WorldWideScience

Sample records for californium 244

  1. Historical review of californium-252 discovery and development

    Science.gov (United States)

    Stoddard, D. H.

    This paper discusses the discovery and history of californium 252. This isotope may be synthesized by irradiating plutonium 239, plutonium 242, americium 243, or curium 244 with neutrons in a nuclear reactor. Various experiments and inventions involving (252)Cf conducted at the Savannah River Plant are discussed. The evolution of radiotherapy using californium 252 is reviewed.

  2. Californium-252 progress, report No. 7, April 1971

    Energy Technology Data Exchange (ETDEWEB)

    1971-12-31

    This report contains discusses of the following topics on Californium-252: First sales of californium-252; encapsulation services discussed; three new participants in market evaluation program; summer training programs to use californium; Californium-252 shipping casks available; Californium-252 questions and answers, radiotherapy; neutron radiography; natural resources exploration; nuclear safeguards; process control; dosimetry; neutron radiography; neutron shielding; and nuclear safeguards.

  3. Californium-252: a remarkable versatile radioisotope

    Energy Technology Data Exchange (ETDEWEB)

    Osborne-Lee, I.W.; Alexander, C.W.

    1995-10-10

    A product of the nuclear age, Californium-252 ({sup 252}Cf) has found many applications in medicine, scientific research, industry, and nuclear science education. Californium-252 is unique as a neutron source in that it provides a highly concentrated flux and extremely reliable neutron spectrum from a very small assembly. During the past 40 years, {sup 252}Cf has been applied with great success to cancer therapy, neutron radiography of objects ranging from flowers to entire aircraft, startup sources for nuclear reactors, fission activation for quality analysis of all commercial nuclear fuel, and many other beneficial uses, some of which are now ready for further growth. Californium-252 is produced in the High Flux Isotope Reactor (HFIR) and processed in the Radiochemical Engineering Development Center (REDC), both of which are located at the Oak Ridge National Laboratory (ORNL) in Oak Ridge, Tennessee. The REDC/HFIR facility is virtually the sole supplier of {sup 252}Cf in the western world and is the major supplier worldwide. Extensive exploitation of this product was made possible through the {sup 252}Cf Market Evaluation Program, sponsored by the United States Department of Energy (DOE) [then the Atomic Energy Commission (AEC) and later the Energy Research and Development Administration (ERDA)]. This program included training series, demonstration centers, seminars, and a liberal loan policy for fabricated sources. The Market Evaluation Program was instituted, in part, to determine if large-quantity production capability was required at the Savannah River Laboratory (SRL). Because of the nature of the product and the means by which it is produced, {sup 252}Cf can be produced only in government-owned facilities. It is evident at this time that the Oak Ridge research facility can meet present and projected near-term requirements. The production, shipment, and sales history of {sup 252}Cf from ORNL is summarized herein.

  4. Production, Distribution, and Applications of Californium-252 Neutron Sources

    Energy Technology Data Exchange (ETDEWEB)

    Balo, P.A.; Knauer, J.B.; Martin, R.C.

    1999-10-03

    The radioisotope {sup 252}Cf is routinely encapsulated into compact, portable, intense neutron sources with a 2.6-year half-life. A source the size of a person's little finger can emit up to 10{sup 11} neutrons/s. Californium-252 is used commercially as a reliable, cost-effective neutron source for prompt gamma neutron activation analysis (PGNAA) of coal, cement, and minerals, as well as for detection and identification of explosives, laud mines, and unexploded military ordnance. Other uses are neutron radiography, nuclear waste assays, reactor start-up sources, calibration standards, and cancer therapy. The inherent safety of source encapsulations is demonstrated by 30 years of experience and by U.S. Bureau of Mines tests of source survivability during explosions. The production and distribution center for the U. S Department of Energy (DOE) Californium Program is the Radiochemical Engineering Development Center (REDC) at Oak Ridge National Laboratory (ORNL). DOE sells The radioisotope {sup 252}Cf is routinely encapsulated into compact, portable, intense neutron sources with a 2.6- year half-life. A source the size of a person's little finger can emit up to 10 neutrons/s. Californium-252 is used commercially as a reliable, cost-effective neutron source for prompt gamma neutron activation analysis (PGNAA) of coal, cement, and minerals, as well as for detection and identification of explosives, laud mines, and unexploded military ordnance. Other uses are neutron radiography, nuclear waste assays, reactor start-up sources, calibration standards, and cancer therapy. The inherent safety of source encapsulations is demonstrated by 30 years of experience and by U.S. Bureau of Mines tests of source survivability during explosions. The production and distribution center for the U. S Department of Energy (DOE) Californium Program is the Radiochemical Engineering Development Center (REDC) at Oak Ridge National Laboratory(ORNL). DOE sells {sup 252}Cf to commercial

  5. 12 CFR 24.4 - Investment limits.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 1 2010-01-01 2010-01-01 false Investment limits. 24.4 Section 24.4 Banks and... ENTITIES, COMMUNITY DEVELOPMENT PROJECTS, AND OTHER PUBLIC WELFARE INVESTMENTS § 24.4 Investment limits. (a) Limits on aggregate outstanding investments. A national bank's aggregate outstanding investments under...

  6. 8 CFR 244.16 - Confidentiality.

    Science.gov (United States)

    2010-01-01

    ... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Confidentiality. 244.16 Section 244.16 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS TEMPORARY PROTECTED STATUS FOR NATIONALS OF DESIGNATED STATES § 244.16 Confidentiality. The information contained in the...

  7. 8 CFR 244.8 - Appearance.

    Science.gov (United States)

    2010-01-01

    ... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Appearance. 244.8 Section 244.8 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS TEMPORARY PROTECTED STATUS FOR NATIONALS OF DESIGNATED STATES § 244.8 Appearance. The applicant may be required to appear in person before an...

  8. 8 CFR 244.4 - Ineligible aliens.

    Science.gov (United States)

    2010-01-01

    ... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Ineligible aliens. 244.4 Section 244.4 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS TEMPORARY PROTECTED STATUS FOR NATIONALS OF DESIGNATED STATES § 244.4 Ineligible aliens. An alien is ineligible for Temporary...

  9. 8 CFR 244.17 - Annual registration.

    Science.gov (United States)

    2010-01-01

    ... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Annual registration. 244.17 Section 244.17... FOR NATIONALS OF DESIGNATED STATES § 244.17 Annual registration. (a) Aliens granted Temporary... of residence. Such registration will apply to nationals of those foreign states designated or...

  10. 37 CFR 2.44 - Collective mark.

    Science.gov (United States)

    2010-07-01

    ... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Collective mark. 2.44 Section 2.44 Patents, Trademarks, and Copyrights UNITED STATES PATENT AND TRADEMARK OFFICE, DEPARTMENT OF COMMERCE RULES OF PRACTICE IN TRADEMARK CASES The Written Application § 2.44 Collective mark. (a) In an...

  11. 48 CFR 244.304 - Surveillance.

    Science.gov (United States)

    2010-10-01

    ... Reviews 244.304 Surveillance. (b) The ACO, or the purchasing system analyst (PSA) with the concurrence of... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Surveillance. 244.304 Section 244.304 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS SYSTEM, DEPARTMENT...

  12. 8 CFR 244.15 - Travel abroad.

    Science.gov (United States)

    2010-01-01

    ... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Travel abroad. 244.15 Section 244.15 Aliens... NATIONALS OF DESIGNATED STATES § 244.15 Travel abroad. (a) After the grant of Temporary Protected Status... to travel abroad. Permission to travel may be granted by the director pursuant to the Service's...

  13. Unusual structure, bonding and properties in a californium borate

    Energy Technology Data Exchange (ETDEWEB)

    Polinski, Matthew J.; Garner, Edward B.; Maurice, Rémi; Planas, Nora; Stritzinger, Jared T.; Parker, T. Gannon; Cross, Justin N.; Green, Thomas D.; Alekseev, Evgeny V.; Van Cleve, Shelley M.; Depmeier, Wulf; Gagliardi, Laura; Shatruk, Michael; Knappenberger, Kenneth L.; Liu, Guokui; Skanthakumar, S.; Soderholm, Lynda; Dixon, David A.; Albrecht-Schmitt, Thomas E.

    2014-03-23

    The participation of the valence orbitals of actinides in bonding has been debated for decades. Recent experimental and computational investigations demonstrated the involvement of 6p, 6d and/or 5f orbitals in bonding. However, structural and spectroscopic data, as well as theory, indicate a decrease in covalency across the actinide series, and the evidence points to highly ionic, lanthanide-like bonding for late actinides. Here we show that chemical differentiation between californium and lanthanides can be achieved by using ligands that are both highly polarizable and substantially rearrange on complexation. A ligand that suits both of these desired properties is polyborate. We demonstrate that the 5f, 6d and 7p orbitals are all involved in bonding in a Cf(III) borate, and that large crystal-field effects are present. Synthetic, structural and spectroscopic data are complemented by quantum mechanical calculations to support these observations.

  14. Biomedical neutron research at the Californium User Facility for neutron science

    Energy Technology Data Exchange (ETDEWEB)

    Martin, R.C. [Oak Ridge National Lab., TN (United States); Byrne, T.E. [Roane State Community College, Harriman, TN (United States); Miller, L.F. [Univ. of Tennessee, Knoxville, TN (United States)

    1997-04-01

    The Californium User Facility for Neutron Science has been established at Oak Ridge National Laboratory (ORNL). The Californium User Facility (CUF) is a part of the larger Californium Facility, which fabricates and stores compact {sup 252}Cf neutron sources for worldwide distribution. The CUF can provide a cost-effective option for research with {sup 252}Cf sources. Three projects at the CUF that demonstrate the versatility of {sup 252}Cf for biological and biomedical neutron-based research are described: future establishment of a {sup 252}Cf-based neutron activation analysis system, ongoing work to produce miniature high-intensity, remotely afterloaded {sup 252}Cf sources for tumor therapy, and a recent experiment that irradiated living human lung cancer cells impregnated with experimental boron compounds to test their effectiveness for boron neutron capture therapy.

