BAND

    OpenAIRE

    Héctor Carrasco E

    2007-01-01

    En este trabajo se presentan resultados experimentales de medición de canal y evaluación de capacidad MIMO (Multiple Input Multiple Output) de arrays de antenas PIFA (Planar Inverted "F" Antenna) compactos en la banda de frecuencia de 2.45 GHz, en entornos interiores ricos en multitrayecto. Se evalúan dos configuraciones básicas de arrays, Lineal y Cuadrada de cuatro antenas PIFA, cuyas características de bajo perfil y grados de libertad de construcción y configuración constituyen ventajas co...

  14. Timing analysis of the X-ray transient source XTE J1806--246 (2S1803--245)

    OpenAIRE

    Revnivtsev, M.; Borozdin, K.; A. Emelyanov

    1999-01-01

    An outburst of the X-ray transient source XTE J1806--246 (2S1803--245) has been observed by Rossi X-ray Timing Explorer in April-July 1998. Strong quasi-periodical oscillations (QPO) with a central peak frequency around 9 Hz was detected in one observation of the series performed by PCA/RXTE experiment. X-ray flux from the source during the observation with QPO was maximal. The energy spectrum of XTE J1806--246 at this time was softer than for other observations. A sufficient variability of t...

  15. A RF-MEMS Based Tunable Matching Network for 2.45-GHz Discrete-Resizing CMOS Power Amplifiers

    Directory of Open Access Journals (Sweden)

    F. Alimenti

    2014-04-01

    Full Text Available This paper deals with the design and experimental validation of a tunable matching network for discrete-resizing CMOS power amplifiers operating at 2.45 GHz (i.e. in the WiFi frequency band. The network is based on a two stages ladder configuration and exploits high-Q MEMS capacitors to achieve the impedance tuning. Furthermore, since these capacitors can be programmed through a 3-wires serial interface, a fully digital control of the transformed impedance is achieved.

  16. Genetic Variants Of Cytochrome b-245, Alpha Polypeptide Gene And Premature Acute Myocardial Infarction Risk In An Iranian Population

    Directory of Open Access Journals (Sweden)

    Amin Fatemeh

    2015-10-01

    Full Text Available Background: Oxidative stress induced by superoxide anion plays critical roles in the pathogenesis of coronary artery disease (CAD and hence acute myocardial infarction (AMI. The major source of superoxide production in vascular smooth muscle and endothelial cells is the NADPH oxidase complex. An essential component of this complex is p22phox, that is encoded by the cytochrome b-245, alpha polypeptide (CYBA gene. The aim of this study was to investigate the association of CYBA variants (rs1049255 and rs4673 and premature acute myocardial infarction risk in an Iranian population.

  17. Production of over-dense plasmas by launching 2.45 GHz electron cyclotron waves in a helical device

    International Nuclear Information System (INIS)

    For production of low temperature plasmas with low collisionality, 2.45 GHz microwave power up to 20 kW is injected perpendicularly to the toroidal field at very low toroidal field Bt t = 0.0613 T, the maximum electron density reaches three times the O-mode cutoff density and the measured power deposition is concentrated in the plasma core region beyond the Left-hand cutoff layer. It clearly suggests that this over-dense plasma is produced and heated by electron Bernstein waves converted from the launched X-mode in the peripheral region with steep density gradient. (authors)

  18. Curium-245 and curium-247 neutron cross sections between 10 keV and 10 MeV

    International Nuclear Information System (INIS)

    The optical model code 2PLUS and the statistical model codes COMNUC and CASCADE were used to compute neutron cross sections for Cm-245 and Cm-247 between 10 keV and 10 MeV. Cross sections for elastic and inelastic scattering, radiative capture, fission, and the (n,2n) reactions were computed. The parameters for the fission model were selected to yield agreement with the cross sections from the Physics-8 bomb shot. Pu-239 cross sections were calculated and compared with existing cross section evaluations to demonstrate the validity of the calculational methods

  19. Surfatron plasma source working at frequency 2.45 GHz for technological applications

    International Nuclear Information System (INIS)

    Plasma as an active medium is widely exploited in technological applications processes. To the most important plasma application belongs plasma-aided surface processing of solid-state samples. Due to unique reactivity and chemical interaction with materials, plasma is capable to treat the surface i.e. to be used for material deposition, surface cleaning or surface activation, sterilisation etc. We attempted to develop microwave plasma source, based on surfatron that is potentially applicable for technological purposes. Plasma is generated by commercial (Sairem) surfatron working at frequency 2.45 GHz. The surfatron is fed by microwave power in the range from several watts up to 300 watts. A quartz tube is inserted into surfatron cavity. The outlet of the tube is situated in a cylindrical vacuum vessel pumped out by rotary vacuum pump. The microwave power interacts with the working gas (we used Ar or He as carrier gases with reactive admixtures of O2 or N2) which flows through quartz tube, and ionizes the gas/mixture. The azimuthally symmetric surface wave then sustains created plasma also further downstream of the quartz tube end to the reactor vessel volume. Substrate table movable in three dimensions by stepping motors and controlled via computer is located inside the vessel. This equipment allows uniform surface treatment of the samples. The generator can be operated in cw as well as in computer-controlled impulse regime. The impulse regime of plasma source is one of the ways how to prevent treated materials (especially thermal sensitive materials, e.g. plastics) against thermal damage. Plasma exiting the tube was studied with Langmuir probes and optical spectroscopy. These diagnostics were done at different experimental conditions. Single probe method was used for determination of basic plasma parameters (plasma potential Vpl, mean electron energy Em, electron density ne, EEDF) at low pressures. Double probe method was used at higher vessel pressures when ion

  20. A 915 MHz/2.45 GHz ECR plasma source for large area ion beam and plasma processing

    International Nuclear Information System (INIS)

    The technology for producing uniform, high density (1011--1012/cm3) microwave discharges over cross sections of 50 cm2 is well established. The present challenge is to extend the high density, and electrodeless benefits of microwave discharges to produce uniform densities over an area of 300--700 cm2. Such discharges have important applications for 6 to 8-in. single wafer processing and as large surface, broad beam, high current density ion sources. The design principles for scaling the 18 cm diam MPDR ECR cavity applicator technology to 38--47 cm diam are reviewed. Microwave discharges with diameters of 20--30 cm can be created when these applicators are excited with either 2.45 GHz or 915 MHz. The design and construction of a prototype cavity applicator with a 20 cm diam discharge is described. The discharge is enclosed with a 12-pole multicusp static magnetic field produced by 2-in. by 2-in. by 1-in. rare-earth magnets. Each magnet has a pole face field strength of 3 kG. The experimental test of this plasma source in argon gas excited with 2.45 GHz energy is reviewed

  1. Spectral reflectance and discrimination of plutonic rocks in the 0.45- to 2.45-micron region

    Science.gov (United States)

    Blom, R. G.; Abrams, M. J.; Adams, H. G.

    1980-01-01

    Visible and near-infrared field spectral reflectance measurements of plutonic rocks were acquired in the 0.45- to 2.45-micron region with a portable field reflectance spectrometer. These spectra were used to determine spectral signatures for the various rock types and to evaluate the separability of these rocks based on their spectral characteristics. A total of 135 samples were divided into 11 groups based on their mineralogy. These 11 groups approximately correspond to traditional rock classifications and include five granitic groups, three gabbroic groups, and three ultramafic groups. The positions, intensity, and presence of iron, CO3(-2), and Al-OH and Mg-OH absorption bands varied among the 11 groups. Each rock group also had a range of albedos characteristic of the group. Stepwise linear discriminant analysis was performed on the spectral data to determine the separability of the 11 groups. Classification accuracy for 30 equally spaced wavelength bands between 0.45 and 2.45 microns was 78% with 10% serious misclassifications. The same analysis was repeated, limiting the spectral data to the wavelength regions corresponding to the proposed Landsat D thematic mapper scanner.

  2. Influence of tantalum additions on the microstructure and shape memory response of Ti50.5Ni24.5Pd25 high-temperature shape memory alloy

    International Nuclear Information System (INIS)

    A Ti50.5Ni24.5Pd25 (at%) high-temperature shape memory alloy (HTSMA) was alloyed with 1, 3, and 5 at% Ta additions in an effort to enhance the shape memory properties, particularly the dimensional stability for actuator applications. Thermomechanical characterization indicated that the dimensional stability of Ti50.5Ni24.5Pd25 improved significantly, but mostly for the highest Ta addition. This improvement was attributed in part to a particulate strengthening effect, since both Ti47.5Ni24.5Pd25Ta3 and Ti45.5Ni24.5Pd25Ta5 were found to have similar amounts of Ta, approximately 2.2 at%, in solid solution. However, by 5% Ta addition, the transformation temperatures decreased by about 65 °C and reductions in transformation strain and fracture resistance occurred. Consequently, among the alloys studied, Ti47.5Ni24.5Pd25Ta3 seemed to be the optimum composition with a transformation temperature around 150 °C, a transformation strain value close to that of the unalloyed composition, and improved dimensional stability

  3. The influence of p53 gene 245 site mutation to human lung adenocarcinoma cell line H1299%p53基因245位点突变对非小细胞肺癌细胞H1299的影响

    Institute of Scientific and Technical Information of China (English)

    王蕊; 宫兆华; 姜立新; 孙等军; 矫爱红; 陈剑; 张良明

    2011-01-01

    Background and purpose: The mutation of thc p53 gene could bca common molccular biological event during the process of lung adenocarcinoma because 245 site was a hot site for p53 gene mutation.A study of 245 site's mutation of p53 may provide the basic theories for the diagnosis and treatment for lung adenocarcinoma.This study aimed to investigate the influence of p53 245 site's mutation on p53-deficient human lung cancer H1299 cell line in vitro.Methods: H1299 cells were transiently transfected with wide type p53 and G245V p53 plasmid.Flow cytometry was performed for cell apoptosis analysis.H1299 cells were also stably transfected with wide type p53 and G245V p53 plasmid.The G418-selected cells were assayed for colony-forming efficiency, and the transfected cells were examined using MTT for the purpose of drawing the growth curve and evaluazing cell growth.Results: In the experimental study of cell apoptosis, we could see that the apoptosis rate of H1299 cells transfected with G245V-p53 gene appeared significantly less than in cells transfected with wide type p53 gene (P<0.001), similar happened to those transfected with pcmv plasmid.The colony-forming efficiency showed that there were more cells transfected with G245V-p53 gene than those transfected with wide type p53 gene(P<0.05).Thc growth curve indicates that cells transfectcd with G245V-p53 gene grew faster than those transfected with wide type p53 gene.Conclusion: Wild type p53 gene loses all function when mutation happens to the site 245.%背景与目的:p53基因突变是肺腺癌发生中的常见的分子生物学事件,第245位点突变为其突变热点之一,因此研究p53基因第245位点突变可能为肺腺痛的诊断、治疗提供一定的理论基础.本研究旨在研究肺癌常见的245位点突变对p53缺失的人肺腺癌细胞系H1299的影响.方法:应用流式细胞术观察脂质体瞬时转染p53基因第245突变体(G245V)对细胞凋亡的影响,同时用稳定转染观察

  4. Photosynthetic 14C fixation in leaves and isolated chloroplasts of some scrub species under the influence of paraquat and 2,4,5-T

    International Nuclear Information System (INIS)

    The diurnal course of carbon dioxide uptake in the leaves of six nonsucculent semiarid scrub species was investigated. Five nonsucculent scrub species, Carissa spinarum, Maba buxifolia, Flacourtia sepiaria, Gymnosporia emerginata and Dodonaea viscosa exhibited nocturnal carbon assimilation while day time CO2 uptake was predominant in Chomelia asiatica. Foliar application of paraquat (100 mg 1sup(-1)) or 2,4,5-T (2000 mg 1sup(-1)) caused a marked inhibition in the dark uptake of CO2. On the other hand, carbon uptake during day was slightly reduced. Studies on the carbon assimilation of isolated chloroplasts under the influence of paraquat or 2,4,5-T revealed that paraquat is more effective than 2,4,5-T in the suppression of carbon assimilation of in vivo and in vitro chloroplasts. The data suggested that the process of nocturnal carbon assimilation is far more sensitive to paraquat than the light dependent carbon fixation during day. (author)

  5. Residues in blackcurrants, fodder peas, spinach and potatoes treated with sublethal doses of 2,4,5-T to simulate wind drift damage

    DEFF Research Database (Denmark)

    Løkke, Hans; Odgaard, Peder

    1981-01-01

    .1 kg ha-1 on potato plants, the disappearance of 2,4,5-T was rapid during the first month, but residues were translocated into the tubers and reached a constant level of 0.02 mg kg-1 after 1 month until harvest at 108 days after treatment. In all crops, visible effects were observed after treatment...... concentrations declined in the same period due to growth dilution. In spinach leaves from old plants, treated with 0.1 kg ha-1, 0.05 mg of 2,4,5-T kg-1 was found 14 days after treatment. Fodder peas showed no residues (<0.002 mg kg-1) at harvest 62 days after treatment with 2,4,5-T esters. After application of 0...

  6. Effects of Wi-Fi (2.45 GHz) Exposure on Apoptosis, Sperm Parameters and Testicular Histomorphometry in Rats: A Time Course Study

    OpenAIRE

    2015-01-01

    Objective: In today’s world, 2.45-GHz radio-frequency radiation (RFR) from industrial, scientific, medical, military and domestic applications is the main part of indoor-outdoor electromagnetic field exposure. Long-term effects of 2.45-GHz Wi-Fi radiation on male reproductive system was not known completely. Therefore, this study aimed to investigate the major cause of male infertility during short- and long-term exposure of Wi-Fi radiation. Materials and Methods: This is an an...

  7. Hazards assessment document for receiving basin for offsite fuel (244-H) and resin regeneration facility (245-H) (RBOF/RRF)

    International Nuclear Information System (INIS)

    The Hazard Assessment Document (HAD) for the Receiving Basin for Offsite Fuels (RBOF), Building 244-H, and the Resin Regeneration Facility (RRF), Building 245-H, was prepared in accordance with Department of Energy (DOE) Order 5480.23, DOE-STD-1 027-92, and WSRC-MS-92-206. The HAD provides hazards categorizations based on the radiological and chemical hazards associated with the facility. The hazard category is used to provide the input data for a graded approach to the development of the facility Safety Analysis Report (SAR) in accordance with DOE Order 5480.23. The RBOF/RRF was assumed to be a one segment facility. The accident consequences are calculated without consideration for any mitigative systems or administrative controls This facility is categorized as Hazard Category 2 as a result of the analysis of the radiological inventory conducted in accordance with Reference 2 and the chemical inventory in accordance with Reference 3

  8. Design of a 2.45 GHz ECR Ion Source for Production of Medium Charge States Ions

    International Nuclear Information System (INIS)

    At Lawrence Berkeley National Laboratory we are constructing an ECR ion source test facility for nuclear science experiments. For this purpose a single-stage 2.45 GHz electron cyclotron resonance ion source has been designed and fabricated. It features an axial magnetic field with a mirror ratio of up to 5.5 and a hexapole field produced by a novel Nd-Fe-B permanent magnet assembly. In order to enhance the ion confinement time the source plasma volume has been enlarged as much as possible while still maintaining a high mirror ratio. This paper describes the design of the source. Ion optics simulation of the extraction system currently under design will also be presented

  9. 桌面的3D诱惑——Acer Aspire GD245HQ显示器

    Institute of Scientific and Technical Information of China (English)

    2010-01-01

    3D当前被炒得如火如萘,3D电影、3D电视机、3D投影机、3D相机、3D蓝光机,当然还有3D显示器,可以说3D已经在我们的周围无处不在,现在你可以轻轻松松地随时随地体验3D世界。坐在显示器前,戴上眼镜,让Acer GD245HQ 3D显示器为你带来身临其境的真切画面吧。

  10. Possibility of 2,4,5-triamino-6-hydroxypyrimidine as an intermediate in the pathway of riboflavin biosynthesis.

    Science.gov (United States)

    Nakajima, K; Yamada, Y; Mitsuda, H

    1985-01-01

    It was studied with resting cells of a high flavinogenic mold, Eremothecium ashbyii, whether or not 2,4,5-triamino-6-hydroxypyrimidine (THP) is an intermediate in the early pathway of riboflavin biosynthesis. A small amounts of THP strongly inhibited riboflavin formation in the resting cells, but the inhibition was effectively reversed by the added purines, except for adenine. Radioactive tracer experiments showed that the incorporation of the radioactivity from [2-14C]THP into riboflavin was negligible. The results obtained strongly suggest that THP is not an intermediate but a rigid inhibitor for riboflavin formation, and thus there is non salvage pathway of THP for the pathway of riboflavin biosynthesis in resting cells of E. ashbyii. PMID:4041122

  11. Novel synthesis, structural analysis, photophysical properties and theoretical study of 2,4,5-tris(2-pyridyl)imidazole

    Science.gov (United States)

    Báez-Castro, Alberto; Baldenebro-López, Jesús; Glossman-Mitnik, Daniel; Höpfl, Herbert; Cruz-Enríquez, Adriana; Miranda-Soto, Valentín; Parra-Hake, Miguel; Campos-Gaxiola, José J.

    2015-11-01

    2,4,5-Tris(2-pyridyl)imidazole has been successfully synthetized by a novel synthetic route and fully characterized by FT-IR,UV-Vis and fluorescence spectroscopy, one- and two-dimensional NMR spectroscopy (1H, 13C{1H} ATP, 1H-1H COSY, NOESY 1H-13C HSQC and HMBC) high-resolution, mass spectrometry (HR-FAB+), and single-crystal X-ray diffraction analysis. Additionally, the molecular geometry, vibrational frequencies and infrared intensities were calculated by density functional theory using the M06/6-31G(d) level of theory, showing good agreement with the experimental results. The title compound showed interesting photophysical properties, which were studied experimentally in solution and in the solid state by UV-Vis and fluorescence spectroscopy, and theoretically using TD-DFT calculations. Natural and Mulliken atomic charges and the molecular electrostatic potential (MEP) have been mapped.

  12. Mössbauer spectroscopic study of 57Fe metabolic transformations in the rhizobacterium Azospirillum brasilense Sp245

    Science.gov (United States)

    Kamnev, Alexander A.; Tugarova, Anna V.; Kovács, Krisztina; Biró, Borbála; Homonnay, Zoltán; Kuzmann, Ernő

    2014-04-01

    Preliminary 57Fe transmission Mössbauer spectroscopic data were obtained for the first time for live cells of the plant-growth-promoting rhizobacterium Azospirillum brasilense (wild-type strain Sp245) grown aerobically with 57FeIII-nitrilotriacetate (NTA) complex as a sole source of iron. The results obtained have shown that live cells actively reduce part of the assimilated iron(III) to iron(II), the latter amounting up to 33 % of total cellular iron after 18 h of growth, and 48 % after additional 3 days of storage of the dense wet cell suspension in nutrient-free saline solution in air at room temperature (measured at 80 K). The cellular iron(II) was found to be represented by two quadrupole doublets of different high-spin forms, while the parameters of the cellular iron(III) were close to those typical for bacterioferritins.

  13. Experimental investigation of R-245fa flow boiling in minichannels at high saturation temperatures: Flow patterns and flow pattern maps

    International Nuclear Information System (INIS)

    Highlights: • Image processing method and analysis of the heat transfer coefficient for two-phase flow pattern characterization. • Four flow patterns (intermittent flow, annular flow, dryout flow and mist flow) and their transitions were recognized. • The influence of the high saturation temperature (up to 120 °C) on flow pattern with R-245fa was investigated. • Comparisons with available transition lines in the literature were made. - Abstract: In this work, flow visualizations and measurements are carried out to identify flow regime transitions during the flow boiling of R-245fa in a 3.00 mm inner diameter minichannel at high saturation temperatures, i.e. saturation temperature ranging from 60 °C to 120 °C. Flow boiling experiments at such high temperatures have so to say almost not been reported in the open literature so far. The mass velocity is ranging from 100 to 1500 kg/m2 s, the heat flux is varying from 10 to 50 kW/m2 and the inlet vapor quality from 0 to 1. Based on an image processing method and with the help of an adequate analysis of the heat transfer coefficient, four main flow regimes can be identified: intermittent flow, annular flow, dryout and mist flow. Their transitions were detected and plotted on flow pattern maps. The influence of the heat flux and the saturation temperature are highlighted and discussed. Comparisons with available transition lines in the literature have been made. Whereas the flow regime would suggest a macroscale type of flow, the flow patterns transitions are closer to those observed in microscale

  14. Review of fission product yields and delayed neutron data for the actinides NP-237, PU-242, AM-242M, AM-243, CM-243 and CM-245

    International Nuclear Information System (INIS)

    A review of fission product yields and delayed neutron data for Np-237, Pu-242, Am-242m, Am-243, Cm-243 and Cm-245 has been undertaken. Gaps in understanding and inconsistencies in existing data were identified and priority areas for further experimental, theoretical and evaluation investigation detailed

  15. Critical and subcritical masses of curium-245, -246 and -247 calculated with a combination of MCNP4A code and JENDL-3.2 library

    International Nuclear Information System (INIS)

    Critical masses of three curium isotopes, 245Cm, 246Cm and 247Cm, were calculated with a combination of the current version of the Japanese Evaluated Nuclear Data Library, JENDL-3.2, and a continuous energy Monte Carlo neutron transport code, MCNP4A. The subcritical masses corresponding to the neutron multiplication factor keff=0.9 and 0.8 were also computed in the same way. The subcritical masses that correspond to keff=0.9 for 246Cm metal and 246CmO2 with a 30-cm-thick stainless steel reflector were computed as 25.2 kg and 41.8 kg, respectively. The minimum critical mass for 245Cm was obtained as 65.6 g in a sphere of a homogeneous mixture of granulated 245Cm metal and water surrounded by a fully thick water reflector. The corresponding quantity for 247Cm was found to be 2.19 kg. The critical masses of 245Cm, 246Cm and 247Cm metals were computed also for reference by replacing the JENDL-3.2 with the ENDF/B-VI; they were reduced by 23%, 45% and 2%, respectively, from each corresponding value, which revealed a large dependence of the results on the evaluated nuclear data libraries. The present report was prepared for revision of the ANSI/ANS-8.15, the American National Standard for Nuclear Criticality Control of Special Actinide Elements. (author)

  16. Morphological Investigation of the Differences on the Ear-to-Ear Path Gain and the Packet Loss at 2.45 Ghz

    DEFF Research Database (Denmark)

    Pehrson, Signe; Kvist, Søren Helstrup; Jakobsen, Kaj Bjarne; Thaysen, Jesper

    The effect of the anatomical variation of the head on the ear-to-ear communication at 2:45 GHz has been investigated. Several anatomical characteristics of the head, such as the dimensions and the position of the ears, have been recorded for a group of 25 test persons. Active Packet Error Rate (P...

  17. 8 CFR 245.18 - How can physicians (with approved Forms I-140) that are serving in medically underserved areas or...

    Science.gov (United States)

    2010-01-01

    ... physicians submitting adjustment applications upon approval of an immigrant petition are required to follow... he or she has completed the service required under 8 CFR 204.12(a), USCIS shall serve the alien... ADJUSTMENT OF STATUS TO THAT OF PERSON ADMITTED FOR PERMANENT RESIDENCE § 245.18 How can physicians...

  18. 8 CFR 245.8 - Adjustment of status as a special immigrant under section 101(a)(27)(K) of the Act.

    Science.gov (United States)

    2010-01-01

    ... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Adjustment of status as a special immigrant... RESIDENCE § 245.8 Adjustment of status as a special immigrant under section 101(a)(27)(K) of the Act. (a) Application. Each person applying for adjustment of status as a special immigrant under section...

  19. Amberlyst A-15: Reusable catalyst for the synthesis of 2,4,5-trisubstituted and 1,2,4,5-tetrasubstituted-1-imidazoles under MW irradiation

    Indian Academy of Sciences (India)

    Shivaji S Pandit; Swapnil K Bhalerao; Uddhav S Aher; Gorakshanath L Adhav; Vikram U Pandit

    2011-07-01

    One-pot multi-component condensation of benzyl, aldehydes, ammonium acetate and primary amines were used for synthesis of 2,4,5-trisubstituted and 1,2,4,5-tetrasubstituted-1-imidazole derivatives underMWradiation using amberlyst A-15 as a catalysts. This catalyst has several advantages (simple work-up, low cost and reusability).

  20. Ceric ammonium nitrate catalysed three component one-pot efficient synthesis of 2,4,5-triaryl-1H-imidazoles

    Indian Academy of Sciences (India)

    Jaiprakash N Sangshetti; Nagnnath D Kokare; Sandeep A Kotharkara; Devanand B Shinde

    2008-09-01

    Ceric ammonium nitrate (CAN) is used as an efficient catalyst for the synthesis of 2,4,5-triaryl-1H-imidazoles via condensation of benzoin/benzil, ammonium acetate, and aromatic aldehydes. The easy work-up, higher yields and shorter reaction time are the advantages of the method presented here.

  1. Time-Domain Measurement of the Ear-to-Ear On-Body Path Gain at 2.45 GHz in a Radio Anechoic Environment

    DEFF Research Database (Denmark)

    Kvist, Søren Helstrup; Thaysen, Jesper; Jakobsen, Kaj Bjarne

    2012-01-01

    The ear-to-ear on-body path gain (jS21j) at 2:45 GHz is measured in the time domain. The measurements were conducted in a radio anechoic environment to study the effects of the on-body paths only. Two different monopole antenna configurations that are polarized normal and tangential to the surface...

  2. 8 CFR 245.9 - Adjustment of status of certain nationals of the People's Republic of China under Public Law 102...

    Science.gov (United States)

    2010-01-01

    ... district directors in 8 CFR part 245 to accept and adjudicate an application for adjustment of status under..., 1990, and October 9, 1992; (5) Is admissible to the United States as an immigrant, unless the basis for... period begins on July 1, 1993. To benefit from the provisions of Public Law 102-404 (the Chinese...

  3. 2,4,5-TRICHLOROPHENOXYACETIC ACID INFLUENCE ON 2,6-DINITROTOLUENE-INDUCED URINE GENOTOXICITY IN FISCHER 344 RATS: EFFECT ON G.I. MICROFLORA AND ENZYME ACTIVITY

    Science.gov (United States)

    2,4,5-Trichlorophenoxyacetic acid and 2,6-dinitrotoluene are hazardous chemicals that have potential harmful effects 2,6-DNT is recognized as a hepatoxicant while 2,4,5-T, a component in Agent Orange, is also suspect. ,6-DNT requires both oxidative and reductive metabolism to eli...

  4. Effect of exposure to 2.45 GHz microwave on DNA repair genes transcription in cultured cells

    International Nuclear Information System (INIS)

    The aim of the study was to investigate, in vitro, the effect of 2.45 GHz continuous (C.W.) and pulsed (P.W.) electromagnetic field exposure combined with a known mutagen on the induction of enzymes implicated in the DNA repair pathway. Microwaves do not create bonds breaks within molecules and there is no clear hypothesis for a possible mechanism supporting a biological action. Nevertheless, an indirect influence of microwaves during an intermediary step of the complex sequence of events involved in mutagenesis cannot yet be excluded. Highly sensitive real-time R.T.q.P.C.R. was used to monitor transcriptional variations of DNA repair genes. The experiments were carried out using the monocyte human cell line T.H.P.1 with the genotoxic compound 4- nitro-quinoline-N-oxide (4-N.Q.O.). The carrier frequency was 2.45 GHz C.W. and P.W. (1 khz repetition time, 10 % duty cycle) with the same power density corresponding to an average specific absorption rate (S.A.R.) value of 0.19 W/kg in the biological samples. Non exposed (sham) and exposed (P.W. and C.W.) cell culture plates were incubated simultaneously in three identical incubators in the presence of 4-N.Q.O., under shaking, at 37 Celsius degrees. Specially designed incubators were integrated in three identical anechoic chambers equipped with waveguide antennas. Care was taken to increase the reproducibility of the experiments and to avoid false positive or misinterpretation of the results. The presence or the absence of the electromagnetic field was the only difference between the sham and exposed assays. The different exposure conditions were applied alternatively in the three anechoic chambers in order to avoid cage effects. The temperature inside the cell plates was measured with an optic fiber probe (Luxtron). Numerical dosimetry was calculated using the Finite Difference Time Domain method. A time-scaled form of the heat transfer equation allowed to calculate the temperature distribution inside the petri dishes

  5. Effects of acute exposure to WIFI signals (2.45GHz) on heart variability and blood pressure in Albinos rabbit.

    Science.gov (United States)

    Saili, Linda; Hanini, Amel; Smirani, Chiraz; Azzouz, Ines; Azzouz, Amina; Sakly, Mohsen; Abdelmelek, Hafedh; Bouslama, Zihad

    2015-09-01

    Electrocardiogram and arterial pressure measurements were studied under acute exposures to WIFI (2.45GHz) during one hour in adult male rabbits. Antennas of WIFI were placed at 25cm at the right side near the heart. Acute exposure of rabbits to WIFI increased heart frequency (+22%) and arterial blood pressure (+14%). Moreover, analysis of ECG revealed that WIFI induced a combined increase of PR and QT intervals. By contrast, the same exposure failed to alter maximum amplitude and P waves. After intravenously injection of dopamine (0.50ml/kg) and epinephrine (0.50ml/kg) under acute exposure to RF we found that, WIFI alter catecholamines (dopamine, epinephrine) action on heart variability and blood pressure compared to control. These results suggest for the first time, as far as we know, that exposure to WIFI affect heart rhythm, blood pressure, and catecholamines efficacy on cardiovascular system; indicating that radiofrequency can act directly and/or indirectly on cardiovascular system. PMID:26356390

  6. Effects of olive leave extract on metabolic disorders and oxidative stress induced by 2.45 GHz WIFI signals.

    Science.gov (United States)

    Salah, Myriam Ben; Abdelmelek, Hafedh; Abderraba, Manef

    2013-11-01

    We investigated the effect of olive leaves extract administration on glucose metabolism and oxidative response in liver and kidneys of rats exposed to radio frequency (RF). The exposure of rats to RF (2.45 GHz, 1h/day during 21 consecutive days) induced a diabetes-like status. Moreover, RF decreased the activities of glutathione peroxidase (GPx, -33.33% and -49.40%) catalase (CAT, -43.39% and -39.62%) and the superoxide dismutase (SOD, -59.29% and -68.53%) and groups thiol amount (-62.68% and -34.85%), respectively in liver and kidneys. Indeed, exposure to RF increased the malondialdehyde (MDA, 29.69% and 51.35%) concentration respectively in liver and kidneys. Olive leaves extract administration (100 mg/kg, ip) in RF-exposed rats prevented glucose metabolism disruption and restored the activities of GPx, CAT and SOD and thiol group amount in liver and kidneys. Moreover, olive leave extract administration was able to bring down the elevated levels of MDA in liver but not in kidneys. Our investigations suggested that RF exposure induced a diabetes-like status through alteration of oxidative response. Olive leaves extract was able to correct glucose metabolism disorder by minimizing oxidative stress induced by RF in rat tissues. PMID:23994945

  7. Recoil-range studies of heavy products of multinucleon transfer from 18O to 245Cm and 249Cf

    International Nuclear Information System (INIS)

    Recoil range distributions were measured for alpha and spontaneous fission activities made in the bombardment of 245Cm and 249Cf with 18O from 6.20 MeV/nucleon down to the interaction barrier. The shape of the distributions indicates tht transfers of up to four protons take place via a combination of quasi-elastic (QET) and deep inelastic (DIT) mechanisms, rather than complete fusion-de-excitation (CF) or massive transfer (MT). Angular distributions constructed from recoil range distributions, assuming QET/DIT, indicate that the QET component contributes more significantly to the heavy product residue cross section than the DIT, even though primary cross sections are expected to be higher for DIT than for QET. This may be explained qualitatively as a result of the high excitation energies associated with DIT; the very negative Q/sub gg/ of projectile stripping for these systems combined with the lower expected optimal Q/sub rxn/ of QET compared to DIT can give QET products comparatively low excitation

  8. Dust Extinction in High-z Galaxies with GRB Afterglow Spectroscopy - The 2175{\\AA} Feature at z=2.45

    CERN Document Server

    Elíasdóttir, Á; Hjorth, J; Ledoux, C; Watson, D; Andersen, A C; Malesani, D; Vreeswijk, P M; Prochaska, J X; Sollerman, J; Jaunsen, A O

    2008-01-01

    We report the clear detection of the 2175A dust absorption feature in the optical afterglow spectrum of the gamma-ray burst (GRB) GRB070802 at a redshift of z=2.45. This is the highest redshift for a detected 2175A dust bump to date, and it is the first clear detection of the 2175A bump in a GRB host galaxy, while several tens of optical afterglow spectra without the bump have been recorded in the past decade. The derived extinction curve gives A_V=0.8-1.5 depending on the assumed intrinsic slope. Of the three local extinction laws, an LMC type extinction gives the best fit to the extinction curve of the host of GRB070802. Besides the 2175A bump we find that the spectrum of GRB070802 is characterized by unusually strong low-ionization metal lines and possibly a high metallicity for a GRB sightline ([Si/H]=-0.46+/-0.38, [Zn/H]=-0.50+/-0.68). In particular, the spectrum of GRB070802 is unique for a GRB spectrum in that it shows clear CI absorption features, leading us to propose a correlation between the presen...

  9. Measurement of enhanced heat transfer coefficient with perforated twisted tape inserts during condensation of R-245fa

    Science.gov (United States)

    Khatua, A. K.; Kumar, P.; Singh, H. N.; Kumar, R.

    2016-04-01

    The experimental conductive heat transfer results for flow through inserted perforated twisted tapes in a horizontal tube during condensation of pure R-245fa vapor. The test section consisting of two separate coaxial double pipes assembled in series, acted like a counter flow heat exchanger, where the refrigerant condensed inside the inner tube by rejecting heat to the cooling water flowing inside the outer tube in reversed direction. Data for three perforated twisted tapes having constant twist ratio of 7.1 mm and pitch of perforation as 12.5, 25.0 and 37.5 mm, inserted one by one in full length of test condenser by varying refrigerant mass flux from 100 to 200 kg/m2 s in steps of 50 kg/m2 s for the range of vapor quality from 0.1 to 0.9, were collected together with flow and without insert (plain tube). It has been found that the perforated twisted tape insert having pitch of perforation equal to in order of 12.5 mm gives the highest value of average heat transfer coefficient and is of the order of 37.5 % more than that of the plain one and the correlation predicts the experimental data within an error band of ±15 %.

  10. Experimental results of superimposing 9.9 GHz extraordinary mode microwaves on 2.45 GHz ECRIS plasma

    International Nuclear Information System (INIS)

    Efficient production of multicharged ions has been investigated on the tandem-type ECRIS in Osaka University. According to the consideration of the accessibility conditions of microwaves to resonance and cutoff regions, it was suggested that the upper hybrid resonance (UHR) heating contributed to enhancement of ion beam intensity. In order to enhance multicharged ion beams efficiently, injecting higher frequency microwave with extraordinary (X-mode) toward UHR region has been tried. In this study, 2.45 GHz frequency microwaves are used for conventional ECR discharge, and 9.9 GHz frequency microwaves with X-mode are superimposed for UHR heating. The effects of additive microwave injection are investigated experimentally in terms of plasma parameters and electron energy distribution function (EEDF) measured by Langmuir probe and ion beam current. As the results show, it is confirmed that the electrons in the high energy region are affected by 9.9 GHz X-mode microwave injection from the detailed analysis of EEDF

  11. Experimental results of superimposing 9.9 GHz extraordinary mode microwaves on 2.45 GHz ECRIS plasma

    Energy Technology Data Exchange (ETDEWEB)

    Nishiokada, Takuya, E-mail: nishiokada@nf.eie.eng.osaka-u.ac.jp; Nagaya, Tomoki; Hagino, Shogo; Otsuka, Takuro; Sato, Fuminobu; Kato, Yushi [Division of Electrical, Electronic, and Information Engineering, Graduate School of Engineering, Osaka University, 2-1 Yamada-oka, Suita-shi, Osaka 565-0871 (Japan); Muramatsu, Masayuki; Kitagawa, Atsushi [National Institute of Radiological Sciences (NIRS), 4-9-1 Anagawa, Inage-ku, Chiba-shi, Chiba 263-855 (Japan)

    2016-02-15

    Efficient production of multicharged ions has been investigated on the tandem-type ECRIS in Osaka University. According to the consideration of the accessibility conditions of microwaves to resonance and cutoff regions, it was suggested that the upper hybrid resonance (UHR) heating contributed to enhancement of ion beam intensity. In order to enhance multicharged ion beams efficiently, injecting higher frequency microwave with extraordinary (X-mode) toward UHR region has been tried. In this study, 2.45 GHz frequency microwaves are used for conventional ECR discharge, and 9.9 GHz frequency microwaves with X-mode are superimposed for UHR heating. The effects of additive microwave injection are investigated experimentally in terms of plasma parameters and electron energy distribution function (EEDF) measured by Langmuir probe and ion beam current. As the results show, it is confirmed that the electrons in the high energy region are affected by 9.9 GHz X-mode microwave injection from the detailed analysis of EEDF.