  15. Dicty_cDB: VHP244 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHP244 (Link to dictyBase) - G03062 DDB0216322 Contig-U12556-1 VHP...244P (Link to Original site) VHP244F 616 VHP244Z 781 VHP244P 1377 - - Show VHP244 Library VH (Link to library) Clone ID VHP...Contig-U12556-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHP2-B/VHP...244Q.Seq.d/ Representative seq. ID VHP244P (Link to Original site) Representative DNA sequence >VHP244 (VHP244Q) /CSM/VH/VHP...2-B/VHP244Q.Seq.d/ GTTCGTAATTATTTCAAAATTGGTGCGACACACTCGTATCCACAATGAAAAAATTAGTCC ATAAAGA

  16. Apparatus for the measurement of total body nitrogen using prompt neutron activation analysis with californium-252.

    Science.gov (United States)

    Mackie, A; Hannan, W J; Smith, M A; Tothill, P

    1988-01-01

    Details of clinical apparatus designed for the measurement of total body nitrogen (as an indicator of body protein), suitable for the critically ill, intensive-care patient are presented. Californium-252 radio-isotopic neutron sources are used, enabling a nitrogen measurement by prompt neutron activation analysis to be made in 40 min with a precision of +/- 3.2% for a whole body dose equivalent of 0.145 mSv. The advantages of Californium-252 over alternative neutron sources are discussed. A comparison between two irradiation/detection geometries is made, leading to an explanation of the geometry adopted for the apparatus. The choice of construction and shielding materials to reduce the count rate at the detectors and consequently to reduce the pile-up contribution to the nitrogen background is discussed. Salient features of the gamma ray spectroscopy system to reduce spectral distortion from pulse pile-up are presented.

  17. Safety Analysis Report for Packaging (SARP) of the Oak Ridge National Laboratory TRU Californium Shipping Container

    Energy Technology Data Exchange (ETDEWEB)

    Box, W.D.; Shappert, L.B.; Seagren, R.D.; Klima, B.B.; Jurgensen, M.C.; Hammond, C.R.; Watson, C.D.

    1980-01-01

    An analytical evaluation of the Oak Ridge National Laboratory TRU Californium Shipping Container was made in order to demonstrate its compliance with the regulations governing off-site shipment of packages that contain radioactive material. The evaluation encompassed five primary categories: structural integrity, thermal resistance, radiation shielding, nuclear criticality safety, and quality assurance. The results of this evaluation demonstrate that the container complies with the applicable regulations.

  18. 27 CFR 46.244 - Location of records.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 2 2010-04-01 2010-04-01 false Location of records. 46.244 Section 46.244 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU... Tubes Held for Sale on April 1, 2009 Records § 46.244 Location of records. The dealer must keep the...

  19. 48 CFR 52.244-5 - Competition in Subcontracting.

    Science.gov (United States)

    2010-10-01

    ... Subcontracting. 52.244-5 Section 52.244-5 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION....244-5 Competition in Subcontracting. As prescribed in 44.204(c), insert the following clause: Competition in Subcontracting (DEC 1996) (a) The Contractor shall select subcontractors (including suppliers...

  20. 42 CFR 456.244 - Data sources for studies.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 4 2010-10-01 2010-10-01 false Data sources for studies. 456.244 Section 456.244 Public Health CENTERS FOR MEDICARE & MEDICAID SERVICES, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) MEDICAL ASSISTANCE PROGRAMS UTILIZATION CONTROL Utilization Control: Mental Hospitals Ur Plan: Medical Care Evaluation Studies § 456.244 Data...

  1. Crippling load test of Budd Pioneer Car 244, test 3.

    Science.gov (United States)

    2013-04-01

    This report summarizes Test 3, a crippling load test on Budd Pioneer Car 244, conducted on June 28, 2011. Before the crippling load test, Transportation Technology Center, Inc., conducted two 800,000-pound (lb) quasi-static tests on Car 244 in accord...

  2. 40 CFR 52.244 - Motor vehicle emissions budgets.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 3 2010-07-01 2010-07-01 false Motor vehicle emissions budgets. 52.244... (CONTINUED) APPROVAL AND PROMULGATION OF IMPLEMENTATION PLANS California § 52.244 Motor vehicle emissions budgets. (a) Approval of the motor vehicle emissions budgets for the following ozone rate-of-progress and...

  3. Application of TSH bioindicator for studying the biological efficiency of neutrons from californium-252 source

    Energy Technology Data Exchange (ETDEWEB)

    Cebulska-Wasilewska, A.; Rekas, K. [Institute of Nuclear Physics, Cracow (Poland); Kim, J.K. [Korea Atomic Energy Research Inst., Taejon (Korea, Republic of)

    1997-12-31

    The effectiveness of neutrons from a Californium-252 source in the induction of various abnormalities in the Tradescantia clone 4430 stamen hair cells (TSH-assay) was studied. The special attention was paid to check whether any enhancement in effects caused by process of boron neutron capture is visible in the cells enriched with boron ions. Two chemicals (borax and BSH) were applied to introduce boron-10 ions into cells. Inflorescence, normal or pretreated with chemicals containing boron, were irradiated in the air with neutrons from a Cf-252 source at KAERI, Taejon, Korea. To estimate the relative biological effectiveness (RBE) in the induction of gene mutations of the neutron beam under the study, Tradescantia inflorescences, without any chemical pretreatment, were irradiated with various doses of X-rays. The ranges of radiation doses used were 0-0.1 Gy in neutrons and 0-0.5 Gy in X-rays. After the time needed to complete the postirradiation repair Tradescantia cuttings were transferred to Cracow, where screening of gene and lethal; mutations, cell cycle alterations in somatic cells have been done, and dose response relationships were figured. The maximal RBE values were estimated in the range of 4.6-6.8. Alterations of RBE value were observed; from 6.8 to 7.8 in the case of plants pretreated with 240 ppm of B-10 from borax, and 4.6 to 6.1 in the case of 400 ppm of B-10 from BSH. Results showed a slight, although statistically insignificant increase in biological efficacy of radiation from the Cf-252 source in samples pretreated with boron containing chemicals. (author)

  4. 40 CFR 60.244 - Test methods and procedures.

    Science.gov (United States)

    2010-07-01

    ... Fertilizer Industry: Granular Triple Superphosphate Storage Facilities § 60.244 Test methods and procedures... quantities of product are being cured or stored in the facility. (1) Total granular triple superphosphate is at least 10 percent of the building capacity, and (2) Fresh granular triple superphosphate is at...

  5. Phenotype abnormality: 244 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 244 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u1ria224u750i delayed in orga...n named outer integument during process named starch catabolic process ... outer integument ... delayed ... starch catabolic process ...

  6. Study of the shielding for spontaneous fission sources of Californium-252; Estudio de blindaje para fuentes de fision espontanea de Californio-252

    Energy Technology Data Exchange (ETDEWEB)

    Davila R, I

    1991-06-15

    A shielding study is made to attenuate, until maximum permissible levels, the neutrons radiation and photons emitted by spontaneous fission coming from a source of Californium-252. The compound package by a database (Library DLC-23) and the ANISNW code is used, in it version for personal computer. (Author)

  7. Simulation and design of an electron beam ion source charge breeder for the californium rare isotope breeder upgrade

    Directory of Open Access Journals (Sweden)

    Clayton Dickerson

    2013-02-01

    Full Text Available An electron beam ion source (EBIS will be constructed and used to charge breed ions from the californium rare isotope breeder upgrade (CARIBU for postacceleration into the Argonne tandem linear accelerator system (ATLAS. Simulations of the EBIS charge breeder performance and the related ion transport systems are reported. Propagation of the electron beam through the EBIS was verified, and the anticipated incident power density within the electron collector was identified. The full normalized acceptance of the charge breeder with a 2 A electron beam, 0.024π  mm mrad for nominal operating parameters, was determined by simulating ion injection into the EBIS. The optics of the ion transport lines were carefully optimized to achieve well-matched ion injection, to minimize emittance growth of the injected and extracted ion beams, and to enable adequate testing of the charge bred ions prior to installation in ATLAS.

  8. Extraction of Trivalent Actinides and Lanthanides from Californium Campaign Rework Solution Using TODGA-based Solvent Extraction System

    Energy Technology Data Exchange (ETDEWEB)

    Benker, Dennis [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Delmau, Laetitia Helene [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Dryman, Joshua Cory [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States)

    2017-07-01

    This report presents the studies carried out to demonstrate the possibility of quantitatively extracting trivalent actinides and lanthanides from highly acidic solutions using a neutral ligand-based solvent extraction system. These studies stemmed from the perceived advantage of such systems over cationexchange- based solvent extraction systems that require an extensive feed adjustment to make a low-acid feed. The targeted feed solutions are highly acidic aqueous phases obtained after the dissolution of curium targets during a californium (Cf) campaign. Results obtained with actual Cf campaign solutions, but highly diluted to be manageable in a glove box, are presented, followed by results of tests run in the hot cells with Cf campaign rework solutions. It was demonstrated that a solvent extraction system based on the tetraoctyl diglycolamide molecule is capable of quantitatively extracting trivalent actinides from highly acidic solutions. This system was validated using actual feeds from a Cf campaign.

  9. Beyond Californium-A Neutron Generator Alternative for Dosimetry and Instrument Calibration in the U.S.

    Science.gov (United States)

    Piper, Roman K; Mozhayev, Andrey V; Murphy, Mark K; Thompson, Alan K

    2017-09-01

    Evaluations of neutron survey instruments, area monitors, and personal dosimeters rely on reference neutron radiations, which have evolved from the heavy reliance on (α,n) sources to a shared reliance on (α,n) and the spontaneous fission neutrons of californium-252 (Cf). Capable of producing high dose equivalent rates from an almost point source geometry, the characteristics of Cf are generally more favorable when compared to the use of (α,n) and (γ,n) sources or reactor-produced reference neutron radiations. Californium-252 is typically used in two standardized configurations: unmoderated, to yield a fission energy spectrum; or with the capsule placed within a heavy-water moderating sphere to produce a softened spectrum that is generally considered more appropriate for evaluating devices used in nuclear power plant work environments. The U.S. Department of Energy Cf Loan/Lease Program, a longtime origin of affordable Cf sources for research, testing and calibration, was terminated in 2009. Since then, high-activity sources have become increasingly cost-prohibitive for laboratories that formerly benefited from that program. Neutron generators, based on the D-T and D-D fusion reactions, have become economically competitive with Cf and are recognized internationally as important calibration and test standards. Researchers from the National Institute of Standards and Technology and the Pacific Northwest National Laboratory are jointly considering the practicality and technical challenges of implementing neutron generators as calibration standards in the U.S. This article reviews the characteristics of isotope-based neutron sources, possible isotope alternatives to Cf, and the rationale behind the increasing favor of electronically generated neutron options. The evaluation of a D-T system at PNNL has revealed characteristics that must be considered in adapting generators to the task of calibration and testing where accurate determination of a dosimetric quantity is

  10. Californium-252 Brachytherapy Combined With External-Beam Radiotherapy for Cervical Cancer: Long-Term Treatment Results

    Energy Technology Data Exchange (ETDEWEB)

    Lei Xin; Qian Chengyuan; Qing Yi; Zhao Kewei; Yang Zhengzhou; Dai Nan; Zhong Zhaoyang; Tang Cheng; Li Zheng; Gu Xianqing; Zhou Qian; Feng Yan; Xiong Yanli; Shan Jinlu [Cancer Center, Research Institute of Surgery and Daping Hospital, Third Military Medical University, Chongqing (China); Wang Dong, E-mail: dongwang64@hotmail.com [Cancer Center, Research Institute of Surgery and Daping Hospital, Third Military Medical University, Chongqing (China)

    2011-12-01

    Purpose: To observe, by retrospective analysis, the curative effects and complications due to californium-252 ({sup 252}Cf) neutron intracavitary brachytherapy (ICBT) combined with external-beam radiotherapy (EBRT) in the treatment of cervical cancer. Methods and Materials: From February 1999 to December 2007, 696 patients with cervical cancer (Stages IB to IIIB) were treated with {sup 252}Cf-ICBT in combination of EBRT. Of all, 31 patients were at Stage IB, 104 at IIA, 363 at IIB, 64 at IIIA, and 134 at IIIB. Californium-252 ICBT was delivered at 7-12 Gy per insertion per week, with a total dose of 29-45 Gy to reference point A in three to five insertions. The whole pelvic cavity was treated with 8-MV X-ray external irradiation at 2 Gy per fraction, four times per week. After 16-38 Gy of external irradiation, the center of the whole pelvic field was blocked with a 4-cm-wide lead shield, with a total external irradiation dose of 44-56 Gy. The total treatment course was 5 to 6 weeks. Results: Overall survival rate at 3 and 5 years for all patients was 76.0% and 64.9%, respectively. Disease-free 3- and 5-year survival rates of patients were 71.2% and 58.4%, respectively. Late complications included vaginal contracture and adhesion, radiation proctitis, radiation cystitis, and inflammatory bowel, which accounted for 5.8%, 7.1%, 6.2%, and 4.9%, respectively. Univariate analysis results showed significant correlation of stage, age, histopathologic grade, and lymph node status with overall survival. Cox multiple regression analysis showed that the independent variables were stage, histopathologic grade, tumor size, and lymphatic metastasis in all patients. Conclusion: Results of this series suggest that the combined use of {sup 252}Cf-ICBT with EBRT is an effective method for treatment of cervical cancer.

  11. 8 CFR 244.11 - Renewal of application; appeal to the Board of Immigration Appeals.

    Science.gov (United States)

    2010-01-01

    ... of Immigration Appeals. 244.11 Section 244.11 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS TEMPORARY PROTECTED STATUS FOR NATIONALS OF DESIGNATED STATES § 244.11 Renewal of application; appeal to the Board of Immigration Appeals. If a charging document is served on the alien with a...

  12. 48 CFR 1852.244-70 - Geographic participation in the aerospace program.

    Science.gov (United States)

    2010-10-01

    ... the aerospace program. 1852.244-70 Section 1852.244-70 Federal Acquisition Regulations System NATIONAL... Provisions and Clauses 1852.244-70 Geographic participation in the aerospace program. As prescribed in 1844.204-70, insert the following clause: Geographic Participation in the Aerospace Program (APR 1985) (a...

  13. 27 CFR 24.244 - Use of acid to stabilize standard wine.

    Science.gov (United States)

    2010-04-01

    ... standard wine. 24.244 Section 24.244 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY LIQUORS WINE Storage, Treatment and Finishing of Wine § 24.244 Use of acid to stabilize standard wine. Standard wine other than citrus wine, regardless of the fixed...

  14. 60-day waste compatibility safety issues and final results for TX-244 grab samples

    Energy Technology Data Exchange (ETDEWEB)

    Nuzum, J.L., Fluor Daniel Hanford

    1997-02-05

    Three grab samples (244-TX-96-1, 244-TX-96-2, and 244-TX-96-3) were taken from Riser 8 of Tank 241-TX-244 on October 18, 1996, and received by 222-S Laboratory on October 18, 1996. These samples were analyzed in accordance with Compatibility Grab Sampling and Analysis Plan (TSAP) and Data Quality Objectives for Tank Farms Waste Compatibility Program (DQO) in support ofthe Waste Compatibility Program. Notifications were made in accordance with TSAP for pH and OH- analyses. Upon further review, the pH notification was deemed unnecessary, as the notification limit did not apply to this tank.

  15. Long-term effects of an intracavitary treatment with californium-252 on normal tissue. [Swine, /sup 226/Ra

    Energy Technology Data Exchange (ETDEWEB)

    Sullivan, M.F.; Beamer, J.L.; Mahony, T.D.; Cross, F.T.; Lund, J.E.; Endres, G.W.R.

    1976-01-01

    About one hundred fifty swine were exposed to either radium-226 or californium-252 sources in the uterine cervix to determine an RBE for both acute and long-term effects. That value for early changes in the tissues at risk in the treatment of cervical cancer was between 6.2 and 6.8. The incidence of complications increased with time after exposure, especially among animals treated with /sup 252/Cf. Analysis of rectal injury showed that ulceration occurred frequently within a year postexposure at doses between 1600 and 2400 rad calculated at 2 cm lateral to the source midline. Fat necrosis and smooth muscle atrophy, resulting in a local rectal stricture, were delayed changes observed in some animals. The lower ureter was the site for a greater frequency of complications than the GI tract. Ureteral stricture often occurred at doses of 1200 rad from /sup 252/Cf and 7000 rad from /sup 226/Ra. Observation of delayed effects in the uterine-cervix in animals held up to 4 years postexposure indicate that the RBE for /sup 252/Cf may be increased to a value as high as 18, while repair may have even decreased it to about 5.6 in the rectum. Fifty swine are still being observed for long-term effects after doses above 800 rad from /sup 252/Cf and 5000 rad from /sup 226/Ra.

  16. 8 CFR 244.5 - Temporary treatment benefits for eligible aliens.

    Science.gov (United States)

    2010-01-01

    ... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Temporary treatment benefits for eligible aliens. 244.5 Section 244.5 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION... for eligible aliens. (a) Prior to the registration period. Prior to the registration period...

  17. 49 CFR 244.11 - Contents of a Safety Integration Plan.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Contents of a Safety Integration Plan. 244.11... ADMINISTRATION, DEPARTMENT OF TRANSPORTATION REGULATIONS ON SAFETY INTEGRATION PLANS GOVERNING RAILROAD CONSOLIDATIONS, MERGERS, AND ACQUISITIONS OF CONTROL Safety Integration Plans § 244.11 Contents of a Safety...

  18. 48 CFR 52.244-4 - Subcontractors and outside associates and consultants (Architect-engineer services).

    Science.gov (United States)

    2010-10-01

    ... associates and consultants (Architect-engineer services). 52.244-4 Section 52.244-4 Federal Acquisition... consultants (Architect-engineer services). As prescribed in 44.204(b), insert the following clause: Subcontractors and Outside Associates and Consultants (Architect-Engineer Services) (AUG 1998) Any subcontractors...

  19. Table of radionuclides (Vol. 5 - A = 22 to 244)

    Energy Technology Data Exchange (ETDEWEB)

    Be, M.M.; Chiste, V.; Dulieu, C.; Mougeot, X.; Browne, E.; Chechev, V.; Kuzmenko, N.; Kondev, F.; Luca, A.; Galan, M.; Arinc, A.; Huang, X.

    2010-07-01

    have agreed on the methodologies to be used and the CD-ROM included with this monograph contains the evaluators' comments for each radionuclide in addition to the data tables included in the monograph. This volume includes the evaluation of the following radionuclides: {sup 22}Na, {sup 40}K, {sup 75}Se, {sup 124}Sb, {sup 207}Bi, {sup 211}Bi, {sup 217}At, {sup 222}Ra, {sup 225}Ac, {sup 228}Ra, {sup 231}Th, {sup 232}Th, {sup 233}Th, {sup 233}Pa, {sup 234}Th, {sup 235}U, {sup 237}U, {sup 238}Pu, {sup 240}Pu, {sup 241}Am, {sup 242}Pu, {sup 242}Am, {sup 243}Am, {sup 244}Am, {sup 244}Am{sup m}. Primary recommended data comprise half-lives, decay modes, X-rays, gamma-rays, electron emissions, alpha -and beta- particle transitions and emissions, and their uncertainties

  20. Ab initio full-potential study of mechanical properties and magnetic phase stability of californium monopnictides (CfN and CfP)

    Energy Technology Data Exchange (ETDEWEB)

    Amari, S., E-mail: siham_amari@yahoo.fr [Faculté des Sciences de la Nature et de la Vie, Université Hassiba Benbouali, Chlef, 02000 (Algeria); Bouhafs, B. [Laboratoire de Modélisation et Simulation en Sciences des Matériaux, Université Djillali Liabès de Sidi Bel-Abbés, Sidi Bel-Abbés, 22000 (Algeria)

    2016-09-15

    Based on the first-principles methods, the structural, elastic, electronic, properties and magnetic ordering of californium monopnictides CfX (X = P) have been studied using the full-potential augmented plane wave plus local orbitals (FP-L/APW + lo) method within the framework of density functional theory (DFT). The electronic exchange correlation energy is described by generalized gradient approximation GGA and GGA+U (U is the Hubbard correction). The GGA+U method is applied to the rare-earth 5f states. We have calculated the lattice parameters, bulk modulii and the first pressure derivatives of the bulk modulii. The elastic properties of the studied compounds are only investigated in the most stable calculated phase. In order to gain further information, we have calculated Young’s modulus, shear modulus, anisotropy factor and Kleinman parameter by the aid of the calculated elastic constants. The results mainly show that californium monopnictides CfX (X = P) have an antiferromagnetic spin ordering. Density of states (DOS) and charge densities for both compounds are also computed in the NaCl (B1) structure.

  1. Direct high-precision mass measurements on Am241,243, Pu244, and Cf249

    Science.gov (United States)

    Eibach, M.; Beyer, T.; Blaum, K.; Block, M.; Düllmann, Ch. E.; Eberhardt, K.; Grund, J.; Nagy, Sz.; Nitsche, H.; Nörtershäuser, W.; Renisch, D.; Rykaczewski, K. P.; Schneider, F.; Smorra, C.; Vieten, J.; Wang, M.; Wendt, K.

    2014-06-01

    The absolute masses of four long-lived transuranium nuclides, Am241,243, Pu244, Pu244, and Cf249, in the vicinity of the deformed N =152 neutron shell closure have been measured directly with the Penning-trap mass spectrometer TRIGA-TRAP. Our measurements confirm the AME2012 mass values of Am241,243 and Pu244 within one standard deviation, which were indirectly determined, by decay spectroscopy studies. In the case of the Cf249 mass, a discrepancy of more than three standard deviations has been observed, affecting absolute masses even in the superheavy element region. The implementation of the mass values into the AME2012 network yields a reduced mass uncertainty for 84 nuclides, particularly for Pu244 and its strongly correlated α decay chains.