  12. Abatement of fluorinated compounds using a 2.45GHz microwave plasma torch with a reverse vortex plasma reactor.

    Science.gov (United States)

    Kim, J H; Cho, C H; Shin, D H; Hong, Y C; Shin, Y W

    2015-08-30

    Abatement of fluorinated compounds (FCs) used in semiconductor and display industries has received an attention due to the increasingly stricter regulation on their emission. We have developed a 2.45GHz microwave plasma torch with reverse vortex reactor (RVR). In order to design a reverse vortex plasma reactor, we calculated a volume fraction and temperature distribution of discharge gas and waste gas in RVR by ANSYS CFX of computational fluid dynamics (CFD) simulation code. Abatement experiments have been performed with respect to SF6, NF3 by varying plasma power and N2 flow rates, and FCs concentration. Detailed experiments were conducted on the abatement of NF3 and SF6 in terms of destruction and removal efficiency (DRE) using Fourier transform infrared (FTIR). The DRE of 99.9% for NF3 was achieved without an additive gas at the N2 flow rate of 150 liter per minute (L/min) by applying a microwave power of 6kW with RVR. Also, a DRE of SF6 was 99.99% at the N2 flow rate of 60 L/min using an applied microwave power of 6kW. The performance of reverse vortex reactor increased about 43% of NF3 and 29% of SF6 abatements results definition by decomposition energy per liter more than conventional vortex reactor. PMID:25841085

  13. Study of higher excited states in 20Ne by inelastic scattering of 24.5MeV protons

    International Nuclear Information System (INIS)

    The angular distributions of the differential cross-sections for the inelastic scattering of 24.5MeV protons were measured for excited states up to 9.50MeV in 20Ne. Prior to the experiment, an excitation function was measured for incident proton energies between 23 and 26MeV to select a resonance-free region. Twenty cross-sections have been measured, generally with high precision and low statistical errors. Large variations have been found in the shapes of angular distributions for states having the same spins and parities. Some of the excited states were analyzed in the framework of the collective model using either vibrational or rotational model wave functions. Very good agreement with the cross sections of the K=0+ ground state band have been obtained using β2, β4 and β6 multipole deformations of +0.47, +0.28 and -010, respectively. There is definite evidence for a new state in 20Ne at 9.31MeV which we tentatively assign a J(π)=4+ state

  14. Synthesis of the isotopes of elements 118 and 116 in the 249Cf and 245Cm+48Ca fusion reactions

    Energy Technology Data Exchange (ETDEWEB)

    Oganessian, Y T; Utyonkov, V K; Lobanov, Y V; Abdullin, F S; Polyakov, A N; Sagaidak, R N; Shirokovsky, I V; Tsyganov, Y S; Voinov, A A; Gulbekian, G G; Bogomolov, S L; Gikal, B N; Mezentsev, A N; Iliev, S; Subbotin, V G; Sukhov, A M; Subotic, K; Zagrebaev, V I; Vostokin, G K; Itkis, M G; Moody, K J; . Patin, J B; Shaughnessy, D A; Stoyer, M A; Stoyer, N J; Wilk, P A; Kenneally, J M; Landrum, J H; Wild, J F; Lougheed, R W

    2006-01-31

    The decay properties of {sup 290}116 and {sup 291}116, and the dependence of their production cross sections on the excitation energies of the compound nucleus, {sup 293}116, have been measured in the {sup 245}Cm({sup 48}Ca,xn){sup 293-x}116 reaction. These isotopes of element 116 are the decay daughters of element 118 isotopes, which are produced via the {sup 249}Cf+{sup 48}Ca reaction. They performed the element 118 experiment at two projectile energies, corresponding to {sup 297}118 compound nucleus excitation energies of E* = 29.2 {+-} 2.5 and 34.4 {+-} 2.3 MeV. During an irradiation with a total beam dose of 4.1 x 10{sup 19} {sup 48}Ca projectiles, three similar decay chains consisting of two or three consecutive {alpha} decays and terminated by a spontaneous fission (SF) with high total kinetic energy of about 230 MeV were observed. The three decay chains originated from the even-even isotope {sup 294}118 (E{sub {alpha}} = 11.65 {+-} 0.06 MeV, T{sub {alpha}} = 0.89{sub -0.31}{sup +1.07} ms) produced in the 3n-evaporation channel of the {sup 249}Cf+{sup 48}Ca reaction with a maximum cross section of 0.5{sub -0.3}{sup +1.6} pb.

  15. Effects of Wi-Fi (2.45 GH z Exposure on Apoptosis, Sperm Parameters and Testicular Histomorphometry in Rats: A Time Course Study

    Directory of Open Access Journals (Sweden)

    Saeed Shokri

    2015-07-01

    Full Text Available Objective: In today’s world, 2.45-GHz radio-frequency radiation (RFR from industrial, scientific, medical, military and domestic applications is the main part of indoor-outdoor electromagnetic field exposure. Long-term effects of 2.45-GHz Wi-Fi radiation on male reproductive system was not known completely. Therefore, this study aimed to investigate the major cause of male infertility during short- and long-term exposure of Wi-Fi radiation. Materials and Methods: This is an animal experimental study, which was conducted in the Department of Anatomical Sciences, Faculty of Medicine, Zanjan University of Medical Sciences, Zanjan, IRAN, from June to August 2014. Three-month-old male Wistar rats (n=27 were exposed to the 2.45 GHz radiation in a chamber with two Wi-Fi antennas on opposite walls. Animals were divided into the three following groups: I. control group (n=9 including healthy animals without any exposure to the antenna, II. 1-hour group (n=9 exposed to the 2.45 GHz Wi-Fi radiation for 1 hour per day during two months and III.7-hour group (n=9 exposed to the 2.45 GHz Wi-Fi radiation for 7 hours per day during 2 months. Sperm parameters, caspase-3 concentrations, histomorphometric changes of testis in addition to the apoptotic indexes were evaluated in the exposed and control animals. Results: Both 1-hour and 7-hour groups showed a decrease in sperm parameters in a time dependent pattern. In parallel, the number of apoptosis-positive cells and caspase-3 activity increased in the seminiferous tubules of exposed rats. The seminal vesicle weight reduced significantly in both1-hour or 7-hour groups in comparison to the control group. Conclusion: Regarding to the progressive privilege of 2.45 GHz wireless networks in our environment, we concluded that there should be a major concern regarding the timedependent exposure of whole-body to the higher frequencies of Wi-Fi networks existing in the vicinity of our living places.

  16. Improvement in the Shape Memory Response of Ti50.5Ni24.5Pd25 High-Temperature Shape Memory Alloy with Scandium Microalloying

    Science.gov (United States)

    Atli, K. C.; Karaman, I; Noebe, R. D.; Garg, A.; Chumlyakov, Y. I.; Kireeva, I. V.

    2010-01-01

    A Ti(50.5)Ni(24.5)Pd25 high-temperature shape memory alloy (HTSMA) is microalloyed with 0.5 at. pct scandium (Sc) to enhance its shape-memory characteristics, in particular, dimensional stability under repeated thermomechanical cycles. For both Ti(50.5)Ni(24.5)Pd25 and the Sc-alloyed material, differential scanning calorimetry is conducted for multiple cycles to characterize cyclic stability of the transformation temperatures. The microstructure is evaluated using electron microscopy, X-ray diffractometry, and wavelength dispersive spectroscopy. Isobaric thermal cycling experiments are used to determine transformation temperatures, dimensional stability, and work output as a function of stress. The Sc-doped alloy displays more stable shape memory response with smaller irrecoverable strain and narrower thermal hysteresis than the baseline ternary alloy. This improvement in performance is attributed to the solid solution hardening effect of Sc.

  17. Experimental and DFT studies on the vibrational and electronic spectra of 2-(4,5-phenyl-1H-imidazole-2-yl)-phenol

    Science.gov (United States)

    Ye, Yunfeng; Tang, Guodong; Tang, Tingting; Culnane, Lance F.; Zhao, Jianyin; Zhang, Yu

    2015-02-01

    The compound 2-(4,5-phenyl-1H-imidazole-2-yl-phenol (PIP) was synthesized, followed by structure determination by X-ray diffraction, the results of which agree well with the calculated optimized, lowest energy geometrical structure. Vibrational information was obtained by FT-IR and Raman spectroscopy which also agree well with calculations (of harmonic vibration frequencies). The calculations were carried out with density functional theory B3LYP methods using 6-311++G** and LANL2DZ basis sets. Absorption UV-Vis experiments of PIP in CH3CH2OH solution reveal three maximum peaks at 245, 292 and 317 nm, which are in agreement with calculated electronic transitions using TD-B3LYP/6-311++G** in CH3CH2OH solution, and agree to the gas-phase calculations.

  18. Design and analysis of an implantable CPW-fed X-monopole antenna for 2.45-GHz ISM band applications.

    Science.gov (United States)

    Ashok Kumar, Srinivasan; Shanmuganantham, Thangavelu

    2014-03-01

    A novel antenna design that effectively covers the industrial, scientific, and medical (ISM) band at 2.45 GHz using an X-shaped structure with a coplanar waveguide (CPW) feed is described. The antenna has a compact size of 67.6 mm(3). The proposed design is effective for ISM band biotelemetry with a wakeup controller (2.45 GHz). An experimental prototype of the compact implantable CPW-fed X-shaped monopole antenna was fabricated on a biocompatible alumina Al2O3 ceramic substrate. The optimal antenna was fabricated and tested in minced tissue from the front leg of a pig and on a human body phantom liquid. The simulated and measured bandwidths are 180 MHz and 210 MHz in the ISM band, respectively. PMID:24404821

  19. Study of the rhizobacterium Azospirillum brasilense Sp245 using Mössbauer spectroscopy with a high velocity resolution: Implication for the analysis of ferritin-like iron cores

    Science.gov (United States)

    Alenkina, I. V.; Oshtrakh, M. I.; Tugarova, A. V.; Biró, B.; Semionkin, V. A.; Kamnev, A. A.

    2014-09-01

    The results of a comparative study of two samples of the rhizobacterium Azospirillum brasilense (strain Sp245) prepared in different conditions and of human liver ferritin using Mössbauer spectroscopy with a high velocity resolution demonstrated the presence of ferritin-like iron (i.e. iron similar to that found in ferritin-like proteins) in the bacterium. Mössbauer spectra of these samples were fitted in two ways: as a rough approximation using a one quadrupole doublet fit (the homogeneous iron core model) and using a superposition of quadrupole doublets (the heterogeneous iron core model). Both results demonstrated differences in the Mössbauer parameters for mammalian ferritin and for bacterial ferritin-like iron. Moreover, some differences in the Mössbauer parameters were observed between the two samples of A. brasilense Sp245 related to the differences in their preparation conditions.

  20. Nano copper and cobalt ferrites as heterogeneous catalysts for the one-pot synthesis of 2,4,5-tri substituted imidazoles

    Indian Academy of Sciences (India)

    Paul Douglas Sanasi; D Santhipriya; Y Ramesh; M Ravi Kumar; B Swathi; K Jaya Rao

    2014-11-01

    A simple one-pot synthesis has been developed for the synthesis of 2,4,5-trisubstituted imidazoles using magnetic recyclable spinel nano copper and cobalt ferrites by the condensation of benzil, aromatic aldehyde and ammonium acetate in ethanol as solvent. The reaction, with these catalysts was carried out under mild reaction conditions with very good yields of substituted imidazoles. These catalysts can be recycled very easily and reused, which makes this methodology environmentally benign.

  1. A novel and an efficient catalyst for one-pot synthesis of 2,4,5-trisubstituted imidazoles by using microwave irradiation under solvent-free conditions

    Indian Academy of Sciences (India)

    Javad Safari; Shiva Dehghan Khalili; Sayed Hossein Banitaba

    2010-05-01

    (NH4)6Mo7O24.4H2O has been used as an efficient catalyst for an improved and rapid synthesis of 2,4,5-trisubstituted imidazoles by a three-component, one-pot condensation of benzil, aryl aldehydes and ammonium acetate in good yields under solvent-free conditions using microwave irradiation. The reactions in conventional heating conditions were compared with the microwave-assisted reactions.

  2. Measurement of neutron induced fission of {sup 235}U, {sup 233}U and {sup 245}Cm with the FIC detector at the CERN n-TOF facility

    Energy Technology Data Exchange (ETDEWEB)

    Calviani, M.; Karadimos, D.; Abbondanno, U.; Aerts, G.; Alvarez, H.; Alvarez-Velarde, F.; Andriamonje, S.; Andrzejewski, J.; Assimakopoulos, P.; Audouin, L.; Badurek, G.; Baumann, P.; Becvar, F.; Berthoumieux, E.; Calvino, F.; Cano-Ott, D.; Capote, R.; Carrapic, C.; Cennini, P.; Chepel, V.; Chiaveri, E.; Colonna, N.; Cortes, G.; Couture, A.; Cox, J.; Dahlfors, M.; David, S.; Dillmann, I.; Domingo-Pardo, C.; Dridi, W.; Duran, I.; Eleftheriadis, C.; Embid-Segura, M.; Ferrant, L.; Ferrari, A.; Ferreira-Marques, R.; Fujii, K.; Furman, W.; Goncalves, I.; Gonzalez-Romero, E.; Gramegna, F.; Guerrero, C.; Gunsing, F.; Haas, B.; Haight, R.; Heil, M.; Herrera-Martinez, A.; Igashira, M.; Jericha, E.; Kappeler, F.; Kadi, Y.; Karamanis, D.; Kerveno, M.; Koehler, P.; Kossionides, E.; Krticka, M.; Lampoudis, C.; Leeb, H.; Lindote, A.; Lopes, I.; Lozano, M.; Lukic, S.; Marganiec, J.; Marrone, S.; Martinez, T.; Massimi, C.; Mastinu, P.; Mengoni, A.; Milazzo, P.M.; Moreau, C.; Mosconi, M.; Neves, F.; Oberhummer, H.; O' Brien, S.; Pancin, J.; Papachristodoulou, C.; Papadopoulos, C.; Paradela, C.; Patronis, N.; Pavlik, A.; Pavlopoulos, P.; Perrot, L.; Pigni, M.T.; Plag, R.; Plompen, A.; Plukis, A.; Poch, A.; Praena, J.; Pretel, C.; Quesada, J.; Rauscher, T.; Reifarth, R.; Rubbia, C.; Rudolf, G.; Rullhusen, P.; Salgado, J.; Santos, C.; Sarchiapone, L.; Savvidis, I.; Stephan, C.; Tagliente, G.; Tain, J.L.; Tassan-Got, L.; Tavora, L.; Terlizzi, R.; Vannini, G.; Vaz, P.; Ventura, A.; Villamarin, D.; Vincente, M.C.; Vlachoudis, V.; Vlastou, R.; Voss, F.; Walter, S.; Wiescher, M.; Wisshak, K

    2008-07-01

    A series of measurements of neutron induced fission cross section of various transuranic isotopes have been performed at the CERN n-TOF spallation neutron facility, in the energy range from thermal to nearly 250 MeV. The experimental apparatus consists in a fast ionization chamber (FIC), used as a fission fragment detector with a high efficiency. Good discrimination between alphas and fission fragments can be obtained with a simple amplitude threshold. In order to allow the monitoring of the neutron beam and to extract the n-TOF neutron flux, the well known cross section of the {sup 235}U(n,f) reaction, considered as a fission standard, has been used. Preliminary results for the cross section are shown for some selected isotopes such as {sup 235}U, {sup 233}U and {sup 245}Cm in the energy range from 0.050 eV to about 2 MeV. These results for {sup 235}U, {sup 233}U and {sup 245}Cm show results consistent with databases in the resonance region, with no normalization required for {sup 233}U. In the case of {sup 245}Cm, for the energy range between thermal and 20 eV, we obtained the first experimental data ever published, while showing a good agreement with previous data in the region above that value.

  3. Measurement of neutron induced fission of 235U, 233U and 245Cm with the FIC detector at the CERN n-TOF facility

    International Nuclear Information System (INIS)

    A series of measurements of neutron induced fission cross section of various transuranic isotopes have been performed at the CERN n-TOF spallation neutron facility, in the energy range from thermal to nearly 250 MeV. The experimental apparatus consists in a fast ionization chamber (FIC), used as a fission fragment detector with a high efficiency. Good discrimination between alphas and fission fragments can be obtained with a simple amplitude threshold. In order to allow the monitoring of the neutron beam and to extract the n-TOF neutron flux, the well known cross section of the 235U(n,f) reaction, considered as a fission standard, has been used. Preliminary results for the cross section are shown for some selected isotopes such as 235U, 233U and 245Cm in the energy range from 0.050 eV to about 2 MeV. These results for 235U, 233U and 245Cm show results consistent with databases in the resonance region, with no normalization required for 233U. In the case of 245Cm, for the energy range between thermal and 20 eV, we obtained the first experimental data ever published, while showing a good agreement with previous data in the region above that value.

  4. Electromagnetic fields at 2.45 GHz trigger changes in heat shock proteins 90 and 70 without altering apoptotic activity in rat thyroid gland

    Directory of Open Access Journals (Sweden)

    María José Misa Agustiño

    2012-07-01

    Non-ionizing radiation at 2.45 GHz may modify the expression of genes that codify heat shock proteins (HSP in the thyroid gland. Using the enzyme-linked immunosorbent assay (ELISA technique, we studied levels of HSP-90 and HSP-70. We also used hematoxilin eosin to look for evidence of lesions in the gland and applied the DAPI technique of fluorescence to search for evidence of chromatin condensation and nuclear fragmentation in the thyroid cells of adult female Sprague-Dawley rats. Fifty-four rats were individually exposed for 30 min to 2.45 GHz radiation in a Gigahertz transverse electromagnetic (GTEM cell at different levels of non-thermal specific absorption rate (SAR, which was calculated using the finite difference time domain (FDTD technique. Ninety minutes after radiation, HSP-90 and HSP-70 had decreased significantly (P<0.01 after applying a SAR of 0.046±1.10 W/Kg or 0.104±5.10−3 W/Kg. Twenty-four hours after radiation, HSP-90 had partially recovered and HSP-70 had recovered completely. There were few indications of lesions in the glandular structure and signs of apoptosis were negative in all radiated animals. The results suggest that acute sub-thermal radiation at 2.45 GHz may alter levels of cellular stress in rat thyroid gland without initially altering their anti-apoptotic capacity.

  5. Abatement of fluorinated compounds using a 2.45 GHz microwave plasma torch with a reverse vortex plasma reactor

    International Nuclear Information System (INIS)

    Highlights: • We developed a microwave plasma torch with reverse vortex reactor (RVR). • We calculated a volume fraction and temperature distribution of discharge gas and waste. • The performance of reverse vortex reactor increased from 29% to 43% than conventional vortex reactor. - Abstract: Abatement of fluorinated compounds (FCs) used in semiconductor and display industries has received an attention due to the increasingly stricter regulation on their emission. We have developed a 2.45 GHz microwave plasma torch with reverse vortex reactor (RVR). In order to design a reverse vortex plasma reactor, we calculated a volume fraction and temperature distribution of discharge gas and waste gas in RVR by ANSYS CFX of computational fluid dynamics (CFD) simulation code. Abatement experiments have been performed with respect to SF6, NF3 by varying plasma power and N2 flow rates, and FCs concentration. Detailed experiments were conducted on the abatement of NF3 and SF6 in terms of destruction and removal efficiency (DRE) using Fourier transform infrared (FTIR). The DRE of 99.9% for NF3 was achieved without an additive gas at the N2 flow rate of 150 liter per minute (L/min) by applying a microwave power of 6 kW with RVR. Also, a DRE of SF6 was 99.99% at the N2 flow rate of 60 L/min using an applied microwave power of 6 kW. The performance of reverse vortex reactor increased about 43% of NF3 and 29% of SF6 abatements results definition by decomposition energy per liter more than conventional vortex reactor

  6. Abatement of fluorinated compounds using a 2.45 GHz microwave plasma torch with a reverse vortex plasma reactor

    Energy Technology Data Exchange (ETDEWEB)

    Kim, J.H.; Cho, C.H.; Shin, D.H. [Plasma Technology Research Center, National Fusion Research Institute, 814-2 Oxikdo-dong, Gunsan-city, Jeollabuk-do (Korea, Republic of); Hong, Y.C., E-mail: ychong@nfri.re.kr [Plasma Technology Research Center, National Fusion Research Institute, 814-2 Oxikdo-dong, Gunsan-city, Jeollabuk-do (Korea, Republic of); Shin, Y.W. [Plasma Technology Research Center, National Fusion Research Institute, 814-2 Oxikdo-dong, Gunsan-city, Jeollabuk-do (Korea, Republic of); School of Advanced Green Energy and Environments, Handong Global University, Heunghae-eup, Buk-gu, Pohang-city, Gyeongbuk (Korea, Republic of)

    2015-08-30

    Highlights: • We developed a microwave plasma torch with reverse vortex reactor (RVR). • We calculated a volume fraction and temperature distribution of discharge gas and waste. • The performance of reverse vortex reactor increased from 29% to 43% than conventional vortex reactor. - Abstract: Abatement of fluorinated compounds (FCs) used in semiconductor and display industries has received an attention due to the increasingly stricter regulation on their emission. We have developed a 2.45 GHz microwave plasma torch with reverse vortex reactor (RVR). In order to design a reverse vortex plasma reactor, we calculated a volume fraction and temperature distribution of discharge gas and waste gas in RVR by ANSYS CFX of computational fluid dynamics (CFD) simulation code. Abatement experiments have been performed with respect to SF{sub 6}, NF{sub 3} by varying plasma power and N{sub 2} flow rates, and FCs concentration. Detailed experiments were conducted on the abatement of NF{sub 3} and SF{sub 6} in terms of destruction and removal efficiency (DRE) using Fourier transform infrared (FTIR). The DRE of 99.9% for NF{sub 3} was achieved without an additive gas at the N{sub 2} flow rate of 150 liter per minute (L/min) by applying a microwave power of 6 kW with RVR. Also, a DRE of SF{sub 6} was 99.99% at the N{sub 2} flow rate of 60 L/min using an applied microwave power of 6 kW. The performance of reverse vortex reactor increased about 43% of NF{sub 3} and 29% of SF{sub 6} abatements results definition by decomposition energy per liter more than conventional vortex reactor.

  7. CW/Pulsed H− ion beam generation with PKU Cs-free 2.45 GHz microwave driven ion source

    International Nuclear Information System (INIS)

    Circular accelerators used for positron emission tomography (PET, i.e. accelerator used for make radio isotopes) need several mA of CW H- ion beam for their routine operation. Other facilities, like Space Radio-Environment Simulate Assembly (SPRESA), require less than 10 mA pulsed mode H− beam. Caesium free negative hydrogen ion source is a good choice for those facilities because of its compact structure, easy operation and low cost. Up to now, there is no H− source able to produce very intense H− beams with important variation of the duty factor[1]. Recently, a new version of 2.45 GHz microwave H− ion source was designed at PKU, based on lessons learnt from the previous one. This non cesiated source is very compact thanks to its permanent magnet configuration. Special attention was paid on the design of the discharge chamber structure, electron dumping and extraction system. Source test to produce H− ion beams in pulsed and CW mode was carried out on PKU ion source test bench. In CW mode, a 10.8 mA/30keV H− beam with rms emittance about 0.16 π·mm·mrad has been obtained with only 500 W rf power. The power efficiency reaches 21 mA/kW. In pulsed mode with duty factor of 10% (100Hz/1ms), this compact source can easily deliver 20 mA H− ion beam at 35 keV with rms emittance about 0.2 π·mm·mrad when RF power is set at 2.2 kW (peak power). Several hour successive running operation in both modes and totaling more than 200 hours proves its high quality. The outside dimension of this new H− source body is ϕ116 mm × 124 mm, and the entire H− source infrastructure, including rf matching section, plasma chamber and extraction system, is ϕ310 × 180 mm. The high voltage region is limited with in a ϕ310 mm × 230 mm diagram. Details are given in this paper

  8. CW/Pulsed H- ion beam generation with PKU Cs-free 2.45 GHz microwave driven ion source

    Science.gov (United States)

    Peng, S. X.; Ren, H. T.; Xu, Y.; Zhang, T.; Zhang, A. L.; Zhang, J. F.; Zhao, J.; Guo, Z. Y.; Chen, J. E.

    2015-04-01

    Circular accelerators used for positron emission tomography (PET, i.e. accelerator used for make radio isotopes) need several mA of CW H- ion beam for their routine operation. Other facilities, like Space Radio-Environment Simulate Assembly (SPRESA), require less than 10 mA pulsed mode H- beam. Caesium free negative hydrogen ion source is a good choice for those facilities because of its compact structure, easy operation and low cost. Up to now, there is no H- source able to produce very intense H- beams with important variation of the duty factor[1]. Recently, a new version of 2.45 GHz microwave H- ion source was designed at PKU, based on lessons learnt from the previous one. This non cesiated source is very compact thanks to its permanent magnet configuration. Special attention was paid on the design of the discharge chamber structure, electron dumping and extraction system. Source test to produce H- ion beams in pulsed and CW mode was carried out on PKU ion source test bench. In CW mode, a 10.8 mA/30keV H- beam with rms emittance about 0.16 π.mm.mrad has been obtained with only 500 W rf power. The power efficiency reaches 21 mA/kW. In pulsed mode with duty factor of 10% (100Hz/1ms), this compact source can easily deliver 20 mA H- ion beam at 35 keV with rms emittance about 0.2 π.mm.mrad when RF power is set at 2.2 kW (peak power). Several hour successive running operation in both modes and totaling more than 200 hours proves its high quality. The outside dimension of this new H- source body is ϕ116 mm × 124 mm, and the entire H- source infrastructure, including rf matching section, plasma chamber and extraction system, is ϕ310 × 180 mm. The high voltage region is limited with in a ϕ310 mm × 230 mm diagram. Details are given in this paper.

  9. A Novel Substitution of The Heme-binding Residue Histidine-245 by Histidine-249 in Heme Oxygenase HugZ%血红素氧合酶HugZ组氨酸-249对组氨酸-245侧链缺失补偿的结构基础

    Institute of Scientific and Technical Information of China (English)

    沈溪辉; 胡永林; 王大成

    2012-01-01

    The heme oxygenase HugZ from Helicobacter pylori plays essential roles in the colonization of the bacteria in human hosts and is required for the utilization of heme as the sole iron source. Residue His245, which is highly conserved, coordinates the heme iron through its sidechain imidazole group. Surprisingly, this residue was not required for the enzymatic activities of HugZ. To investigate the roles played by His245 in heme binding and enzymatic mechanisms of HugZ, we have solved the crystal structure of HugZ mutant H245A at 2.55 (A) resolution and found that a nearby histidine residue, His249, coordinates the heme iron. This substitution is made possible by the fact that both residues 245 and 249 are located in a flexible loop region ranged from Gly239 to the C-terminus. Similar structural features have not been observed in other heme oxygenases so far. We have also performed spectroscopic studies on the heme-binding properties of HugZ and relevant mutants and our results suggest that the flexible C-terminal loop region of HugZ and the presence of multiple histidine residues in this region may play important roles in heme recruiting and in the catalytic mechanisms of HugZ.%血红素氧合酶HugZ是幽门螺旋杆菌(Helicobacter pylori)利用宿主血红素作为铁源的关键蛋白.HugZ的His245残基侧链咪唑基与血红素中心铁配位结合,是酶活中心的重要组成部分.用定点突变的方法构建HugZ突变体H245A、H249A和H245A/H249A基因,并将突变体蛋白表达纯化.通过X射线晶体学途径解析了突变体H245A与血红素复合物的2.55(A)分辨率晶体结构.结构解析表明,HugZ的His249残基侧链咪唑基团与血红素的铁原子结合,从而补偿了His245侧链缺失.这种结构特征在已知血红素氧合酶中未曾发现.Va1238ψ平面的可翻转和Gly239的柔性是His249能与血红素配位结合的关键原因,二者的共同作用改变了C端肽链的走向,使Va1238与His249之间的柔性

  10. Promoter-trap identification of wheat seed extract-induced genes in the plant-growth-promoting rhizobacterium Azospirillum brasilense Sp245.

    Science.gov (United States)

    Pothier, Joël F; Wisniewski-Dyé, Florence; Weiss-Gayet, Michèle; Moënne-Loccoz, Yvan; Prigent-Combaret, Claire

    2007-10-01

    Azospirillum strains have been used as plant-growth-promoting rhizobacteria (PGPR) of cereal crops, but their adaptation to the root remains poorly understood. Here, we used a global approach based on differential fluorescence induction (DFI) promoter trapping to identify genes of the wheat isolate Azospirillum brasilense Sp245 that are induced in the presence of spring wheat seed extracts. Fluorescence-based flow cytometry sorting of Sp245 cells was validated using PlacZ, PsbpA and PnifH promoters and egfp. A random promoter library was constructed by cloning 1-3 kb Sp245 fragments upstream of a promoterless version of egfp in the promoter-trap plasmid pOT1e (genome coverage estimated at threefold). Exposure to spring wheat seed extracts obtained using a methanol solution led to the detection of 300 induced DFI clones, and upregulation by seed extracts was confirmed in vitro for 46 clones. Sequencing of 21 clones enabled identification of seven promoter regions. Five of them displayed upregulation once inoculated onto spring wheat seedlings. Their downstream sequence was similar to (i) a predicted transcriptional regulator, (ii) a serine/threonine protein kinase, (iii) two conserved hypothetical proteins, or (iv) the copper-containing dissimilatory nitrite reductase NirK. Two of them were also upregulated when inoculated on winter wheat and pea but not on maize, whereas the three others (including PnirK) were upregulated on the three hosts. The amounts of nitrate and/or nitrite present in spring wheat seed extracts were sufficient for PnirK upregulation. Overall, DFI promoter trapping was useful to reveal Azospirillum genes involved in the interaction with the plant. PMID:17906157

  11. The relationship between visible light emission and species fraction of the hydrogen ion beams extracted from 2.45 GHz microwave discharge

    CERN Document Server

    Cortázar, O D; Tarvainen, O; Kalvas, T; Koivisto, H

    2015-01-01

    The relationship between Balmer-α and Fulcher-band emissions with extracted H +, H+2 , and H+3 ions is demonstrated for a 2.45 GHz microwave discharge. Ion mass spectra and optical measurements of Balmer-α and Fulcher-band emissions have been obtained with a Wien Filter having an optical view-port on the plasma chamber axis. The beam of approximately 1 mA is analyzed for different plasma conditions simultaneously with the measurement of light emissions both with temporal resolution. The use of visible light emissions as a valuable diagnostic tool for monitoring the species fraction of the extracted beams is proposed.

  12. High Concentration InGaN/GaN Multi-Quantum Well Solar Cells with a Peak Open-Circuit Voltage of 2.45 V

    International Nuclear Information System (INIS)

    We report InGaN/GaN multi-quantum well (MQW) solar cells with a comparatively high open-circuit voltage and good concentration properties. The open circuit voltage (Voc) keeps increasing logarithmically with concentration ratio until 60 suns. The peak Voc of InGaN/GaN MQW solar cells, which has a predominant peak wavelength of 456 nm from electroluminescence measurements, is found to be 2.45 V when the concentration ratio reaches 333×. Furthermore, the dependence of conversion efficiency and fill factor on concentration ratio are analyzed. (cross-disciplinary physics and related areas of science and technology)

  13. Photometric and spectroscopic study of Shakhbazian compact galaxy groups ShCG 104, ShCG 120, ShCG 223, and ShCG 245

    OpenAIRE

    Tovmassian, Hrant M.; H. Tiersch; Tovmassian, Gaghik H.; V. H. Chavushyan; Neizvestny, S.; Pramskij, A. G.; J. P. Torres-Papaqui; M Rozas

    2007-01-01

    Los grupos compactos de galaxias Shakhbazian son las configuraciones más densas que se conocen. Hace algunos años iniciamos un estudio fotométrico y espectroscópico de estos grupos. En este artículo presentamos los resultados de la investigación en los grupos ShCG 104, ShCG 120, ShCG 243 y ShCG 245. Presentamos los corrimientos al rojo de las galaxias miembro, los resultados de la fotometría R, las curvas de brillo superficial-radio efectivo, las masas estimadas, las luminosida...

  14. Spectroscopic study of 206,207,208Pb isotopes by high resolution analysis of 24.5 MeV proton scattering

    International Nuclear Information System (INIS)

    206,207,208pb have been studied by 24.5 MeV proton inelastic scattering with a resolution of 20 keV. The angular distributions of the differential cross-sections corresponding to the different excited levels have been measured in a large angular region and analysed with the DWBA.This work shows that it exists between 4 and 5 MeV of excitation energy some strongly excited levels corresponding to transfer momenta l = 2, 4, 6 and 8. The single particle-hole models do not explain these states; so it will probably be necessary to introduce some several particle - hole configurations. (author)

  15. Report on the low-RF-power and data-acquisition-systems of the 2.45 GHz Lower-Hybrid Transmitter at the ASDEX tokamak

    International Nuclear Information System (INIS)

    This report relates to the low-power section of the 2.45 GHz transmitter used for current drive experiments at the ASDEX tokamak. The high-RF-power section is dealt with elsewhere. Data acquisition and evaluation of quantities pertaining to the Lower Hybrid experiment are also treated here. As in the previous report on the 1.3 GHz system (M. Zouhar: 'Beschreibung des Niederleistungsteils des HF-Systems fuer die LH-Experimente in ASDEX.', IPP-report 4/218, February 1984), most space is spent in commenting upon the amplitude (power)- and phase-feedback control loops. (orig.)

  16. Design and characterization of 2.45 GHz electron cyclotron resonance plasma source with magnetron magnetic field configuration for high flux of hyperthermal neutral beam

    International Nuclear Information System (INIS)

    A 2.45 GHz electron cyclotron resonance (ECR) source with a magnetron magnetic field configuration was developed to meet the demand of a hyperthermal neutral beam (HNB) flux on a substrate of more than 1x1015 cm-2 s-1 for industrial applications. The parameters of the operating pressure, ion density, electron temperature, and distance between the neutralization plate and the substrate for the HNB source are specified in a theoretical analysis. The electron temperature and the ion density are measured to characterize the ECR HNB source using a Langmuir probe and optical emission spectroscopy. The parameters of the ECR HNB source are in good agreement with the theoretically specified parameters.

  17. Comparative analysis of CO2-based transcritical Rankine cycle and HFC245fa-based subcritical organic Rankine cycle using low-temperature geothermal source

    Institute of Scientific and Technical Information of China (English)

    2010-01-01

    A detailed thermodynamic and techno-economic comparison is presented for a CO2-based transcritical Rankine cycle and a subcritical organic Rankine cycle (ORC) using HFC245fa (1,1,1,3,3-pentafluoro-propane) as the working fluid driven by the low-temperature geothermal source,in order to determine the configuration that presents the maximum net power output with a minimum investment.The evaluations of both Rankine cycles have been performed based on equal thermodynamic mean heat rejection temperature by varying certain system operating parameters to achieve each Rankine cycle’s optimum design at various geothermal source temperature levels ranging from 80oC to 120oC.The results obtained show that the optimum ther-modynamic mean heat injection temperatures of both Rankine cycles are distributed in the scope of 55% to 65% of a given geothermal source temperature level,and that the CO2-based transcritical Rankine cycle presents 3% to 7% higher net power output,84% reduction of turbine inlet volume flow rate,47% reduction of expansion ratio and 1.68 times higher total heat transfer capacity compared with the HFC245fa-based subcritical ORC.It is also indicated that using the CO2-based transcritical system can reduce the dimension of turbine design.However,it requires larger heat transfer areas with higher strength heat exchanger materials because of the higher system pressure.

  18. Design and construction of a 2.45 GHz waveguide-based microwave plasma jet at atmospheric pressure for material processing

    International Nuclear Information System (INIS)

    We have designed a low-cost and reliable 2.45 GHz waveguide-based applicator to generate a microwave plasma jet (MPJ) at atmospheric pressure. The MPJ system consists of a 1-6 kW magnetron power supply, a circulator, a water-cooled matched load and the applicator. The applicator includes a tuning section, which is required to reduce the reflected power, and the nozzle section. The plasma is formed by the interaction of the high electrical field, generated by the microwave power, between the waveguide aperture and the gas nozzle. A variety of gases have been used to produce the plasma including argon, helium and nitrogen. A 2 kW, 2.45 GHz MPJ, constructed using a rectangular waveguide WG9A (WR340), has been investigated. An MPJ has been used for material processing applications including cutting, welding, glass vitrification and quartz/ceramic processing. This paper discusses the design parameters and the potential of the MPJ for industrial applications and how the jet can be tailored to suit different tasks, by adjusting the various parameters such as the type of gas, the flow rate, the input power and the nozzle design. (author)

  19. Shadow of a Colossus: A z=2.45 Galaxy Protocluster Detected in 3D Ly-a Forest Tomographic Mapping of the COSMOS Field

    CERN Document Server

    Lee, Khee-Gan; White, Martin; Prochaska, J Xavier; Font-Ribera, Andreu; Schlegel, David J; Rich, R Michael; Suzuki, Nao; Stark, Casey W; Fevre, Olivier Le; Nugent, Peter E; Salvato, Mara; Zamorani, Gianni

    2015-01-01

    Using moderate-resolution optical spectra from 58 background Lyman-break galaxies and quasars at $z\\sim 2.3-3$ within a $11.5'\\times13.5'$ area of the COSMOS field ($\\sim 1200\\,\\mathrm{deg}^2$ projected area density or $\\sim 2.4\\,h^{-1}\\,\\mathrm{Mpc}$ mean transverse separation), we reconstruct a 3D tomographic map of the foreground Ly$\\alpha$ forest absorption at $2.22.45$ associated with a recently-discovered galaxy protocluster at the same redshift. Based on simulations matched to our data, we estimate the enclosed dark matter mass within this IGM overdensity to be $M_{\\rm dm} (z=2.45) = (9\\pm4)\\times 10^{13}\\,h^{-1}\\,\\mathrm{M_\\o...

  20. Fate of the herbicides 2,4,5-T, atrazine, and DNOC in a shallow, anaerobic aquifer investigated by in situ passive diffusive emitters and laboratory batch experiments

    DEFF Research Database (Denmark)

    Arildskov, N.P.; Pedersen, Philip Grinder; Albrechtsen, Hans-Jørgen

    2001-01-01

    following first-order kinetics. The removal mechanism was likely an abiotic reduction. At day 25, the first-order rate constant was 1.47 d(-1), but it decreased with time and seemed to stabilize at 0.35 d(-1) after 150 to 200 days. In the laboratory, batch experiments were conducted with sediments from 3 to...... 4 rubs and from 8 to 9 rubs. In these incubations, formation of Fe2+ and depletion of sulfate showed iron and sulfate reduction in sediment from 3 to 3.5 rubs and sulfate reduction in 3.5 to 4 rubs sediment. In sediment from 8 to 9 rubs, the dominant redox process was methane formation. In sediment...... from 3 to 3.5 rubs, only 27% to 52% of the 2,4,5-T remained after 196 days. 2,4,5-trichlorophenol was identified as the major metabolite. A lag period of at least 50 days was observed, and no degradation occurred in HgCl2 amended controls, verifying that the process was microbially mediated. In the...

  1. Assessing the efficacy of co-inoculation of wheat seedlings with the associative bacteria Paenibacillus polymyxa 1465 and Azospirillum brasilense Sp245.

    Science.gov (United States)

    Yegorenkova, Irina V; Tregubova, Kristina V; Burygin, Gennady L; Matora, Larisa Y; Ignatov, Vladimir V

    2016-03-01

    Co-inoculation of associative bacteria, which have high nitrogen-fixing activity, tolerance for environmental conditions, and the ability to compete with the natural microflora, is used widely to enhance the growth and yields of agricultural plants. We evaluated the ability of 2 co-inoculated plant-growth-promoting rhizobacteria, Paenibacillus polymyxa 1465 and Azospirillum brasilense Sp245, to colonize roots of wheat (Triticum aestivum L. 'Saratovskaya 29') seedlings, and we assessed the morphometric parameters of wheat early in its development. Analysis by ELISA with polyclonal antibodies raised against the exopolysaccharide of P. polymyxa 1465 and the lipopolysaccharide of A. brasilense Sp245 demonstrated that the root-colonizing activity of A. brasilense was higher when the bacterium was co-inoculated with P. polymyxa than when it was inoculated singly. Immunofluorescence microscopy with Alexa Fluor 532-labeled antibodies revealed sites of attachment of co-inoculated P. polymyxa and A. brasilense and showed that the 2 bacteria colonized similar regions of the roots. Co-inoculation exerted a negative effect on wheat seedling development, inhibiting root length by 17.6%, total root weight by 11%, and total shoot weight by 12%. Under certain conditions, dual inoculation of wheat may prove ineffective, apparently owing to the competition between the rhizobacteria for colonization sites on the plant roots. The findings from this study may aid in developing techniques for mixed bacterial inoculation of cultivated plants. PMID:26863134

  2. Isobaric heat capacities of R245fa and R236fa in liquid phase at temperatures from (315 to 365) K and pressures up to 5.5 MPa

    International Nuclear Information System (INIS)

    Highlights: • Isobaric heat capacity for compressed liquid R245fa and R236fa were measured. • Experimental data was correlated to an empirical equation. • Comparison was carried out between present data and latest equation of states. - Abstract: Isobaric heat capacities of compressed liquid 1,1,1,3,3-pentafluoropropane (R245fa) and 1,1,1,3,3,3-hexafluoropropane (R236fa) were measured by scanning calorimetry. The experimental system basically consists of a calvet calorimeter (Setaram C80) and a pressure balance unit. A total of 55 data points for liquid R245fa and 52 data points for liquid R236fa were obtained at temperatures from (315 to 365) K and pressures up to 5.5 MPa. The uncertainties for the heat capacity of R245fa and R236fa were estimated to be (1.8 and 1.6)%, respectively. The experimental data was correlated to an empirical equation, the form of which was decided by stepwise fit method. The average absolute percentage deviations between the data points and the equation were (0.23 and 0.10)% for R245fa and R236fa

  3. Porovnání sběracích lisů CLAAS ROLLANT 46 SILAGE a LELY WELGER RP 245 při sklizni píce a slámy.

    OpenAIRE

    KOCÁBEK, Jan

    2012-01-01

    This thesis is focused on a comparison of round balers from two different producers. The compared balers were Claas Rollant 46 Silage and Lely Welger RP 245. The compared parametrs were the quality of the cutting, compressibility and the quality of forage, The thesis is supplemented by an analysis of performance indicators and exploitation , the cost of pressing and the cost per 1 ton of harvested materiál. For the baler Lely Welger RP 245 the better quality of haylage , more effective compre...

  4. Repetitive generation of 2.45 MeV nuclear fusion neutron from deuterated nano-sized particles irradiated by 20 TW all-solid-state laser

    International Nuclear Information System (INIS)

    We propose a novel neutron source technique using ultra-high intensity laser based on the cluster fusion scheme. We have developed the high-repetition rate 20 TW ultra-short pulse laser system MATSU-1 pumped by the efficient diode-pumped high energy solid-state laser KURE-1. Irradiating the ultra-high intensity of >2x1018 W/cm2 in 60 fs laser pulse, high-energy deuterons were generated from the Coulomb explosion of deuterated polystyrene solid nanoparticles, and 2.45 MeV neutrons were observed by deuteron-deuteron fusion reaction. The yield of 104-105 neutrons per shot was stably observed during a hundred shots at 0.1-1 Hz operation. (author)

  5. Analysis of gene expression in a human-derived glial cell line exposed to 2.45 GHz continuous radiofrequency electromagnetic fields

    International Nuclear Information System (INIS)

    The increasing use of mobile phones has aroused public concern regarding the potential health risks of radiofrequency (RF) fields. We investigated the effects of exposure to RF fields (2.45 GHz, continuous wave) at specific absorption rate (SAR) of 1, 5, and 10 W/kg for 1, 4, and 24 h on gene expression in a normal human glial cell line, SVGp12, using DNA microarray. Microarray analysis revealed 23 assigned gene spots and 5 non-assigned gene spots as prospective altered gene spots. Twenty-two genes out of the 23 assigned gene spots were further analyzed by reverse transcription-polymerase chain reaction to validate the results of microarray, and no significant alterations in gene expression were observed. Under the experimental conditions used in this study, we found no evidence that exposure to RF fields affected gene expression in SVGp12 cells. (author)

  6. Catalytic transfer hydrogenation of azobenzene by low-valent nickel complexes: a route to 1,2-disubstituted benzimidazoles and 2,4,5-trisubstituted imidazolines.

    Science.gov (United States)

    Zurita, Daniel A; Flores-Alamo, Marcos; García, Juventino J

    2016-06-21

    The one-pot synthesis of 1,2-disubstituted benzimidazoles by the transfer hydrogenation of azobenzene, using benzylamine as a hydrogen donor, sequential rearrangement of hydrazobenzene to semidine and further condensation with N-benzylideneamine is reported, catalyzed by 2 mol% of [Ni(COD)2] : dippe. The N2 substitution on benzimidazole can be controlled by the selection of different azobenzenes and C2 substitution will only depend on the chosen benzylamine. The current methodology avoids the addition of external oxidants, which are needed in the classical benzimidazole synthesis. In addition, the byproduct, N-benzylideneamine, obtained from dehydrogenation of benzylamine produced 2,4,5-trisubstituted imidazolines by cyclization and C-H functionalization, and this route was optimized with the use of 2 mol% of [Ni(COD)2] : 2PPh3. PMID:27254530

  7. Measurement of Neutron Induced Fission of 235U, 233U and 245Cm with the FIC Detector at the CERN n()TOF Facility

    International Nuclear Information System (INIS)

    A series of measurements of neutron induced fission cross section of various TRU isotopes have been performed at the CERN n()TOF spallation neutron facility, in the energy range from thermal to nearly 250 MeV. The experimental apparatus consists in a fast ionization chamber (FIC), used as a fission fragment detector with a high efficiency. Good discrimination between alphas and fission fragments can be obtained with a simple amplitude threshold. In order to allow the monitoring of the neutron beam and to extract the n()TOF neutron flux, the well known cross section of the 235U(n,f) reaction, considered as a fission standard, has been used. Preliminary results for the cross section are shown for some selected isotopes such as 235U, 233U and 245Cm in the energy range from 0.050 eV to about 2 MeV.

  8. Energy distributions and yields of 3H, 4He and 6He-particles emitted in the 245Cm(n_th,f) reaction

    CERN Document Server

    Serot, O; Wagemans, J; Goeminne, G; Köster, U; Geltenbort, P; Nesvizhevsky, V V

    2001-01-01

    The energy distributions and yields of light charged particles emitted during thermal neutron induced fission of 245Cm have been measured at the high flux reactor of the Institute Laue Langevin in Grenoble (France). The detection of the ternary particles was done using a Delta-E/E telescope, permitting a good separation of the ternary particles. In this way, the characteristics of the energy distribution (average energy and full width at half maximum) for 4He, 3H and 6He particles as well as their emission probabilities could be determined. For the emission probabilities per fission, the following values were obtained: LRA/B=(2.15+-0.05)E-3, 3H/B=(1.85+-0.10)E-4 and 6He/B=(4.95+-1.25)E-5.

  9. Fission Cross-section Measurements of (233)U, (245)Cm and (241,243)Am at CERN n_TOF Facility

    CERN Document Server

    Calviani, M; Andriamonje, S; Chiaveri, E; Vlachoudis, V; Colonna, N; Meaze, M H; Marrone, S; Tagliente, G; Terlizzi, R; Belloni, F; Abbondanno, U; Fujii, K; Milazzo, P M; Moreau, C; Aerts, G; Berthoumieux, E; Dridi, W; Gunsing, F; Pancin, J; Perrot, L; Plukis, A; Alvarez, H; Duran, I; Paradela, C; Alvarez-Velarde, F; Cano-Ott, D; Gonzalez-Romero, E; Guerrero, C; Martinez, T; Villamarin, D; Vicente, M C; Andrzejewski, J; Marganiec, J; Assimakopoulos, P; Karadimos, D; Karamanis, D; Papachristodoulou, C; Patronis, N; Audouin, L; David, S; Ferrant, L; Isaev, S; Stephan, C; Tassan-Got, L; Badurek, G; Jericha, E; Leeb, H; Oberhummer, H; Pigni, M T; Baumann, P; Kerveno, M; Lukic, S; Rudolf, G; Becvar, F; Krticka, M; Calvino, F; Capote, R; Carrillo De Albornoz, A; Marques, L; Salgado, J; Tavora, L; Vaz, P; Cennini, P; Dahlfors, M; Ferrari, A; Gramegna, F; Herrera-Martinez, A; Kadi, Y; Mastinu, P; Praena, J; Sarchiapone, L; Wendler, H; Chepel, V; Ferreira-Marques, R; Goncalves, I; Lindote, A; Lopes, I; Neves, F; Cortes, G; Poch, A; Pretel, C; Couture, A; Cox, J; O'brien, S; Wiescher, M; Dillman, I; Heil, M; Kappeler, F; Mosconi, M; Plag, R; Voss, F; Walter, S; Wisshak, K; Dolfini, R; Rubbia, C; Domingo-Pardo, C; Tain, J L; Eleftheriadis, C; Savvidis, I; Frais-Koelbl, H; Griesmayer, E; Furman, W; Konovalov, V; Goverdovski, A; Ketlerov, V; Haas, B; Haight, R; Reifarth, R; Igashira, M; Koehler, P; Kossionides, E; Lampoudis, C; Lozano, M; Quesada, J; Massimi, C; Vannini, G; Mengoni, A; Oshima, M; Papadopoulos, C; Vlastou, R; Pavlik, A; Pavlopoulos, P; Plompen, A; Rullhusen, P; Rauscher, T; Rosetti, M; Ventura, A

    2011-01-01

    Neutron-induced fission cross-sections of minor actinides have been measured using the n_TOF white neutron source at CERN, Geneva, as part of a large experimental program aiming at collecting new data relevant for nuclear astrophysics and for the design of advanced reactor systems. The measurements at n_TOF take advantage of the innovative features of the n_TOF facility, namely the wide energy range, high instantaneous neutron flux and good energy resolution. Final results on the fission cross-section of 233U, 245Cm and 243Am from thermal to 20 MeV are here reported, together with preliminary results for 241Am. The measurement have been performed with a dedicated Fast Ionization Chamber (FIC), a fission fragment detector with a very high efficiency, relative to the very well known cross-section of 235U, measured simultaneously with the same detector.

  10. Comments on: Effects of Wi-Fi (2.45 GH z Exposure on Apoptosis, Sperm Parameters and Testicular Histomorphometry in Rats: A Time Course Study

    Directory of Open Access Journals (Sweden)

    Seyed Mohammad Javad Mortazavi

    2016-02-01

    Full Text Available We read with great interest an article by Shokri et al. entitled "Effects of Wi-Fi (2.45 GH z exposure on apoptosis, sperm parameters and testicular histomorphometry in rats: a time course study" that is published in the latest issue of the Cell Journal (Vol.17, 2015: 322-331. In this article, Shokri et al. have presented their findings obtained in an experiment on an animal model. These researchers exposed rats to the 2.45 GHz radiation in a chamber with two Wi-Fi antennas on opposite walls of a box. The exposed animals in this study showed a decrease in sperm parameters. We have previously shown that exposure to electromagnetic fields generated by Wi-Fi routers or mobile phone jammers can adversely affect the sperm quality (1-3. The paper published by Shokri et al. is seriously flawed. The first major shortcoming of this paper is its exposure geometry. The authors stated that their exposure system was "a chamber (180 cm×80 cm×70 cm, designed for whole-body exposure of free-moving rats to a Wi-Fi signal. Two Wi-Fi antennas (NanoStation Loco M2, 2.45 GHz, 8.5 dBi, Ubiquiti Networks, Inc. USA were placed at the center of two sides of the chamber". It should be noted that in this case, the power density can be calculated using the below equation: S=P•G/4πR2 Where S=Power density P=Power input to antenna G=Antenna gain In this light, the geometry used in the study of Shokri et al. makes a very inhomogeneous distribution of power densities. The second shortcoming comes from this point that the authors claimed that their study was performed on a basis that could not affect the hormonal balance "A previous study applied a restrainer to fix space between antenna and rat. Since it was a stressful condition that could probably affect hormonal balance of animals, we tried to assess the effect of radiation on the free moving animals". However, these authors only had a control group and did not use a sham-exposed group to control the animals’s stress

  11. Dosimetry of a set-up for the exposure of newborn mice to 2.45-GHz WiFi frequencies

    International Nuclear Information System (INIS)

    This work describes the dosimetry of a two waveguide cell system designed to expose newborn mice to electromagnetic fields associated with wireless fidelity signals in the frequency band of 2.45 GHz. The dosimetric characterisation of the exposure system was performed both numerically and experimentally. Specific measures were adopted with regard to the increase in both weight and size of the biological target during the exposure period. The specific absorption rate (SAR, W kg-1) for 1 W of input power vs. weight curve was assessed. The curve evidenced an SAR pattern varying from -1 to > 6 W kg-1 during the first 5 weeks of the life of mice, with a peak resonance phenomenon at a weight around 5 g. This curve was used to set the appropriate level of input power during experimental sessions to expose the growing mice to a defined and constant dose. (authors)

  12. PRODUCTION OF S = 0, -1 RESONANT STATES IN K- p INTERACTIONS AT 2.45 GeV/c

    Energy Technology Data Exchange (ETDEWEB)

    Ross, Ronald R.; Friedman, Jerome H.; Siegel, Daniel M.; Flatte, Stanley; Alvarez, Luis W.; Barbaro-Galtieri, Angela; Button-Shafer, Janice; Dahl, Orin I.; Eberhard, Philippe; Humphrey, William E.; Kalbfleisch, George R.; Lindsey, James S.; Merrill, Deane W.; Murray, Joseph J.; Rittenberg, Alan; Shively, Frank T.; Smith, Gerald A.; Tripp, Robert D.

    1964-07-07

    About 70,000 pictures of 2.45-GeV/c K{sup -}-p interactions have been obtained in the present 72-inch hydrogen bubble-chamber experiment. Approximately 24,000 events of all topologies except 1-, 2-, and 3-prong events have been measured, and 50% have been remeasured. They report here on a study of the production of known resonances in the reactions: (1) K{sup -} + p {yields} {Lambda} + {pi}{sup +} + {pi}{sup -}; (2) K{sup -} + p {yields} {Lambda} + {pi}{sup +} + {pi}{sup 0} + {pi}{sup -}. The cross section for production and number of events in reactions (1) and (2) are given in Table I.

  13. Strategic Petroleum Reserve (SPR) oil storage cavern sulphur mines 2-4-5 certification tests and analysis. Part I: 1981 testing. Part II: 1982 testing

    Energy Technology Data Exchange (ETDEWEB)

    Beasley, R.R.

    1982-12-01

    Well leak tests and a cavern pressure were conducted in June through December 1981, and are described in Part I. The tests did not indicate conclusively that there was no leakage from the cavern, but the data indicate that cavern structural failure during oil storage is unlikely. The test results indicated that retesting and well workover were desirable prior to making a decision on the cavern use. Well leak tests were conducted in March through May 1982, and are described in Part II. The tests indicated that there was no significant leakage from wells 2 and 4 but that the leakage from wells 2A and 5 exceeded the DOE criterion. Because of the proximity of cavern 2-4-5 to the edge of the salt, this cavern should be considered for only one fill/withdrawal cycle prior to extensive reevaluation. 57 figures, 17 tables.

  14. Enhancing the photoluminescence of 1-(naphthalene-1-yl)-2,4,5-triphenyl-1H-imidazole anchored to superparamagnetic nanoparticles

    Science.gov (United States)

    Jayabharathi, J.; Karunakaran, C.; Kalaiarasi, V.; Ramanathan, P.; Prabhakaran, A.

    2015-01-01

    Synthesis and characterization of 1-(naphthalene-1-yl)-2,4,5-triphenyl-1H-imidazole has been carried out by spectral studies. The synthesized phosphated imidazole and phosphated imidazole bound magnetic nanoparticles were characterized using fourier-transform infrared spectroscopy (FT-IR), scanning electron microscopy (SEM), energy dispersive X-ray spectroscopy (EDS) and powder X-ray diffraction (XRD). The photophysical characteristics of the synthesized phosphated imidazole and phosphated imidazole bound magnetic nanoparticles were investigated by steady-state absorption and emission spectra as well as time resolved fluorometry. The intensities of absorption and emission maxima increase in the following order, phosphated imidazole bound Fe2O3 > phosphated imidazole > imidazole.

  15. Dielectric and magnetic properties of NiFe2O4 at 2.45 GHz and heating capacity for potential uses under microwaves

    International Nuclear Information System (INIS)

    This paper presents the dielectric and magnetic properties, measured at 2.45 GHz, of a new nickel ferrite, NiFe2O4, synthetized by plasma technology. These properties were measured by the small perturbation method in a resonant cavity, from 293 to 513 K. Using these values, the adiabatic heating of nanoparticles of NiFe2O4 under microwave irradiation was also modeled. The wave propagation equation (Maxwell's equation) coupled to the heat transfer in the solid was numerically solved. The influence of parameters such as the bed volume, its porosity, the microwave incident power or the microwave system geometry is discussed. This study demonstrates that NiFe2O4 nanoparticles can be rapidly heated up to at least 513 K under microwaves and can probably achieve higher temperatures according to the thermal insulation. The magnetic contribution to heating overcomes the dielectric one in the explored temperature range. Very efficient energy yield (>90%) can then be achieved when the magnetic field position is centered over the bed. - Highlights: • A new nickel ferrite, NiFe2O4, was synthetized by plasma technology. • Its dielectric and magnetic properties were measured at 2.45 GHz. • The adiabatic heating of nanoparticles of NiFe2O4 under microwave was modeled. • NiFe2O4 nanoparticles can be rapidly heated up to at least 513 K. • The magnetic contribution to heating overcomes the dielectric one from 293 K to 513 K

  16. Antiproteolytic activities of the blood plasma and cervical mucus in ewes after the hormonal treatment of ovaries and gamma irradiation (2,45 Gy) in anoestrus

    International Nuclear Information System (INIS)

    The antiproteolytic activities in blood plasma (BP) and cervical mucus (CM) of ewes after superovulatory stimulations in anoestrus are affected by gamma rays. The effects of a dose of 2.45 Gy on the trypsin inhibiting activities (TIA) (trypsin-model serine protease) in the BP and CM, on 17-beta-estradiol (E2), progesterone (P4) in BP, and the average numbers of ovulations were examined on 100 individuals of Merino breed ewes. Younger ewes (lambings) and older ewes (yearlings) responded differently to the irradiation and superovulatory stimulations, not only in dependence on age but also in dependence on the kind of stimulation (with the follicle stimulating hormone - FSH, with serum gonadotropin - SG). Changes in TIA of BP were statistically significant for yearling ewes (the P<0.001 increase caused by stimulation was eliminated by irradiation). Lambing ewes responded to stimulation by insignificant changes in the average TIA values of BP, the response by days, however, was different on day 13 and day 14. Similar changes were found in the low molecular weight TIA fraction of BP. The TIA values of CM after stimulation with FSH and SG changed insignificantly in yearling ewes; irradiation reduced (P<0.002) the TIA of CM only after stimulation with FSH. The amount of cervical mucus decreased following stimulation and irradiation, the muscle thickness and ovarian epithelium also decreased (differently in different parts). Although ovulations occurred in the stimulated and irradiated ewes, none remained pregnant after they were returned to the flock. The dose of 2.45 Gy following superovulatory stimulations caused nonfertile ovulation of the ewes. (author). 7 figs., 16 refs

  17. Dielectric and magnetic properties of NiFe{sub 2}O{sub 4} at 2.45 GHz and heating capacity for potential uses under microwaves

    Energy Technology Data Exchange (ETDEWEB)

    Polaert, Isabelle, E-mail: isabelle.polaert@insa-rouen.fr [LSPC (Laboratoire de Sécurité des Procédés Chimiques). Institut National des Sciences Appliquées INSA Rouen (France); Bastien, Samuel [Département de génie chimique et de génie biotechnologique, Université de Sherbrooke, Sherbrooke, Québec, Canada J1K 2R1 (Canada); Legras, Benoit [LSPC (Laboratoire de Sécurité des Procédés Chimiques). Institut National des Sciences Appliquées INSA Rouen (France); Département de génie chimique et de génie biotechnologique, Université de Sherbrooke, Sherbrooke, Québec, Canada J1K 2R1 (Canada); Estel, Lionel [LSPC (Laboratoire de Sécurité des Procédés Chimiques). Institut National des Sciences Appliquées INSA Rouen (France); Braidy, Nadi [Département de génie chimique et de génie biotechnologique, Université de Sherbrooke, Sherbrooke, Québec, Canada J1K 2R1 (Canada)

    2015-01-15

    This paper presents the dielectric and magnetic properties, measured at 2.45 GHz, of a new nickel ferrite, NiFe{sub 2}O{sub 4}, synthetized by plasma technology. These properties were measured by the small perturbation method in a resonant cavity, from 293 to 513 K. Using these values, the adiabatic heating of nanoparticles of NiFe{sub 2}O{sub 4} under microwave irradiation was also modeled. The wave propagation equation (Maxwell's equation) coupled to the heat transfer in the solid was numerically solved. The influence of parameters such as the bed volume, its porosity, the microwave incident power or the microwave system geometry is discussed. This study demonstrates that NiFe{sub 2}O{sub 4} nanoparticles can be rapidly heated up to at least 513 K under microwaves and can probably achieve higher temperatures according to the thermal insulation. The magnetic contribution to heating overcomes the dielectric one in the explored temperature range. Very efficient energy yield (>90%) can then be achieved when the magnetic field position is centered over the bed. - Highlights: • A new nickel ferrite, NiFe{sub 2}O{sub 4}, was synthetized by plasma technology. • Its dielectric and magnetic properties were measured at 2.45 GHz. • The adiabatic heating of nanoparticles of NiFe{sub 2}O{sub 4} under microwave was modeled. • NiFe{sub 2}O{sub 4} nanoparticles can be rapidly heated up to at least 513 K. • The magnetic contribution to heating overcomes the dielectric one from 293 K to 513 K.

  18. [Insertional mutation in the AZOBR_p60120 gene is accompanied by defects in the synthesis of lipopolysaccharide and calcofluor-binding polysaccharides in the bacterium Azospirillum brasilense Sp245].

    Science.gov (United States)

    Katsy, E I; Prilipov, A G

    2015-03-01

    In the bacterium Azospirillum brasilense Sp245, extracellular calcofluor-binding polysaccharides (Cal+ phenotype) and two types of lipopolysaccharides, LPSI and LPSII, were previously identified. These lipopolysaccharides share the same repeating O-polysaccharide unit but have different antigenic structures and different charges of their O-polysaccharides and/or core oligosaccharides. Several dozens of predicted genes involved in the biosynthesis of polysaccharides have been localized in the AZOBR_p6 plasmid of strain Sp245 (GenBank accession no. HE577333). In the present work, it was demonstrated that an artificial transposon Omegon-Km had inserted into the central region of the AZOBR_p60120 gene in the A. brasilense Sp245 LPSI- Cal- KM252 mutant. In A. brasilense strain Sp245, this plasmid gene encodes a putative glycosyltransferase containing conserved domains characteristic of the enzymes participating in the synthesis of O-polysaccharides and capsular polysaccharides (accession no. YP004987664). In mutant KM252, a respective predicted protein is expected to be completely inactivated. As a result of the analysis of the EcoRI fragment of the AZOBR_p6 plasmid, encompassing the AZOBR_p60120 gene and a number of other loci, novel data on the structure of AZOBR_p6 were obtained: an approximately 5-kb gap (GenBank accession no. KM189439) was closed in the nucleotide sequence of this plasmid. PMID:26027369

  19. Survey of potential markets for devices using Californium-252

    International Nuclear Information System (INIS)

    Potential applications for devices or systems containing 252Cf in the years from 1975 to 1980 are estimated. The estimated number of devices and associated business value were derived from a survey of 46 industrial, educational and governmental organizations conducted from Jan. to May, 1975. Applications for devices and systems based on 252Cf are expected to increase by a factor of 7 in the 6-y period from 1975 to 1980. The annual business value of 252Cf devices should increase from 1.5 million dollars in 1975 to 10.8 million dollars in 1980. The potential European market should be several times as large as the US market, based on actual sales of 252Cf, which have been two to four times greater in Europe than in the US

  20. The protective cell petrus for the production of californium 252

    International Nuclear Information System (INIS)

    The alpha, beta, gamma, neutron cell which is described in the present paper is devoted to the transplutonium element production and study. It is located at the CEN in Fontenay-aux-Roses (France). The 4 feet ordinary concrete shielding made of stacked blocs allows the manipulation of radioactive sources as high as 1000 curies of 1 MeV gamma rays and with a fast neutrons flux of 109 n.cm-2.s-1. The airtight alpha containment box is equipped with two transfer systems, one consists of a parallelepiped shaped airtight box located in a turntable, the other uses standard cylindrical containers made of polyethylene. The general equipment and the main setting up are also described. (authors)

  1. Californium-252 neutron activation facility at the Savannah River Laboratory

    International Nuclear Information System (INIS)

    A neutron irradiation facility has been established to develop new analytical methods and for the support of research programs. A major component of this facility is a 252Cf source which provides both fission spectrum and thermal neutrons. (U.S.)

  2. Californium-252 brachytherapy for anal and ano-rectal carcinoma

    International Nuclear Information System (INIS)

    Surgery has historically been the standard treatment for anal, ano-rectal and rectal carcinoma but is prone to local or regional failure. Over the past 15 years there has been increasing interest in and success with radiation therapy and combined chemoradiotherapy for treatment of anal and ano-rectal cancers. Cf-252 brachytherapy combined with external beam teletherapy has been investigated for anal and ano-rectal lesions at the Univ. of Kentucky with encouraging results

  3. Mobile equipment for neutron radiography using a californium-252 source

    International Nuclear Information System (INIS)

    The basic requirements for successful neutron radiography are first summarised and the use of 252Cf is placed in perspective by comparing its properties with those of sources based on the Be (γ, n) and Be (α, n) reactions which have a broadly similar range of applications. The more essential design features of mobile neutron radiography equipment are next examined in some detail, to show how the often conflicting requirements of optimum beam production and adequate shielding may be reconciled. An assembly with a maximum dimension around 1 m with a source of 1 mg is used as an example. The design data used are reproduced in graphical form to permit designs to be scaled to suit the source available and the requirements. The selection of suitable image recorders for 252Cf radiography is discussed with the conclusion that the gadolinium foil-film combinations are likely to remain the normal choice. Demonstration radiographs are presented with particular reference to the location of residual casting sand in gas-cooled turbine blades. Finally, it is suggested that other applications for mobile 252Cf-based neutron radiography equipment will be found in the ordnance, aero-space, chemical and nuclear fuel manufacturing industries. (author)

  4. Automated absolute activation analysis with californium-252 sources

    Energy Technology Data Exchange (ETDEWEB)

    MacMurdo, K.W.; Bowman, W.W.

    1978-09-01

    A 100-mg /sup 252/Cf neutron activation analysis facility is used routinely at the Savannah River Laboratory for multielement analysis of many solid and liquid samples. An absolute analysis technique converts counting data directly to elemental concentration without the use of classical comparative standards and flux monitors. With the totally automated pneumatic sample transfer system, cyclic irradiation-decay-count regimes can be pre-selected for up to 40 samples, and samples can be analyzed with the facility unattended. An automatic data control system starts and stops a high-resolution gamma-ray spectrometer and/or a delayed-neutron detector; the system also stores data and controls output modes. Gamma ray data are reduced by three main programs in the IBM 360/195 computer: the 4096-channel spectrum and pertinent experimental timing, counting, and sample data are stored on magnetic tape; the spectrum is then reduced to a list of significant photopeak energies, integrated areas, and their associated statistical errors; and the third program assigns gamma ray photopeaks to the appropriate neutron activation product(s) by comparing photopeak energies to tabulated gamma ray energies. Photopeak areas are then converted to elemental concentration by using experimental timing and sample data, calculated elemental neutron capture rates, absolute detector efficiencies, and absolute spectroscopic decay data. Calculational procedures have been developed so that fissile material can be analyzed by cyclic neutron activation and delayed-neutron counting procedures. These calculations are based on a 6 half-life group model of delayed neutron emission; calculations include corrections for delayed neutron interference from /sup 17/O. Detection sensitivities of < or = 400 ppB for natural uranium and 8 ppB (< or = 0.5 (nCi/g)) for /sup 239/Pu were demonstrated with 15-g samples at a throughput of up to 140 per day. Over 40 elements can be detected at the sub-ppM level.

  5. Californium-based neutron radiography for corrosion detection in aircraft

    International Nuclear Information System (INIS)

    In support of an overall program aimed at minimizing disassembly and reducing inspection time during aircraft maintenance, a series of projects has been carried out to determine the feasibility of applying neutron radiographic techniques to the nondestructive (NDT) inspection of aircraft and aircraft components. These investigations have clearly demonstrated the superiority of neutron radiography over all other NDT techniques in its ability to detect surface and subsurface corrosion in aircraft structure. This capability is particularly significant where the corrosion is hidden behind thick metallic structural members. The neutron radiographic technique has been applied successfully to detect corrosion in the wing tank of E-2C, C-130, and DC-9 aircraft; rear stabilators of F-4 and F-111 aircraft; aft spar, starboard and port wing, and rudder of the F-8; fuselage skin of the 727; rotary blades of AH-1 and SH-3 helicopters; rotary tail flaps of the UH-2 helicopter; and nose landing gear of A-7 aircraft

  6. Automated absolute activation analysis with californium-252 sources

    International Nuclear Information System (INIS)

    A 100-mg 252Cf neutron activation analysis facility is used routinely at the Savannah River Laboratory for multielement analysis of many solid and liquid samples. An absolute analysis technique converts counting data directly to elemental concentration without the use of classical comparative standards and flux monitors. With the totally automated pneumatic sample transfer system, cyclic irradiation-decay-count regimes can be pre-selected for up to 40 samples, and samples can be analyzed with the facility unattended. An automatic data control system starts and stops a high-resolution gamma-ray spectrometer and/or a delayed-neutron detector; the system also stores data and controls output modes. Gamma ray data are reduced by three main programs in the IBM 360/195 computer: the 4096-channel spectrum and pertinent experimental timing, counting, and sample data are stored on magnetic tape; the spectrum is then reduced to a list of significant photopeak energies, integrated areas, and their associated statistical errors; and the third program assigns gamma ray photopeaks to the appropriate neutron activation product(s) by comparing photopeak energies to tabulated gamma ray energies. Photopeak areas are then converted to elemental concentration by using experimental timing and sample data, calculated elemental neutron capture rates, absolute detector efficiencies, and absolute spectroscopic decay data. Calculational procedures have been developed so that fissile material can be analyzed by cyclic neutron activation and delayed-neutron counting procedures. These calculations are based on a 6 half-life group model of delayed neutron emission; calculations include corrections for delayed neutron interference from 17O. Detection sensitivities of 239Pu were demonstrated with 15-g samples at a throughput of up to 140 per day. Over 40 elements can be detected at the sub-ppM level

  7. Observation of 2.45 MeV neutrons correlated with natural atmospheric lightning discharges by Lead-Free Gulmarg Neutron Monitor

    Science.gov (United States)

    Ishtiaq, P. M.; Mufti, S.; Darzi, M. A.; Mir, T. A.; Shah, G. N.

    2016-01-01

    The first experimental evidence of detecting the neutrons correlated with the natural atmospheric lightning discharges (NALD) was obtained with Lead-Free Gulmarg Neutron Monitor (LFGNM) operating at High Altitude Research Laboratory, Gulmarg, Kashmir, India, and was reported in the year 1985. The neutron observations still continue with LFGNM. However, the current configuration of LFGNM is the upgraded version of the system used earlier to record neutron bursts (in the recording period of 320 μs in four successive electronic gates of 80 μs each) supposedly originating from an NALD. In the current system the neutron recording time period/interval has been extended to 1260 μs with 63 successive gates of 20 μs each. The system also simultaneously records the differential times—maximum up to 14—between the consecutive strokes of a multistroke lightning flash. The distance between an NALD channel and LFGNM setup is determined empirically by making use of the time delay (td)/time of flight (TOF) measurement of the first detected neutron subsequent to the sensing of the electrostatic field variation caused by the initiation of an NALD in the ambient atmosphere of the LFGNM setup. Assuming a priori incident energy as 2.45 MeV of the detected neutrons supposedly generated due to the fusion of deuterium ions in the lightning discharge channel leads to quantifying the neutron emission flux if the NALD channel distance with respect to the LFGNM setup is established. In this paper we discuss the experiment and the time profiles of several of a large number of the major neutron burst events recorded with LFGNM in association with NALDs. Moreover, a rare and an extraordinary neutron burst event, in terms of its associated "td/TOF" of first detected neutron after triggering, recorded by this system is specifically discussed. In this event, the recorded TOF of 14 μs of the escaping neutron detected by the system immediately after getting triggered by the NALD that struck a

  8. Recoil-range studies of heavy products of multinucleon transfer from /sup 18/O to /sup 245/Cm and /sup 249/Cf

    Energy Technology Data Exchange (ETDEWEB)

    McFarland, R.M.

    1982-09-01

    Recoil range distributions were measured for alpha and spontaneous fission activities made in the bombardment of /sup 245/Cm and /sup 249/Cf with /sup 18/O from 6.20 MeV/nucleon down to the interaction barrier. The shape of the distributions indicates tht transfers of up to four protons take place via a combination of quasi-elastic (QET) and deep inelastic (DIT) mechanisms, rather than complete fusion-de-excitation (CF) or massive transfer (MT). Angular distributions constructed from recoil range distributions, assuming QET/DIT, indicate that the QET component contributes more significantly to the heavy product residue cross section than the DIT, even though primary cross sections are expected to be higher for DIT than for QET. This may be explained qualitatively as a result of the high excitation energies associated with DIT; the very negative Q/sub gg/ of projectile stripping for these systems combined with the lower expected optimal Q/sub rxn/ of QET compared to DIT can give QET products comparatively low excitation.