  2. Above-threshold structure in {sup 244}Cm neutron-induced fission cross section

    Energy Technology Data Exchange (ETDEWEB)

    Maslov, V.M. [Radiation Physics and Chemistry Problems Inst., Minsk-Sosny (Belarus)

    1997-03-01

    The quasi-resonance structure appearing above the fission threshold in neutron-induced fission cross section of {sup 244}Cm(n,f) is interpreted. It is shown to be due to excitation of few-quasiparticle states in fissioning {sup 245}Cm and residual {sup 244}Cm nuclides. The estimate of quasiparticle excitation thresholds in fissioning nuclide {sup 245}Cm is consistent with pairing gap and fission barrier parameters. (author)

  3. Low-Dose-Rate Californium-252 Neutron Intracavitary Afterloading Radiotherapy Combined With Conformal Radiotherapy for Treatment of Cervical Cancer

    Energy Technology Data Exchange (ETDEWEB)

    Zhang Min [Department of Oncology, Armed Police Hospital of Hangzhou, Hangzhou, Zhejiang Province (China); Xu Hongde [Cancer Center, Armed Police Hospital of Hangzhou, Hangzhou, Zhejiang Province (China); Pan Songdan; Lin Shan; Yue Jianhua [Department of Oncology, Armed Police Hospital of Hangzhou, Hangzhou, Zhejiang Province (China); Liu Jianren, E-mail: liujianren0571@hotmail.com [Second Affiliated Hospital, School of Medicine, Zhejiang University, Hangzhou, Zhejiang Province (China)

    2012-07-01

    Purpose: To study the efficacy of low-dose-rate californium-252 ({sup 252}Cf) neutron intracavitary afterloading radiotherapy (RT) combined with external pelvic RT for treatment of cervical cancer. Methods and Materials: The records of 96 patients treated for cervical cancer from 2006 to 2010 were retrospectively reviewed. For patients with tumors {<=}4 cm in diameter, external beam radiation was performed (1.8 Gy/day, five times/week) until the dose reached 20 Gy, and then {sup 252}Cf neutron intracavitary afterloading RT (once/week) was begun, and the frequency of external beam radiation was changed to four times/week. For patients with tumors >4 cm, {sup 252}Cf RT was performed one to two times before whole-pelvis external beam radiation. The tumor-eliminating dose was determined by using the depth limit of 5 mm below the mucosa as the reference point. In all patients, the total dose of the external beam radiation ranged from 46.8 to 50 Gy. For {sup 252}Cf RT, the dose delivered to point A was 6 Gy/fraction, once per week, for a total of seven times, and the total dose was 42 Gy. Results: The mean {+-} SD patient age was 54.7 {+-} 13.7 years. Six patients had disease assessed at stage IB, 13 patients had stage IIA, 49 patients had stage IIB, 3 patients had stage IIIA, 24 patients had stage IIIB, and 1 patient had stage IVA. All patients obtained complete tumor regression (CR). The mean {+-} SD time to CR was 23.5 {+-} 3.4 days. Vaginal bleeding was fully controlled in 80 patients within 1 to 8 days. The mean {+-} SD follow-up period was 27.6 {+-} 12.7 months (range, 6-48 months). Five patients died due to recurrence or metastasis. The 3-year survival and disease-free recurrence rates were 89.6% and 87.5 %, respectively. Nine patients experienced mild radiation proctitis, and 4 patients developed radiocystitis. Conclusions: Low-dose-rate {sup 252}Cf neutron RT combined with external pelvic RT is effective for treating cervical cancer, with a low incidence of

  4. Evaluation of nuclear data of {sup 244}Pu and {sup 237}Pu

    Energy Technology Data Exchange (ETDEWEB)

    Nakagawa, Tsuneo; Konshin, V.A. [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment

    1995-10-01

    The evaluation of nuclear data for {sup 244}Pu and {sup 237}Pu was made in the neutron energy region from 10{sup -5} eV to 20 MeV. For the both nuclides, the total, elastic and inelastic scattering, fission, capture, (n,2n) and (n,3n) reaction cross sections were evaluated on the basis of theoretical calculation. The resonance parameters were given for {sup 244}Pu. The angular and energy distributions of secondary neutrons were also estimated for the both nuclides. The results were compiled in the ENDF-5 format and will be adopted in JENDL Actinoid File. (author).

  5. HAYNES 244 alloy – a new 760 ∘C capable low thermal expansion alloy

    OpenAIRE

    Fahrmann Michael G.; Srivastava S. Krishna; Pike Lee M.

    2014-01-01

    HAYNES® 244TM alloy is a new 760∘C capable, high strength low thermal expansion (CTE) alloy. Its nominal chemical composition in weight percent is Ni – 8 Cr – 22.5 Mo – 6 W. Recently, a first mill-scale heat of 244 alloy was melted by Haynes International, and processed to various product forms such as re-forge billet, plate, and sheet. This paper presents key attributes of this new alloy (CTE, strength, low-cycle fatigue performance, oxidation resistance, thermal stability) as they pertain t...

  6. The measurement of prompt neutron spectrum in spontaneous fission of {sup 244}Cm

    Energy Technology Data Exchange (ETDEWEB)

    Batenkov, O.I.; Boykov, G.S.; Drapchinsky, L.V.; Majorov, M.Ju.; Trenkin, V.A. [V.G. Khlopin Radium Inst., Saint Petersburg (Russian Federation)

    1997-03-01

    Under the Program of Measurements of Prompt Fission Neutron Spectra of Minor Actinides for Transmutation Purposes the integral neutron spectrum in spontaneous fission of {sup 244}Cm has been measured by the time-of-flight method in the energy range of 0.1-15 MeV relative to the standard neutron spectrum in {sup 252}Cf spontaneous fission. Essential attention was paid to revealing of possible systematic errors. It is shown, that the {sup 244}Cm spectrum shape may be well described by using Mannhart evaluation with appropriate parameter of Maxwell temperature T{sub M} = 1.37 MeV. (author)

  7. HAYNES 244 alloy – a new 760 ∘C capable low thermal expansion alloy

    Directory of Open Access Journals (Sweden)

    Fahrmann Michael G.

    2014-01-01

    Full Text Available HAYNES® 244TM alloy is a new 760∘C capable, high strength low thermal expansion (CTE alloy. Its nominal chemical composition in weight percent is Ni – 8 Cr – 22.5 Mo – 6 W. Recently, a first mill-scale heat of 244 alloy was melted by Haynes International, and processed to various product forms such as re-forge billet, plate, and sheet. This paper presents key attributes of this new alloy (CTE, strength, low-cycle fatigue performance, oxidation resistance, thermal stability as they pertain to the intended use in rings and seals of advanced gas turbines.

  8. The early solar system abundance of /sup 244/Pu as inferred from the St. Severin chondrite

    Energy Technology Data Exchange (ETDEWEB)

    Hudson, G.B.; Kennedy, B.M.; Podosek, F.A.; Hohenberg, C.M.

    1987-03-01

    We describe the analysis of Xe released in stepwise heating of neutron-irradiated samples of the St. Severin chondrite. This analysis indicates that at the time of formation of most chondritic meteorites, approximately 4.56 x 10/sup 9/ years ago, the atomic ratio of /sup 244/Pu//sup 238/U was 0.0068 +- 0.0010 in chondritic meteorites. We believe that this value is more reliable than that inferred from earlier analyses of St. Severin. We feel that this value is currently the best available estimate for the early solar system abundance of /sup 244/Pu. 42 refs., 2 tabs.

  9. Measurements of neutron cross section of the {sup 243}Am(n,{gamma}){sup 244}Am reaction

    Energy Technology Data Exchange (ETDEWEB)

    Hatsukawa, Yuichi; Shinohara, Nobuo; Hata, Kentaro [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment

    1998-03-01

    The effective thermal neutron cross section of {sup 243}Am(n,{gamma}){sup 244}Am reaction was measured by the activation method. Highly-purified {sup 243}Am target was irradiated in an aluminum capsule by using a research reactor JRR-3M. The tentative effective thermal neutron cross sections are 3.92 b, and 84.44 b for the production of {sup 244g}Am and {sup 244m}Am, respectively. (author)

  10. Stability of 244− 260Fm isotopes against alpha and cluster ...

    Indian Academy of Sciences (India)

    Taking Coulomb and proximity potentials as the interacting barrier we have studied the cold valley in the radioactive decay of 244-260Fm isotopes. It is found that in addition to alpha particle minima, other minima occur at S, Ar and Ca clusters. We have computed the half-lives and other characteristics of different clusters ...

  11. 27 CFR 28.244a - Shipment to a customs bonded warehouse.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Shipment to a customs... Export Consignment § 28.244a Shipment to a customs bonded warehouse. Distilled spirits and wine withdrawn for shipment to a customs bonded warehouse shall be consigned in care of the customs officer in charge...

  12. 43 CFR 24.4 - Resource management and public activities on Federal lands.

    Science.gov (United States)

    2010-10-01

    ... 43 Public Lands: Interior 1 2010-10-01 2010-10-01 false Resource management and public activities... DEPARTMENT OF THE INTERIOR FISH AND WILDLIFE POLICY: STATE-FEDERAL RELATIONSHIPS § 24.4 Resource management... with a Park Service approved Resource Management Plan. The appropriate States shall be consulted prior...

  13. ASASSN-17ka: Discovery of A Probable Supernova in ESO 244-G 019

    Science.gov (United States)

    Monard, L. A. G.; Brimacombe, J.; Brown, J. S.; Stanek, K. Z.; Holoien, T. W.-S.; Kochanek, C. S.; Shields, J.; Thompson, T. A.; Shappee, B. J.; Prieto, J. L.; Bersier, D.; Dong, Subo; Bose, S.; Chen, Ping; Bock, G.; Fernandez, J. M.; Kiyota, S.; Masi, G.; Post, R. S.

    2017-07-01

    During the ongoing All Sky Automated Survey for SuperNovae (ASAS-SN, Shappee et al. 2014), using data from the quadruple 14-cm "Cassius" telescope in Cerro Tololo, Chile, we discovered a new transient source, most likely a supernova, in the galaxy ESO 244-G 019. ASASSN-17ka (AT 2017frr) was discovered in images obtained on UT 2017-07-27.23 at V 16.5 mag. We also detect the object in images obtained on UT 2017-07-24.24 (V 16.6), UT 2017-07-29.23 (V 16.0), and UT 2017-07-30.23 (V 16.5).