  9. FDTD analysis of temperature elevation in the lens of human and rabbit models due to near-field and far-field exposures at 2.45 GHz.

    Science.gov (United States)

    Oizumi, Takuya; Laakso, Ilkka; Hirata, Akimasa; Fujiwara, Osamu; Watanabe, Soichi; Taki, Masao; Kojima, Masami; Sasaki, Hiroshi; Sasaki, Kazuyuki

    2013-07-01

    The eye is said to be one of the most sensitive organs to microwave heating. According to previous studies, the possibility of microwave-induced cataract formation has been experimentally investigated in rabbit and monkey eyes, but not for the human eye due to ethical reasons. In the present study, the temperature elevation in the lens, the skin around the eye and the core temperature of numerical human and rabbit models for far-field and near-field exposures at 2.45 GHz are investigated. The temperature elevations in the human and rabbit models were compared with the threshold temperatures for inducing cataracts, thermal pain in the skin and reversible health effects such as heat exhaustion or heat stroke. For plane-wave exposure, the core temperature elevation is shown to be essential both in the human and in the rabbit models as suggested in the international guidelines and standards. For localised exposure of the human eye, the temperature elevation of the skin was essential, and the lens temperature did not reach its threshold for thermal pain. On the other hand, the lens temperature elevation was found to be dominant for the rabbit eye. PMID:23390146

  10. Origin of the 2.45 eV luminescence band observed in ZnO epitaxial layers grown on c-plane sapphire by chemical vapour deposition

    International Nuclear Information System (INIS)

    Zinc oxide epitaxial layers have been grown on c-plane sapphire substrates by the chemical vapour deposition (CVD) technique. A structural study shows (0001)-oriented films with good crystalline quality. The temperature and excitation power dependence of the photoluminescence (PL) characteristics of these layers is studied as a function of various growth parameters, such as the growth temperature, oxygen flow rate and Zn flux, which suggest that the origin of the broad visible luminescence (VL), which peaks at 2.45 eV, is the transition between the conduction band and the Zn vacancy acceptor states. A bound excitonic transition observed at 3.32 eV in low temperature PL has been identified as an exciton bound to the neutral Zn vacancy. Our study also reveals the involvement of two activation processes in the dynamics of VL, which has been explained in terms of the fluctuation of the capture barrier height for the holes trapped in Zn vacancy acceptors. The fluctuation, which might be a result of the inhomogeneous distribution of Zn vacancies, is found to be associated with an average height of 7 and 90 meV, respectively, for the local and global maxima. (paper)

  11. FDTD analysis of temperature elevation in the lens of human and rabbit models due to near-field and far-field exposures at 2.45 GHz

    International Nuclear Information System (INIS)

    The eye is said to be one of the most sensitive organs to microwave heating. According to previous studies, the possibility of microwave-induced cataract formation has been experimentally investigated in rabbit and monkey eyes, but not for the human eye due to ethical reasons. In the present study, the temperature elevation in the lens, the skin around the eye and the core temperature of numerical human and rabbit models for far-field and near-field exposures at 2.45 GHz are investigated. The temperature elevations in the human and rabbit models were compared with the threshold temperatures for inducing cataracts, thermal pain in the skin and reversible health effects such as heat exhaustion or heat stroke. For plane-wave exposure, the core temperature elevation is shown to be essential both in the human and in the rabbit models as suggested in the international guidelines and standards. For localised exposure of the human eye, the temperature elevation of the skin was essential, and the lens temperature did not reach its threshold for thermal pain. On the other hand, the lens temperature elevation was found to be dominant for the rabbit eye. (authors)

  12. Effects of long-term pre- and post-natal exposure to 2.45 GHz wireless devices on developing male rat kidney.

    Science.gov (United States)

    Kuybulu, Ayça Esra; Öktem, Faruk; Çiriş, İbrahim Metin; Sutcu, Recep; Örmeci, Ahmet Rıfat; Çömlekçi, Selçuk; Uz, Efkan

    2016-05-01

    Purpose The aim of the present study was to investigate oxidative stress and apoptosis in kidney tissues of male Wistar rats that pre- and postnatally exposed to wireless electromagnetic field (EMF) with an internet frequency of 2.45 GHz for a long time. Methods The study was conducted in three groups of rats which were pre-natal, post-natal. and sham exposed groups. Oxidative stress markers and histological evaluation of kidney tissues were studied. Results Renal tissue malondialdehyde (MDA) and total oxidant (TOS) levels of pre-natal group were high and total antioxidant (TAS) and superoxide dismutase (SOD) levels were low. Spot urine NAG/creatinine ratio was significantly higher in pre- and post-natal groups (p Bcl-2 in cortical and medullar areas of pre-natal group (p values, 0.000, 0.002, 0.000, respectively) when compared with sham group. Bcl2/Bax staining intensity ratios of medullar and cortical area was higher in pre-natal group than sham group (p = 0.018, p = 0.011). Conclusion Based on this study, it is thought that chronic pre- and post-natal period exposure to wireless internet frequency of EMF may cause chronic kidney damages; staying away from EMF source in especially pregnancy and early childhood period may reduce negative effects of exposure on kidney. PMID:26905323

  13. Donor-acceptor binding interaction of 1-(naphthalene-1-yl)-2,4,5-triphenyl-1H-imidazole with semiconductor nanomaterials

    Science.gov (United States)

    Jayabharathi, J.; Karunakaran, C.; Kalaiarasi, V.; Ramanathan, P.

    2015-02-01

    The dynamics of photoinduced electron injection from 1-(naphthalene-1-yl)-2,4,5-triphenyl-1H-imidazole (NTI) to pristine ZnO, Mn-doped TiO2 and BaTiO3 nanoparticles have been studied by absorption, fluorescence and lifetime spectroscopic methods. Both the absorption and fluorescence results suggest the association between the nanoparticles and NTI. The calculated free energy change (ΔGet) confirms the electron injection from NTI to nano semiconductors. The critical energy transfer distance between NTI and the nanoparticles have been deduced. The emission of NTI is enhanced by pristine ZnO and quenched by Mn-doped TiO2 and BaTiO3 nanoparticles which are likely due to change of LUMO and HOMO levels of NTI on its association with nano semiconductors. The strong adsorption of the NTI on the surface of ZnO nanocrystals is likely due to the chemical affinity of the nitrogen atom of the NTI to the zinc ion on the surface of nanocrystals. Electron injection from photoexcited NTI to the CB(S∗ → S+ + e-CB) is likely to be the reason for the fluorescence enhancement.

  14. Synthesis, crystal structure investigation, DFT studies and DPPH radical scavenging activity of 1-(furan-2-ylmethyl)-2,4,5-triphenyl-1H-imidazole derivatives

    Science.gov (United States)

    Rajaraman, D.; Sundararajan, G.; Rajkumar, R.; Bharanidharan, S.; Krishnasamy, K.

    2016-03-01

    A new series of 1-(furan-2ylmethyl)-2,4,5-triphenyl-1H-imidazole derivatives are conveniently synthesized and characterized by IR, 1H NMR and 13C NMR spectral techniques. The compound 5a also characterized by HSQC correlation spectra. All the newly synthesized compounds were evaluated for their antioxidant activities with DPPH radical scavenging activity. The structure of 5e was also confirmed by single crystal XRD analysis and optimized bond parameters are calculated by density functional theory (DFT) method at B3LYP/6-31G (d, p) level of theory. The optimized geometrical parameters obtained by DFT calculation are in good agreement with single crystal XRD data. The experimentally observed FT-IR and FT-Raman bands were assigned to different normal modes of the molecule. The stability and charge delocalization of the molecule were also studied by natural bond orbital (NBO) analysis. The HOMO-LUMO energies describe the charge transfer takes place within the molecule. Molecular electrostatic potential has been analyzed. The reported 5e molecule used as a potential NLO material since it has high μβ0 value.

  15. Structural and Catalytic Differences between Two FADH2-Dependent Monooxygenases: 2,4,5-TCP 4-Monooxygenase (TftD) from Burkholderia cepacia AC1100 and 2,4,6-TCP 4-Monooxygenase (TcpA) from Cupriavidus necator JMP134

    OpenAIRE

    ChulHee Kang; Luying Xun; Andrew Popchock; Arun Kumar Subramanian; Webb, Brian N.; Robert P. Hayes; Mark Nissen

    2012-01-01

    2,4,5-TCP 4-monooxygenase (TftD) and 2,4,6-TCP 4-monooxygenase (TcpA) have been discovered in the biodegradation of 2,4,5-trichlorophenol (2,4,5-TCP) and 2,4,6-trichlorophenol (2,4,6-TCP). TcpA and TftD belong to the reduced flavin adenine dinucleotide (FADH2)-dependent monooxygenases and both use 2,4,6-TCP as a substrate; however, the two enzymes produce different end products. TftD catalyzes a typical monooxygenase reaction, while TcpA catalyzes a typical monooxygenas...

  16. Comparative Analysis of the Effects of Severe Plastic Deformation and Thermomechanical Training on the Functional Stability of Ti50.5Ni24.5Pd25 High-Temperature Shape Memory Alloy

    Science.gov (United States)

    Atli, K. C.; Karaman, I.; Noebe, R. D.; Maier, H. J.

    2010-01-01

    We compare the effectiveness of a conventional thermomechanical training procedure and severe plastic deformation via equal channel angular extrusion to achieve improved functional stability in a Ti50.5Ni24.5Pd25 high-temperature shape memory alloy. Thermomechanical testing indicates that both methods result in enhanced shape memory characteristics, such as reduced irrecoverable strain and thermal hysteresis. The mechanisms responsible for the improvements are discussed in light of microstructural findings from transmission electron microscopy.

  17. Erratum to "Solar Sources and Geospace Consequences of Interplanetary Magnetic Clouds Observed During Solar Cycle 23-Paper 1" [J. Atmos. Sol.-Terr. Phys. 70(2-4) (2008) 245-253

    Science.gov (United States)

    Gopalswamy, N.; Akiyama, S.; Yashiro, S.; Michalek, G.; Lepping, R. P.

    2009-01-01

    One of the figures (Fig. 4) in "Solar sources and geospace consequences of interplanetary magnetic Clouds observed during solar cycle 23 -- Paper 1" by Gopalswamy et al. (2008, JASTP, Vol. 70, Issues 2-4, February 2008, pp. 245-253) is incorrect because of a software error in t he routine that was used to make the plot. The source positions of various magnetic cloud (MC) types are therefore not plotted correctly.

  18. μ-ICC2.45在线微波浓度测量仪服务于沼气加工和污水污泥的处理%The Application of μ-ICC 2.45 On-line Microwave Concentration Measurement in the Processing of Biogas and Sewage Sludge

    Institute of Scientific and Technical Information of China (English)

    赵剑峰; K.-H.Theisen; M.Deutsch

    2012-01-01

    This article describes that the process of biogas and treatment of sewage,sludge was detected by the instrument of proMtec on-line microware concentration measurement.With its novel measurement means and unique structural design,the instrument was used to measure the on-line TS-content of materials which entering and discharging from the fermentation tank,this method could achieve the suitable material balance and maximal methane profits.The method also plays an important monitoring role in the whole process and would save energy and reduce emission.For comparison with the conventional measurement,μ-ICC 2.45 measuring system has more advantages,which will not be affected on the coating and storage,and the transmitter can be installed directly on the large pipeline or tank.%本文介绍proMtec在线实时微波浓度测量仪在沼气生产中对填料的浓度、污水污泥处理过程中对污泥浓度密度进行测量的应用。以其新颖的测量手段和独特的结构设计,对进入发酵罐物料和其卸料的在线TS-含量进行监控,以达到最理想的物料平衡,提高细菌的活性,使沼气收益最大化。在线式实时监控,有利于对生产过程的即时掌控,帮助实现节能减排。相比较传统测量方法,μ-ICC 2.45测量设备探头不受结垢、堵塞的影响,可直接安装于大口径的管路或是箱体上。

  19. CW/Pulsed H{sup −} ion beam generation with PKU Cs-free 2.45 GHz microwave driven ion source

    Energy Technology Data Exchange (ETDEWEB)

    Peng, S. X., E-mail: sxpeng@pku.edu.cn; Ren, H. T.; Xu, Y.; Zhang, T.; Zhang, J. F.; Zhao, J.; Guo, Z. Y. [State Key Laboratory of Nuclear Physics and Technology and Institute of Heavy Ion Physics, School of Physics, Peking University, Beijing 100871, People' s Republic of China (China); Zhang, A. L. [University of Chinese Academy of Sciences, Beijing 100049, People' s Republic of China (China); Chen, J. E. [State Key Laboratory of Nuclear Physics and Technology and Institute of Heavy Ion Physics, School of Physics, Peking University, Beijing 100871, People' s Republic of China (China); University of Chinese Academy of Sciences, Beijing 100049, People' s Republic of China (China)

    2015-04-08

    Circular accelerators used for positron emission tomography (PET, i.e. accelerator used for make radio isotopes) need several mA of CW H- ion beam for their routine operation. Other facilities, like Space Radio-Environment Simulate Assembly (SPRESA), require less than 10 mA pulsed mode H{sup −} beam. Caesium free negative hydrogen ion source is a good choice for those facilities because of its compact structure, easy operation and low cost. Up to now, there is no H{sup −} source able to produce very intense H{sup −} beams with important variation of the duty factor{sup [1]}. Recently, a new version of 2.45 GHz microwave H{sup −} ion source was designed at PKU, based on lessons learnt from the previous one. This non cesiated source is very compact thanks to its permanent magnet configuration. Special attention was paid on the design of the discharge chamber structure, electron dumping and extraction system. Source test to produce H{sup −} ion beams in pulsed and CW mode was carried out on PKU ion source test bench. In CW mode, a 10.8 mA/30keV H{sup −} beam with rms emittance about 0.16 π·mm·mrad has been obtained with only 500 W rf power. The power efficiency reaches 21 mA/kW. In pulsed mode with duty factor of 10% (100Hz/1ms), this compact source can easily deliver 20 mA H{sup −} ion beam at 35 keV with rms emittance about 0.2 π·mm·mrad when RF power is set at 2.2 kW (peak power). Several hour successive running operation in both modes and totaling more than 200 hours proves its high quality. The outside dimension of this new H{sup −} source body is ϕ116 mm × 124 mm, and the entire H{sup −} source infrastructure, including rf matching section, plasma chamber and extraction system, is ϕ310 × 180 mm. The high voltage region is limited with in a ϕ310 mm × 230 mm diagram. Details are given in this paper.

  20. Composition and syngeneity of molecular fossils from the 2.78 to 2.45 billion-year-old Mount Bruce Supergroup, Pilbara Craton, Western Australia

    Science.gov (United States)

    Brocks, Jochen J.; Buick, Roger; Logan, Graham A.; Summons, Roger E.

    2003-11-01

    Shales of very low metamorphic grade from the 2.78 to 2.45 billion-year-old (Ga) Mount Bruce Supergroup, Pilbara Craton, Western Australia, were analyzed for solvent extractable hydrocarbons. Samples were collected from ten drill cores and two mines in a sampling area centered in the Hamersley Basin near Wittenoom and ranging 200 km to the southeast, 100 km to the southwest and 70 km to the northwest. Almost all analyzed kerogenous sedimentary rocks yielded solvent extractable organic matter. Concentrations of total saturated hydrocarbons were commonly in the range of 1 to 20 ppm (μg/g rock) but reached maximum values of 1000 ppm. The abundance of aromatic hydrocarbons was ˜1 to 30 ppm. Analysis of the extracts by gas chromatography-mass spectrometry (GC-MS) and GC-MS metastable reaction monitoring (MRM) revealed the presence of n-alkanes, mid- and end-branched monomethylalkanes, ω-cyclohexylalkanes, acyclic isoprenoids, diamondoids, tri- to pentacyclic terpanes, steranes, aromatic steroids and polyaromatic hydrocarbons. Neither plant biomarkers nor hydrocarbon distributions indicative of Phanerozoic contamination were detected. The host kerogens of the hydrocarbons were depleted in 13C by 2 to 21‰ relative to n-alkanes, a pattern typical of, although more extreme than, other Precambrian samples. Acyclic isoprenoids showed carbon isotopic depletion relative to n-alkanes and concentrations of 2α-methylhopanes were relatively high, features rarely observed in the Phanerozoic but characteristic of many other Precambrian bitumens. Molecular parameters, including sterane and hopane ratios at their apparent thermal maxima, condensate-like alkane profiles, high mono- and triaromatic steroid maturity parameters, high methyladamantane and methyldiamantane indices and high methylphenanthrene maturity ratios, indicate thermal maturities in the wet-gas generation zone. Additionally, extracts from shales associated with iron ore deposits at Tom Price and Newman have

  1. Dichloridobis(methanol-κO[cis-(±-2,4,5-tris(pyridin-2-yl-2-imidazoline-κ3N2,N3,N4]ytterbium(III chloride

    Directory of Open Access Journals (Sweden)

    Alberto Baez-Castro

    2012-06-01

    Full Text Available In the crystal structure of the title complex, [YbCl2(C18H15N5(CH3OH2]Cl, the pseudo-pentagonal–bipyramidal coordination geometry of the YbIII cation is composed of three N atoms from one cis-(±-2,4,5-tris(pyridin-2-ylimidazoline (HL ligand, two O atoms from two methanol molecules and two Cl− anions. Chains are formed along [010] through N—H...Cl, O—H...Cl and O—H...N hydrogen bonds.

  2. Bis(tetra­methyl­amonium) bis­(2,4,5-carboxy­benzoate)–benzene-1,2,4,5-tetra­carboxylic acid (1/1)

    OpenAIRE

    Girginova, Penka I.; Tito Trindade; João Rocha; Jacek Klinowski; Almeida Paz, Filipe A.; Luís Cunha-Silva

    2007-01-01

    The asymmetric unit of the title compound, 2C4H12N+·2C10H5O8−·C10H6O8, consists of a tetramethylamonium cation, an anion derived from the singly deprotonated pyromellitic acid anion, 2,4,5-carboxybenzoate (H3bta−), and one-half of a benzene-1,2,4,5-tetracarboxylic acid (H4bta) molecule, which has the centroid of the aromatic ring positioned at a crystallographic centre of inversion. The H4bta and H3bta− residues are involved in an extensive intermolecular O—H...

  3. The effect of Fe addition on the transformation temperatures, lattice parameter and magnetization saturation of Ni52.5-XMn23Ga24.5FeX ferromagnetic shape memory alloy

    International Nuclear Information System (INIS)

    The effect of Fe addition on martensitic transformation temperatures, Curie temperature (TC), lattice parameters and magnetization saturation was studied in Ni52.5-XMn23Ga24.5FeX alloys fabricated by arc-melting furnace. The characterizations were performed by DSC, X-ray diffraction and magnetometry. Fe replacing Ni sites leads to an increment on lattice parameter and on the magnetization saturation of the austenitic phase at room temperature. Also, TC increases from 370 K up to 400 K and remains constant for X ≥ 3.1 at.% Fe. In contrast, martensitic transformation temperatures decrease with Fe substituting Ni

  4. Effect of herbicide concentration and organic and inorganic nutrient amendment on the mineralization of mecoprop, 2,4-D and 2,4,5-T in soil and aquifer samples.

    Science.gov (United States)

    de Lipthay, Julia R; Sørensen, Sebastian R; Aamand, Jens

    2007-07-01

    The impact of the herbicide concentration (0.10-10,000 microg kg(-1)) and addition of organic and inorganic nutrients on mecoprop, 2,4-D and 2,4,5-T mineralization in aquifer and soil samples was studied in laboratory experiments. Generally, 2,4-D was most rapidly mineralized followed by mecoprop and 2,4,5-T. A shift from non-growth to growth-linked mineralization kinetics was observed in aquifer sediment with 2,4-D concentrations >0.10 microg kg(-1) and mecoprop concentrations >10.0 microg kg(-1). The shift was apparent at higher herbicide concentrations in soil coinciding with a lower bioavailable fraction and a higher herbicide sorption to soil. Herbicide addition did not affect the bacterial density, although 2,4-D and mecoprop applied at 10,000 microg kg(-1) stimulated growth of specific degraders. Generally, nutrient amendments did not stimulate mineralization at the lowest herbicide concentrations. In contrast, the mineralization rate of higher herbicide concentrations was significantly stimulated by the amendment of inorganic nutrients. PMID:17254678

  5. Low Noise Amplifier for 2.45 GHz Frequency Band at 0.18 μm CMOS Technology for IEEE Standard 802.11 b/g WLAN

    Directory of Open Access Journals (Sweden)

    Viranjay M. Srivastava

    2012-08-01

    Full Text Available This paper presents the design of low noise amplifier (LNA at 2.45 GHz and integrated at 0.18 µm RF CMOS process technology. This type of LNA at 2.45 GHz is use in the Bluetooth receiver. The proposed method is useful to optimize noise performance and power gain while maintaining good input and output matching. The amplifier is designed to be used as first stage of a receiver for wireless communication. The main aim of designer is to achieve low noise figure with improved gain with the help of CMOS technology by using single stage n-MOS amplifier. The simulation results show a forward gain of 14.0 dB, a noise-figure of 0.5 dB and stability factor is approximate unity, in which the circuit operates at 14.2 mA drain current with supply voltage of 3.5 V and biasing voltage of 1.5 V.

  6. Effect of herbicide concentration and organic and inorganic nutrient amendment on the mineralization of mecoprop, 2,4-D and 2,4,5-T in soil and aquifer samples

    International Nuclear Information System (INIS)

    The impact of the herbicide concentration (0.10-10 000 μg kg-1) and addition of organic and inorganic nutrients on mecoprop, 2,4-D and 2,4,5-T mineralization in aquifer and soil samples was studied in laboratory experiments. Generally, 2,4-D was most rapidly mineralized followed by mecoprop and 2,4,5-T. A shift from non-growth to growth-linked mineralization kinetics was observed in aquifer sediment with 2,4-D concentrations >0.10 μg kg-1 and mecoprop concentrations >10.0 μg kg-1. The shift was apparent at higher herbicide concentrations in soil coinciding with a lower bioavailable fraction and a higher herbicide sorption to soil. Herbicide addition did not affect the bacterial density, although 2,4-D and mecoprop applied at 10 000 μg kg-1 stimulated growth of specific degraders. Generally, nutrient amendments did not stimulate mineralization at the lowest herbicide concentrations. In contrast, the mineralization rate of higher herbicide concentrations was significantly stimulated by the amendment of inorganic nutrients. - Natural attenuation and biostimulation potential of a wide concentration range of three phenoxyalkanoic acid herbicides were evaluated in agricultural soil and aquifer sediment

  7. Measurement of the Neutron Capture Cross Sections of $^{233}$U, $^{237}$Np, $^{240,242}$Pu, $^{241,243}$Am and $^{245}$Cm with a Total Absorption Calorimeter at n_TOF

    CERN Multimedia

    Beer, H; Wiescher, M; Cox, J; Rapp, W; Embid, M; Dababneh, S

    2002-01-01

    Accurate and reliable neutron capture cross section data for actinides are necessary for the poper design, safety regulation and precise performance assessment of transmutation devices such as Fast Critical Reactors or Accelerator Driven Systems (ADS). The goal of this proposal is the measurement of the neutron capture cross sections of $^{233}$U, $^{237}$Np, $^{240,242}$Pu, $^{241,243}$Am and $^{245}$Cm at n_TOF with an accuracy of 5~\\%. $^{233}$U plays an essential role in the Th fuel cycle, which has been proposed as a safer and cleaner alternative to the U fuel cycle. The capture cross sections of $^{237}$Np,$^{240,242}$Pu, $^{241,243}$Am and $^{245}$Cm play a key role in the design and optimization of a strategy for the Nuclear Waste Transmutation. A high accuracy can be achieved at n_TOF in such measurements due to a combination of features unique in the world: high instantaneous neutron fluence and excellent energy resolution of the facility, innovative Data Acquisition System based on flash ADCs and t...

  8. Estudo das malformações congênitas do aparelho urinário: análise de 6.245 necropsias pediátricas Study of urinary tract congenital malformations: analysis of 6,245 pediatric autopsies

    Directory of Open Access Journals (Sweden)

    Lucia de Noronha

    2003-09-01

    Full Text Available O presente estudo tece investigações sobre os aspectos epidemiológicos de malformações do aparelho urinário de uma população de natimortos, neomortos, lactentes, pré-escolares e escolares de uma amostra representativa da população de Curitiba e região metropolitana - análise de 40 anos de necropsias na Unidade de Patologia Pediátrica e Perinatal (UPPP do Serviço de Anatomia Patológica do Hospital de Clínicas de Curitiba da Universidade Federal do Paraná (UFPR. Variáveis como sexo, idade, faixa etária e causas de morte são correlacionadas, estratificando a amostra em grupos específicos de indivíduos, apontando anormalidades epidemiológicas, doenças raras e a relação das doenças com o processo de morte. Foram encontrados 182 casos com malformações do aparelho urinário, correspondendo a 2,9% do número de necropsias avaliadas. Não foram observadas diferenças entre os sexos, e houve maior prevalência de recém-natos com tais anormalidades. A classe mais prevalente foi a de malformações renais e de trato urinário superior, com 150 casos.The presented study investigates epidemiologic aspects regarding congenital malformations of the urinary tract in a representative sample of stillborns, newborns, infants and children from Curitiba, analising autopsies from the Pediatric and Perinatal Pathology Unit (Service of the Clinical Hospital - Curitiba, Paraná in a 40-year period. Sex, age groups and death causes are correlated, dividing the cases in specific groups of study, revealing epidemiologic abnormalities, rare diseases and diseases related to the death process. Out of 6,245 autopsies, 182 cases (2.9% presented urinary tract congenital malformations. There was no difference between sex, and the group of newborns was the most prevalent. The group of malformations of the kidney and upper urinary tract contributed with 150 abnormalities.

  9. Tracking Down the Paleoproterozoic Glaciations 2.5-2.2 Ga Using Coeval Subglacial Meteoric-Hydrothermal Systems and Estimates of δ18O Value in Seawater at ~2.45Ga

    Science.gov (United States)

    Zakharov, D. O.; Bindeman, I. N.; Serebryakov, N. S.; Kulikov, V. S.

    2014-12-01

    We continue investigation of the world's lowest δ18O and δD (down to -27.3‰ and -235‰, respectively) rocks associated with high-Mg and high-Fe intrusions found within a 450-km-long zone of metamorphic rocks in the Belomorian Belt (Baltic shield, Russia). We suggest that extreme depletion occurred during premetamorphic high temperature interaction between shallow mafic intrusions and Paleoproterozoic glacial waters. Heat associated with intrusion of Paleoproterozoic mafic dikes allowed for circulation of glacial water in mafic dikes' exterior causing isotopic exchange between ultra-low-δ18O water and host rocks. Based on correlation of Paleoproterozoic glaciogenic deposits scattered worldwide, it was inferred that that global glaciations occurred three times between 2.45 to 2.20 Ga, independently or systematically coincident with the rise of atmospheric oxygen. However, the exact ages of glaciations remain uncertain. Dating igneous cores within zircon grains from the intrusions that interacted with subglacial meteoric waters enables us to develop a new approach to determine the age of δ18O depletion and thus, glacial events. Recently published geochronology data for Fennoscandia indicates that there were at least three episodes of compositionally distinct mafic magmatism spanning between 2.5 and 2.2 Ga which may help us to precisely resolve the glaciation episodes. Initial efforts to date the Paleoproterozoic mafic intrusions in conjunction with newly published geochronology data suggest that the low-δ18O anomalies discovered at different localities were probably produced during different glacial episodes. We also present new data based on a study of the ~2.45 Ga Vetreny Belt rift, Karelia craton, where unmetamorphosed pillow basalts contain abundant genetically-related hydrothermal quartz-epidote veins (+4.7‰ and -0.44‰, for the two minerals respectively) that formed at temperature of ~350°C. Since hydrothermal minerals likely precipitated from

  10. Charged pion form factor between $Q^2$=0.60 and 2.45 GeV$^2$. I. Measurements of the cross section for the ${^1}$H($e,e'\\pi^+$)$n$ reaction.

    Energy Technology Data Exchange (ETDEWEB)

    Blok, Henk; Horn, Tanja; Huber, Garth; Beise, Elizabeth; Gaskell, David; Mack, David; Tadevosyan, Vardan; Volmer, Jochen; Abbott, David; Aniol, Konrad; Anklin, Heinz; Armstrong, Christopher; Arrington, John; Assamagan, Ketevi; Avery, Steven; Baker, O; Barrett, Robert; Bochna, Christopher; Boeglin, Werner; Brash, Edward; Breuer, Herbert; Chang, C; Chang, C C; Chant, Nicholas; Christy, Michael; Dunne, James; Eden, Thomas; Ent, Rolf; Fenker, Howard; Gibson, Edward; Gilman, Ronald; Gustafsson, Kenneth; Hinton, Wendy; Holt, Roy; Jackson, Harold; uk Jin, Seong; Jones, Mark; Keppel, Cynthia; Kim, pyunghun; Kim, Wooyoung; King, Paul; Klein, Andreas; Koltenuk, Douglas; Kovaltchouk, Vitali; Liang, Meihua; Liu, Jinghua; Lolos, George; Lung, Allison; Margaziotis, Demetrius; Markowitz, Pete; Matsumura, Akihiko; McKee, David; Meekins, David; Mitchell, Joseph; Miyoshi, Toshinobu; Mkrtchyan, Hamlet; Mueller, Robert; Niculescu, Gabriel; Niculescu, Maria-Ioana; Okayasu, Yuichi; Pentchev, Lubomir; Perdrisat, Charles; Pitz, David; Potterveld, David; Punjabi, Vina; Qin, Liming; Reimer, Paul; Reinhold, Joerg; Roche, Julie; Roos, Philip; Sarty, Adam; Shin, Ilkyoung; Smith, Gregory; Stepanyan, Stepan; Tang, Liguang; Tvaskis, Vladas; van der Meer, Rob; Vansyoc, Kelley; Van Westrum, Derek; Vidakovic, Sandra; Vulcan, William; Warren, Glen; Wood, Stephen; Xu, C; Yan, Chen; Zhao, Wenxia; Zheng, Xiaochao; Zihlmann, Benedikt

    2008-10-01

    DOI: http://dx.doi.org/10.1103/PhysRevC.78.045202
    Cross sections for the reaction 1H(e,e'pi+)n were measured in Hall C at Thomas Jefferson National Accelerator Facility (JLab) using the high-intensity Continuous Electron Beam Accelerator Facility (CEBAF) to determine the charged pion form factor. Data were taken for central four-momentum transfers ranging from Q2=0.60 to 2.45 GeV2 at an invariant mass of the virtual photon-nucleon system of W=1.95 and 2.22 GeV. The measured cross sections were separated into the four structure functions sigmaL,sigmaT,sigmaLT, and sigmaTT. The various parts of the experimental setup and the analysis steps are described in detail, including the calibrations and systematic studies, which were needed to obtain high-precision results. The different types of systematic uncertainties are also discussed. The results for the separated cross sections as a function of the Mandelstam variable t at the different values of Q2 are presented. Some global featu

  11. Electric vehicle propulsion batteries: design and cost study for nickel/zinc battery manufacture. Task A. [25 kWh, 700 pounds, 245 Ah at 100+ V, 4. 77 ft/sup 3/

    Energy Technology Data Exchange (ETDEWEB)

    None

    1977-01-01

    For satisfying the 25-kWh energy requirement necessary for vehicle propulsion, a 700-pound nickel--zinc battery was configured. Containing 64 individual cells, the unit was selected for minimum weight from computed packaging possibilities. Unit volume was projected to be 4.77 cubic feet. Capacity of the cells delivering 100+ volts was set at 245 ampere-hours. Selection was made primarily because of the compatibility with expressed vehicle requirements of a lower-current system. Manufacturing costs were computed for a unit using sintered positive electrodes at $86/kWh, pilot plant rate, and $78/kWh, production plant rate. Based on a lower than anticipated cost differential between sintered and nonsintered positive electrodes and certain other performance differences, the sintered electrode was chosen for the battery design. Capital expenditures for a production rate of 10,000 batteries per year are estimated to be $2,316,500. Capital expenditure for demonstrating production rates in a pilot plant facility is approximately $280,000, with the use of some shared available equipment. 29 figures, 9 tables.

  12. Chinese Frost multidimensional perfectionism scale: a survey of perfectionism under different background in undergraduates%中文Frost多维完美主义量表对1 245名大学生测试结果分析

    Institute of Scientific and Technical Information of China (English)

    马珺; 冯泽永; 杨小丽

    2008-01-01

    目的 研究大学生在不同背景下完美主义心理的差别.方法 用中文Frost多维完美主义量表(Chinese Frost multidimensional perfectionism scale, CFMPS)对1 245 名大学生进行测试.结果 CFMPS的得分在是否独生子女(P=0.009)、成绩等级(P=0.008)和母亲文化程度(P=0.001)上有显著的统计学差异,在性别、年级、生源、家庭经济情况、是否担任学生干部等几个方面没有统计学差异(P>0 05).结论 完美主义既是一种稳定的人格特质,也因个体背景不同(如是否独生子女、成绩等级、母亲文化程度)而有所差异.

  13. Study of thermal structure differences from coordinated lidar observations over Mt. Abu (24.5° N, 72.7° E) and Gadanki (13.5° N, 79.2° E)

    Science.gov (United States)

    Sharma, Som; Chandra, H.; Lal, S.; Acharya, Y. B.; Jayaraman, A.; Gadhavi, H.; Sridharan, S.; Chandra, S.

    2015-06-01

    Rayleigh lidars at Gadanki (13.5° N, 79.2° E), a tropical site, and at Mt. Abu (24.5° N, 72.7° E), a subtropical site, in India were operated simultaneously during the months of March, April, and May 2004. Significant differences are found in the temperatures over both the locations. Higher temperature, ~10-20 K, in the altitude region of 40-65 km is found during March 2004 over Mt. Abu. The mean stratopause temperature during March 2004 is found ~284 K at an altitude of 48 km over Mt. Abu, which is 18 K higher than the observed stratopause temperature of ~266 K over Gadanki. During April and May 2004, the temperatures over Mt. Abu are higher in the entire altitude range of 30-70 km than over Gadanki. Lidar-observed temperatures, over both the locations, are compared with the temperatures observed by SABER (Sounding of the Atmosphere using Broadband Emission Radiometry; onboard TIMED (Thermosphere Ionosphere Mesosphere Energetics and Dynamics)) and HALOE (Halogen Occultation Experiment; onboard UARS (Upper Atmosphere Research Satellite)). It is found that the lidar-observed temperatures are in qualitative agreement with the temperature observed by satellites, though quantitatively there are significant differences. Wave types of fluctuations have been noted in the upper stratosphere and in the lower mesosphere over both the locations.

  14. Analysis and comparison of microstrip antenna for 2.45GHz RFID applications%面向RFID应用的几种2.45GHz微带天线的分析比较

    Institute of Scientific and Technical Information of China (English)

    夏文祥; 胡永忠

    2011-01-01

    With the wide use of RFID, microstrip antenna has become the indispensable part in RFID, common microstrip antennas have single dipole and double dipole antennas. Based on the current application of RFID, some on-board antennas based on 2.45 GHz are put forward. The structures are analyzed combining with the the basic theory of antenna. This paper discusses the advantages and disadvantages of various microstrip antennas through the analysis of the simulation results which generated by using simulation software HFSS. It provides suggest for the application of RFID.%随着RFID的广泛应用,微带天线已经成为RFID中不可缺少的一部分,常见的微带天线有单偶极子和双偶极子天线。根据目前RFID的应用,提出了几种基于2.45GHz的板载天线,同时结合天线的基本理论对这几种结构进行了分析,并通过HFSS软件进行仿真比较。通过对仿真结果的分析,讨论了各种微带天线的优缺点,为RFID的应用提供了参考。

  15. Structural and Catalytic Differences between Two FADH2-Dependent Monooxygenases: 2,4,5-TCP 4-Monooxygenase (TftD from Burkholderia cepacia AC1100 and 2,4,6-TCP 4-Monooxygenase (TcpA from Cupriavidus necator JMP134

    Directory of Open Access Journals (Sweden)

    ChulHee Kang

    2012-08-01

    Full Text Available 2,4,5-TCP 4-monooxygenase (TftD and 2,4,6-TCP 4-monooxygenase (TcpA have been discovered in the biodegradation of 2,4,5-trichlorophenol (2,4,5-TCP and 2,4,6-trichlorophenol (2,4,6-TCP. TcpA and TftD belong to the reduced flavin adenine dinucleotide (FADH2-dependent monooxygenases and both use 2,4,6-TCP as a substrate; however, the two enzymes produce different end products. TftD catalyzes a typical monooxygenase reaction, while TcpA catalyzes a typical monooxygenase reaction followed by a hydrolytic dechlorination. We have previously reported the 3D structure of TftD and confirmed the catalytic residue, His289. Here we have determined the crystal structure of TcpA and investigated the apparent differences in specificity and catalysis between these two closely related monooxygenases through structural comparison. Our computational docking results suggest that Ala293 in TcpA (Ile292 in TftD is possibly responsible for the differences in substrate specificity between the two monooxygenases. We have also identified that Arg101 in TcpA could provide inductive effects/charge stabilization during hydrolytic dechlorination. The collective information provides a fundamental understanding of the catalytic reaction mechanism and the parameters for substrate specificity. The information may provide guidance for designing bioremediation strategies for polychlorophenols, a major group of environmental pollutants.

  16. 8 CFR 245a.21 - Confidentiality.

    Science.gov (United States)

    2010-01-01

    ... whether the applicant has at any time been convicted of a crime may be used or released for immigration... Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS ADJUSTMENT OF STATUS TO... IMMIGRATION AND NATIONALITY ACT Legal Immigration Family Equity (LIFE) Act Legalization Provisions §...

  17. 48 CFR 53.245 - Government property.

    Science.gov (United States)

    2010-10-01

    ... 120-A (GSA), Continuation Sheet (Report of Excess Personal Property). See 45.602-3 and 41 CFR 102-36... Property for Sale (Continuation Sheet). See FPMR 101-45.303 (41 CFR 101-45.303.)) (c) SF 1423 (Rev. 5/04... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Government property....

  18. Design and experimental investigation of a 1 kW organic Rankine cycle system using R245fa as working fluid for low-grade waste heat recovery from steam

    International Nuclear Information System (INIS)

    Highlights: • A 1 kW organic Rankine cycle test rig for waste heat recovery was investigated for net electric power output. • Low grade steam (1–3 bar) was used directly in evaporator as heat source. • Effect of superheating of working fluid on system performance was studied. • The maximum electric power output and thermal efficiency is 1016 W and 5.75% respectively. - Abstract: This work presents an experimental investigation of a small scale (1 kW range) organic Rankine cycle system for net electrical power output ability, using low-grade waste heat from steam. The system was designed for waste steam in the range of 1–3 bar. After the organic Rankine cycle system was designed and thermodynamic simulation was performed, equipment selection and construction of test rig was carried out. R245fa was used as working fluid, a scroll type expansion directly coupled with electrical generator produced a maximum electrical power output of 1.016 kW with 0.838 kW of net electrical power output. The thermal efficiency of the system was 5.64%, net efficiency was 4.66% and expander isentropic efficiency was 58.3% at maximum power output operation point. Maximum thermal efficiency was 5.75% and maximum expander isentropic efficiency obtained was 77.74% during the experiment. Effect of superheating of working fluid at expander inlet was also investigated which show that an increase in the degree of superheating by 1 °C reduces thermal efficiency of system by 0.021% for current system. The results indicated that the measured electric power output and enthalpy determined power output (after accounting for isentropic efficiency) differed by 40%. Similarly, the screw pump converted 42.25% of electric power to the enthalpy determined pumping power delivered to the working fluid. Both expander and screw pump were losing power in electric and mechanical losses (generator/motor) presenting a need of further development of these components for better efficiency. Heat loss in

  19. Capture cross section measurement analysis in the Californium-252 spectrum with the Monte Carlo method

    International Nuclear Information System (INIS)

    Absolute average capture cross sections of gold, thorium, tantalum, molybdenum, copper and strontium in 252Cf spontaneous fission neutron spectrum were simulated for two types of experiment setups preformed by Z. Dezso and J. Csikai and by L. Green. The experiments were simulated with MCNP5 using cross section data from the ENDF/B-VII.0 library. The determination of neutron backscattering was calculated with the use of neutron flagging. Correction factors to experimentally measured values were determined to obtain average cross sections in a pure 252Cf spontaneous fission spectrum. Influence of concrete wall thickness, air moisture and room size on the average cross section was analyzed. Correction factors amounted to about 30%. Corrected values corresponding to average cross sections in a pure 252Cf spectrum were calculated for 197Au, 232Th, 181Ta, 98Mo, 65Cu and 84Sr. Average cross sections were also calculated with the RR-UNC software using IRDFF-v.1.05 and ENDF/B-VII.0 libraries. The revised average radiative capture cross sections are 75.5±0.1 mb for 197Au, 87.0±1.6 mb for 232Th , 98.0±4.5 mb for 181Ta, 21.2±0.5 mb for 98Mo, 10.3±0.3 mb for 63Cu, and 34.9±6.5 mb for 84Sr. - Highlights: • Average capture cross sections in 252Cf spontaneous fission spectrum were simulated. • Calculations were done using MCNP5 code and ENDF/B-VII.0 library. • Correction factors for self-shielding and room return effects were taken into account. • The revised average radiative capture cross sections for different materials are published

  20. Multi-element neutron activation analysis of sediment using a californium-252 source

    International Nuclear Information System (INIS)

    The application of a 252Cf source to the neutron activation analysis of several elements in small (approximately 1.5 in. in dia) cores was studied using high-resolution gamma ray spectroscopy and manual data reduction. (U.S.)

  1. OER of californium-252 at low dose rate for growth inhibition in Vicia faba

    International Nuclear Information System (INIS)

    OER of 252Cf, at low dose rate, has been determined for growth inhibition in Vicia faba roots. A new strain ''BelB'' was used; it was found to be more resistant to prolonged anoxia. Two sets of linear 252Cf sources were used (linear activity 0.31 and 0.47 (μg.cm-1)) in somewhat different geometrical arrangements. The (n+γ) 252Cf dose rates at the level of the root tips were 0.11 and 0.13 Gy.h-1 respectively. The relative contribution of the γ component Dsub(γ) to the total absorbed dose Dsub(n+γ) at the level of the root tips was evaluated Dsub(γ)/Dsub(n+γ)=0.35 for the first source-geometry and 0.42 for the second source-geometry. The reference radiation was the γ emission of 192Ir, used in the same geometrical conditions and for similar irradiation times. Irradiations performed in aerobic and anoxic conditions were alternated. OER values of 1.4 +- 0.1 and 1.5 +- 0.1 were observed for the 252Cf emission with the first and second source-geometry respectively. The corresponding OER values for 192Ir were 2.3 +- 0.2 and 2.6 +- 0.1; the derived oxygen gain factors were then equal to 1.6 and 1.7 repectively

  2. Estudio de marcadores biológicos de estrés en la glándula tiroides y en el timo de rata en un modelo experimental de radiación subtérmico a 2,45 GHz

    OpenAIRE

    Misa Agustiño, María José

    2014-01-01

    Introducción: En el campo de la Medicina Física y Rehabilitación se utilizan las microondas por los efectos terapéuticos causados por el calentamiento en los tejidos. Se desconocen, sin embargo, cuales son los efectos subtérmicos tisulares de las microondas. Esta tesis es un estudio experimental de marcadores biológicos obtenidos en las glándulas tiroides y timos de las ratas después la exposición subtérmica a 2,45 GHz. Objetivos: a) La obtención de un modelo experimental de radiación subt...

  3. 1-Methyl-2-[(E-2,4,5-trimethoxystyryl]pyridinium iodideThis paper is dedicated to the late His Majesty King Chulalongkorn (King Rama V of Thailand for his numerous reforms to modernize the country on the occasion of Chulalongkorn Day (Piyamaharaj Day which fell on the 23rd October.

    Directory of Open Access Journals (Sweden)

    Hoong-Kun Fun

    2010-12-01

    Full Text Available In the title compound, C17H20NO3+·I−, the cation exists in the E configuration. The pyridinium and benzene rings are close to coplanar, with a dihedral angle of 7.43 (12° between them. The three methoxy groups of 2,4,5-trimethoxyphenyl are essentially coplanar with the benzene plane, with C—O—C—C torsion angles of 1.0 (3, −1.9 (3 and 3.6 (3°. A weak intramolecular C—H...O interaction generates an S(6 ring motif. In the crystal, the cations are stacked in columns in an antiparallel manner along the a axis through π–π interactions, with a centroid–centroid distance of 3.7714 (16 Å. The iodide anion is situated between the columns and linked to the cation by a weak C—H...I interaction.

  4. The determination of americium, curium and californium in biological samples by combined solvent extraction-liquid scintillation counting

    International Nuclear Information System (INIS)

    A method has been developed to extract Am, Cm and Cf from ashed biological samples dissolved in 8 M LiN03-10-2 M HN03 into a liquid/scintillation cocktail. This new method reduces tissue and instrument background and allows use of a larger sample for analysis than when using a commercial gelling cocktail. The extractant cocktail is 20% N,N,N-trioctyl-N-methylammonium chloride dissolved in toluene containing the scintillators p-terphenyl and 1,4-bis-2-(5-phenyl-oxazolyl)-benzene. Several different types of biological samples were analyzed and radionuclide recoveries greater than 90% were obtained in all cases. (author)

  5. Oxidation-reduction properties of americium, curium, berkelium, californium, einsteinium and fermium, and thermodynamic consequences for the 5f series

    International Nuclear Information System (INIS)

    The amalgamation of 5f elements from Am to Fm has been studied by using 241Am, 244Cm, 249Bk, 249Cf, 252Cf, 253Es, 254Es, 252Fm and 255Fm with two electrochemical methods, radiocoulometry and radiopolarography, perfectly adapted to investigate extremely diluted solutions when the concentration of electroactive species is as low as 10-16M. The theory of radiocoulometry has been developed in the general cases of reversible and irreversible electrode process. It has been used to interpret the experimental data on the kinetic curves of amalgamation, and to estimate the standard rate constant of the electrode process in complexing medium (citric). On the other hand the radiopolarographic method has been applied to study the mechanism of reduction at the dropping mercury electrode of cations M3+ in aqueous medium to the metal M with formation of amalgam. The results are exploited into two directions: 1- Acquisition of some data concerning the oxidation-reduction properties of elements from Am to Fm. Therefore the standard electrode E0 [M(III-0)] potentials for Bk, Cf and Es, and the standard electrode E0 [M(II-0)] potential for Fm are estimated and the relative stability of each oxidation state (from II to VII) of 5f elements is discussed; 2- Acquisition of unknown thermodynamic data on transcalifornium elements. Correlations between 4f and 5f elements are precised and some divergences appear for the second half of 4f and 5f series (i.e. for 65<=Z<=71 and 97<=Z<=103)

  6. Raman and absorption spectrophotometric studies of selected lanthanide, californium-doped lanthanide, and actinide trihalides in the solid state

    International Nuclear Information System (INIS)

    The solid-state absorption spectra of Cf(III) ions as a dopant in lanthanide trihalide hosts (LnCl3: Ln = Ce, Sm, and Y; LnBr3: Ln = Ce, Sm, Tb, and Y; LnI3: Ln = Ce and Y) have been recorded. The spectra of Cf(III) have been correlated with the various crystal structures. The phonon Raman spectra and solid-state absorption spectra of PmF3, PmCl3, PmBr3, and two crystal modifications of PmI3 have been recorded. Symmetry assignments have been made for the Raman-active bands for these trihalides and also the sesquioxide. The room-temperature absorption spectra have been correlated to crystal field effects. The symmetry assignments of the Raman-active phonon modes have been made based on polarized Raman spectra from single crystals of YF3-type orthorhombic TbF3 and PuBr3-type orthorhombic NdBr3. Raman spectra of other isostructural lanthanide compounds have been recorded and compared. Symmetry assignments for these compounds have been made by analogy to the single-crystal assignments. Raman spectra have been obtained and catalogued for a number of actinide compounds. Symmetry assignments have been made for the observed Raman-active phonon bands in this work based on the assignments made for isostructural lanthanide compounds. 29 figs., 22 tabs

  7. Optical Transitions in Highly Charged Californium Ions with High Sensitivity to Variation of the Fine-Structure Constant

    Science.gov (United States)

    Berengut, J. C.; Dzuba, V. A.; Flambaum, V. V.; Ong, A.

    2012-08-01

    We study electronic transitions in highly charged Cf ions that are within the frequency range of optical lasers and have very high sensitivity to potential variations in the fine-structure constant, α. The transitions are in the optical range despite the large ionization energies because they lie on the level crossing of the 5f and 6p valence orbitals in the thallium isoelectronic sequence. Cf16+ is a particularly rich ion, having several narrow lines with properties that minimize certain systematic effects. Cf16+ has very large nuclear charge and large ionization energy, resulting in the largest α sensitivity seen in atomic systems. The lines include positive and negative shifters.

  8. Optical transitions in highly-charged californium ions with high sensitivity to variation of the fine-structure constant

    CERN Document Server

    Berengut, J C; Flambaum, V V; Ong, A

    2012-01-01

    We study electronic transitions in highly-charged Cf ions that are within the frequency range of optical lasers and have very high sensitivity to potential variations in the fine-structure constant, alpha. The transitions are in the optical despite the large ionisation energies because they lie on the level-crossing of the 5f and 6p valence orbitals in the thallium isoelectronic sequence. Cf16+ is a particularly rich ion, having several narrow lines with properties that minimize certain systematic effects. Cf16+ has very large nuclear charge and large ionisation energy, resulting in the largest alpha-sensitivity seen in atomic systems. The lines include positive and negative shifters.

  9. AN INTEGRAL REACTOR PHYSICS EXPERIMENT TO INFER ACTINIDE CAPTURE CROSS-SECTIONS FROM THORIUM TO CALIFORNIUM WITH ACCELERATOR MASS SPECTROMETRY

    International Nuclear Information System (INIS)

    The principle of the proposed experiment is to irradiate very pure actinide samples in the Advanced Test Reactor (ATR) at INL and, after a given time, determine the amount of the different transmutation products. The determination of the nuclide densities before and after neutron irradiation will allow inference of effective neutron capture cross-sections. This approach has been used in the past and the novelty of this experiment is that the atom densities of the different transmutation products will be determined using the Accelerator Mass Spectroscopy (AMS) technique at the ATLAS facility located at ANL. It is currently planned to irradiate the following isotopes: 232Th, 235U, 236U, 238U, 237Np, 238Pu, 239Pu, 240Pu, 241Pu, 242Pu, 241Am, 243Am and 248Cm.

  10. Integral range, energy, residual range, and linear energy transfer distributions for Californium fission fragments in microelectronics materials

    International Nuclear Information System (INIS)

    This report discusses the advantages and limitations of using Cf-252 radiation sources for single event testing of microelectronics for space environments. Integral distributions for the range, energy, residual range, and linear energy transfer of Cf-252 fission fragments in absorber and microelectronic materials have been calculated. Techniques are suggested for determining when single event testing using Cf-252 is appropriate; also, techniques are given for estimating the saturation cross section and thresh old linear energy transfer from test data. 10 refs., 25 figs., 2 tabs

  11. Research and experimental work at Groote Schuur Hospital and the University of Cape Town using californium-252 sources

    International Nuclear Information System (INIS)

    Experiments have been undertaken to determine the high-LET and low-LET components of the absorbed dose from neutron beams. This is achieved by measuring the fluxes of the high-LET and low-LET radiations in a tissue-equivalent phantom individually and simultaneously using a scintillation probe fitted with a pulse shape discriminator. This system was successfully used with a 22 MeV neutron beam from the T(d,n) reaction and has been employed with 252Cf sources. Results obtained in the low-energy ranges (up to 3 MeV) indicate that the electron counts exceed the high-LET counts by a factor of 2 to 3. These results are related to the absorbed dose. Calculations have also been undertaken to establish whether the Paterson-Parker system could be used for the design of 252Cf treatments and the optimum needle activities to yield the desired dose. Experiments are under way to determine the variation of RBE and OER for 252Cf radiations around the source. The inhibition of root growth in Vicia Faba is being used to determine any such effects. Dose rates comparable to that employed in interstitial radiotherapy are being aimed at. A study of dose fractionation effects is also being undertaken. (author)

  12. 24 CFR 990.245 - Types of appeals.

    Science.gov (United States)

    2010-04-01

    ... taken aggressive marketing and outreach measures to rent these units. For example, a PHA could appeal if... may appeal its PEL if it can produce actual project cost data derived from actual asset management, as... specific local conditions. This appeal would be based on demonstrations that the model's predictions...

  13. 7 CFR 245.3 - Eligibility standards and criteria.

    Science.gov (United States)

    2010-01-01

    ... under the jurisdiction of the local educational agency, specify the uniform family-size income criteria... the National School Lunch or School Breakfast Programs and in commodity-only schools, and for determining eligibility for free milk when the School Food Authority has chosen to serve free milk in...

  14. Dicty_cDB: SHH245 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available mino Acid sequence (All Frames) Frame A: ifpls*khnpfyfilffffxvfxfxfxfxfxxffxnfxexffxq--- ---crvim...227023.1 HS_2013_A2_F08_MR CIT Approved Human Genomic Sperm Library D Homo sapien...QUENCE, 20 unordered pieces. 38 0.013 2 DV159077 |DV159077.1 KG9B.005G02F.050721T7 KG9B Nicotiana tabacum cD... 2e-13 CP000600_105( CP000600 |pid:none) Ostreococcus lucimarinus CCE9901... 74 5e-12 (Q0P4U8) RecName: Full=SWI/SNF-related ma...Y*nfn* rmvvvvvvekkmiiai*iilmtmkmmnmimmtkmvlmkmifqmqfmmdqilkmk*chqki npkpqrnqll*nlqklllllcsskstt Translated A

  15. 48 CFR 52.245-1 - Government Property.

    Science.gov (United States)

    2010-10-01

    ... Management Regulation 102-71.20 (41 CFR 102-71.20). Sensitive property means property potentially dangerous...., extent of liability for loss, theft, damage or destruction of Government property). (B) The Contractor... Contractor shall establish and maintain Government accounting source data, as may be required by...

  16. Family II. Leptospiraceae Hovind-Hougen 1979, 245AL

    Science.gov (United States)

    Bacteria within the Family Leptospiraceae comprise a diverse group of three bacterial genera, Leptospira, Leptonema, and Turneriella. These bacteria are aerobes that consume long-chain fatty acids and alcohols as carbon and energy sources. Some members of this Family cause serious infections in ani...

  17. Dicty_cDB: SFF245 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available rsslllsryssssfrcklstnpsqlsirrkgwc*klpt*wfhgc qw*ww*rsklstklfrxsratsricst*i*rlwfrc...ossina morsitans morsitans (Tseatse fly) EST from adult infected midgut library, clone Tse74e09_q1c. 74 3e-0...9 1 BX554380 |BX554380.1 Glossina morsitans morsitans (Tseatse fly) EST from adul...t infected midgut library, clone Tse15b01_q1c. 74 3e-09 1 BX554266 |BX554266.1 Glossina morsitans morsitans (Tseats...378080_1( AY378080 |pid:none) Tetrahymena thermophila putative c... 247 2e-64 (Q9PWF7) RecName: Full=Catalas

  18. 48 CFR 1253.245-70 - Report of Government property.

    Science.gov (United States)

    2010-10-01

    ... following form is prescribed for use by contractors to report Government property, as specified in (TAR) 48 CFR 1245.505-1470: Form DOT F 4220.43, Contractor Report of Government Property. See 1245.505-1470... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Report of...

  19. 19 CFR 24.5 - Filing identification number.

    Science.gov (United States)

    2010-04-01

    ..., the Social Security number. (2) If neither an Internal Revenue Service employer identification number nor a Social Security number has been assigned, the word “None” shall be written on the line provided... Service employer identification number or a Social Security number, an importer identification...

  20. 24 CFR 245.420 - Rights of tenants to participate.

    Science.gov (United States)

    2010-04-01

    ... HOUSING AND URBAN DEVELOPMENT MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER... representatives acting for tenants individually or as a group) must have the right to inspect and copy the... business hours. (b) The tenants have the right during this period to submit written comments on...

  1. 50 CFR 216.245 - Requirements for monitoring and reporting.

    Science.gov (United States)

    2010-10-01

    ... to categorize in any way, the observed behavior of the animals (such as animal closing to bow ride... explosive detonations. The Navy shall provide NMFS with species or description of the animal(s), the condition of the animal(s) (including carcass condition if the animal is dead), location, time of...

  2. 48 CFR 1552.245-70 - Government property.

    Science.gov (United States)

    2010-10-01

    ... Government. f. Lease versus purchase analysis shall be furnished with the request to acquire property on... classification listed on the EPA Property Report form, with the exception of material, the contractor shall provide the total acquisition cost and total quantity. If there are zero items in a classification, or...

  3. 8 CFR 245a.2 - Application for temporary residence.

    Science.gov (United States)

    2010-01-01

    ... inapplicability of this provision of law lies with the applicant who may provide: (i) Evidence of a history of...) (narcotics) except for a single offense of simple possession of thirty grams or less of marijuana; (iii... who has a consistent employment history which shows the ability to support himself or herself...

  4. 7 CFR 245.1 - General purpose and scope.

    Science.gov (United States)

    2010-01-01

    ... Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF... agencies, Food and Nutrition Service Regional Offices, school food authorities or local educational... Offices, school food authorities or local educational agencies, as applicable, with respect to...

  5. Dicty_cDB: SSL245 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ) acidic repetitive protein arp1 - Tetrahymena ther... 35 0.63 AB276041_1( AB276041 |pid:none) Halocynthia ...lus adult male tongue cDNA, partial sequence, clone 2300004K05. 34 0.27 2 BH91162...X-263J20 on chromosome 7 Contains a gene for a novel kinase with a CNH domain, one complete and part of five... genes for novel proteins similar to novel immune-type receptors (nitr), a novel gene similar to nitr4 and par...nts: (bits) Value AL844508_198( AL844508 |pid:none) Plasmodium falciparum 3D7 chr

  6. 8 CFR 245a.13 - During pendency of application.

    Science.gov (United States)

    2010-01-01

    ... States submits a prima facie application for adjustment of status under LIFE Legalization during the... inadmissibility, an application for adjustment of status shall be treated as a prima facie application during the... eligible alien who submits a prima facie application for adjustment of status under this Subpart B shall...

  7. Lophine (2,4,5-triphenyl-1H-imidazole

    Directory of Open Access Journals (Sweden)

    Diana Yanover

    2009-04-01

    Full Text Available The title compound, C21H16N2, has been known since 1877. Although the crystal structure of 36 derivatives of lophine are known, the structure of parent compound has remained unknown until now. The three phenyl rings bonded to the imidazole core are not coplanar with the latter, with dihedral angles of 21.4 (3, 24.7 (3, and 39.0 (3°, respectively, between the phenyl ring planes in the 2-, 4- and 5-positions of the imidazole ring. The molecules are packed in layers running perpendicular to the b axis. Although there are acceptor and donor atoms for hydrogen bonds, no such interactions are detected in the crystal in contrast to other lophine derivatives.

  8. Dicty_cDB: SHJ245 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available iwvmlsklnhqlnhllnhllnhqhlhhllvvpslvyylpismvmeflme--- Homology vs CSM-cDNA Score E Sequences producing significant alignme...1337_3037( CP001337 |pid:none) Chloroflexus aggregans DSM 9485... 36 0.96 AM263198_431( AM263198 |pid:none) Listeria welshimeri ser...AVAGLLFTDINGNGIFDG--- Frame C: f*iyiliyinililik*kyyihyy*yqv*f*ily*ifhhkyminvfwh*kenvi*iqikm hcmmkvnqdlemlkfl*emqliireiniqyvihllm...) /CSM/SH/SHL6-D/SHL696Q.Seq.d/ 954 0.0 own update 2009. 4. 4 Homology vs DNA Score E Sequences producing significant alignme...nts: (bits) Value N AC129388 |AC129388.3 Rattus norvegicus clone CH230-9G8, *** SEQUENCING

  9. Dicty_cDB: AFI245 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available qmciffqrgks*sfnhsrwskskrsqqei hr*qrtsyrsr*tsfirfkigfirsrfhhdescrqri*mepqlw*yrplmerwlyhsfnf pr*nqgsl**estt*qs...dro... 265 2e-69 BC095571_1( BC095571 |pid:none) Danio rerio phosphogluconate hydro... 265 2e-69 BT059099_1( BT059099 |pid:none) Salm...one Contig1702 GND1 gene, complete cds. 52 4e-16 4 Z73041 |Z73041.1 S.cerevisiae chromosome VII reading frame..., complete cds. 46 6e-12 4 X99228 |X99228.1 S.cerevisiae genomic sequence from chromosome VII. 54 2e-11 4 dn... 6e-69 protein update 2009. 4.22 PSORT psg: 0.70 gvh: 0.48 alm: 0.36 top: 0.53 tms: 0.00 mit: 0.21 mip: 0.00 nuc: 0.00 erl: 0.00 er

  10. 8 CFR 245.10 - Adjustment of status upon payment of additional sum under section 245(i).

    Science.gov (United States)

    2010-01-01

    ... to the regulations of the Secretary of Labor, 20 CFR 656.21. (3) Approvable when filed means that, as... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Adjustment of status upon payment of... SECURITY IMMIGRATION REGULATIONS ADJUSTMENT OF STATUS TO THAT OF PERSON ADMITTED FOR PERMANENT...

  11. Accurate determination of Curium and Californium isotopic ratios by inductively coupled plasma quadrupole mass spectrometry (ICP-QMS) in 248Cm samples for transmutation studies

    International Nuclear Information System (INIS)

    The French Atomic Energy Commission has carried out several experiments including the mini-INCA (INcineration of Actinides) project for the study of minor-actinide transmutation processes in high intensity thermal neutron fluxes, in view of proposing solutions to reduce the radiotoxicity of long-lived nuclear wastes. In this context, a Cm sample enriched in 248Cm (∼97 %) was irradiated in thermal neutron flux at the High Flux Reactor (HFR) of the Laue-Langevin Institute (ILL). This work describes a quadrupole ICP-MS (ICP-QMS) analytical procedure for precise and accurate isotopic composition determination of Cm before sample irradiation and of Cm and Cf after sample irradiation. The factors that affect the accuracy and reproducibility of isotopic ratio measurements by ICP-QMS, such as peak centre correction, detector dead time, mass bias, abundance sensitivity and hydrides formation, instrumental background, and memory blank were carefully evaluated and corrected. Uncertainties of the isotopic ratios, taking into account internal precision of isotope ratio measurements, peak tailing, and hydrides formations ranged from 0.3% to 1.3%. This uncertainties range is quite acceptable for the nuclear data to be used in transmutation studies.

  12. MANTRA: An Integral Reactor Physics Experiment to Infer Actinide Capture Cross-sections from Thorium to Californium with Accelerator Mass Spectrometry

    Energy Technology Data Exchange (ETDEWEB)

    G. Youinou; C. McGrath; G. Imel; M. Paul; R. Pardo; F. Kondev; M. Salvatores; G. Palmiotti

    2011-08-01

    The principle of the proposed experiment is to irradiate very pure actinide samples in the Advanced Test Reactor at INL and, after a given time, determine the amount of the different transmutation products. The determination of the nuclide densities before and after neutron irradiation will allow inference of effective neutron capture cross-sections. This approach has been used in the past and the novelty of this experiment is that the atom densities of the different transmutation products will be determined using the Accelerator Mass Spectrometry technique at the ATLAS facility located at ANL. It is currently planned to irradiate the following isotopes: 232Th, 235U, 236U, 238U, 237Np, 238Pu, 239Pu, 240Pu, 241Pu, 242Pu, 241Am, 243Am, 244Cm and 248Cm.

  13. Radiological Characterization Technical Report on Californium-252 Sealed Source Transuranic Debris Waste for the Off-Site Source Recovery Project at Los Alamos National Laboratory

    Energy Technology Data Exchange (ETDEWEB)

    Feldman, Alexander [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2014-04-24

    This document describes the development and approach for the radiological characterization of Cf-252 sealed sources for shipment to the Waste Isolation Pilot Plant. The report combines information on the nuclear material content of each individual source (mass or activity and date of manufacture) with information and data on the radionuclide distributions within the originating nuclear material. This approach allows for complete and accurate characterization of the waste container without the need to take additional measurements. The radionuclide uncertainties, developed from acceptable knowledge (AK) information regarding the source material, are applied to the summed activities in the drum. The AK information used in the characterization of Cf-252 sealed sources has been qualified by the peer review process, which has been reviewed and accepted by the Environmental Protection Agency.

  14. The development and medical applications of a simple facility for partial body in vivo neutron activation analysis using californium-252 sources

    International Nuclear Information System (INIS)

    A simple and cheap facility for partial body neutron activation analysis has been designed, based on the use of two 100 μg 252Cf neutron sources. The results reported show that calcium can be measured in parts of the body such as the tibia with a precision as good as +- 1.6 % for a radiation dose of 2 rem. The uniformity of the thermal neutron flux density is better than +- 3 % over 10 cm. Some applications of this irradiation facility for studies of trace elements, in particular cadmium in liver and aluminium in liver or brain, have also been explored. However, the sensitivity attainable is not yet sufficient for the study of normal levels, but could be of interest in toxicological investigations

  15. Accurate determination of Curium and Californium isotopic ratios by inductively coupled plasma quadrupole mass spectrometry (ICP-QMS) in Cm-248 samples for transmutation studies

    International Nuclear Information System (INIS)

    The French Atomic Energy Commission has carried out several experiments including the mini-INCA (Incineration of Actinides) project for the study of minor-actinide transmutation processes in high intensity thermal neutron fluxes, in view of proposing solutions to reduce the radiotoxicity of long-lived nuclear wastes. In this context, a Cm sample enriched in 248Cm (similar to 97%) was irradiated in thermal neutron flux at the High Flux Reactor (HFR) of the Laue-Langevin Institute (ILL). This work describes a quadrupole ICP-MS (ICP-QMS) analytical procedure for precise and accurate isotopic composition determination of Cm before sample irradiation and of Cm and Cf after sample irradiation. The factors that affect the accuracy and reproducibility of isotopic ratio measurements by ICP-QMS, such as peak centre correction, detector dead time, mass bias, abundance sensitivity and hydrides formation, instrumental background, and memory blank were carefully evaluated and corrected. Uncertainties of the isotopic ratios, taking into account internal precision of isotope ratio measurements, peak tailing, and hydrides' formations ranged from 0. 3% to 1. 3%. This uncertainties' range is quite acceptable for the nuclear data to be used in transmutation studies. (authors)

  16. MANTRA: An Integral Reactor Physics Experiment to Infer Actinide Capture Cross-sections from Thorium to Californium with Accelerator Mass Spectrometry

    International Nuclear Information System (INIS)

    The principle of the proposed experiment is to irradiate very pure actinide samples in the Advanced Test Reactor at INL and, after a given time, determine the amount of the different transmutation products. The determination of the nuclide densities before and after neutron irradiation will allow inference of effective neutron capture cross-sections. This approach has been used in the past and the novelty of this experiment is that the atom densities of the different transmutation products will be determined using the Accelerator Mass Spectrometry technique at the ATLAS facility located at ANL. It is currently planned to irradiate the following isotopes: 232Th, 235U, 236U, 238U, 237Np, 238Pu, 239Pu, 240Pu, 241Pu, 242Pu, 241Am, 243Am, 244Cm and 248Cm.

  17. 17 CFR 245.103 - Issuer right of recovery; right of action by equity security owner.

    Science.gov (United States)

    2010-04-01

    ... U.S.C. 7244(a)(1)) will inure to and be recoverable by the issuer, regardless of any intention on... recoverable in an action undertaken pursuant to section 306(a)(2) of the Sarbanes-Oxley Act of 2002 from a... measured by comparing the difference between the amount paid or received for the equity security on...

  18. Antibacterial activity of synthesized 2,4,5-trisubstituted imidazole derivatives

    Digital Repository Service at National Institute of Oceanography (India)

    Khan, M.S.; Siddiqui, S.A.; Siddiqui, M.S.R.A.; Goswami, U.; Srinivasan, K.V.; Khan, M.I.

    activity, aryl aldehydes, a-hydroxyketone Received 15 February 2008, revised 28 June 2008 and accepted for publication 29 June 2008 Different imidazoles have been reported to show biological activities such as anti-inflammatory activity inhibiting cytokine... of this work 197 Chem Biol Drug Des 2008; 72: 197–204 Research Article ª 2008 The Authors Journal compilation ª 2008 Blackwell Munksgaard doi: 10.1111/j.1747-0285.2008.00691.x and screen them for antibacterial and antifungal activity with respect...

  19. Flow boiling of R245fa in vertical small metallic tubes

    OpenAIRE

    Pike-Wilson, Emily Alexandra

    2014-01-01

    This thesis was submitted for the degree of Doctor of Philosophy and awarded by Brunel University London The research presented is part of a larger study, dedicated to investigating flow boiling in small to microchannels. The test facility, originally designed by Huo (2005) and since used by Chen (2006) and Mahmoud (2011), has been used to investigate flow boiling of R134a across a range of channel diameters and both seamless cold drawn and welded channels. These previous studies concluded...

  20. Production and action pattern of inulinase from Aspergillus Niger-245: hydrolysis of inulin from several sources

    OpenAIRE

    Cruz Vinícius D?Arcadia; Belote Juliana Gisele; Belline Márcia Zilioli; Cruz Rubens

    1998-01-01

    A strain of Aspergillus niger isolated from soil samples showed great capacity to produce extracellular inulinase. Although the enzyme has been synthesized in presence of monosaccharides, sucrose and sugar cane molasse, the productivity was significantly higher (p<0.05) when the microorganism was inoculated in media formulated with dahlia extract and pure inulin, as carbon sources. With regard to the nitrogen source, the best results were obtained with casein and other sources of proteic n...

  1. Multicellular algae from lower Proterozoic (2.45 Ga) weathering crusts of the Kola Peninsula

    Science.gov (United States)

    Astafieva, Marina M.; Rozanov, Alexei Y.; Hoover, Richard B.

    2011-10-01

    Microbiological analysis of several cold-preserved tissue samples from the Siberian baby mammoth known as Lyuba revealed a number of culturable bacterial strains that were grown on anaerobic media at 3 oC. Lactic acid produced by LAB (lactic acid bacteria) group, usually by members of the genera Carnobacterium and Lactosphera, appears to be a wonderful preservative that keeps other bacteria from colonizing a system. Permafrost and lactic acid preserved the body of this one month-old baby mammoth and kept it in exceptionally good condition, resulting in this mammoth being the most complete sample of the species ever recovered. The diversity of novel psychrophilic anaerobic isolates was expressed on morphological, physiological and phylogenetic levels. Here, we discuss the specifics of the isolation of new psychrophilic strains, differentiation from trivial contamination, and preliminary results for characterization of the cultures

  2. All-Solid-State 2.45-to-2.78-THz Source

    Science.gov (United States)

    Mehdi, Imran; Chattopadhyay, Goutam; Schlecht, Erich T.; Lin, Robert H.; Sin, Seith; Peralta, Alejandro; Lee, Choonsup; Gill, John J.; Pearson, John C.; Goldsmith, Paul F.; Siegel, Peter H.; Drouin, Brian J.; Bruneau, Peter J.; Thomas, Bertrand C.; Maestrini, Alain; Ward, John

    2011-01-01

    Sources in the THz range are required in order for NASA to implement heterodyne instruments in this frequency range. The source that has been demonstrated here will be used for an instrument on the SOFIA platform as well as for upcoming astrophysics missions. There are currently no electronic sources in the 2 3- THz frequency range. An electronically tunable compact source in this frequency range is needed for lab spectroscopy as well as for compact space-deployable heterodyne receivers. This solution for obtaining useful power levels in the 2 3- THz range is based on utilizing power-combined multiplier stages. Utilizing power combining, the input power can be distributed between different multiplier chips and then recombined after the frequency multiplication. A continuous wave (CW) coherent source covering 2.48 2.75 THz, with greater than 10 percent instantaneous and tuning bandwidth, and having l 14 W of output power at room temperature, has been demonstrated. This source is based on a 91.8 101.8-GHz synthesizer followed by a power amplifier and three cascaded frequency triplers. It demonstrates that purely electronic solid-state sources can generate a useful amount of power in a region of the electromagnetic spectrum where lasers (solid-state or gas) were previously the only available coherent sources. The bandwidth, agility, and operability of this THz source has enabled wideband, high-resolution spectroscopic measurements of water, methanol, and carbon monoxide with a resolution and signal-to-noise ratio unmatched by other existing systems, providing new insight in the physics of these molecules. Further - more, the power and optical beam quality are high enough to observe the Lamb-dip effect in water. The source frequency has an absolute accuracy better than 1 part in 1012, and the spectrometer achieves sub-Doppler frequency resolution better than 1 part in 108. The harmonic purity is better than 25 dB. This source can serve as a local oscillator for a variety of heterodyne systems, and can be used as a method for precision control of more powerful but much less frequency-agile quantum mechanical terahertz sources.

  3. 48 CFR 245.606-5 - Instructions for preparing and submitting schedules of contractor inventory.

    Science.gov (United States)

    2010-10-01

    .... For termination inventory included in a settlement proposal, include cost of inventory acquired for performance of the entire contract in column F1 and cost of inventory acquired solely for the terminated portion of the contract in column F2. Cost of inventory acquired for the entire contract must be...

  4. Efficient 2.45 GHz Rectenna Design with high Harmonic Rejection for Wireless Power Transmission

    OpenAIRE

    Zied Harouni; Lotfi Osman; Ali Gharsallah

    2010-01-01

    The purpose of this work is to propose an efficient microstrip rectenna operating on ISM band with high harmonic rejection. The receiving antenna with proximity coupled feeding line implemented in a multilayer substrate. The rectenna with integrated circular sector antenna can eliminate the need for an low pass filter (LPF) placed between the antenna and the diode as well as produce higher output power, with maximum conversion efficiency of 74% using a 1300 load resistor at a power density of...