  14. Type B investigation report of curium-244 exposure at the ORNL TRU Facility, January 15, 1986

    Energy Technology Data Exchange (ETDEWEB)

    Love, G.L.; Butler, H.M.; Duncan, D.T.; Oakes, T.W.

    1986-04-01

    This Type B Investigative Report provides an evaluation of relevant events and activities that led to, were a part of, or resulted from the release of curium-244 in the Building 7920 facility at ORNL in January 1986. Impacts have been evaluated with respect to employee exposures and the costs and loss of productivity resulting from increased bioassay analyses and activities of investigative committees. Management systems evaluated include (1) training of employees performing lab analyses, (2) adherence to procedures, and (3) response to unusual circumstances.

  15. Californium-252 neutron intracavity brachytherapy alone for T1N0 low-lying rectal adenocarcinoma: A definitive anal sphincter-preserving radiotherapy

    Science.gov (United States)

    Xiong, Yanli; Shan, Jinlu; Liu, Jia; Zhao, Kewei; Chen, Shu; Xu, Wenjing; Zhou, Qian; Yang, Mei; Lei, Xin

    2017-01-01

    This study evaluated the 4-year results of 32 patients with T1N0 low-lying rectal adenocarcinoma treated solely with californium-252 (Cf-252) neutron intracavity brachytherapy (ICBT). Patients were solicited into the study from January 2008 to June 2011. All the patients had refused surgery or surgery was contraindicated. The patients were treated with Cf-252 neutron ICBT using a novel 3.5-cm diameter off-axis 4-channel intrarectal applicator designed by the authors. The dose reference point was defined on the mucosa surface, with a total dose of 55–62 Gy-eq/4 f (13–16 Gy-eq/f/wk). All the patients completed the radiotherapy in accordance with our protocol. The rectal lesions regressed completely, and the acute rectal toxicity was mild (≤G2). The 4-year local control, overall survival, disease-free survival, and late complication (≥G2) rates were 96.9%, 90.6%, 87.5% and 15.6%, respectively. No severe late complication (≥G3) occurred. The mean follow-up was 56.1 ± 16.0 months. At the end of last follow-up, 29 patients remained alive. The mean survival time was 82.1 ± 2.7 months. Cf-252 neutron ICBT administered as the sole treatment (without surgery) for patients with T1N0 low-lying rectal adenocarcinoma is effective with acceptable late complications. Our study and method offers a definitive anal sphincter-preserving radiotherapy for T1N0 low-lying rectal adenocarcinoma patients. PMID:28094790

  16. High solubilities of small hydrocarbons in trihexyl tetradecylphosphonium bis(2,4,4-trimethylpentyl) phosphinate.

    Science.gov (United States)

    Liu, Xiangyang; Afzal, Waheed; Yu, Guangren; He, Maogang; Prausnitz, John M

    2013-09-12

    Experimental solubilities are reported for methane, ethane, ethylene, propane, and propylene in trihexyl tetradecylphosphonium bis(2,4,4-trimethylpentyl) phosphinate [P(14)666][TMPP] from 313 to 353 K up to 6.7 MPa. A literature review on solubilities of small hydrocarbons in ionic liquids shows that solubilities in [P(14)666][TMPP] are appreciably larger than those in other ionic liquids. Contrary to solubilities in ionic liquids studied earlier, solubilities of paraffins (ethane and propane) in [P(14)666][TMPP] are larger than those of the corresponding olefins (ethylene and propylene). Because, at fixed temperature, the vapor pressure of an olefin is larger than that of the corresponding paraffin, the relative volatility of the olefin exceeds that of the corresponding paraffin, contrary to the relative volatility observed in conventional extractive distillation with polar solvents where the volatility of the paraffin exceeds that of the corresponding olefin.

  17. 19 CFR 24.4 - Optional method for payment of estimated import taxes on alcoholic beverages upon entry, or...

    Science.gov (United States)

    2010-04-01

    ... taxes on alcoholic beverages upon entry, or withdrawal from warehouse, for consumption. 24.4 Section 24... estimated import taxes on alcoholic beverages upon entry, or withdrawal from warehouse, for consumption. (a) Application to defer. An importer, including a transferee of alcoholic beverages in a Customs bonded warehouse...

  18. 5 CFR 531.244 - Adjusting a GM employee's rate at the time of an annual pay adjustment.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Adjusting a GM employee's rate at the... Rules for Gm Employees § 531.244 Adjusting a GM employee's rate at the time of an annual pay adjustment... agency must set the new GS rate for a GM employee as follows: (1) For a GM employee whose GS rate equals...

  19. 30 CFR 250.244 - What geological and geophysical (G&G) information must accompany the DPP or DOCD?

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false What geological and geophysical (G&G... Operations Coordination Documents (docd) § 250.244 What geological and geophysical (G&G) information must accompany the DPP or DOCD? The following G&G information must accompany your DPP or DOCD: (a) Geological...

  20. Synthesis and structure of [2-(4,4-dimethyl-2-oxazoline)-5-methylphenyl] methylphenyltin bromide : A novel triorganotin halide having a configurationally stable chiral tin center

    NARCIS (Netherlands)

    Koten, G. van; Jastrzebski, J.T.B.H.; Wehman, E.; Boersma, J.; Goubitz, K.; Heijdenrijk, D.

    1991-01-01

    Reaction of [2-(4, 4-dimethyl-2-oxazoline)-5-methylphenyl]copper with dimethyltin dibromide or methylphenyltin dibromide affords [2-(4,4-dimethyl-2-oxazoline)-5-methylphenyl]dimethyltin bromide (1) and [2-(4,4-dimethyl-2-oxazoline)-5-methylphenyl]methylphenyltin bromide (2), respectively. The

  1. Californium-252 Program Equipment Evaluation

    Energy Technology Data Exchange (ETDEWEB)

    Chattin, Fred Rhea [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Wilson, Kenton [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Ezold, Julie G. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States)

    2017-12-01

    To successfully continue the 252Cf production and meet the needs of the customers, a comprehensive evaluation of the Building 7920 processing equipment was requested to identify equipment critical to the operational continuity of the program.

  2. The statistical model calculation of prompt neutron spectra from spontaneous fission of {sup 244}Cm and {sup 246}Cm

    Energy Technology Data Exchange (ETDEWEB)

    Gerasimenko, B.F. [V.G. Khlopin Radium Inst., Saint Peterburg (Russian Federation)

    1997-03-01

    The calculations of integral spectra of prompt neutrons of spontaneous fission of {sup 244}Cm and {sup 246}Cm were carried out. The calculations were done by the Statistical Computer Code Complex SCOFIN applying the Hauser-Feschbach method as applied to the description of the de-excitation of excited fission fragments by means of neutron emission. The emission of dipole gamma-quanta from these fragments was considered as a competing process. The average excitation energy of a fragment was calculated by two-spheroidal model of tangent fragments. The density of levels in an excited fragment was calculated by the Fermi-gas model. The quite satisfactory agreement was reached between theoretical and experimental results obtained in frames of Project measurements. The calculated values of average multiplicities of neutron number were 2,746 for {sup 244}Cm and 2,927 for {sup 246}Cm that was in a good accordance with published experimental figures. (author)

  3. Short-Lived 244Pu Points to Neutron Star Binary Mergers as Sites for r-Process Nucleosynthesis

    Science.gov (United States)

    Hotokezaka, Kenta; Piran, Tsvi; Paul, Michael

    Measurements of the radioactive 244Pu abundances can break the degeneracy between high-rate/low-yield and low-rate/high-yield scenarios for the production of heavy r-process elements. The first corresponds to production by core collapse supernovae (cc-SNe) while the latter corresponds to production by e.g., neutron star binary mergers. The estimated 244Pu abundance in the current interstellar medium inferred from deep-sea measurements is significantly lower than that corresponding Early Solar System abundances. We estimate the expected median value of the 244Pu abundances and fluctuations around this value in both models [1]. We show that while the current and Early Solar System abundances are explained within the low-rate/high-yield scenario, they are incompatible with the high-rate/low-yield (cc-SNe) model. The inferred event rate remarkably agrees with neutron star binary merger rates estimated from Galactic neutron star binaries and from short gamma-ray bursts. The ejected mass of r-process elements per event agrees with both theoretical and observational macronova estimates.

  4. Investigating the Role of Loop C Hydrophilic Residue 'T244' in the Binding Site of ρ1 GABAC Receptors via Site Mutation and Partial Agonism.

    Directory of Open Access Journals (Sweden)

    Moawiah M Naffaa

    Full Text Available The loop C hydrophilic residue, threonine 244 lines the orthosteric binding site of ρ1 GABAC receptors was studied by point mutation into serine, alanine and cysteine, and tested with GABA, some representative partial agonists and antagonists. Thr244 has a hydroxyl group essential for GABA activity that is constrained by the threonine methyl group, orienting it toward the binding site. Significant decreases in activation effects of the studied ligands at ρ1 T244S mutant receptors, suggests a critical role for this residue. Results of aliphatic and heteroaromatic partial agonists demonstrate different pharmacological effects at ρ1 T244S mutant receptors when co-applied with GABA EC50 responses. ρ1 T244A and ρ1 T244C mutant receptors have minimal sensitivity to GABA at high mM concentrations, whereas, the ρ1 WT partial agonists, β-alanine and MTSEA demonstrate more efficacy and potency, respectively, than GABA at these mutant receptors. This study explores the role of Thr244 in the binding of agonists as an initial step during channel gating by moving loop C towards the ligand.