  5. Efficient 2.45 GHz Rectenna Design with high Harmonic Rejection for Wireless Power Transmission

    Directory of Open Access Journals (Sweden)

    Zied Harouni

    2010-09-01

    Full Text Available The purpose of this work is to propose an efficient microstrip rectenna operating on ISM band with high harmonic rejection. The receiving antenna with proximity coupled feeding line implemented in a multilayer substrate. The rectenna with integrated circular sector antenna can eliminate the need for an low pass filter (LPF placed between the antenna and the diode as well as produce higher output power, with maximum conversion efficiency of 74% using a 1300 load resistor at a power density of 0.3 mW/cm square.

  6. Relative hyperperfusion by SPECT in a family with a presenilin 1 (T245P) mutation.

    Science.gov (United States)

    Edwards-Lee, Terri; Wen, Johnny; Chung, Julia A; Vasinrapee, Panukorn; Mishkin, Frederick S

    2008-01-01

    Clinical characteristics of autosomal dominant Alzheimer's disease often differ clinically from sporadic disease with the onset of seizures, spasticity and myoclonus early in the disease course. Similarly imaging characteristics may also differ. We report the findings of relative hyperperfusion by Tc-99m HMPAO SPECT in the medial orbitofrontal cortex and anterior temporal lobe in four affected family members carrying a presenilin 1 mutation. SPECT of the four individuals was compared to an age-matched normal database. We speculate that the findings of relative medial orbitofrontal and anterior temporal lobe hyperperfusion may be a marker of early onset Alzheimer's disease in this family. PMID:19085559

  7. Effect of axial magnetic field on a 2.45 GHz permanent magnet ECR ion source

    Energy Technology Data Exchange (ETDEWEB)

    Nakamura, T., E-mail: tsubasa@oshima-k.ac.jp; Wada, H.; Furuse, M. [National Institute of Technology, Oshima College, 1091-1 Komatsu, Suouoshima, Oshima, Yamaguchi 742-2193 (Japan); Asaji, T. [National Institute of Technology, Toyama College, 13 Hongo, Toyama 939-8630 (Japan)

    2016-02-15

    Herein, we conduct a fundamental study to improve the generation efficiency of a multi-charged ion source using argon. A magnetic field of our electron cyclotron resonance ion source is composed of a permanent magnet and a solenoid coil. Thereby, the axial magnetic field in the chamber can be tuned. Using the solenoid coil, we varied the magnetic field strength in the plasma chamber and measured the ion beam current extracted at the electrode. We observed an approximately three times increase in the Ar{sup 4+} ion beam current when the magnetic field on the extractor-electrode side of the chamber was weakened. From our results, we can confirm that the multi-charged ion beam current changes depending on magnetic field intensity in the plasma chamber.

  8. 2-(4,5-Dihydro-1H-imidazol-2-ylpyridine

    Directory of Open Access Journals (Sweden)

    Reza Kia

    2009-04-01

    Full Text Available In the molecule of the title compound, C8H9N3, a new imidazoline derivative, the six- and five-membered rings are slightly twisted away from each other, forming a dihedral angle of 7.96 (15°. In the crystal structure, neighbouring molecules are linked together by intermolecular N—H...N hydrogen bonds into extended one-dimensional chains along the a axis. The pyridine N atom is in close proximity to a carbon-bound H atom of the imidazoline ring, with an H...N distance of 2.70 Å, which is slightly shorter than the sum of the van der Waals radii of these atoms (2.75 Å. The crystal structure is further stabilized by intermolecular C—H...π and π–π interactions (centroid-to-centroid distance 3.853 Å.

  9. Options in Education. Technology in College, Parts One and Two, Program Nos. 244-245.

    Science.gov (United States)

    George Washington Univ., Washington, DC. Inst. for Educational Leadership.

    Scripts of public radio programs on the subject of technology in college are presented. The scripts are as follows: "Dental Videotape;""A Geography Student Talks About Learning by Computers;""Linda Harris Talks About Fear of Computers;""Charles Van Loan, Who Teaches Computer Science at Cornell University;""Students Who Learn Through…

  10. 17 CFR 245.102 - Exceptions to definition of blackout period.

    Science.gov (United States)

    2010-04-01

    ... corporate merger, acquisition, divestiture or similar transaction involving the plan or plan sponsor, the... able to participate in the same class of equity securities after the merger, acquisition,...

  11. Designing Artificial Magnetic Conductor at 2.45 GHz for Metallic Detection in RFID Tag Application

    Directory of Open Access Journals (Sweden)

    Maisarah Abu

    2014-03-01

    Full Text Available In this paper, three types of AMC with different shape and design is discussed. The single unit cell Halfring AMC designed in this paper had increased the bandwidth up to 9.46%. Parametric studies were conducted for those three AMCs to investigate the effect of varying the parameters of each design. The values of gain, directivity and return loss for all AMCs is discussed and compared. From the simulated result, when the dipole is attached on Perfect Electric Conductor, PEC the performance of antenna will drop severely. The new Halfring AMC designed in this paper had overcome the problem of metallic object detection in RFID tag application. The simulated result shows that the Halfring AMC at half-lambda size had increased the performance of dipole antenna with return loss = -22.60 dB, gain = 7.58 dB and directivity of 8.15 dBi.

  12. An implantable bioimpedance monitor using 2.45 GHz band for telemetry

    International Nuclear Information System (INIS)

    This paper describes a multi-frequency single-channel electrical implantable bioimpedance monitor (35 mm × 35 mm × 10 mm, weight 52 g) powered by a NiMH battery. By using the tetrapolar method and injecting 10 µApeak, the monitor is capable of measuring at 14 different frequencies, from 100 Hz to 200 kHz. It contains a ZigBee transceiver to monitor the measurements performed, and has an embedded memory for backing up the data. RC networks and in-situ heart excised tissues were used to test the system. When measuring a full spectrum every 5 min, 35 days of autonomy are possible due to the low power consumption of the monitor. Temperature drift was estimated by short-term and long-term measurements. Temperature cycling was used to measure modulus and phase angle stability. The result was a very low effect on a modulus decrease of 2.34 Ω, with respect to an impedance of 322 Ω, at 100 Hz and a phase angle increase of 1.1°, at 200 kHz. In addition, measurement errors were bigger at low frequencies because of the high impedance of the electrodes used, which was higher than 10 kΩ at frequencies below 1 kHz. (paper)

  13. 24 CFR 245.130 - Tenants' rights not to be re-canvassed.

    Science.gov (United States)

    2010-04-01

    ... HOUSING AND URBAN DEVELOPMENT MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER...' rights not to be re-canvassed. A tenant has the right not to be re-canvassed against his or her...

  14. Yeast Interacting Proteins Database: YPL070W, YLR245C [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available ey Rows with this prey as prey (4) Rows with this prey as bait Rows with this prey as bait (1) Literature on bait (YPD) 4 Literature... on prey (YPD) 5 Literature shared by bait and prey 3 Literature

  15. Yeast Interacting Proteins Database: YNL189W, YLR245C [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available his prey as prey (4) Rows with this prey as bait Rows with this prey as bait (1) Literature... on bait (YPD) 67 Literature on prey (YPD) 5 Literature shared by bait and prey 4 Literature shari

  16. 48 CFR 1652.245-70 - Government property (negotiated benefits contracts).

    Science.gov (United States)

    2010-10-01

    ... OF PERSONNEL MANAGEMENT FEDERAL EMPLOYEES HEALTH BENEFITS ACQUISITION REGULATION CLAUSES AND FORMS... property, the risk of which has been assumed by the Government under this contract, the Government shall... which any Government property is located for the purpose of inspecting the Government property. (g)...

  17. Piperazine-1,4-diium bis(2,4,5-tricarboxybenzoate dihydrate

    Directory of Open Access Journals (Sweden)

    Nagaraju Narayanam

    2013-04-01

    Full Text Available In the title hydrated salt, C4H12N22+·2C10H5O8−·2H2O, the piperazinediium cation, lying about an inversion center, adopts a chair conformation. The benzene ring of the anion makes dihedral angles of 25.17 (8° with the carboxylate group and angles of 8.50 (7, 20.07 (7 and 80.86 (8° with the three carboxylic acid groups. In the crystal, the cations, anions and water molecules are connected by O—H...O and N—H...O hydrogen bonds into double layers parallel to (110.

  18. 8 CFR 245a.5 - Temporary disqualification of certain newly legalized aliens from receiving benefits from...

    Science.gov (United States)

    2010-01-01

    ... guarantee programs, that they are unable to obtain financing from alternative sources, or at prevailing... assistance is directed, geographically or otherwise, in a way that is intended to primarily benefit...

  19. Change in spectrum of ionic liquids exposed to 2.45 GHz surface wave plasmas

    International Nuclear Information System (INIS)

    Spectrum of three ionic liquids (ILs), those of which are 1-hexyl-4-methylpyridinium bis(trifluoromethanesulfonyl) imide, 1-butyl-1-methylpyrrolidinium bis(trifluoromethanesulfonyl)imide, and trioctylmethylammonium bis(trifluoromethanesulfonyl)imide, are measured with an ultra violet-visible-near infrared (UV-VIS-NIR) spectrophotometer and a Raman spectroscopy. After being exposed to surface wave plasmas (SWP) for 10 min., apparent broad spectrum appear in the wide range of longer wavelength for all cases of the three ILs. Data strongly suggest that due to the SWP irradiation, the ILs are altered considerably and some materials of wide conjugated carbons are produced in the ILs. (author)

  20. 7 CFR 245.9 - Special assistance certification and reimbursement alternatives.

    Science.gov (United States)

    2010-01-01

    ... school participating in Provision 3 must pay, with funds from non-Federal sources, the difference between... difference between the cost of serving lunches and/or breakfasts at no charge to all participating children... Provision 2 only in the School Breakfast Program, school food authorities must continue to comply with...

  1. 8 CFR 245a.18 - Ineligibility and applicability of grounds of inadmissibility.

    Science.gov (United States)

    2010-01-01

    ... simple possession of 30 grams or less of marijuana); (iii) Section 212(a)(2)(B) (multiple criminal... history that shows the ability to support himself or herself even though his or her income may be below... history need not be continuous in that it is uninterrupted. In applying the Special Rule, the Service...

  2. Purex canyon exhaust fan bearing temperature monitoring system doric 245 datalogger programming

    International Nuclear Information System (INIS)

    A micro-processor based datalogger is used to monitor, display, and log seventeen RTD temperature channels. Five bearings are monitored for each of the three electric motor-fan assemblies and two bearings are monitored on the steam turbine unit. Several alarms per data channel (a High alarm at 236 degrees and a High High alarm at 246 degrees F) will alert the operation's staff to increasing abnormal bearing temperatures. This procedure is cross-referenced to the manufacturers manual. All programming steps will have the following footnote: Mpg x-xx. The Mpg refers to the Manual page, with x as the section number and xx as the page number in that section. When more information is needed, such as pictures or details, then the manual section and page number is provided

  3. Reported Disposal of 2,4,5-T on Ottawa National Wildlife Refuge

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — In March, 1986 Mr. Dornbusch supplied us with an old sample of the herbicide that he thought was buried. He said he had taken some of the material home before the...

  4. 40 CFR 1065.245 - Sample flow meter for batch sampling.

    Science.gov (United States)

    2010-07-01

    ... laminar flow element, an ultrasonic flow meter, a subsonic venturi, a critical-flow venturi or multiple... 40 Protection of Environment 32 2010-07-01 2010-07-01 false Sample flow meter for batch sampling... Sample flow meter for batch sampling. (a) Application. Use a sample flow meter to determine sample......

  5. Education and Conflict in Haiti: Rebuilding the Education Sector after the 2010 Earthquake. Special Report 245

    Science.gov (United States)

    Luzincourt, Ketty; Gulbrandson, Jennifer

    2010-01-01

    In Haiti, education both promotes and ameliorates conflict. This report describes the education sector before the 2010 earthquake, then presents recommendations on how Haiti and the international community can increase access to and the quality of Haitian schools and modernize the organization and function of the national education sector.…

  6. 42 CFR 456.245 - Number of studies required to be performed.

    Science.gov (United States)

    2010-10-01

    ... SERVICES (CONTINUED) MEDICAL ASSISTANCE PROGRAMS UTILIZATION CONTROL Utilization Control: Mental Hospitals... mental hospital must, at least, have one study in progress at any time and complete one study...

  7. Overdense plasma generation by 2.45 GHz heating in WEGA

    Czech Academy of Sciences Publication Activity Database

    Podoba, Y.Y.; Laqua, H.P.; Marsen, S.; Otte, M.; Preinhaelter, Josef; Stange, T.; Urban, Jakub; Zhang, D.

    Greifswald : IPP Greifswald, 2009, s. 3-3. ISBN N. [Joint Russian-German Workshop on ECRH and Gyrotrons (STC-Meeting)/21st./. Greifswald (DE), 11.05.2009-15.05.2009] R&D Projects: GA ČR GA202/08/0419; GA MŠk 7G09042 Institutional research plan: CEZ:AV0Z20430508 Keywords : Stellarator * Electron Bernstein wave * EBW * WEGA * ECRH Subject RIV: BL - Plasma and Gas Discharge Physics

  8. 40 CFR 81.245 - Southwest Minnesota Intrastate Air Quality Control Region.

    Science.gov (United States)

    2010-07-01

    ... within the outermost boundaries of the area so delimited): In the State of Minnesota: Big Stone County..., Lyon County, McLeod County, Meeker County, Murray County, Nobles County, Pipestone County, Redwood... 40 Protection of Environment 17 2010-07-01 2010-07-01 false Southwest Minnesota Intrastate...

  9. Design of a seismic energy dissipator for an interruptor type 3AS2-45; Diseno de un disipador de energia sismica para un interruptor tipo 3AS2-45

    Energy Technology Data Exchange (ETDEWEB)

    Castro Felix, Jaime

    2004-02-15

    With the aid of the theory behind seismically isolated structures and the bi-linear behavior of an isolated system of Multiple Degrees of Freedom (MDOF), the information obtained on the spectral analysis is complemented with the purpose of simulating one itself for the design of a dissipator of seismic energy. The seismicity in the world is briefly explained, (in Mexico in special for the Geothermal Field of Cerro Prieto), the types of earthquakes, etc., to give way to a documentation of the state-of-the-art in advanced seismic resistant systems and to a procedure to establish the level of seismic qualification of electrical equipment from the level of seismic performance for the Mexican Republic. [Spanish] Con la ayuda de la teoria detras de estructuras aisladas sismicamente y el comportamiento bilineal de un sistema de aislamiento de Multiples Grados de Libertad (MDOF), se complementa la informacion recabada sobre el analisis espectral con el fin de simular uno propio para el diseno de un disipador de energia sismica. Se explica brevemente la sismicidad en el mundo, en Mexico, en especial el Campo Geotermico de Cerro Prieto, los tipos de sismos, etc., para dar paso a una documentacion del estado del arte en sistemas sismorresistentes avanzados y a un procedimiento para establecer el nivel de calificacion sismica de equipos electricos a partir del Nivel de desempeno sismico para la Republica Mexicana.

  10. Freeze drying method for preparing radiation source material

    International Nuclear Information System (INIS)

    Fabrication of a neutron source is specifically claimed. A palladium/californium solution is freeze dried to form a powder which, through conventional powder metallurgy, is shaped into a source containing the californium evenly distributed through a palladium metal matrix. (E.C.B.)

  11. Review of RBE and OER values for Cf-neutrons

    International Nuclear Information System (INIS)

    Californium-252, an isotope emitting neutrons, gamma photons and alpha particles, is being investigated for its practical use in intracavitary and interstitial brachytherapy. A review of published RBE and OER values for californium neutrons as a function of dose rate for a variety of biological endpoints is given. (Auth.)

  12. Design and Measurement of a 2.45 Ghz On-Body Antenna Optimized for Hearing Instrument Applications

    DEFF Research Database (Denmark)

    Kvist, Søren Helstrup; Jakobsen, Kaj Bjarne; Thaysen, Jesper

    2012-01-01

    structure can be made conformal to the outer surface of a hearing instrument, such that the bandwidth of the antenna is optimized given the available volume. The radiation patterns, ear-to-ear path gain and available bandwidth is measured and compared to the simulated results. It is found that the antenna...

  13. SU-E-J-245: Sensitivity of FDG PET Feature Analysis in Multi-Plane Vs. Single-Plane Extraction

    Energy Technology Data Exchange (ETDEWEB)

    Harmon, S; Jeraj, R [University of Wisconsin, Madison, WI (United States); Galavis, P [University of Wisconsin, Madison, WI (United States); NYU Langone Medical Center, New York, NY (United States)

    2015-06-15

    Purpose: Sensitivity of PET-derived texture features to reconstruction methods has been reported for features extracted from axial planes; however, studies often utilize three dimensional techniques. This work aims to quantify the impact of multi-plane (3D) vs. single-plane (2D) feature extraction on radiomics-based analysis, including sensitivity to reconstruction parameters and potential loss of spatial information. Methods: Twenty-three patients with solid tumors underwent [{sup 18}F]FDG PET/CT scans under identical protocols. PET data were reconstructed using five sets of reconstruction parameters. Tumors were segmented using an automatic, in-house algorithm robust to reconstruction variations. 50 texture features were extracted using two Methods: 2D patches along axial planes and 3D patches. For each method, sensitivity of features to reconstruction parameters was calculated as percent difference relative to the average value across reconstructions. Correlations between feature values were compared when using 2D and 3D extraction. Results: 21/50 features showed significantly different sensitivity to reconstruction parameters when extracted in 2D vs 3D (wilcoxon α<0.05), assessed by overall range of variation, Rangevar(%). Eleven showed greater sensitivity to reconstruction in 2D extraction, primarily first-order and co-occurrence features (average Rangevar increase 83%). The remaining ten showed higher variation in 3D extraction (average Range{sub var}increase 27%), mainly co-occurence and greylevel run-length features. Correlation of feature value extracted in 2D and feature value extracted in 3D was poor (R<0.5) in 12/50 features, including eight co-occurrence features. Feature-to-feature correlations in 2D were marginally higher than 3D, ∣R∣>0.8 in 16% and 13% of all feature combinations, respectively. Larger sensitivity to reconstruction parameters were seen for inter-feature correlation in 2D(σ=6%) than 3D (σ<1%) extraction. Conclusion: Sensitivity and correlation of various texture features were shown to significantly differ between 2D and 3D extraction. Additionally, inter-feature correlations were more sensitive to reconstruction variation using single-plane extraction. This work highlights a need for standardized feature extraction/selection techniques in radiomics.

  14. Evaluation of HFC-245ca for commercial use in low pressure chillers. Final report, Volume II: Chiller test data

    Energy Technology Data Exchange (ETDEWEB)

    Keuper, E.F. [Trane Co., LaCrosse, WI (United States)

    1996-03-01

    The data presented here were taken under Trane Laboratory Test Order 23127 between May and October 1995. The chiller was a 200 nominal ton three stage direct drive centrifugal chiller with two economizers. Three sets of impellers, three refrigerants and two oils were tested in the chiller according to the following matrix. Trane 22 is a mineral oil and Solest 68 is a polyolester oil. Runs 1 through 6 were to optimize the refrigerant charge using CFC-11. This was determined to be 360 lbm (163.3 Kg) and this value was used for all three refrigerants. The chiller takes a charge of six gallons of oil (22.7 liters). These data which follow are divided into Large Impeller, Medium Impeller and Small Impeller sets further subdivided by Imperial and Metric presentation. The data were taken in Imperial Units. These data are presented in four-page sets. Page 1 shows the reduced chiller test data. Page 2 shows some supporting calculations by curve fit, such as motor efficiency and motor speed. Pages 3 and 4 show the raw data as delivered by the laboratory. All following four-page sets are repetition of the form but for successive test runs.

  15. Manufacturing And High Temperature Oxidation Properties Of Electro-Sprayed Fe-24.5% Cr-5%Al Powder Porous Metal

    Directory of Open Access Journals (Sweden)

    Lee Kee-Ahn

    2015-06-01

    Full Text Available Fe-Cr-Al based Powder porous metals were manufactured using a new electro-spray process, and the microstructures and high-temperature oxidation properties were examined. The porous materials were obtained at different sintering temperatures (1350°C, 1400°C, 1450°C, and 1500°C and with different pore sizes (500 μm, 450 μm, and 200 μm. High-temperature oxidation experiments (TGA, Thermal Gravimetry Analysis were conducted for 24 hours at 1000°C in a 79% N2+ 21% O2, 100 mL/min. atmosphere. The Fe-Cr-Al powder porous metals manufactured through the electro-spray process showed more-excellent oxidation resistance as sintering temperature and pore size increased. In addition, the fact that the densities and surface areas of the abovementioned powder porous metals had the largest effects on the metal’s oxidation properties could be identified.

  16. Improvement of the ear-to-ear path gain at 2.45 GHz using parasitic antenna element

    DEFF Research Database (Denmark)

    Kvist, Søren Helstrup; Ôzden, Sinasi; Thaysen, Jesper;

    2012-01-01

    the antenna structures. It is found that the bandwidth, as well as the ear-to-ear path gain can be improved by the addition of a parasitic monopole antenna element. The parasitic antenna element affects the electric current distribution on the ground plane, which has a favorable impact on the on...

  17. SU-E-J-245: Sensitivity of FDG PET Feature Analysis in Multi-Plane Vs. Single-Plane Extraction

    International Nuclear Information System (INIS)

    Purpose: Sensitivity of PET-derived texture features to reconstruction methods has been reported for features extracted from axial planes; however, studies often utilize three dimensional techniques. This work aims to quantify the impact of multi-plane (3D) vs. single-plane (2D) feature extraction on radiomics-based analysis, including sensitivity to reconstruction parameters and potential loss of spatial information. Methods: Twenty-three patients with solid tumors underwent [18F]FDG PET/CT scans under identical protocols. PET data were reconstructed using five sets of reconstruction parameters. Tumors were segmented using an automatic, in-house algorithm robust to reconstruction variations. 50 texture features were extracted using two Methods: 2D patches along axial planes and 3D patches. For each method, sensitivity of features to reconstruction parameters was calculated as percent difference relative to the average value across reconstructions. Correlations between feature values were compared when using 2D and 3D extraction. Results: 21/50 features showed significantly different sensitivity to reconstruction parameters when extracted in 2D vs 3D (wilcoxon α<0.05), assessed by overall range of variation, Rangevar(%). Eleven showed greater sensitivity to reconstruction in 2D extraction, primarily first-order and co-occurrence features (average Rangevar increase 83%). The remaining ten showed higher variation in 3D extraction (average Rangevarincrease 27%), mainly co-occurence and greylevel run-length features. Correlation of feature value extracted in 2D and feature value extracted in 3D was poor (R<0.5) in 12/50 features, including eight co-occurrence features. Feature-to-feature correlations in 2D were marginally higher than 3D, ∣R∣>0.8 in 16% and 13% of all feature combinations, respectively. Larger sensitivity to reconstruction parameters were seen for inter-feature correlation in 2D(σ=6%) than 3D (σ<1%) extraction. Conclusion: Sensitivity and correlation of various texture features were shown to significantly differ between 2D and 3D extraction. Additionally, inter-feature correlations were more sensitive to reconstruction variation using single-plane extraction. This work highlights a need for standardized feature extraction/selection techniques in radiomics

  18. Structural Stability and Deformation of Solvated Sm@C2(45)-C90 under High Pressure

    Science.gov (United States)

    Cui, Jinxing; Yao, Mingguang; Yang, Hua; Liu, Ziyang; Liu, Shijie; Du, Mingrun; Li, Quanjun; Liu, Ran; Cui, Tian; Liu, Bingbing

    2016-08-01

    Solvated fullerenes recently have been shown to exhibit novel compression behaviors compared with the pristine fullerenes. However, less attention has been focused on the large cage endohedral metallofullerenes. Here, we have firstly synthesized solvated Sm@C90 microrods by a solution drop-drying method, and then studied the transformations under high pressure. The pressure-induced structural evolutions of Sm@C90 molecules both undergo deformation and collapse. The band gaps of both samples decrease with increasing pressure. The trapped Sm atom plays a role in restraining the compression of the adjacent bonds. The solvent plays a role in protecting Sm@C90 against collapse in the region of 12–20 GPa, decreasing and postponing the change of band gap. Above 30 GPa, the carbon cages collapse. Released from 45 GPa, the compressed solvated Sm@C90 forms a new ordered amorphous carbon cluster (OACC) structure with metal atoms trapped in the units of amorphous carbon clusters, which is different from the OACC structure formed by compressing solvated C60 and C70. This discovery opens the door for the creation of new carbon materials with desirable structural and physical properties when suitable starting materials are selected.

  19. Characteristics of an atmospheric-pressure line plasma excited by 2.45 GHz microwave travelling wave

    Science.gov (United States)

    Suzuki, Haruka; Nakano, Suguru; Itoh, Hitoshi; Sekine, Makoto; Hori, Masaru; Toyoda, Hirotaka

    2016-01-01

    An atmospheric-pressure line plasma was produced by microwave discharge using a slot antenna with travelling microwave power. Two different types of plasma mode, i.e., “pseudo” and “real” line plasma were investigated using a high-speed camera under different discharge conditions, such as slot gap width and power. Using wide slot gaps (0.5 mm) and low powers (microwave power, the plasma mode changed from the pseudo to real line plasma mode, i.e., the spatiotemporally uniform plasma mode along the slot. A gas temperature was obtained from N2 second positive band spectra as low as 400 K. The movement of the plasma in the pseudo line plasma mode was well explained by a one-dimensional diffusion model including the spatial distribution of the ionization rate in a moving plasma.

  20. 8 CFR 245a.4 - Adjustment to lawful resident status of certain nationals of countries for which extended...

    Science.gov (United States)

    2010-01-01

    ... applicant who may provide: (A) Evidence of a history of employment (i.e., employment letter, W-2 forms...) (narcotics) except for a single offense of simple possession of thirty grams or less of marijuana; (C..., income and vocation. (C) An alien who has a consistent employment history which shows the ability...

  1. A simulation approach to material removal in microwave drilling of soda lime glass at 2.45 GHz

    Science.gov (United States)

    Lautre, Nitin Kumar; Sharma, Apurbba Kumar; Pradeep, Kumar; Das, Shantanu

    2015-09-01

    Material removal during microwave drilling is basically due to thermal ablation of the material in the vicinity of the drilling tool. The microtip of the tool, also termed as concentrator, absorbs microwaves and ionizes the dielectric in its proximity creating a zone of plasma. The plasma takes the shape of a sphere owing to the atmospheric sphere, which acts as the source of thermal energy to be used for processing a material. This mechanism of heating, also called localized microwave heating, was used in the present study to drill holes in 1.2-mm-thick soda lime glass. The mechanism of material removal had been analyzed through simulation of the hot spot region, and the results were attempted to explain through experiment observations. It was realized that the glass being a poor conductor of heat, a low power (90 W in this case) yields better drilling results owing to more localized heat corresponding to a low-volume plasma sphere. The low application time prevents further heat transfer, and a localized concentration of heat becomes possible that primarily causes the material ablation. The plasma sphere appears sustain while the tool moves through the bulk of the glass thickness although its volume gets further shrunk. The process needs careful selection of the parameters. The simulation results show relatively low temperature in the top half (opposite to the tool tip) of the plasma sphere which eventually causes the semimolten viscous glass to collapse into the drill cavity as the tool advances into the bulk and stops the movement of the tool. The continued plasma sphere raises the tip temperature, which makes the tip to melt and gets blunt. The plasma formation ceases owing to larger diameter of the tool, and the tool gets stuck which could be verified through experimental results.

  2. Structural Stability and Deformation of Solvated Sm@C2(45)-C90 under High Pressure.

    Science.gov (United States)

    Cui, Jinxing; Yao, Mingguang; Yang, Hua; Liu, Ziyang; Liu, Shijie; Du, Mingrun; Li, Quanjun; Liu, Ran; Cui, Tian; Liu, Bingbing

    2016-01-01

    Solvated fullerenes recently have been shown to exhibit novel compression behaviors compared with the pristine fullerenes. However, less attention has been focused on the large cage endohedral metallofullerenes. Here, we have firstly synthesized solvated Sm@C90 microrods by a solution drop-drying method, and then studied the transformations under high pressure. The pressure-induced structural evolutions of Sm@C90 molecules both undergo deformation and collapse. The band gaps of both samples decrease with increasing pressure. The trapped Sm atom plays a role in restraining the compression of the adjacent bonds. The solvent plays a role in protecting Sm@C90 against collapse in the region of 12-20 GPa, decreasing and postponing the change of band gap. Above 30 GPa, the carbon cages collapse. Released from 45 GPa, the compressed solvated Sm@C90 forms a new ordered amorphous carbon cluster (OACC) structure with metal atoms trapped in the units of amorphous carbon clusters, which is different from the OACC structure formed by compressing solvated C60 and C70. This discovery opens the door for the creation of new carbon materials with desirable structural and physical properties when suitable starting materials are selected. PMID:27503144

  3. 8 CFR 245.15 - Adjustment of status of certain Haitian nationals under the Haitian Refugee Immigrant Fairness...

    Science.gov (United States)

    2010-01-01

    ... submission of the application to the Immigration Court in accordance with 8 CFR 240.11(f). If a request for a... terms: Abandoned and abandonment mean that both parents have, or the sole or surviving parent has, or in... obligated to provide such care. Parent, father, or mother means a parent, father, or mother only where...

  4. Computer simulation and experimental study of the polysaccharide-polysaccharide interaction in the bacteria Azospirillum brasilense Sp245

    Science.gov (United States)

    Arefeva, Oksana A.; Kuznetsov, Pavel E.; Tolmachev, Sergey A.; Kupadze, Machammad S.; Khlebtsov, Boris N.; Rogacheva, Svetlana M.

    2003-09-01

    We have studied the conformational properties and molecular dynamics of polysaccharides by using molecular modeling methods. Theoretical and experimental results of polysaccharide-polysaccharide interactions are described.

  5. ХАРАКТЕРИСТИКА СТРУКТУРНЫХ ОСОБЕННОСТЕЙ ЛИПОПОЛИСАХАРИД-БЕЛКОВЫХ КОМПЛЕКСОВ КАПСУЛЫ БАКТЕРИЙ AZOSPIRILLUM BRASILENSE SR80 И SP245 ПРИ РОСТЕ НА АГАРИЗОВАННОЙ СРЕДЕ

    OpenAIRE

    Халэпа, Яна; Евстигнеева, Стелла; Сигида, Елена; Федоненко, Юлия; Коннова, Светлана; Игнатов, Владимир

    2014-01-01

    Проведено сравнительное исследование структурных особенностей липополисахарид-белковых комплексов (ЛПБК) из капсульного материала бактерий Azospirillum brasilense SR80 и Sp245, выращенных в жидкой и агаризованной питательных средах. Анализ данных ГЖХ и ЯМР-спектроскопии выявил отличия структуры липидной и полисахаридной составляющих ЛПБК исследуемых бактерий, в зависимости от условий их культивирования. Отличительной особенностью ЛПБК обоих штаммов, рост которых осуществлялся на плотной среде...

  6. Monte Carlo modeling and analyses of YALINA-booster subcritical assembly part 1: analytical models and main neutronics parameters.

    Energy Technology Data Exchange (ETDEWEB)

    Talamo, A.; Gohar, M. Y. A.; Nuclear Engineering Division

    2008-09-11

    This study was carried out to model and analyze the YALINA-Booster facility, of the Joint Institute for Power and Nuclear Research of Belarus, with the long term objective of advancing the utilization of accelerator driven systems for the incineration of nuclear waste. The YALINA-Booster facility is a subcritical assembly, driven by an external neutron source, which has been constructed to study the neutron physics and to develop and refine methodologies to control the operation of accelerator driven systems. The external neutron source consists of Californium-252 spontaneous fission neutrons, 2.45 MeV neutrons from Deuterium-Deuterium reactions, or 14.1 MeV neutrons from Deuterium-Tritium reactions. In the latter two cases a deuteron beam is used to generate the neutrons. This study is a part of the collaborative activity between Argonne National Laboratory (ANL) of USA and the Joint Institute for Power and Nuclear Research of Belarus. In addition, the International Atomic Energy Agency (IAEA) has a coordinated research project benchmarking and comparing the results of different numerical codes with the experimental data available from the YALINA-Booster facility and ANL has a leading role coordinating the IAEA activity. The YALINA-Booster facility has been modeled according to the benchmark specifications defined for the IAEA activity without any geometrical homogenization using the Monte Carlo codes MONK and MCNP/MCNPX/MCB. The MONK model perfectly matches the MCNP one. The computational analyses have been extended through the MCB code, which is an extension of the MCNP code with burnup capability because of its additional feature for analyzing source driven multiplying assemblies. The main neutronics parameters of the YALINA-Booster facility were calculated using these computer codes with different nuclear data libraries based on ENDF/B-VI-0, -6, JEF-2.2, and JEF-3.1.

  7. Safety Evaluation Report related to the full-term operating license for Millstone Nuclear Power Station, Unit No. 1 (Docket No. 50-245)

    International Nuclear Information System (INIS)

    The Safety Evaluation Report for the full-term operating license application filed by the Connecticut Light and Power Company, the Hartford Electric Light Company, Western Massachusetts Electric Company and the Millstone Point Company [(now known as Connecticut Light and Power Company (CL and P) and Western Massachusetts Electric Company (WMECO) having authority to possess Millstone-1, 2, and 3, and the Northeast Nuclear Energy Company (NNECO) as the responsible entity for operation of the facilities)] for Millstone Nuclear Power Station Unit 1 has been prepared by the Office of Nuclear Reactor Regulation of the US Nuclear Regulatory Commission. The facility is located in the town of Waterford, Connecticut. Subject to favorable resolution of the items discussed in this report, the staff concludes that the facility can continue to be operated without endangering the health and safety of the public

  8. Pheromone synthesis. Part 245: Synthesis and chromatographic analysis of the four stereoisomers of 4,8-dimethyldecanal, the male aggregation pheromone of the red flour beetle, Tribolium castaneum

    Science.gov (United States)

    All four stereoisomers of 4,8-dimethyldecanal (1) were synthesized from the enantiomers of 2-methyl-1-butanol and citronellal. Enantioselective GC analysis enabled separation of (4R,8R)-1 and (4R,8S)-1 from a mixture of (4S,8R)-1 and (4S,8S)-1, when octakis- (2,3-di-O-methoxymethyl-6-O-t-butyldimet...

  9. 4-[(E-(2,4,5-Trimethoxybenzylideneamino]-1,5-dimethyl-2-phenyl-1H-pyrazol-3(2H-one

    Directory of Open Access Journals (Sweden)

    Hoong-Kun Fun

    2010-07-01

    Full Text Available The title compound, C21H23N3O4, adopts an E configuration about the central C=N double bond and the pyrazolone ring is almost planar, with a maximum deviation of 0.042 (1 Å. The central pyrazolone ring makes dihedral angles of 51.96 (5 and 3.82 (5° with the attached phenyl and the trimethoxy-substituted benzene rings, respectively. The dihedral angle between the phenyl ring and the trimethoxy-substituted benzene ring is 50.19 (5° and an intramolecular C—H...O hydrogen bond generates an S(6 ring motif. The crystal structure is stabilized by intermolecular C—H...O and C—H...N hydrogen bonds.

  10. Charged pion form factor between $Q^2$=0.60 and 2.45 GeV$^2$. II. Determination of, and results for, the pion form factor

    Energy Technology Data Exchange (ETDEWEB)

    Huber, Garth; Blok, Henk; Horn, Tanja; Beise, Elizabeth; Gaskell, David; Mack, David; Tadevosyan, Vardan; Volmer, Jochen; Abbott, David; Aniol, Konrad; Anklin, Heinz; Armstrong, Christopher; Arrington, John; Assamagan, Ketevi; Avery, Steven; Baker, O.; Barrett, Robert; Bochna, Christopher; Boeglin, Werner; Brash, Edward; Breuer, Herbert; Chang, C.; Chang, C.C.; Chant, Nicholas; Christy, Michael; Dunne, James; Eden, Thomas; Ent, Rolf; Fenker, Benjamin; Gibson, Edward; Gilman, Ronald; Gustafsson, Kenneth; Hinton, Wendy; Holt, Roy; Jackson, Harold; uk Jin, Seong; Jones, Mark; Keppel, Cynthia; Kim, pyunghun; Kim, Wooyoung; King, Paul; Klein, Andreas; Koltenuk, Douglas; Kovaltchouk, Vitali; Liang, Meihua; Liu, Jinghua; Lolos, George; Lung, Allison; Margaziotis, Demetrius; Markowitz, Pete; Matsumura, Akihiko; McKee, David; Meekins, David; Mitchell, Joseph; Miyoshi, Toshinobu; Mkrtchyan, Hamlet; Mueller, Robert; Niculescu, Gabriel; Niculescu, Maria-Ioana; Okayasu, Yuichi; Pentchev, Lubomir; Perdrisat, Charles; Pitz, David; Potterveld, David; Punjabi, Vina; Qin, Liming; Reimer, Paul; Reinhold, Joerg; Roche, Julie; Roos, Philip; Sarty, Adam; Shin, Ilkyoung; Smith, Gregory; Stepanyan, Stepan; Tang, Liguang; Tvaskis, Vladas; van der Meer, Rob; Vansyoc, Kelley; Van Westrum, Derek; Vidakovic, Sandra; Vulcan, William; Warren, Glen; Wood, Stephen; Xu, Chen; Yan, Chen; Zhao, Wenxia; Zheng, Xiaochao; Zihlmann, Benedikt

    2008-10-01

    DOI: http://dx.doi.org/10.1103/PhysRevC.78.045203
    The charged pion form factor, Fpi(Q2), is an important quantity that can be used to advance our knowledge of hadronic structure. However, the extraction of Fpi from data requires a model of the 1H(e,e'pi+)n reaction and thus is inherently model dependent. Therefore, a detailed description of the extraction of the charged pion form factor from electroproduction data obtained recently at Jefferson Lab is presented, with particular focus given to the dominant uncertainties in this procedure. Results for Fpi are presented for Q2=0.60-2.45 GeV2. Above Q2=1.5 GeV2, the Fpi values are systematically below the monopole parametrization that describes the low Q2 data used to determine the pion charge radius. The pion form factor can be calculated in a wide variety of theoretical approaches, and the experimental results are compared to a number of calculations. This comparison is helpful in understanding the role of soft versus hard c

  11. Integrated-plant-safety assessment Systematic Evaluation program. Millstone Nuclear Power Station, Unit 1, Northeast Nuclear Energy Company, Docket No. 50-245

    International Nuclear Information System (INIS)

    The Systematic Evaluation Program was initiated in February 1977 to review the designs of older operating nuclear reactor plants to reconfirm and document their safety. The review provides: (1) an assessment of how these plants compare with current licensing safety requirements relating to selected issues, (2) a basis for deciding on how these differences should be resolved in an integrated plant review, and (3) a documented evaluation of plant safety. This report documents the review of the Millstone Nuclear Power Station, Unit 1, operated by Northeast Nuclear Energy Company (located in Waterford, Connecticut). Millstone Nuclear Power Station, Unit 1, is one of ten plants reviewed under Phase II of this program. This report indicates how 137 topics selected for review under Phase I of the program were addressed. Equipment and procedural changes have been identified as a result of the review. It is expected that this report will be one of the bases in considering the issuance of a full-term operating license in place of the existing provisional operating license

  12. 40 CFR 180.426 - 2-[4,5-Dihydro-4-methyl-4-(1-methylethyl)-5-oxo-1H-imidazol-2-yl]-3-quinoline carboxylic acid...

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 23 2010-07-01 2010-07-01 false 2- -3-quinoline carboxylic acid... Tolerances § 180.426 2- -3-quinoline carboxylic acid; tolerance for residues. A tolerance is established for residues of the herbicide 2- -3-quinoline carboxylic acid, in or on the raw agricultural commodity...

  13. Knowledge about epilepsy by students and staff of a school in Fortaleza-CE - doi:10.5020/18061230.2009.p245

    OpenAIRE

    Janaiana Lemos Uchoa; Eliane Magalhães de Brito; Rita Neuma Dantas Cavalcante de Abreu; Thereza Maria Magalhães Moreira; Lucilane Maria Sales da Silva; Silvânia Maria Mendes Vasconcelos; Maria Rocineide Ferreira da Silva

    2012-01-01

    Objective: To assess the knowledge of teachers, students and employees of a school about epilepsy. Methods: A descriptive cross-sectional, quantitative study held in a school in Fortaleza - CE. The universe consisted of all students and staff at the school who met the following inclusion criteria: to be a student or employee of the night shift, to be 18 years old or above. Data collection occurred in September 2007, by applying a structured questionnaire. From 69 questionnaires, 50 were...

  14. Simulation and measurement of very fast transient over voltages in a 245kv GIS and research on suppressing method using ferrite rings

    OpenAIRE

    J.V.G. Rama Rao; J. Amarnath; S. Kamakshaiah

    2010-01-01

    Very fast transient over voltages are generated during the switching of disconnections in gas insulated substation. Such over voltages can cause mal functioning of protection circuits and control circuits and also initiates faults and influence on other components such as transformers. The suppression of VFTO (Very fast transient over voltage) is very important in GIS systems. There are some deficiencies in the existing suppressing methods. In this paper new idea for the suppressing VFTO by f...

  15. Effect of electromagnetic fields at 2.45 GHz on the levels of cellular stress proteins HSP-90 and 70 in the rat thyroid

    International Nuclear Information System (INIS)

    In this study we analyzed the cellular stress levels achieved by heat shock proteins (HSP) 90 and 70 in rat thyroid tissue after exposure to radio waves in TWG experimental system. Parallel measurements of body stress in animals by rectal temperature probes allow us to determine whether there is any interaction between temperature increases and cellular stress.

  16. Integrated safety assessment report: Integrated Safety Assessment Program: Millstone Nuclear Power Station, Unit 1 (Docket No. 50-245): Draft report

    International Nuclear Information System (INIS)

    The Integrated Safety Assessment Program (ISAP) was initiated in November 1984, by the US Nuclear Regulatory Commission to conduct integrated assessments for operating nuclear power reactors. The integrated assessment is conducted in a plant-specific basis to evaluate all licensing actions, licensee initiated plant improvements and selected unresolved generic/safety issues to establish implementation schedules for each item. In addition, procedures will be established to allow for a periodic updating of the schedules to account for licensing issues that arise in the future. This report documents the review of Millstone Nuclear Power Station, Unit No. 1, operated by Northeast Nuclear Energy Company (located in Waterford, Connecticut). Millstone Nuclear Power Station, Unit No. 1, is one of two plants being reviewed under the pilot program for ISAP. This report indicates how 85 topics selected for review were addressed. This report presents the staff's recommendations regarding the corrective actions to resolve the 85 topics and other actions to enhance plant safety. The report is being issued in draft form to obtain comments from the licensee, nuclear safety experts, and the Advisory Committee for Reactor Safeguards (ACRS). Once those comments have been resolved, the staff will present its positions, along with a long-term implementation schedule from the licensee, in the final version of this report

  17. Integrated Plant Safety Assessment: Systematic Evaluation Program. Millstone Nuclear Power Station, Unit 1, Northeast Nuclear Energy Company, Docket No. 50-245. Final report

    International Nuclear Information System (INIS)

    This report documents the review of the Millstone Nuclear Power Station, Unit 1, operated by Northeast Nuclear Energy Company (located in Waterford, Connecticut). Millstone Nuclear Power Station, Unit 1, is one of ten plants reviewed under Phase II of this program. This report indicates how 137 topics selected for review under Phase I of the program were addressed. Equipment and procedural changes have been identified as a result of the review. It is expected that this report will be one of the bases in considering the issuance of a full-term operating license in place of the existing provisional operating license. This report also addresses the comments and recommendations made by the Advisory Committee on Reactor Safeguards in connection with its review of the Draft Report, issued in November 1982

  18. Long-Term Follow-Up of 24.5 Years After Intra-Articular Anterior Cruciate Ligament Reconstruction With Lateral Extra-Articular Augmentation

    OpenAIRE

    PERNIN, Jérôme; Verdonk, Peter C. M.; AIT SI SELMI, Tarik; Massin, Philippe; Neyret, Philippe

    2010-01-01

    Background: Many studies have reported successful outcomes 10 to 15 years after ACL reconstruction. However, few authors report results at ultra long-term follow-up (more than 20 years of follow-up). Purpose: The aim of this study was to determine how the status of the medial meniscus and the medial compartment articular cartilage observed at the time of ACL reconstruction affects results more than 24 years after surgery. This article examines longterm outcome of ACL reconstruction with extra...

  19. 8 CFR 245.13 - Adjustment of status of certain nationals of Nicaragua and Cuba under Public Law 105-100.

    Science.gov (United States)

    2010-01-01

    ... Immigration Court in accordance with 8 CFR 240.11(f). If a request for a fee waiver is denied, the applicaion... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Adjustment of status of certain nationals... DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS ADJUSTMENT OF STATUS TO THAT OF PERSON ADMITTED...

  20. Simulation and Experimental Studies of a 2.45GHz Magnetron Source for an SRF Cavity with Field Amplitude and Phase Controls

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Haipeng [Thomas Jefferson National Accelerator Facility (TJNAF), Newport News, VA (United States); Plawski, Tomasz E. [Thomas Jefferson National Accelerator Facility (TJNAF), Newport News, VA (United States); Rimmer, Robert A. [Thomas Jefferson National Accelerator Facility (TJNAF), Newport News, VA (United States); Dudas, A. [Muons Inc., Batavia, IL (United States); Neubauer, M. L. [Muons Inc., Batavia, IL (United States)

    2016-06-01

    Phase lock to an SRF cavity by using injection signal through output waveguide of a magnetron has been demonstrated [1, 3]. Amplitude control using magnetic field trimming and anode voltage modulation has been studied using MATLAB/Simulink simulations [2]. Based on these, we are planning to use an FPGA based digital LLRF system, which allows applying various types of control algorithms in order to achieve the required accelerating field stability. Since the 1497 MHz magnetron is still in the design stage, the proof of principle measurements of a commercial 2450 MHz magnetron are carried out to characterize the anode I-V curve, output power (the tube electronic efficiency), frequency dependence on the anode current (frequency pushing) and the Rieke diagram (frequency pulling by the reactive load). Based on early Simulink simulation, experimental data and extension of the Adler equation governing injection phase stability by Chen’s model, the specification of the new LLRF control chassis for both 2450 and 1497MHz systems are presented in this paper.

  1. Charged pion form factor between Q^2=0.60 and 2.45 GeV^2. II. Determination of, and results for, the pion form factor

    CERN Document Server

    Huber, G M; Horn, T; Beise, E J; Gaskell, D; Mack, D J; Tadevosyan, V; Volmer, J; Abbott, D; Aniol, K; Anklin, H; Armstrong, C; Arrington, J; Assamagan, K; Avery, S; Baker, O K; Barrett, B; Bochna, C; Boeglin, W; Brash, E J; Breuer, H; Chang, C C; Chant, N; Christy, M E; Dunne, J; Eden, T; Ent, R; Gibson, E; Gilman, R; Gustafsson, K; Hinton, W; Holt, R J; Jackson, H; Jin, S; Jones, M K; Keppel, C E; Kim, P H; Kim, W; King, P M; Klein, A; Koltenuk, D; Kovaltchouk, V; Kiang, M; Liu, J; Lolos, G J; Lung, A; Margaziotis, D J; Markowitz, P; Matsumura, A; McKee, D; Meekins, D; Mitchell, J; Miyoshi, T; Mkrtchyan, H; Müller, B; Niculescu, G; Niculescu, I; Okayasu, Y; Pentchev, L; Perdrisat, C; Pitz, D; Potterveld, D; Punjabi, V; Qin, L M; Reimer, P; Reinhold, J; Roche, J; Roos, P G; Sarty, A; Shin, I K; Smith, G R; Stepanyan, S; Tang, L G; Tvaskis, V; Van der Meer, R L J; Vansyoc, K; Van Westrum, D; Vidakovic, S; Vulcan, W; Warren, G; Wood, S A; Xu, C; Yan, C; Zhao, W -X; Zheng, X; Zihlmann, B

    2008-01-01

    The charged pion form factor, Fpi(Q^2), is an important quantity which can be used to advance our knowledge of hadronic structure. However, the extraction of Fpi from data requires a model of the 1H(e,e'pi+)n reaction, and thus is inherently model dependent. Therefore, a detailed description of the extraction of the charged pion form factor from electroproduction data obtained recently at Jefferson Lab is presented, with particular focus given to the dominant uncertainties in this procedure. Results for Fpi are presented for Q^2=0.60-2.45 GeV^2. Above Q^2=1.5 GeV^2, the Fpi values are systematically below the monopole parameterization that describes the low Q^2 data used to determine the pion charge radius. The pion form factor can be calculated in a wide variety of theoretical approaches, and the experimental results are compared to a number of calculations. This comparison is helpful in understanding the role of soft versus hard contributions to hadronic structure in the intermediate Q^2 regime.

  2. Investigation of an experimental ejector refrigeration machine operating with refrigerant R245fa at design and off-design working conditions. Part 1. Theoretical analysis

    KAUST Repository

    Shestopalov, K.O.

    2015-07-01

    © 2015 Elsevier Ltd and IIR.All rights reserved. The ejector refrigeration machine (ERM) offers several advantages over other heat-driven refrigeration machine, including simplicity in design and operation, high reliability and low installation cost, which enable its wide application in the production of cooling. In this paper the theoretical analysis of ejector design and ejector refrigeration cycle performance is presented. It is shown that ERM performance characteristics depend strongly on the operating conditions, the efficiency of the ejector used, and the thermodynamic properties of the refrigerant used. A 1-D model for the prediction of the entrainment ratio ω, and an optimal design for ejectors with cylindrical and conical-cylindrical mixing chambers are presented in this paper. In order to increase ERM performance values, it is necessary first of all to improve the performance of the ejector.

  3. Environmental assessment for the Satellite Power System (SPS): Studies of honey bees exposed to 2.45 GHz continuous wave electromagnetic energy

    Science.gov (United States)

    Gary, N. E.; Westerdahl, B. B.

    1980-01-01

    Post treatment brood development was normal and teratological effects were not detected at exposures of 3 to 50 mw sq cm for 30 minutes. Post treatment survival, longevity, orientation, navigation, and memory of adult bees were also normal after exposures of 3 to 50 mw sq cm for 30 minutes. Post treatment longevity of confined bees in the laboratory was normal after exposures of 3 to 50 mw sq cm for 24 hours. Thermoregulation of brood nest, foraging activity, brood rearing, and social interaction were not affected by chronic exposure to 1 mw sq cm during 28 days. In dynamic behavioral bioassays the frequency of entry and duration of activity of unrestrained, foraging adult bees was identical in microwave exposed areas versus control areas.

  4. Polinização por Apis mellifera em soja transgênica [Glycine max (L. Merrill] Roundup Ready™ cv. BRS 245 RR e convencional cv. BRS 133 = Pollination by Apis mellifera in transgenic soy (Glycine max (L. Merrill Roundup Ready™ cv. BRS 245 RR and conventional cv. BRS 133

    Directory of Open Access Journals (Sweden)

    Tais da Silva Lopes

    2008-04-01

    Full Text Available O objetivo deste estudo foi verificar a influência de Apis mellifera na produção de grãos e qualidade de sementes da soja transgênica Glycine max (L. Merrill Roundup Ready™ e convencional. A soja transgênica foi plantada intercalada com a convencional, em 18 parcelas, em três tratamentos: gaiolas com abelhas A. mellifera, gaiolas sem abelhas e áreas descobertas, com livre visitação de insetos. Na soja transgênica, em três parcelas de cada tratamento, foi aplicado glifosato, 30 dias após a emergência. Os parâmetros analisados foram: produção de grãos; número de vagens por planta; peso de 100 sementes e porcentagem de germinação das sementes. Não houve diferença entre as cultivares, entretanto a produção de 2.757,40 kg ha-1 obtida na área coberta por gaiola com abelhas, e2.828,47 kg ha-1 na área livre para visitação de insetos foram superiores a 2.000,53 kg ha-1 da área coberta por gaiola sem abelhas. O número de vagens por planta foi maior na área coberta por gaiola com abelhas (38,28 e área livre (32,65, quando comparado com o daárea coberta por gaiola sem abelhas (21,19. O peso médio de 100 sementes e a germinação das sementes não foram diferentes entre as cultivares e nem entre os tratamentos. Concluise que, para as cultivares estudadas, houve benefício na produção de grãos de 37,84%,quando foi permitida a visita de abelhas.This research was carried out to evaluate the influence of Africanized honeybees in grain production and seed quality of Glycine max (L. Merrill Roundup Ready™ transgenic soy, as well as of conventional soy. Transgenic soy was interposed with conventional soybean, in 18 plots and three treatments: covered area with Africanized honeybees, covered area without honeybees, and uncovered area with free insect visitation. The herbicide Glyphosate was applied on three plots of each treatment of transgenic soy, 30 days after emergence. Grain production, number of pods/plant, weight per 100 seeds, and seed germination percentage were evaluated. There was no difference among cultivars; however, the production in the covered area with honeybees (2757.4 kg ha-1 and in the uncovered area (2828.47 kg ha-1 were higher than in the covered area without honeybees (2000.53 kg ha-1. The number of pods/plant was greater than in the covered area with honeybees (38.28 and in the uncovered area (32.65 as compared to the covered area without honeybees (21.19. The weight per 100 seeds seed germination did not differ among cultivars or treatments. It can be concluded that, for these cultivars, there was a rise in grain production of 37.84% when honeybee visits were allowed.

  5. Production and action pattern of inulinase from Aspergillus Niger-245: hydrolysis of inulin from several sources Produção e mecanismo de ação de inulinase de Aspergillus niger-245: hidrólise de inulinas de diferentes origens

    OpenAIRE

    Vinícius D’Arcadia Cruz; Juliana Gisele Belote; Márcia Zilioli Belline; Rubens Cruz

    1998-01-01

    A strain of Aspergillus niger isolated from soil samples showed great capacity to produce extracellular inulinase. Although the enzyme has been synthesized in presence of monosaccharides, sucrose and sugar cane molasse, the productivity was significantly higher (p

  6. Production and action pattern of inulinase from Aspergillus Niger-245: hydrolysis of inulin from several sources Produção e mecanismo de ação de inulinase de Aspergillus niger-245: hidrólise de inulinas de diferentes origens

    Directory of Open Access Journals (Sweden)

    Vinícius D’Arcadia Cruz

    1998-10-01

    Full Text Available A strain of Aspergillus niger isolated from soil samples showed great capacity to produce extracellular inulinase. Although the enzyme has been synthesized in presence of monosaccharides, sucrose and sugar cane molasse, the productivity was significantly higher (pUma linhagem de Aspergillus niger isolada de amostras de solo mostrou grande capacidade de produzir inulinase extracelular. Embora a enzima tenha sido sintetizada na presença de monossacarídeos, sacarose e melaço de cana, a produtividade foi significativamente maior (p<0.01 quando o microrganismo foi inoculado em meios formulados com extrato de dália e inulina pura, como fontes de carbono. Em relação à fonte de nitrogênio, os melhores resultados foram obtidos com caseína e outras fontes de nitrogênio proteico, comparativamente ao nitrogênio mineral. Entretanto, somente foi encontrada significância (p<0.01 entre a produtividade obtida nos meios preparados com caseína e sulfato de amônia. O pH ótimo da enzima purificada foi localizado entre 4.0 e 4.5 e a temperatura ótima a 60ºC. Quando tratada por 30 minutos nesta temperatura nenhuma perda de atividade foi observada. A enzima mostrou capacidade de hidrolisar sacarose, rafinose e inulina, da qual liberou apenas unidades de frutose, mostrando, portanto, um mecanismo de exo-ação. Atuando sobre inulinas de diversas fontes, a enzima mostrou maior velocidade de hidrólise sobre o polissacarídeo da chicória, comparativamente, às inulinas de raízes de dalia e alcachofra.

  7. Determination of the residues of 2,4-D and 2,4,5-T in textiles by gas chromatography/mass spectrography%纺织品中2,4-滴和2,4,5-涕残留量的测定

    Institute of Scientific and Technical Information of China (English)

    黄玉英; 牟峻; 王明泰; 赵庆松; 吴剑

    2005-01-01

    纺织品试样用酸性丙酮水溶液提取,提取液经二氯甲烷液-液分配提取后,再用甲醇-三氟化硼乙醚溶液甲酯化,经正己烷提取,用配有质量选择检测器的气相色谱仪(GC/MSD)测定,外标法定量,采用选择离子检测进行阳性确证.该方法回收率为88.8%~97.3%,相对标准偏差为2.41%~8.91%.

  8. Effect of electromagnetic fields at 2.45 GHz on the levels of cellular stress proteins HSP-90 and 70 in the rat thyroid; Efecto de los campos electromagneticos a 2,45 GHz sobre los niveles de proteinas de estres celular HSP-90 y 70 en el toroides de rata

    Energy Technology Data Exchange (ETDEWEB)

    Misa Agustino, M. J.; Alvarez-Folgueras, M.; Jorge-Mora, M. T.; Jorge Barreiro, F. J.; Ares Pena, F. J.; Lleiro, J.; Lopez Martin, M. E.

    2011-07-01

    In this study we analyzed the cellular stress levels achieved by heat shock proteins (HSP) 90 and 70 in rat thyroid tissue after exposure to radio waves in TWG experimental system. Parallel measurements of body stress in animals by rectal temperature probes allow us to determine whether there is any interaction between temperature increases and cellular stress.

  9. A new shipping container for an intense neutron emitter

    International Nuclear Information System (INIS)

    Californium-252 is an intense neutron emitter (2.34 x 1012 n/s·g) used in medicine, research, and industry. The western world's sole source of this rare radioisotope is the Californium Facility at Oak Ridge National Laboratory's Radiochemical Engineering Development Center (REDC). A project has been initiated at the REDC to design a new Type B Californium Shipping Container. This effort is essential for future transportation of californium to meet the needs of users all over the world. The shipping container must meet all requirements for transport by motor freight, air, vessel, and rail, both domestic and foreign. There are unique problems in the design, fabrication, and licensing of a new Type B shipping container that will accommodate up to 60 milligrams of californium-252. One of the first challenges in the design phase of the project is the selection of a material to shield the high neutron flux. The more stringent safety precautions of today's world impel us to consider more exotic materials for such a purpose. The candidate materials must be examined not just for their neutron shielding properties, but also in conjunction with other properties such as thermal and structural requirements to withstand the hypothetical accident conditions. The design and building of such a container is a formidable task requiring much planning. The licensing process, with the complex, interactive federal codes, is a special challenge and may be the biggest on the project in terms of time and money

  10. Application of Cf for the quantitative measurement of nuclear reactor fuel materials

    International Nuclear Information System (INIS)

    Sensitive and rapid measurements of the quantity and geometric distribution of nuclear reactor fuel materials can be made using neutrons from californium. The neutron-induced fission rate in these materials may be measured by detection of either prompt radiations from fission or delayed radiations from radioactive fission products. A number of californium-based instruments are presently in use by the nuclear industry for purposes of process control, quality control, nuclear materials safeguards, and environmentl assessment. An Automated Fuel Rod Scanner (AFRS) is used for high-speed measurement of the uniformity of loading and total fissile content of reactor fuel rods. The fuel rods are moved first through an irradiator containing about 1 mg of californium, and subsequently through high-efficiency detectors for the measurement of fission-product gamma-rays. Multiple detectors on each of two irradiation channels are used to reduce the californium source strength requirement. The fuel loading of each 15-mm-long pellet is tested to +-10% on 100% of the plant throughput. By summing the response over length, the total fissile material content of the fuel rod is measured to better than 0.5%. An on-line computer for data processing allows the instrument to measure about 150 rods per hour with a single operator. The same activation concept is used with a 25-μg californium source in a Small Sample Assay System (SSAS) which measures the fissile content of fuel pellet sized samples with a precision of 0.5%

  11. Crystal Structure of Mg(2+) Containing Hemopexin-Fold Protein from Kabuli Chana (Chickpea-White, CW-25) at 2.45 Å Resolution Reveals Its Metal Ion Transport Property.

    Science.gov (United States)

    Kumar, Suresh; Singh, Avinash; Yamini, Shavait; Dey, Sharmistha; Singh, T P

    2015-08-01

    Plant seeds contain a number of proteins which play important roles in the protection and the process of germination of seeds. We have isolated and purified a 25 kDa protein from Kabuli Chana (Cicer arietinum L., Chickpea-white, CW-25). The CW-25 protein was crystallized using 0.5 M magnesium acetate, 0.1 M sodium cacodylate and 20 % (w/v) polyethylene glycol 8000, pH 6.5. The crystals of CW-25 belonged to space group P3 with unit cell dimensions, a = b = 80.5 Å, and c = 69.2 Å. The structure of CW-25 was determined using molecular replacement method and refined to an R factor of 0.152. The buried surface area between two molecules was found to be approximately 653 Å(2) indicating the formation of a weak homodimer. The polypeptide chain of CW-25 adopted a hemopexin-fold with four-bladed β-propellers. The structure formed a central tunnel-like architecture. A magnesium ion was observed in the centre of the tunnel. It was located at distances varying between 2.3 and 2.7 Å from five oxygen atoms of which four were backbone oxygen atoms belonging to residues, Asn7, Asp65, Asp121 and Asp174 while the fifth oxygen atom, O(δ1) was from the side chain of Asn7. The approximate length of the tunnel was 30 Å. Furthermore, a series of carbonyl oxygen atoms were present along the internal face of the tunnel. The diameter of the tunnel varied from 4.6 to 6.2 Å. The diameter and chemical environment of the tunnel clearly indicated that it might be used for the transport of various metal ions across the molecule. PMID:26242869

  12. Higher Education: Tuition Continues to Rise, but Patterns Vary by Institution Type, Enrollment, and Educational Expenditures. Report to the Chairman, Committee on Education and Labor, House of Representatives. GOA-08-245

    Science.gov (United States)

    Government Accountability Office, 2007

    2007-01-01

    Higher education has increasingly become critical to the nation's cultural, social, and economic well-being, with 90 percent of the fastest-growing jobs in the knowledge economy requiring some postsecondary education. While a college graduate can expect to earn, on average, approximately $1 million more over the course of his or her working life…

  13. REGRA-MATRIZ DE INCIDÊNCIA TRIBUTÁRIA – CRITÉRIO TEMPORAL: O ART. 1.245 DO CÓDIGO CIVIL E O INCISO I DO ART. 35 DO CTN

    Directory of Open Access Journals (Sweden)

    MENDONÇA, João Josué Walmor de

    2008-10-01

    Full Text Available This article aims to explain that the time criterion of the rule-matrix of taxincidence for the tribute of ITBI is not precise about the impact of their hypothesis, which isthe register, as guidance of the institutes of private law. The prevalence of private law at theexpense of tax rules is constitutional requirement, which makes the reading of theconstitutional system and the very nature of the rules of overlay of tax law that focuses. Theobjective is to demonstrate that the time aspect limits the chance of incidence of ITBI that isthe register. By the way, presents inside the deôntico unit, critical elements for the implicativeoperator as a way to establish the iter in the process that will comment on the legislation.O presente artigo tem como finalidade expor que o critério temporal da regramatrizde incidência tributária para o tributo de ITBI não é preciso quanto à sua hipótese deincidência, que é a do registro, conforme orientação dos institutos de direito privado. Aprevalência do direito privado em detrimento das normas tributárias é exigênciaconstitucional, que se faz da leitura do sistema constitucional e da própria natureza dasnormas de superposição do direito tributário que se enfoca. O objetivo é demonstrar que oaspecto temporal limita a hipótese de incidência do ITBI que é o registro. Não sem razão,apresenta, dentro da unidade deôntica, elementos para crítica ao operador implicativo, comoforma de estabelecer um iter no processo que se fará aos textos normativos em comento.

  14. Application of PGNAA to preincineration assay of combustible waste for chlorine

    Energy Technology Data Exchange (ETDEWEB)

    Gehrke, R.J.; Pawelko, R.J.; Greenwood, R.C. [Idaho National Engineering Lab., Idaho Falls, ID (United States)

    1995-12-31

    A prompt gamma neutron activation analysis method is being developed for on-stream pre-incineration assay of low level radioactive combustible waste for it`s chlorine content. The assay system consists of three californium 252 sources and a germanium or scintillation gamma-ray spectrometer.

  15. Magnetic measurements of the transuranium elements. Progress report, January 1, 1984-December 31, 1984

    International Nuclear Information System (INIS)

    Measurements of the magnetic properties of dhcp californium-249 metal indicated the presence of three regions of differing magnetic character. Additional measurements are also reported. Magnetic moments and valence states of terbium in TbF3, BaTbO3, and TbO18 are discussed. Progress on high-field operation of the micro-magnetic susceptometer is reported

  16. Source storage and transfer cask: Users Guide

    International Nuclear Information System (INIS)

    The storage and shield cask for the dual californium source is designed to shield and transport up to 3.7 mg (2 Ci) of 252Cf. the cask meets Department of Transportation (DOT) license requirements for Type A materials (DOT-7A). The cask is designed to transfer sources to and from the Flourinel and Fuel Storage (FAST) facility delayed-neutron interrogator. Californium sources placed in the cask must be encapsulated in the SR-CF-100 package and attached to Teleflex cables. The cask contains two source locations. Each location contains a gear box that allows a Teleflex cable to be remotely moved by a hand crank into and out of the cask. This transfer procedure permits sources to be easily removed and inserted into the delayed-neutron interrogator and reduces personnel radiation exposure during transfer. The radiation dose rate with the maximum allowable quantity of californium (3.7 mg) in the cask is 30 mR/h at the surface and less than 2 mR/h 1 m from the cask surface. This manual contains information about the cask, californium sources, describes the method to ship the cask, and how to insert and remove sources from the cask. 28 figs

  17. Discovery of Isotopes of the Transuranium Elements with 93 <= Z <= 98

    OpenAIRE

    Fry, C; Thoennessen, M

    2012-01-01

    One hundred and five isotopes of the transuranium elements neptunium, plutonium, americium, curium, berkelium and californium have so far been observed; the discovery of these isotopes is discussed. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  18. Purification and characterization of chlorophenol 4-monooxygenase from Burkholderia cepacia AC1100.

    OpenAIRE

    Xun, L

    1996-01-01

    Burkholderia (formerly Pseudomonas) cepacia AC1100 mineralizes the herbicide 2,4,5-trichlorophenoxyacetate (2,4,5-T), and the first intermediate of 2,4,5-T degradation is 2,4,5-trichlorophenol. Chlorophenol 4-monooxygenase activity responsible for 2,4,5-trichlorophenol degradation was detected in the cell extract. The enzyme consisted of two components separated during purification, and both were purified to more than 95% homogeneity. The reconstituted enzyme catalyzed the hydroxylation of se...

  19. Oxidation of microquantities of transplutonium elements to tetravalent state in mineral acid solutions and their stability

    International Nuclear Information System (INIS)

    Kinetics of americium(3) microquantity oxidation and stability of forming americium(4), as well as possibility of curium and californium oxidation to tetravalent state in solutions of sulfuric and nitric acids depending on the concentration of mineral acid, potassium tungstophosphate and ammonium persulfate are studied by the extraction method. It is shown that curium(3) and californium(3) in solutions of 0.05-2.5 mol/l H2SO4 and HNO3 containing 10-3 mol/l potassium tungstophosphate is not practically oxidized by the mixture of silver nitrate and ammonium persulfate. Americium(3) is oxidized to the utmost to Am(4) for 2-3 min at room temperature, but stability of Am(4) depends on the concentration of sulfuric acid and potassium tungstophosphate

  20. Characterization of berkelium(III) dipicolinate and borate compounds in solution and the solid state.

    Science.gov (United States)

    Silver, Mark A; Cary, Samantha K; Johnson, Jason A; Baumbach, Ryan E; Arico, Alexandra A; Luckey, Morgan; Urban, Matthew; Wang, Jamie C; Polinski, Matthew J; Chemey, Alexander; Liu, Guokui; Chen, Kuan-Wen; Van Cleve, Shelley M; Marsh, Matthew L; Eaton, Teresa M; van de Burgt, Lambertus J; Gray, Ashley L; Hobart, David E; Hanson, Kenneth; Maron, Laurent; Gendron, Frédéric; Autschbach, Jochen; Speldrich, Manfred; Kögerler, Paul; Yang, Ping; Braley, Jenifer; Albrecht-Schmitt, Thomas E

    2016-08-26

    Berkelium is positioned at a crucial location in the actinide series between the inherently stable half-filled 5f(7) configuration of curium and the abrupt transition in chemical behavior created by the onset of a metastable divalent state that starts at californium. However, the mere 320-day half-life of berkelium's only available isotope, (249)Bk, has hindered in-depth studies of the element's coordination chemistry. Herein, we report the synthesis and detailed solid-state and solution-phase characterization of a berkelium coordination complex, Bk(III)tris(dipicolinate), as well as a chemically distinct Bk(III) borate material for comparison. We demonstrate that berkelium's complexation is analogous to that of californium. However, from a range of spectroscopic techniques and quantum mechanical calculations, it is clear that spin-orbit coupling contributes significantly to berkelium's multiconfigurational ground state. PMID:27563098

  1. Neutron activation determination of gold in technogenic raw materials with different mineral composition

    OpenAIRE

    Yudakov Aleksandr A.; Ivannikov Sergey I.; Zheleznov Veniamin V.; Taskin Andrei V.; Tsybulskaya Oksana N.

    2015-01-01

    The methods used to determine the gold content in the technogenic objects of gold mining were analyzed regarding their non-homogeneity and complexity of chemical and mineral compositions. A possible application of the neutron activation analysis with the use of the californium source of neutrons for determining the content of fine-grained and extra-fine-grained gold in the technogenic objects, including the bottom-ash waste of energy providers, is considere...

  2. Jak bylo objeveno spontánní štěpení

    Czech Academy of Sciences Publication Activity Database

    Vobecký, Miloslav

    Praha: Spektroskopická společnost J.M. Marci, 2010 - (Vobecký, M.), s. 5-10 ISBN 978-80-904539-0-6. [Seminář Radioanalytické metody IAA 10. Praha (CZ), 30.06.2010-01.07.2010] Institutional research plan: CEZ:AV0Z40310501 Keywords : spontaneous fission * fission -track dating method * californium 252 neutron source Subject RIV: CB - Analytical Chemistry, Separation

  3. Study of heavy particle decay from superheavy elements by SK model

    International Nuclear Information System (INIS)

    Heavy nuclei usually decay by alpha decay or spontaneous fission. These two decay modes are generally the most probable competing processes. Another less probable decay process is cluster radioactivity in which nuclei from carbon to silicon are emitted from Radium to Californium leading to the most stable daughter nucleus, lead. This work reports such a study using the cubic plus Yukawa plus exponential model of Shanmugam and Kamalaharan (SK)

  4. Measurement of the energy spectra of fission fragments using nuclear track detectors and digital image processing

    International Nuclear Information System (INIS)

    Energy spectra of fission fragments were determined using a Nuclear Track Methodology (NTM) supported by digital image analysis and numerical data processing using a standard personal computer. The analysis of a californium (252Cf) spectrum with this approach shows improvement compared with the values reported previously using the standard procedure, in terms of resolution and accuracy. This new method adds full automation to the technical advantages and cost effectiveness of an NTM.

  5. Heavy ion tests on programmable VLSI

    International Nuclear Information System (INIS)

    The radiation from space environment induces operation damages in onboard computers systems. The definition of a strategy, for the Very Large Scale Integrated Circuitry (VLSI) qualification and choice, is needed. The 'upset' phenomena is known to be the most critical integrated circuit radiation effect. The strategies for testing integrated circuits are reviewed. A method and a test device were developed and applied to space applications candidate circuits. Cyclotron, synchrotron and Californium source experiments were carried out

  6. Properties of neutron sources

    International Nuclear Information System (INIS)

    The Conference presentations were divided into sessions devoted to the following topics: white neutron sources, primarily pulsed (6 papers); fast neutron fields (5 papers); Californium-252 prompt fission neutron spectra (14 papers); monoenergetic sources and filtered beams (11 papers); 14 MeV neutron sources (10 papers); selected special application (one paper); and a general interest session (4 papers). Individual abstracts were prepared separately for the papers

  7. Neutron multiplicities for the transplutonium nuclides

    International Nuclear Information System (INIS)

    This paper continues, with respect to the transplutonium nuclides, earlier efforts to collate and evaluate data from the scientific literature on the prompt neutron multiplicity distribution from fission and its first moment = ΣnuPnu. The isotopes considered here for which P/sub nu/ and or data (or both) were found in the literature are of americium (Am), curium (Cm), berkelium (Bk), californium (Cf), einsteinium (Es), fermium (Fm), and nobelium (No)

  8. Researching Identity and Interculturality

    DEFF Research Database (Denmark)

    Lønsmann, Dorte

    2016-01-01

    Review of: Researching Identity and Interculturality / by F. Dervin and K. Risager (eds.). Routledge 2015, 245 pp.......Review of: Researching Identity and Interculturality / by F. Dervin and K. Risager (eds.). Routledge 2015, 245 pp....

  9. 78 FR 11630 - New England Fishery Management Council; Public Meeting

    Science.gov (United States)

    2013-02-19

    ... Colonial, One Audubon Road, Wakefield, MA 01880; telephone: (781) 245-9300; fax: (781) 245-0842. Council... published on December 21, 2011 (76 FR 79153). After completing a scoping period in early summer of...

  10. 24 CFR 990.250 - Requirements for certain appeals.

    Science.gov (United States)

    2010-04-01

    ... appeals. (a) Appeals under § 990.245 (a) and (c) must be submitted once annually. Appeals under § 990.245... applicable Date of Full Availability (DOFA). (b) Appeals under § 990.245 (c) and (e) are subject to the following requirements: (1) The PHA is required to acquire an independent cost assessment of its...