  5. Table of radionuclides (Vol.3 - {alpha} = 3 to 244); Table de radionucleides

    Energy Technology Data Exchange (ETDEWEB)

    Be, M.M.; Chiste, V.; Dulieu, Ch. [Laboratoire National Henri Becquerel - Centre d' Etudes Nucleaires de Saclay, 91 - Gif-sur-Yvette (France); Browne, E.; Baglin, C. [Lawrence Berkeley National Lab., CA (United States); Chechev, V.; Kuzmenko [Khlopin Radium Institute (KRI) (Russian Federation); Helmer, R. [Idaho National Engineering and Environmental Lab., Idaho Falls, ID (United States); Kondev, F. [Argonne National Lab., IL (United States); MacMahon, T.D. [National Physical Lab., Teddington (United Kingdom); Lee, K.B. [Korea Research Inst. of Standards and Science (Korea, Republic of)

    2006-07-01

    work involved in evaluating nuclear data is on-going and the recommended values are updated on the LNHB web site at http://www.nucleide.org/DDEP WG/DDEPdata.htm. The publication of further volumes of Monographie 5 is envisaged as and when necessary to add new radionuclide data or re-evaluations in a more permanent format that can be referenced easily. Although other data sets may still be used when evaluating radionuclide activity, use of this common, recommended data set should help to reduce the uncertainties in activity evaluations and lead to more coherent results for comparisons. This volume includes the evaluation of the following radionuclides: {sup 3}H, {sup 55}Fe, {sup 56}Co, {sup 60}Co, {sup 63}Ni, {sup 65}Zn, {sup 79}Se, {sup 90}Sr, {sup 90}Y, {sup 90}Y{sup m}, {sup 108}Ag, {sup 108}Ag{sup mn} {sup 111}In, {sup 125}Sb, {sup 137}Cs, {sup 153}Sm, {sup 159}Gd, {sup 203}Pb, {sup 233}Pa, {sup 233}Th, {sup 234}U, {sup 236}Np, {sup 236}Np{sup m}, {sup 237}U, {sup 238}U, {sup 242}Cm, {sup 243}Am, {sup 244}Cm. Primary recommended data comprise half-lives, decay modes, X-rays, gamma-rays, electron emissions, alpha- and beta-particle transitions and emissions, and their uncertainties. (authors)

  6. Chemical evolution of 244Pu in the solar vicinity and its implications for the properties of r-process production

    Science.gov (United States)

    Tsujimoto, Takuji; Yokoyama, Tetsuya; Bekki, Kenji

    2017-01-01

    Meteoritic abundances of r-process elements are analyzed to deduce the history of chemical enrichment by the r-process, from the beginning of disk formation to the present time in the solar vicinity. Our analysis combines the abundance information from short-lived radioactive nuclei such as 244Pu with the abundance information from stable r-process nuclei such as Eu. These two types of nuclei can be associated with one r-process event and an accumulation of events until the formation of the solar system, respectively. With the help of the observed local star formation (SF) history, we deduce the chemical evolution of 244Pu and obtain three main results: (I) the last r-process event occurred 130-140 Myr before the formation of the solar system; (II) the present-day low 244Pu abundance as measured in deep-sea reservoirs results from the low recent SF rate compared to ˜4.5-5 Gyr ago; and (III) there were ˜15 r-process events in the solar vicinity from the formation of the Galaxy to the time of solar system’s formation and ˜30 r-process events to the present time. Then, adopting the hypothesis that a neutron star (NS) merger is the r-process production site, we find that the ejected r-process elements are extensively spread out and mixed with interstellar matter, with a mass of ˜ 3.5× {10}6 M⊙, which is about 100 times larger than that for supernova ejecta. In addition, the event frequency of r-process production is estimated to be 1 per ~1400 core-collapse supernovae, which is identical to the frequency of NS mergers estimated from the analysis of stellar abundances.

  7. A multi-channel 24.4 ps bin size Time-to-Digital Converter for HEP applications

    CERN Document Server

    Mester, C; Morira, P

    2008-01-01

    A multi-channel time-tagging Time-to-Digital Converter (TDC) ASIC with a resolution of 24.4 ps (bin size) has been implemented and fabricated in a 130 nm CMOS technology. An on-chip PLL is used to generate an internal timing reference from an external 40 MHz clock source. The circuit is based on a 32 element Delay Locked Loop (DLL) which performs the time interpolation. The 32 channel architecture of the TDC is suitable for both triggered and non-triggered applications. The prototype contains test structures such as a substrate noise generator. The paper describes the circuit architecture and its principles of operation.

  8. Manganese determination om minerals by activation analysis, using the californium-252 as a neutron source; Determinacao de manganes em minerios, por analise por ativacao, usando californio-252 como fonte de neutrons

    Energy Technology Data Exchange (ETDEWEB)

    Cardoso, Antonio

    1976-07-01

    Neutron Activation Analysis, using a Californium-252 neutron source, has been applied for the determination of manganese in ores such as pyrolusite, rodonite (manganese silicate)' and blending used in dry-batteries The favorable nuclear properties of manganese, such as high thermal neutron cross-section for the reaction {sup 55}Mn (n.gamma){sup 56} Mn, high concentration of manganese in the matrix and short half - life of {sup 56}Mn, are an ideal combination for non-destructive analysis of manganese in ores. Samples and standards of manganese dioxide were irradiated for about 20 minutes, followed by a 4 to 15 minutes decay and counted in a single channel pulse-height discrimination using a NaI(Tl) scintillation detector. Counting time was equal to 10 minutes. The interference of nuclear reactions {sup 56}Fe(n,p){sup 56}Mn and {sup 59} Co (n, {alpha}){sup 56} were studied, as well as problems in connection with neutron shadowing during irradiation, gamma-rays attenuation during counting and influence of granulometry of samples. One sample,was also analysed by wet-chemical method (sodium bismuthate) in order to compare results. As a whole, i t was shown that the analytical method of neutron activation for manganese in ores and blending, is a method simple, rapid and with good precision and accuracy. (author)

  9. Design of a homogeneous subcritical nuclear reactor based on thorium with a source of californium 252; Diseno de un reactor nuclear subcritico homogeneo a base de Torio con una fuente de Californio 252

    Energy Technology Data Exchange (ETDEWEB)

    Delgado H, C. E.; Vega C, H. R. [Universidad Autonoma de Zacatecas, Unidad Academica de Estudios Nucleares, Cipres No. 10, Fracc. La Penuela, 98068 Zacatecas, Zac. (Mexico); Sajo B, L., E-mail: ce_delgado89@hotmail.com [Universidad Simon Bolivar, Laboratorio de Fisica Nuclear, Apdo. 89000, 1080A Caracas (Venezuela, Bolivarian Republic of)

    2015-10-15

    Full text: One of the energy alternatives to fossil fuels which do not produce greenhouse gases is the nuclear energy. One of the drawbacks of this alternative is the generation of radioactive wastes of long half-life and its relation to the generation of nuclear materials to produce weapons of mass destruction. An option to these drawbacks of nuclear energy is to use Thorium as part of the nuclear fuel which it becomes in U{sup 233} when capturing neutrons, that is a fissile material. In this paper Monte Carlo methods were used to design a homogeneous subcritical reactor based on thorium. As neutron reflector graphite was used. The reactor core is homogeneous and is formed of 70% light water as moderator, 12% of enriched uranium UO{sub 2}(NO{sub 3}){sub 4} and 18% of thorium Th(NO{sub 3}){sub 4} as fuel. To start the nuclear fission chain reaction an isotopic source of californium 252 was used with an intensity of 4.6 x 10{sup 7} s{sup -1}. In the design the value of the effective multiplication factor, whose value turned out k{sub eff} <1 was calculated. Also, the neutron spectra at different distances from the source and the total fluence were calculated, as well as the values of the ambient dose equivalent in the periphery of the reactor. (Author)

  10. When the non-contrast-enhanced phase is unnecessary in abdominal computed tomography scans? A retrospective analysis of 244 cases

    Directory of Open Access Journals (Sweden)

    Danilo Manuel Cerqueira Costa

    2013-07-01

    Full Text Available Objective: To evaluate the necessity of the non contrast-enhanced phase in abdominal computed tomography scans. Materials and Methods: A retrospective, cross-sectional, observational study was developed, evaluating 244 consecutive abdominal computed tomography scans both with and without contrast injection. Initially, the contrast-enhanced images were analyzed (first analysis. Subsequently, the observers had access to the non-contrast-enhanced images for a second analysis. The primary and secondary diagnoses were established as a function of the clinical indications for each study (such as tumor staging, acute abdomen, investigation for abdominal collection and hepatocellular carcinoma, among others. Finally, the changes in the diagnoses resulting from the addition of the non-contrast-enhanced phase were evaluated. Results: Only one (0.4%; p > 0.999; non-statistically significant out of the 244 reviewed cases had the diagnosis changed after the reading of non-contrast-enhanced images. As the secondary diagnoses are considered, 35 (14% cases presented changes after the second analysis, as follows: nephrolithiasis (10%, steatosis (3%, adrenal nodule (0.7% and cholelithiasis (0.3%. Conclusion: For the clinical indications of tumor staging, acute abdomen, investigation of abdominal collections and hepatocellular carcinoma, the non-contrast-enhanced phase can be excluded from abdominal computed tomography studies with no significant impact on the diagnosis.

  11. When the non-contrast-enhanced phase is unnecessary in abdominal computed tomography scans? A retrospective analysis of 244 cases

    Energy Technology Data Exchange (ETDEWEB)

    Costa, Danilo Manuel Cerqueira; Salvadori, Priscila Silveira; Monjardim, Rodrigo da Fonseca; Bretas, Elisa Almeida Sathler; Torres, Lucas Rios; Caldana, Rogerio Pedreschi; Shigueoka, David Carlos; Medeiros, Regina Bitelli; D' ippolito, Giuseppe, E-mail: giuseppe_dr@uol.com.br [Universidade Federal de Sao Paulo (EPM/UNIFESP), Sao Paulo, SP (Brazil). Escola Paulista de Medicina. Departamento de Diagnostico por Imagem

    2013-06-15

    Objective: to evaluate the necessity of the non contrast-enhanced phase in abdominal computed tomography scans. Materials and Methods: A retrospective, cross-sectional, observational study was developed, evaluating 244 consecutive abdominal computed tomography scans both with and without contrast injection. Initially, the contrast-enhanced images were analyzed (first analysis). Subsequently, the observers had access to the non-contrast-enhanced images for a second analysis. The primary and secondary diagnoses were established as a function of the clinical indications for each study (such as tumor staging, acute abdomen, investigation for abdominal collection and hepatocellular carcinoma, among others). Finally, the changes in the diagnoses resulting from the addition of the non-contrast-enhanced phase were evaluated. Results: Only one (0.4%; p > 0.999; non-statistically significant) out of the 244 reviewed cases had the diagnosis changed after the reading of non-contrast-enhanced images. As the secondary diagnoses are considered, 35 (14%) cases presented changes after the second analysis, as follows: nephrolithiasis (10%), steatosis (3%), adrenal nodule (0.7%) and cholelithiasis (0.3%). Conclusion: For the clinical indications of tumor staging, acute abdomen, investigation of abdominal collections and hepatocellular carcinoma, the non-contrast-enhanced phase can be excluded from abdominal computed tomography studies with no significant impact on the diagnosis. (author)

  12. Radioactive air emissions notice of construction use of a portable exhauster at 244-AR vault. Revision 2

    Energy Technology Data Exchange (ETDEWEB)

    Carrell, D.J.