  11. Nuevos desafíos en torno a un viejo debate: propuestas para repensar la educación sexual en las aulas : Elizalde, Silvia; Karina Felitti; Graciela Queirolo (coord.) (2009): Género y sexualidades en las tramas del saber. Revisiones y propuestas. Buenos Aires, Libros del Zorzal, pp. 245.

    OpenAIRE

    Ronconi, María Fernanda

    2013-01-01

    Las trayectorias de formación de las coordinadoras se inscriben dentro de varios campos del saber entre los que se encuentran la Comunicación Social, la Historia y las Letras. A ellas se suman María Lucía Puppo y María Laura Rosa que realizan sus aportes desde la Literatura y las Artes Visuales. Las autoras nos invitan a romper el mito que reduce la sexualidad al sexo, y por extensión, al coito, para comenzar a pensar la sexualidad como una dimensión que atraviesa nuestras vidas no sólo en su...

  12. Dependence of metal partition coefficients in D2EHPA capacity on extraction from acid solutions

    International Nuclear Information System (INIS)

    In devising solvent-extraction schemes for extracting the transplutonium elements (TPE), one usually employs the partition coefficients K/sub p/ for trace amounts; when the results are transferred to weighable amounts of the elements, there are difficulties because one lacks capacity characteristics for the extractants under the conditions used. They have determined the capacity of D2EHPA over a wide range in acidity (0.001-2 mole/liter) in relation to dysprosium (the analog of californium) in the system formed by D2EHPA with nitric acid by saturating a set volume of the extractant with dysprosium in nitric acid containing the necessary amount of free acid

  13. TOWARD AN IMPROVED UNDERSTANDING OF STRUCTURE AND MAGNETISM IN NEPTUNIUM AND PLUTONIUM PHOSPHONATES AND SULFONATES

    Energy Technology Data Exchange (ETDEWEB)

    Albrecht-Schmitt, Thomas

    2012-03-01

    This grant supported the exploratory synthesis of new actinide materials with all of the actinides from thorium to californium with the exceptions of protactinium and berkelium. We developed detailed structure-property relationships that allowed for the identification of novel materials with selective ion-exchange, selective oxidation, and long-range magnetic ordering. We found novel bonding motifs and identified periodic trends across the actinide series. We identified structural building units that would lead to desired structural features and novel topologies. We also characterized many different spectroscopic trends across the actinide series. The grant support the preparation of approximately 1200 new compounds all of which were structurally characterized.

  14. NONDESTRUCTIVE IDENTIFICATION OF CHEMICAL WARFARE AGENTS AND EXPLOSIVES BY NEUTRON GENERATOR-DRIVEN PGNAA

    International Nuclear Information System (INIS)

    Prompt gamma-ray neutron activation analysis (PGNAA) is now a proven method for the identification of chemical warfare agents and explosives in military projectiles and storage containers. Idaho National Laboratory is developing a next-generation PGNAA instrument based on the new Ortec Detective mechanically-cooled HPGe detector and a neutron generator. In this paper we review PGNAA analysis of suspect chemical warfare munitions, and we discuss the advantages and disadvantages of replacing the californium-252 radioisotopic neutron source with a compact accelerator neutron generator

  15. NONDESTRUCTIVE IDENTIFICATION OF CHEMICAL WARFARE AGENTS AND EXPLOSIVES BY NEUTRON GENERATOR-DRIVEN PGNAA

    Energy Technology Data Exchange (ETDEWEB)

    T. R. Twomey; A. J. Caffrey; D. L. Chichester

    2007-02-01

    Prompt gamma-ray neutron activation analysis (PGNAA) is now a proven method for the identification of chemical warfare agents and explosives in military projectiles and storage containers. Idaho National Laboratory is developing a next-generation PGNAA instrument based on the new Ortec Detective mechanically-cooled HPGe detector and a neutron generator. In this paper we review PGNAA analysis of suspect chemical warfare munitions, and we discuss the advantages and disadvantages of replacing the californium-252 radioisotopic neutron source with a compact accelerator neutron generator.

  16. Composition containing transuranic elements for use in the homeopathic treatment of aids

    International Nuclear Information System (INIS)

    A homeopathic remedy consisting of a composition containing one or more transuranic elements, particularly plutonium, for preventing and treating acquired immunodeficiency syndrome (AIDS) in humans, as well as seropositivity for human immunodeficiency virus (HIV). Said composition is characterized in that it uses any chemical or isotopic form of one or more transuranic elements (neptunium, plutonium, americium, curium, berkelium, californium or einsteinium), particularly plutonium, said form being diluted and dynamized according to conventional homeopathic methods, particularly the so-called Hahnemann and Korsakov methods, and provided preferably but not exclusively in the form of lactose and/or saccharose globules or granules impregnated with the active principle of said composition. (author)

  17. Neutron nondestructive essay of the plutonium metal parts

    International Nuclear Information System (INIS)

    Based on the principle of neutron multiplicity and data unfolding mathematics, this paper developed the software which can execute the neutron multiplicity analysis, neutron attenuation analysis, parameter calibration, Pu mass solution with the neutron pulse sequence acquisition method. The measurement system consisted of detector,nuclear electronic apparatus, pulsed sequence acquisition and analysis software was tested and calibrated by californium source. Three mental plutonium components with different mass were used for experimental assay and validation, which showed that the assay bias was within 15% against the nominal value of the samples. (authors)

  18. Physical-chemical studies of transuranium elements. Progress report, April 1, 1982-March 31, 1983

    International Nuclear Information System (INIS)

    Progress is reported on the following topics: electrochemical and spectroscopic studies of less-stable higher oxidation states of transuranium elements in complexing aqueous media; spectroscopic and electrochemical studies of selected lanthanides and actinides in molten dimethyl sulfone; spectroelectronchemical studies of the Ce(IV)/Ce(III) couple in aqueous carbonate solutions; characterization of actinide orthophosphates by Raman and absorption spectrophotometries and by x-ray diffraction; relativistic multiple scattering calculations on transuranium element compounds; Raman spectroscopic studies of natural minerals containing the uranyl ion; and solution calorimetry of californium metal

  19. Transuranium element production. II. Chemical processing of targets

    International Nuclear Information System (INIS)

    The chemical processing described concerns small experimental targets irradiated in OSIRIS or EL-III and industrial targets irradiated in the CELESTIN reactors. In view of the difficulties encountered when processing highly irradiated targets (760MWd.kg-1) by liquid-liquid extraction (interface sludges leading to stable emulsion) the new processes developed are based on inverse phase chromatography. This technique applied to targets of americium 241, plutonium 239 and a plutonium mixture rich in isotope 242 has given tens of milligrams of curium 242, grams of americium 243 and curium 244 and micrograms of californium 252

  20. Detection of rare earth elements in Powder River Basin sub-bituminous coal ash using laser-induced breakdown spectroscopy (LIBS)

    Energy Technology Data Exchange (ETDEWEB)

    Tran, Phuoc [National Energy Technology Lab. (NETL), Pittsburgh, PA, (United State; Mcintyre, Dustin [National Energy Technology Lab. (NETL), Pittsburgh, PA, (United State

    2015-10-01

    We reported our preliminary results on the use of laser-induced breakdown spectroscopy to analyze the rare earth elements contained in ash samples from Powder River Basin sub-bituminous coal (PRB-coal). We have identified many elements in the lanthanide series (cerium, europium, holmium, lanthanum, lutetium, praseodymium, promethium, samarium, terbium, ytterbium) and some elements in the actinide series (actinium, thorium, uranium, plutonium, berkelium, californium) in the ash samples. In addition, various metals were also seen to present in the ash samples

  1. Radiation protection data sheet. Radiation protection data sheets for the use of radionuclides in unsealed sources

    International Nuclear Information System (INIS)

    These radiation protection data sheet are devoted to responsible persons and employees of various laboratories or medical, pharmaceutical, university and industrial departments where radionuclides are handled as well as all the persons who attend to satisfy in this field. They contain the essential radiation protection data for the use of unsealed sources: physical characteristics, risk assessment, administrative procedures, recommendations, regulations and bibliography. This new series includes the following radionuclides: californium 252, curium 244, gallium 67, indium 113m, plutonium 238, plutonium 239, polonium 210, potassium 42, radium 226, thorium 232, uranium 238 and zinc 65. (O.M.)

  2. Study by thermochromatography of fluorides of transuranium elements

    International Nuclear Information System (INIS)

    Thermochromatography was made suitable for fluoride study. So, an investigation of actinide tetrafluorides was accomplished from uranium to californium. Pentavalent and hexavalent fluorospecies of uranium, neptunium, plutonium and ruthenium were studied. Some new compounds have been identified in gaseous phase, whose: PuF5, PuOF3 and PaOF3. Furthermore, some presomptions as for the existence in gaseous phase of EsF4 and of an heptavalent fluorospecies of plutonium have been established. An important analogy between plutonium and ruthenium behaviour with fluorine have been shown, these results could explain the difficulties encountered in the fluoride-volatility processes

  3. PROCEEDINGS OF THE SYMPOSIUM COMMEMORATING THE 25th ANNIVERSARY OF ELEMENTS 97 and 98 HELD ON JAN. 20, 1975

    Energy Technology Data Exchange (ETDEWEB)

    Seaborg, Glenn T.; Street Jr., Kenneth; Thompson, Stanley G.; Ghiorso, Albert

    1976-07-01

    This volume includes the talks given on January 20, 1975, at a symposium in Berkeley on the occasion of the celebration of the 25th anniversary of the discovery of berkelium and californium. Talks were given at this symposium by the four people involved in the discovery of these elements and by a number of people who have made significant contributions in the intervening years to the investigation of their nuclear and chemical properties. The papers are being published here, without editing, in the form in which they were submitted by the authors in the months following the anniversary symposium, and they reflect rather faithfully the remarks made on that occasion.

  4. Method for measuring multiple scattering corrections between liquid scintillators

    Science.gov (United States)

    Verbeke, J. M.; Glenn, A. M.; Keefer, G. J.; Wurtz, R. E.

    2016-07-01

    A time-of-flight method is proposed to experimentally quantify the fractions of neutrons scattering between scintillators. An array of scintillators is characterized in terms of crosstalk with this method by measuring a californium source, for different neutron energy thresholds. The spectral information recorded by the scintillators can be used to estimate the fractions of neutrons multiple scattering. With the help of a correction to Feynman's point model theory to account for multiple scattering, these fractions can in turn improve the mass reconstruction of fissile materials under investigation.

  5. Surface fission tracks in diamond

    International Nuclear Information System (INIS)

    Scanning Probe Microscope (SPM) images reveal important fingerprint features of latent tracks induced in diamond by fission fragments from a californium source. Collimated fission fragments with a binary distribution of the predominant energies of 79.4 and 103.8 MeV, are assumed. Cavities, reticular formations around these cavities, and black spots of graphite were found. A brief discussion on the possible track formation mechanism is given on the basis of the explosion spike theory; an attempt to determine latent track core and halo parameters is included

  6. Use of trioctylphosphine oxide for transplutonium element extraction and purification

    International Nuclear Information System (INIS)

    Investigated was extraction of tri-valent curium, berkelium, californium, einsteinium as well as cerium and europium with trioctylphosphin oxide from lactic acid solutions, containing DTPA and aluminium nitrate depending on the aluminium nitrate and TOPO concentrations and nitric acid solutions of variable concentration as well. Under optimum conditions of extraction chromatography of berkelium studied was the distribution of cobalt, nickel, chromium, iron, aluminium, titanium, zirconium and niobium ions, and the coefficients of berkelium purification from cations investigated were determined. The effect of weight quantities of cation impurities on extraction chromatographic yield of berkelium has been investigated. Examples of practice application of the extraction chromatography with the use of TOPO are given

  7. 49 CFR 40.267 - What problems always cause an alcohol test to be cancelled?

    Science.gov (United States)

    2010-10-01

    ... the case of a screening test conducted on a saliva ASD or a breath tube ASD: (1) The STT or BAT reads... § 40.245(a)(8) for the saliva ASD and § 40.245(b)(8) for the breath tube ASD). (2) The saliva ASD does not activate (see § 40.245(a)(7); or (3) The device is used for a test after the expiration...

  8. Human Herpesviruses 6 and 7 and Central Nervous System Infection in Children1

    OpenAIRE

    Ansari, Asad; Li, Shaobing; Abzug, Mark J.; Weinberg, Adriana

    2004-01-01

    The role and frequency of human herpesviruses (HHV)-6 and -7 in central nervous system (CNS) diseases of children are unclear. Cerebrospinal fluid samples from 245 pediatric patients (median age 43 days), submitted for evaluations of possible sepsis or of neurologic symptoms, were tested for HHV-6 and HHV-7 DNA by polymerase chain reaction. HHV-6 DNA was found in 3 of 245 samples, and HHV-7 was found in 0 of 245 samples. The three patients with HHV-6 DNA were

  9. 75 FR 6398 - Ocean Transportation Intermediary License Applicants

    Science.gov (United States)

    2010-02-09

    ..., Rhett N. Willis, President/CEO, (Qualifying Individual), Richard E. Carter, Chairman. H T International..., COO, (Qualifying Individual), Jean Jacques Lalou, CEO. Geevee Enterprises Inc. dba Aerosend, 245...

  10. Microwave Plasma System: PVA Tepla 300

    Data.gov (United States)

    Federal Laboratory Consortium — Description: CORAL Name: Microwave Asher A tool using microwave oxygen plasma to remove organics on the surfaces Specifications / Capabilities: Frequency: 2.45 GHz...

  11. Monte Carlo aided enhanced design of an neutron scatterometer

    International Nuclear Information System (INIS)

    This paper will present a particular example for the use of the Monte Carlo Method to enhance the performance of a neutron scatterometer, currently employed to detect the void fraction in fast-transient high-pressure water-vapour flow in a rod-bundle channel. The scatterometer relies on measuring the slowing-down of californium-252 neutrons by the hydrogen in the water to determine the liquid, hence vapour (void) content. However, californium-252 is a relatively fast-decaying source and alternative isotopic sources are typically too energetic to provide sufficient moderation given the small amount of liquid in the channel. Monte Carlo simulation were utilized to examine various design enhancement possibilities, including: filtering out unthermalized fast neutrons, amplifying by a fissionable material the amount of detected thermal neutrons, adding a dissolvable contrast material to the liquid phase, or relying on the scattering of fast neutrons by oxygen in water. In addition, methods to determine the distribution of the pattern of liquid-vapour phase in the channel are devised

  12. Dicty_cDB: VSA552 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 04062.3 Homo sapiens BAC clone RP11-11I23 from 4, complete sequence. 38 0.32 6 AZ525583 |AZ525583.1 245PbF09... Pb MBN #21 Plasmodium berghei genomic 3', DNA sequence. 36 0.34 3 AZ525582 |AZ525582.1 245PbF

  13. DIOXINS AND ENDOMETRIOSIS: COHORT STUDY OF WOMEN IN WEST VIRGINIA

    Science.gov (United States)

    Kanawha Valley of West Virginia has a history of 2,3,7,8-tetrachlorodibenzo-p-dioxin contamination (dioxin, TCDD). The bulk of the dioxin found in this area appears to be derived from the production of 2,4,5-trichlorophenoxyacetic acid (2,4,5-T) and the disposal of associated wa...

  14. 78 FR 42863 - Adjustment of Status to That of Person Admitted for Permanent Residence

    Science.gov (United States)

    2013-07-18

    ... SECURITY 8 CFR Part 245 Adjustment of Status to That of Person Admitted for Permanent Residence CFR... (g)(1) to read as follows: Sec. 245.15 Adjustment of status of certain Haitian nationals under the Haitian Refugee Immigrant Fairness Act of 1998 (HRIFA). * * * * * (g) Jurisdiction for filing...

  15. 78 FR 3019 - Privacy Act of 1974; Science & Technology Directorate-001 Research, Development, Test, and...

    Science.gov (United States)

    2013-01-15

    ..., Department of Homeland Security, 245 Murray Lane SW., Washington, DC 20528. For privacy issues, please.... To a congressional office from the record of an individual in response to an inquiry from that... Privacy Office, Mail Stop: 0205, Department of Homeland Security, 245 Murray Lane, SW., Washington,...

  16. 76 FR 49497 - Privacy Act of 1974; Department of Homeland Security/United States Secret Service-001 Criminal...

    Science.gov (United States)

    2011-08-10

    ... contact: Latita Payne (202-406-6370), Privacy Officer, United States Secret Service, 245 Murray Lane, SW.... To a congressional office from the record of an individual in response to an inquiry from that..., 245 Murray Lane SW., Building T-5, Washington, DC 20223. Notification procedure: The Secretary...

  17. 40 CFR 136.3 - Identification of test procedures.

    Science.gov (United States)

    2010-07-01

    ... Sediment by Graphite Furnace-Atomic Absorption Spectrometry” Open File Report (OFR) 98-639. 50 “Methods of..., I-3462-852 Automated 245.2 (Issued 1974) Cold vapor atomic fluorescence spectrometry (CVAFS) 245.7... analysis). For non-platform graphite furnace atomic absorption determinations a digestion using nitric...

  18. AcEST: BP913163 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 6 MVLSNDIDLLHPPAEVEKKKHKLKRLVQSPNSYFMDVKCQACFSITTVFSHSQTVVLCGN 245 MVL NDIDLL+PPAE+EK+KHKLKRLVQSPNS+FMDV...KCQ CF+ITTVFSHSQTVV+CGN Sbjct: 1 MVLQNDIDLLNPPAELEKRKHKLKRLVQSPNSFFMDVKCQGCFNITTVFSHS...ives = 77/84 (91%) Frame = +3 Query: 66 MVLSNDIDLLHPPAEVEKKKHKLKRLVQSPNSYFMDVKCQACFSITTVFSHSQTVVLCGN 245 MVL... NDIDLLHPP E+EK+KHKLKRLVQSPNS+FMDVKCQ CF+ITTVFSHSQTVV+CGN Sbjct: 1 MVLQNDIDLLHPPPELEKRKHKLKRLVQSPNSFFMDVKCQG...Positives = 78/84 (92%) Frame = +3 Query: 66 MVLSNDIDLLHPPAEVEKKKHKLKRLVQSPNSYFMDV

  19. Errata to: Characteristics of humic acid fluvic acids in Arabian Sea sediments

    Digital Repository Service at National Institute of Oceanography (India)

    Sardessai, S.

    stream_size 1 stream_content_type text/plain stream_name Indian_J_Mar_Sci_24_245.pdf.txt stream_source_info Indian_J_Mar_Sci_24_245.pdf.txt Content-Encoding ISO-8859-1 Content-Type text/plain; charset=ISO-8859-1 ...

  20. Refrigerant Selection for Cascade Water-to-water Heat Pump%复叠式水水热泵的制冷剂筛选

    Institute of Scientific and Technical Information of China (English)

    赵海波; 杨昭

    2012-01-01

    结合我国现行制冷剂标准,按照环境相容性、安全性、热工循环性能原则进行了高温复叠式热泵循环的制冷剂筛选,对不同制冷剂组合进行了计算和分析.结果表明,高低温侧制冷剂可采用R245fa/R134a、R245fa/R420A、R245fa/R413A、R245ca/R420A等组合.若进一步考虑制冷剂获得的容易程度、经济性等因素时,可选择R245fa/R134a组合.%Based on China National Standard-Number Designation and Safety Classification of Refrigerants, refrigerant for the cascade water-to-water heat pump were selected according to principles of environmental-friendly, safety and thermodynamic cycle performances. Different refrigerant combinations for high- and low-temperature cycles in the cascade heat pump were calculated and compared. Results show that combinations of R245fa/R134a, R245fa/R420A, R245fa/R413A, R245ca/R420A are better for the cascade heat pump. It also shows that, considering easy access and economy of refrigerants, R245fa/R134a combination will be a better choice.

  1. Thermochemical investigation of δ-Bi2O3 doped by Re2O7 and Sm2O3

    International Nuclear Information System (INIS)

    Highlights: • We synthesized new phase Bi12.5Sm1.5ReO24.5. • We measured formation enthalpy of Bi12.5Sm1.5ReO24.5. • The phase is thermodynamically stable with respect to decomposition into binary oxides at room temperature. - Abstract: The Bi12.5Sm1.5ReO24.5 phase has been synthesized for the first time. The preparation of Bi12.5Sm1.5ReO24.5 has been carried out by solid-state reaction from Bi2O3, Sm2O3, and Re2O7. The X-ray measurements have showed that Bi12.5Sm1.5ReO24.5 was cubic structure (space group Fm3m). The standard molar enthalpy of formation of Bi12.5Sm1.5ReO24.5 has been determined by solution calorimetry combining the enthalpies of dissolution of Bi12.5Sm1.5ReO24.5 and 6.25Bi2O3 + 0.75Sm2O3 + 0.5Re2O7 mixture in 2 M HCl and literature data. It has been obtained that above-mentioned phase is thermodynamically stable with respect to their decomposition into binary oxides at room temperatures

  2. Acaricidal properties of a Chenopodium-based botanical.

    Science.gov (United States)

    Chiasson, H; Bostanian, N J; Vincent, C

    2004-08-01

    The emulsifiable concentrate UDA-245 [25% EC (vol:vol)], based on an essential oil extract from Chenopodium ambrosioides variety ambrosioides, a North American herbaceous plant, was compared with commercially available pesticides for their effectiveness to control the adult stage and egg hatch of the twospotted spider mite, Tetranychus urticae Koch (Acari: Tetranychidae) and the European red mite, Panonychus ulmi (Koch) (Acari: Tetranychidae). After a laboratory bioassay with adult twospotted spider mites, a 0.5% concentration of UDA-245 was more effective than 0.7% (AI) of neem oil (Neem Rose Defense). After a similar bioassay with the European red mite, a 0.5% concentration UDA-245 was as effective as 0.006% (AI) of abamectin (Avid). UDA-245 at 0.5% significantly reduced egg hatch of the twospotted spider mite, 5 and 9 d after treatment and of the European red mite 6 d after treatment. Egg hatch was significantly lower using 0.006% (AI) of abamectin, 0.7% of neem oil, and 1.0% insecticidal soap than UDA-245. Residual tests indicated that UDA-245 may be persistent in the environment only for a few hours. Only 23% mortality was noted when mites were introduced on bean leaves 1 h after treatment with a 2% concentration of UDA-245. At the recommended dose of 0.5%, UDA-245 was not considered phytotoxic for most plants tested, i.e., lettuce, roses, and tomatoes. Results suggest that a greenhouse integrated pest management program using UDA-245 could effectively and selectively control mite infestations by treating "hot spots" with negligible effect on biological control agents when treating before introduction or when natural enemies are absent. PMID:15384350

  3. Neutron radiography for nondestructive testing

    International Nuclear Information System (INIS)

    Neutron radiography is similar to X-ray inspection in that both depend upon use of radiation that penetrates some materials and is absorbed by others to provide a contrast image of conditions not readily available for visual inspection. X-rays are absorbed by dense materials, such as metals, whereas neutrons readily penetrate metals, but are absorbed by materials containing hydrogen. The neutron radiography has been successfully applied to a number of inspection situations. These include the inspection of explosives, advanced composites, adhesively bonded structures and a number of aircraft engine components. With the availability of Californium-252, it has become feasible to construct mobile neutron radiography systems suitable for field use. Such systems have been used for in-situ inspection of flight line aircraft, particularly to locate and measure hidden corrosion

  4. Preparation of actinide targets by electrodeposition

    Science.gov (United States)

    Trautmann, N.; Folger, H.

    1989-10-01

    Actinide targets with varying thicknesses on different substrates have been prepared by electrodeposition either from aqueous solutions or from solutions of their nitrates in isopropyl alcohol. With these techniques the actinides can be deposited almost quantitatively on various backing materials within 15 to 30 min. Targets of thorium, uranium, neptunium, plutonium, americium, curium and californium with areal densities from almost carrier-free up to 1.4 mg/cm 2 on thin beryllium, carbon, titanium, tantalum and platinum foils have been prepared. In most cases, prior to the deposition, the actinides had to be purified chemically and for some of them, due to the limited amount of material available, recycling procedures were required. Applications of actinide targets in heavy-ion reactions are briefly discussed.

  5. An atomic beam source for actinide elements: concept and realization

    International Nuclear Information System (INIS)

    For ultratrace analysis of actinide elements and studies of their atomic properties with resonance ionization mass spectroscopy (RIMS), efficient and stable sources of actinide atomic beams are required. The thermodynamics and kinetics of the evaporation of actinide elements and oxides from a variety of metals were considered, including diffusion, desorption, and associative desorption. On this basis various sandwich-type filaments were studied. The most promising system was found to consist of tantalum as the backing material, an electrolytically deposited actinide hydroxide as the source of the element, and a titanium covering layer for its reduction to the metal. Such sandwich sources were experimentally proven to be well suited for the production of atomic beams of plutonium, curium, berkelium and californium at relatively low operating temperatures and with high and reproducible yields. (orig.)

  6. Environmental assessment of the thermal neutron activation explosive detection system for concourse use at US airports

    International Nuclear Information System (INIS)

    This document is an environmental assessment of a system designed to detect the presence of explosives in checked airline baggage or cargo. The system is meant to be installed at the concourse or lobby ticketing areas of US commercial airports and uses a sealed radioactive source of californium-252 to irradiate baggage items. The major impact of the use of this system arises from direct exposure of the public to scattered or leakage radiation from the source and to induced radioactivity in baggage items. Under normal operation and the most likely accident scenarios, the environmental impacts that would be created by the proposed licensing action would not be significant. 44 refs., 19 figs., 18 tabs

  7. A comparative study of bulk etch rate measurement methods in polycarbonate detectors

    International Nuclear Information System (INIS)

    The response of a plastic detector to an incoming charged particle is given by the ratio of track etch rate vt to bulk etch rate vg along its path. Although the accurate determination of vt offers no difficulty as cone length can be comfortably measured, there seems to be a certain ambiguity as how to measure vg. Several LEXAN and TUFFAK polycarbonate plates have been exposed to normally incident Californium-252 fission fragments, etched in a stirred aqueous NaOH solution saturated with etch products and with a 0.05% of Dowfax surfactant, for different etching times, concentrations and temperatures. We have used three methods to measure vg and we obtain consistent results in agreement with those published in the literature. Surface quality and, consequently, ellipses neatness, are far superior in TUFFAK than in LEXAN. (author)

  8. A Novel Approach to β-delayed Neutron Spectroscopy Using the Beta-decay Paul Trap

    International Nuclear Information System (INIS)

    A new approach to β-delayed neutron spectroscopy has been demonstrated that circumvents the many limitations associated with neutron detection by instead inferring the decay branching ratios and energy spectra of the emitted neutrons by studying the nuclear recoil. Using the Beta-decay Paul Trap, fission-product ions were trapped and confined to within a 1-mm3 volume under vacuum using only electric fields. Results from recent measurements of 137I+ and plans for development of a dedicated ion trap for future experiments using the intense fission fragment beams from the Californium Rare Isotope Breeder Upgrade (CARIBU) facility at Argonne National Laboratory are summarized. The improved nuclear data that can be collected is needed in many fields of basic and applied science such as nuclear energy, nuclear astrophysics, and stockpile stewardship

  9. Devices for rapid protein determination in grain products and mixed feeds by the neutron method

    International Nuclear Information System (INIS)

    Protein determination should be carried out using rapid techniques so that each truckful of grain can be checked for protein while mixed feeds can be checked for protein directly in the product flow lines with automatic correction of their work. The existing methods of protein determination do not meet the above requirements. In this connection, the Azot analyzer has beem developed based on the reaction of capture of thermal neutrons by the nuclei of the nitrogen present in the analyzed product and the registration of the resulting gamma-quanta emission of 10.8 Mev. Readings of the nitrogen will be converted to those of protein with the help of standard conversion coefficients. Alongside with protein content, the Azot can measure the test weight of the grain by absorbing californium 252 neutrons

  10. Probe for the exploration of deposits

    International Nuclear Information System (INIS)

    The exploration probes work by means of a prompt (n,γ) analysis, activation analysis or X-ray fluorescence analysis. The neutrons or gamma radiation are provided by a californium-252 source or a cobalt-57 source which are placed in the probe. The probe is in the form of a pipe consisting of single modules. Each module contains a part of the whole radiation producing, shielding, detector, detector cooling and detector electronic system. They can be screwed onto one another and can be exchanged for other parts. A melt cryostatat or a compressor is used as cooling device, a germanium-(Li) detector as detector, and bismuth and heavy water as shielding. All measuring process can thus be carried out in situ in a relatively short measuring time. (DG)

  11. Robotics and remote systems applications

    International Nuclear Information System (INIS)

    This article is a review of numerous remote inspection techniques in use at the Savannah River (and other) facilities. These include: (1) reactor tank inspection robot, (2) californium waste removal robot, (3) fuel rod lubrication robot, (4) cesium source manipulation robot, (5) tank 13 survey and decontamination robots, (6) hot gang valve corridor decontamination and junction box removal robots, (7) lead removal from deionizer vessels robot, (8) HB line cleanup robot, (9) remote operation of a front end loader at WIPP, (10) remote overhead video extendible robot, (11) semi-intelligent mobile observing navigator, (12) remote camera systems in the SRS canyons, (13) cameras and borescope for the DWPF, (14) Hanford waste tank camera system, (15) in-tank precipitation camera system, (16) F-area retention basin pipe crawler, (17) waste tank wall crawler and annulus camera, (18) duct inspection, and (19) deionizer resin sampling

  12. Utilization of radiation facilities at TNRC for shielding researches and related topics

    International Nuclear Information System (INIS)

    This paper presents the running shielding research activities at Tajura Nuclear research center. The main area of researches are concentrated on the investigation of different types of concrete made from local materials such as conventional concrete, Magnetite-Limonite concrete, and heat resistant concrete. The measuring techniques used were neutron-gamma spectrometry, and activation foils. The measurements were performed using collimated beam of reactor neutrons emitted from one of the horizontal channels, as well as from californium-252 neutron source. The transmitted neutron spectra through concrete barriers of different thicknesses were measured by a scintillation spectrometer with NE-213 liquid organic scintillator. A non-destructive testing of some reactor materials were also carried out using neutron and gamma ray computerized tomography technique (CT). Some experiments were also carried out related to measurements of neutron depth dose distributions inside tissue equivalent materials. 10 figs

  13. Nuclear fission and the transuranium elements

    International Nuclear Information System (INIS)

    Many of the transuranium elements are produced and isolated in large quantities through the use of neutrons furnished by nuclear fission reactions: plutonium (atomic number 94) in ton quantities; neptunium (93), americium (95), and curium (96) in kilogram quantities; berkelium (97) in 100 milligram quantities; californium (98) in gram quantities; and einsteinium (99) in milligram quantities. Transuranium isotopes have found many practical applications---as nuclear fuel for the large-scale generation of electricity, as compact, long-lived power sources for use in space exploration, as means for diagnosis and treatment in the medical area, and as tools in numerous industrial processes. Of particular interest is the unusual chemistry and impact of these heaviest elements on the periodic table. This account will feature these aspects. 9 refs., 5 figs

  14. Potential nuclear safeguards applications for neutron generators

    International Nuclear Information System (INIS)

    Many nuclear safeguards inspection instruments use neutron sources to interrogate the fissile material (commonly 235U and 239Pu) to be measured. The neutron sources currently used in these instruments are isotopics such as Californium-252, Americium-Lithium, etc. It is becoming increasingly more difficult to transport isotopic sources from one measurement location to another. This represents a significant problem for the International Atomic Energy Agency (IAEA) safeguards inspectors because they must take their safeguards instruments with them to each nuclear installation to make an independent measurement. Purpose of this paper is to review the possibility of replacing isotopic neutron sources now used in IAEA safeguards instruments with electric neutron sources such as deuterium-tritium (D-T, 14-MeV neutrons) or deuterium-deuterium (D-D, 2-MeV neutrons). The potential for neutron generators to interrogate spent-light water reactor fuel assemblies in storage pools is also reviewed

  15. Reliability of semiconductor and gas-filled diodes for over-voltage protection exposed to ionizing radiation

    Directory of Open Access Journals (Sweden)

    Stanković Koviljka

    2009-01-01

    Full Text Available The wide-spread use of semiconductor and gas-filled diodes for non-linear over-voltage protection results in a variety of possible working conditions. It is therefore essential to have a thorough insight into their reliability in exploitation environments which imply exposure to ionizing radiation. The aim of this paper is to investigate the influence of irradiation on over-voltage diode characteristics by exposing the diodes to californium-252 combined neutron/gamma radiation field. The irradiation of semiconductor over-voltage diodes causes severe degradation of their protection characteristics. On the other hand, gas-filled over-voltage diodes exhibit a temporal improvement of performance. The results are presented with the accompanying theoretical interpretations of the observed changes in over-voltage diode behaviour, based on the interaction of radiation with materials constituting the diodes.

  16. Measurements of the neutron capture cross sections and incineration potentials of minor-actinides in high thermal neutron fluxes: Impact on the transmutation of nuclear wastes

    International Nuclear Information System (INIS)

    This thesis comes within the framework of minor-actinide nuclear transmutation studies. First of all, we have evaluated the impact of minor actinide nuclear data uncertainties within the cases of 241Am and 237Np incineration in three different reactor spectra: EFR (fast), GT-MHR (epithermal) and HI-HWR (thermal). The nuclear parameters which give the highest uncertainties were thus highlighted. As a result of fact, we have tried to reduce data uncertainties, in the thermal energy region, for one part of them through experimental campaigns in the moderated high intensity neutron fluxes of ILL reactor (Grenoble). These measurements were focused onto the incineration and transmutation of the americium-241, the curium-244 and the californium-249 isotopes. Finally, the values of 12 different cross sections and the 241Am isomeric branching ratio were precisely measured at thermal energy point. (author)

  17. Multi-purpose neutron radiography system

    International Nuclear Information System (INIS)

    A conceptual design is given for a low cost, multipurpose radiography system suited for the needs of the Los Alamos National Laboratory (LANL). The proposed neutron source is californium-252. One purpose is to provide an in-house capability for occasional, reactor quality, neutron radiography thus replacing the recently closed Omega-West Reactor. A second purpose is to provide a highly reliable standby transportable neutron radiography system. A third purpose is to provide for transportable neutron probe gamma spectroscopy techniques. The cost is minimized by shared use of an existing x-ray facility, and by use of an existing transport cask. The achievable neutron radiography and radioscopy performance characteristics have been verified. The demonstrated image qualities range from high resolution gadolinium - SR film, with L:D = 100:1, to radioscopy using a LIXI image with L:D = 30:1 and neutron fluence 3.4 x 105 n/cm2

  18. Measurements of the neutron capture cross sections and incineration potentials of minor-actinides in high thermal neutron fluxes: Impact on the transmutation of nuclear wastes; Mesures des sections efficaces de capture et potentiels d'incineration des actinides mineurs dans les hauts flux de neutrons: Impact sur la transmutation des dechets

    Energy Technology Data Exchange (ETDEWEB)

    Bringer, O

    2007-10-15

    This thesis comes within the framework of minor-actinide nuclear transmutation studies. First of all, we have evaluated the impact of minor actinide nuclear data uncertainties within the cases of {sup 241}Am and {sup 237}Np incineration in three different reactor spectra: EFR (fast), GT-MHR (epithermal) and HI-HWR (thermal). The nuclear parameters which give the highest uncertainties were thus highlighted. As a result of fact, we have tried to reduce data uncertainties, in the thermal energy region, for one part of them through experimental campaigns in the moderated high intensity neutron fluxes of ILL reactor (Grenoble). These measurements were focused onto the incineration and transmutation of the americium-241, the curium-244 and the californium-249 isotopes. Finally, the values of 12 different cross sections and the {sup 241}Am isomeric branching ratio were precisely measured at thermal energy point. (author)

  19. Triton and alpha-particle contribution from LiF converter for neutron dosimeter

    CERN Document Server

    Camacho, M E; Balcazar, M

    1999-01-01

    A personnel neutron dosimeter prototype based on chemical and electrochemical etched CR-39 detector, combined with LiF converter, has been calibrated using an ICRP-like phantom, under a heavy-water moderated Californium source neutron spectra; A conversion factor of 1.052+-126 spots cm sup - sup 2 mSv sup - sup 1 was obtained. The sealing properties of the detector holder showed a ten-fold reduction in radon background when it was tested in a high radon atmosphere. A convenient mechanical shock resistance was achieved in LiF converters by sintering to 11 tons pressure LiF powder at 650 deg. C, during one hour.

  20. Nuclear fission and the transuranium elements

    Energy Technology Data Exchange (ETDEWEB)

    Seaborg, G.T.

    1989-02-01

    Many of the transuranium elements are produced and isolated in large quantities through the use of neutrons furnished by nuclear fission reactions: plutonium (atomic number 94) in ton quantities; neptunium (93), americium (95), and curium (96) in kilogram quantities; berkelium (97) in 100 milligram quantities; californium (98) in gram quantities; and einsteinium (99) in milligram quantities. Transuranium isotopes have found many practical applications---as nuclear fuel for the large-scale generation of electricity, as compact, long-lived power sources for use in space exploration, as means for diagnosis and treatment in the medical area, and as tools in numerous industrial processes. Of particular interest is the unusual chemistry and impact of these heaviest elements on the periodic table. This account will feature these aspects. 9 refs., 5 figs.