    1997-12-17

    This document serves as a notice of construction (NOC), pursuant to the requirements of Washington Administrative Code (WAC) 246-247-060, and as a request for approval to construct, pursuant to 40 Code of Federal Regulations (CFR) 61.96, a portable exhauster at the 244-AR Vault. The exhauster would be used during air jetting of accumulated liquids from the cell sumps into the tanks and to make transfers among the tanks within the vault when needed. The 244-AR Vault is considered to be a double-contained receiver tank (OCRT) based on its functional characteristics, although it is not listed as one of the five designated DCRTs in the 200 Area Tank Farm systems. Process operations at the vault have been inactive since 1978 and the vault`s two stacks have not operated since 1993. Since cessation of vault operations an extremely large amount of rain water and snow melt have accumulated in the cell sumps. The water level in the sumps is substantially above their respective operating levels and there is concern for leakage to the environment through containment failure due to corrosion from backed-up sump liquid. Active ventilation is required to provide contamination control during air jetting operations within the vault. It has been determined that it would not be cost effective to repair the existing exhaust systems to an operational condition; thus, a portable exhauster will be used to support the intermittent operations.

  13. Economic development, urbanization, technological change and overweight: What do we learn from 244 Demographic and Health Surveys?

    Science.gov (United States)

    Goryakin, Yevgeniy; Suhrcke, Marc

    2014-01-01

    Obesity and overweight are spreading fast in developing countries, and have reached world record levels in some of them. Capturing the size, patterns and trends of the problem has, however, been severely hampered by the lack of comparable data in low and middle income countries. We seek to begin to fill this gap by testing several hypotheses on the determinants/correlates of overweight among women, related to the influence of economic and technological development. We undertake econometric analysis of nationally representative data on about 878,000 women aged 15–49 from 244 Demographic and Health Surveys (DHS) for 56 countries over the years 1991–2009. Our findings support most previously expressed hypotheses of what might explain obesity patterns in developing countries, but they also reject some prior notions and add considerable nuance to the emerging pattern. PMID:24457038

  14. Interleukin 7 receptor alpha Thr244Ile genetic polymorphism is associated with susceptibility and prognostic markers in breast cancer subgroups.

    Science.gov (United States)

    Vitiello, Glauco Akelinghton Freire; Losi Guembarovski, Roberta; Amarante, Marla Karine; Ceribelli, Jesus Roberto; Carmelo, Elaine Cristina Baraldi; Watanabe, Maria Angelica Ehara

    2018-03-01

    Interleukin-7 (IL-7) exerts crucial functions on lymphoid cells' development and maintenance. In breast cancer (BC), IL-7 promotes growth of tumor cells in culture through the activation of JAK1/3-STAT5 and PI3K/AKT pathways, and expression of IL-7 signaling components was associated with worst prognosis. AC>T polymorphism (rs6897932; Thr244Ile) at exon 6 of IL-7 receptor alpha (IL-7Rα) gene (IL7RA) shifts the balance between the membrane-bound and soluble IL-7Rα splicing variants and was previously associated with autoimmune diseases, but has not been studied in cancer, including BC, so far. Therefore, the present study aimed to investigate the possible association of this polymorphism with the susceptibility and clinicopathological parameters of BC subgroups. IL7RA Thr244Ile was genotyped through PCR-RFLP in 403 women without neoplasia, no personal history of malignancy or family history of BC and in 338 BC patients with clinicopathological data available. BC patients were stratified according to their positivity for estrogen (ER) and/or progesterone receptor (PR) and human epidermal growth factor receptor 2 (HER2). Age-adjusted logistic regression was performed for case-control analyses, and correlations with clinicopathological parameters were assessed through Kendall's Tau-b coefficient. All analyses were two-tailed and had 95% confidence interval. In ER-PR-HER2- BCs, TT genotype was associated with increased susceptibility both in genotypic (TT vs. CC: OR=3.07; CI=1.01-9.38; p=0.05) and recessive (TT vs. CC+CT: OR=3.59; CI=1.19-10.85; p=0.02) models and negatively correlated with disease stage (Tau-b=-0.27; p=0.05). Whereas T allele was positively correlated with histopathological grade (Tau-b=0.29; p=0.03) and lymph node metastasis (Tau-b=0.35; p=0.02) in ER/PR+HER2+BCs and with Ki67 (Tau-b=0.51; p=0.008) in ER-PR-HER2+ subgroup. These data indicate that IL-7Rα is involved in BC, and that IL7RA polymorphism may play distinct roles in breast carcinogenesis

  15. 8 CFR 240.21 - Suspension of deportation and adjustment of status under section 244(a) of the Act (as in effect...

    Science.gov (United States)

    2010-01-01

    ...)(i) of the Illegal Immigration Reform and Immigrant Responsibility Act (IIRIRA), as amended by... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Suspension of deportation and adjustment of... of deportation and adjustment of status under section 244(a) of the Act (as in effect before April 1...

  16. 8 CFR 1240.21 - Suspension of deportation and adjustment of status under section 244(a) of the Act (as in effect...

    Science.gov (United States)

    2010-01-01

    ... described in section 309(c)(5)(C)(i) of the Illegal Immigration Reform and Immigrant Responsibility Act... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Suspension of deportation and adjustment of... Removal § 1240.21 Suspension of deportation and adjustment of status under section 244(a) of the Act (as...

  17. High-quality permanent draft genome sequence of Ensifer medicae strain WSM244, a microsymbiont isolated from Medicago polymorpha growing in alkaline soil.

    Science.gov (United States)

    Ardley, Julie; Tian, Rui; O'Hara, Graham; Seshadri, Rekha; Reddy, T B K; Pati, Amrita; Woyke, Tanja; Markowitz, Victor; Ivanova, Natalia; Kyrpides, Nikos; Howieson, John; Reeve, Wayne

    2015-01-01

    Ensifer medicae WSM244 is an aerobic, motile, Gram-negative, non-spore-forming rod that can exist as a soil saprophyte or as a legume microsymbiont of Medicago species. WSM244 was isolated in 1979 from a nodule recovered from the roots of the annual Medicago polymorpha L. growing in alkaline soil (pH 8.0) in Tel Afer, Iraq. WSM244 is the only acid-sensitive E. medicae strain that has been sequenced to date. It is effective at fixing nitrogen with M. polymorpha L., as well as with more alkaline-adapted Medicago spp. such as M. littoralis Loisel., M. scutellata (L.) Mill., M. tornata (L.) Mill. and M. truncatula Gaertn. This strain is also effective with the perennial M. sativa L. Here we describe the features of E. medicae WSM244, together with genome sequence information and its annotation. The 6,650,282 bp high-quality permanent draft genome is arranged into 91 scaffolds of 91 contigs containing 6,427 protein-coding genes and 68 RNA-only encoding genes, and is one of the rhizobial genomes sequenced as part of the DOE Joint Genome Institute 2010 Genomic Encyclopedia for Bacteria and Archaea-Root Nodule Bacteria (GEBA-RNB) project proposal.

  18. Cysteine residues 244 and 458–459 within the catalytic subunit of Na,K-ATPase control the enzyme's hydrolytic and signaling function under hypoxic conditions

    Directory of Open Access Journals (Sweden)

    Irina Yu. Petrushanko

    2017-10-01

    Full Text Available Our previous findings suggested that reversible thiol modifications of cysteine residues within the actuator (AD and nucleotide binding domain (NBD of the Na,K-ATPase may represent a powerful regulatory mechanism conveying redox- and oxygen-sensitivity of this multifunctional enzyme. S-glutathionylation of Cys244 in the AD and Cys 454-458-459 in the NBD inhibited the enzyme and protected cysteines’ thiol groups from irreversible oxidation under hypoxic conditions. In this study mutagenesis approach was used to assess the role these cysteines play in regulation of the Na,K-ATPase hydrolytic and signaling functions. Several constructs of mouse α1 subunit of the Na,K-ATPase were produced in which Cys244, Cys 454-458-459 or Cys 244-454-458-459 were replaced by alanine. These constructs were expressed in human HEK293 cells. Non-transfected cells and those expressing murine α1 subunit were exposed to hypoxia or treated with oxidized glutathione (GSSG. Both conditions induced inhibition of the wild type Na,K-ATPase. Enzymes containing mutated mouse α1 lacking Cys244 or all four cysteines (Cys 244-454-458-459 were insensitive to hypoxia. Inhibitory effect of GSSG was observed for wild type murine Na,K-ATPase, but was less pronounced in Cys454-458-459Ala mutant and completely absent in the Cys244Ala and Cys 244-454-458-459Ala mutants. In cells, expressing wild type enzyme, ouabain induced activation of Src and Erk kinases under normoxic conditions, whereas under hypoxic conditions this effect was inversed. Cys454-458-459Ala substitution abolished Src kinase activation in response to ouabain treatment, uncoupled Src from Erk signaling, and interfered with O2-sensitivity of Na,K-ATPase signaling function. Moreover, modeling predicted that S-glutathionylation of Cys 458 and 459 should prevent inhibitory binding of Src to NBD. Our data indicate for the first time that cysteine residues within the AD and NBD influence hydrolytic as well as receptor

  19. Cysteine residues 244 and 458-459 within the catalytic subunit of Na,K-ATPase control the enzyme's hydrolytic and signaling function under hypoxic conditions.

    Science.gov (United States)

    Petrushanko, Irina Yu; Mitkevich, Vladimir A; Lakunina, Valentina A; Anashkina, Anastasia A; Spirin, Pavel V; Rubtsov, Peter M; Prassolov, Vladimir S; Bogdanov, Nikolay B; Hänggi, Pascal; Fuller, William; Makarov, Alexander A; Bogdanova, Anna

    2017-10-01

    Our previous findings suggested that reversible thiol modifications of cysteine residues within the actuator (AD) and nucleotide binding domain (NBD) of the Na,K-ATPase may represent a powerful regulatory mechanism conveying redox- and oxygen-sensitivity of this multifunctional enzyme. S-glutathionylation of Cys244 in the AD and Cys 454-458-459 in the NBD inhibited the enzyme and protected cysteines' thiol groups from irreversible oxidation under hypoxic conditions. In this study mutagenesis approach was used to assess the role these cysteines play in regulation of the Na,K-ATPase hydrolytic and signaling functions. Several constructs of mouse α1 subunit of the Na,K-ATPase were produced in which Cys244, Cys 454-458-459 or Cys 244-454-458-459 were replaced by alanine. These constructs were expressed in human HEK293 cells. Non-transfected cells and those expressing murine α1 subunit were exposed to hypoxia or treated with oxidized glutathione (GSSG). Both conditions induced inhibition of the wild type Na,K-ATPase. Enzymes containing mutated mouse α1 lacking Cys244 or all four cysteines (Cys 244-454-458-459) were insensitive to hypoxia. Inhibitory effect of GSSG was observed for wild type murine Na,K-ATPase, but was less pronounced in Cys454-458-459Ala mutant and completely absent in the Cys244Ala and Cys 244-454-458-459Ala mutants. In cells, expressing wild type enzyme, ouabain induced activation of Src and Erk kinases under normoxic conditions, whereas under hypoxic conditions this effect was inversed. Cys454-458-459Ala substitution abolished Src kinase activation in response to ouabain treatment, uncoupled Src from Erk signaling, and interfered with O2-sensitivity of Na,K-ATPase signaling function. Moreover, modeling predicted that S-glutathionylation of Cys 458 and 459 should prevent inhibitory binding of Src to NBD. Our data indicate for the first time that cysteine residues within the AD and NBD influence hydrolytic as well as receptor function of the Na

  20. Evolving role of 2B4/CD244 in T and NK cell responses during virus infection

    Directory of Open Access Journals (Sweden)

    Stephen Noel Waggoner

    2012-12-01

    Full Text Available The signaling lymphocyte activation molecule (SLAM family receptor, 2B4/CD244, was first implicated in anti-viral immunity by the discovery that mutations of the SLAM-associated protein, SAP/SH2D1A, impaired 2B4-dependent stimulation of T and natural killer (NK cell anti-viral functions in X-linked lymphoproliferative (XLP syndrome patients with uncontrolled Epstein-Barr virus (EBV infections. Engagement of 2B4 has been variably shown to either activate or inhibit lymphocytes which express this receptor. While SAP expression is required for stimulatory functions of 2B4 on lymphocytes, it remains unclear whether inhibitory signals derived from 2B4 can predominate even in the presence of SAP. Regardless, mounting evidence suggests that 2B4 expression by NK and CD8 T cells is altered by virus infection in mice as well as in humans, and 2B4-mediated signaling may be an important determinant of effective immune control of chronic virus infections. In this review, recent findings regarding the expression and function of 2B4 as well as SAP on T and NK cells during virus infection is discussed, with a focus on the role of 2B4-CD48 interactions in crosstalk between innate and adaptive immunity.

  1. Resíduos de glifosato e ácido aminometilfosfônico e teores de isoflavonas em soja BRS 244 RR e BRS 154 Residues of glyphosate and aminomethylphosphonic acid and levels of isoflavones in BRS 244 RR and BRS 154 soybean

    Directory of Open Access Journals (Sweden)

    Giani Mariza Bärwald Bohm

    2008-12-01

    Full Text Available A principal forma de controle das plantas daninhas durante o cultivo de soja geneticamente modificada (GM RR BRS 244 RR é o uso de glifosato. Porém, existem dúvidas quanto à segurança desse herbicida, à qualidade dos grãos e do solo da soja GM RR cultivada em Planossolo. Resíduos da molécula do glifosato e do metabólito ácido aminometilfosfônico (AMPA podem estar presentes nos grãos, bem como, podem afetar a concentração de isoflavonas. Por isso, avaliaram-se as sojas BRS 244 RR e BRS 154 cultivadas nos seguintes tratamentos: T1 - soja BRS 244 RR, sem aplicação de herbicida, com capina manual aos 28 dias após o plantio (dap; T2 - soja BRS 154 sem aplicação de herbicida, com capina manual também aos 28 dap; T3 - soja BRS 244 RR com uma aplicação de glifosato a 960 g ia ha-1 aos 28 dap; T4 - soja BRS 244 RR com duas aplicações de glifosato a 960 g ia ha-1 aos 28 e 56 dap; T5 - soja BRS 244 RR com uma aplicação de herbicida imazetapir a 100 g ia ha-1 aos 28 dap; T6 - soja BRS 154 com uma aplicação de herbicida imazetapir a 100 g ia ha-1 aos 28 dap. Verificou-se que a aplicação de glifosato no controle de plantas daninhas resultou em teores elevados de glifosato e ácido aminometilfosfônico no solo. Nos grãos, o teor de isoflavonas não parece ser significativamente afetado pela aplicação de glifosato, mas os resíduos desse herbicida foram superiores ao permitido pela legislação vigente, que é de 10 mg.kg-1.The use of Glyphosate is the best way to control weed growing when cultivating genetically modified soybean (GMRR BRS 244 RR. However, there have been doubts about the safety of this herbicide use concerning its effects on the quality of grains and on the soil of Albaqualf cultivated GMRR soybean. Glyphosate and the metabolite aminomethylphosphonic acid (AMPA residues can be present in the grains and affect the isoflavones concentration. Therefore, BRS 244 RR and BRS 154 soybeans with the following

  2. Resíduos de glifosato e ácido aminometilfosfônico e teores de isoflavonas em soja BRS 244 RR e BRS 154

    OpenAIRE

    Bohm,Giani Mariza Bärwald; Genovese,Maria Inés; Pigosso,Gustavo; Trichez,Daniel; Rombaldi,Cesar Valmor

    2008-01-01

    A principal forma de controle das plantas daninhas durante o cultivo de soja geneticamente modificada (GM RR) BRS 244 RR é o uso de glifosato. Porém, existem dúvidas quanto à segurança desse herbicida, à qualidade dos grãos e do solo da soja GM RR cultivada em Planossolo. Resíduos da molécula do glifosato e do metabólito ácido aminometilfosfônico (AMPA) podem estar presentes nos grãos, bem como, podem afetar a concentração de isoflavonas. Por isso, avaliaram-se as sojas BRS 244 RR e BRS 154 c...

  3. Drospirenone/ethinyl estradiol 3 mg/20 µg (24/4 day regimen: hormonal contraceptive choices – use of a fourth-generation progestin

    Directory of Open Access Journals (Sweden)

    Gloria Bachmann

    2009-08-01

    Full Text Available Gloria Bachmann, Sharon KopaczWomen’s Health Institute, University of Medicine and Dentistry of New Jersey, USAAbstract: The combined oral contraceptive pill (COC consisting of drospirenone 3 mg/ethinyl estradiol 20 µg (3 mg DRSP/20 µg EE-24/4 supplies 24 days of pills with hormones followed by 4 days of hormone-free pills. This regimen is called the 24/4 regimen. The progesterone component of this oral contraceptive pill (OCP, drospirenone (DRSP, is a fourth-generation progestin that has potent progestogenic, antimineralocorticoid, and antiandrogenic activity, which are unique characteristics compared with the other progestogens contained in most of the other OCPs currently marketed. This formulation, in addition to being an effective long-term OCP, has the additional medical benefit of providing a good parallel treatment for premenstrual dysphoric disorder and moderate acne. The effectiveness of 3 mg DRSP/20 µg EE-24/4, its tolerability and safety, and its additional non-contraceptive benefits are discussed.Keywords: drospirenone, premenstrual dysphoric disorder, acne vulgaris, contraception, antimineralocorticoid activity, antiandrogenic activity

  4. Biological, chemical and other data collected aboard the THOMAS G. THOMPSON during cruise TN244 in the Coastal Waters of SE Alaska from 2009-12-05 to 2009-12-08 (NODC Accession 0117395)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NODC accession 0117395 includes biological, chemical, optical and physical data collected aboard the THOMAS G. THOMPSON during cruise TN244 in the Coastal Waters of...

  5. Uptake of curium (/sup 244/Cm) by five benthic marine species (Arenicola marina, Cerastoderma edule, Corophium volutator, Nereis diversicolor and Scrobicularia plana): comparison with americium and plutonium

    Energy Technology Data Exchange (ETDEWEB)

    Miramand, P.; Germain, P.; Arzur, J.C.

    1987-01-01

    Curium (/sup 244/Cm) uptake from contaminated sea water was studied in five benthic marine species: two bivalve molluscs (Scrobicularia plana and Cerastoderma edule), two polychaete annelids (Arenicola marina and Nereis diversicolor) and one amphidpod crustacean (Corophium volutator). The concentrations in the whole organisms relative to the concentration in the sea water (concentration factors) were: 700 for the amphipods (after 11 d of accumulation), 140 for the cockles (after 28 d), 80 for the scrobicularia (after 23d) and approx. 30 for the two annelids (after > 20 d). All species except S. plana accumulated americium and curium similarly; S. plana accumulated similar amounts of curium and plutonium.

  6. Novel and highly effective chemoenzymatic synthesis of (2R)-2-[4-(4-cyano-2-fluorophenoxy)phenoxy]butylpropanoate based on lipase mediated transesterification.

    Science.gov (United States)

    Zhu, Genlin; Yao, Risheng; Zhu, Huixia; Wang, Huai

    2012-04-01

    (2R)-2-[4-(4-Cyano-2-fluorophenoxy)phenoxy]butylpropanoate (cyhalofop-butyl, CyB) was synthesized by a chemoenzymatic route involving enantioselective transesterification with Candida antarctica lipase B (Novozym 435). The optimum organic solvent, acyl donor, a ( w ), reaction temperature and shaking rate for the transesterification were acetonitrile, n-butanol, 0.11, 45°C and 200 rpm, respectively. Under the optimum conditions, the maximum substrate conversion and the enantiomeric purity of the product were 96.9 and >99%, respectively. The total yield and enantiomeric purity of CyB by this chemoenzymatic synthesis were 60.4 and >99%, respectively; 15.3 and 21% higher than that of the traditional way (45 and 78%).

  7. Analysis of linear energy transfers and quality factors of charged particles produced by spontaneous fission neutrons from 252Cf and 244Pu in the human body.

    Science.gov (United States)

    Endo, Akira; Sato, Tatsuhiko

    2013-04-01

    Absorbed doses, linear energy transfers (LETs) and quality factors of secondary charged particles in organs and tissues, generated via the interactions of the spontaneous fission neutrons from (252)Cf and (244)Pu within the human body, were studied using the Particle and Heavy Ion Transport Code System (PHITS) coupled with the ICRP Reference Phantom. Both the absorbed doses and the quality factors in target organs generally decrease with increasing distance from the source organ. The analysis of LET distributions of secondary charged particles led to the identification of the relationship between LET spectra and target-source organ locations. A comparison between human body-averaged mean quality factors and fluence-averaged radiation weighting factors showed that the current numerical conventions for the radiation weighting factors of neutrons, updated in ICRP103, and the quality factors for internal exposure are valid.

  8. A study of nuclear structure for 244Cm, 241Am, 238Pu, 210Po, 147Pm, 137Cs, 90Sr and 63Ni nuclei used in nuclear battery

    Science.gov (United States)

    Artun, Ozan

    2017-07-01

    In this paper, we intend to extend the nuclear data of 244Cm, 241Am, 238Pu, 210Po, 147Pm, 137Cs, 90Sr and 63Ni nuclei used in nuclear battery technology, because, these nuclei are quite important for space investigations in radioisotope thermoelectric generator (RTG) and for microelectronic technologies in betavoltaic batteries. Therefore, the nuclear structure properties of nuclei such as separation energies, neutron skin thicknesses, proton, charge and neutron density distributions as a function of radius, the root mean square (rms) proton, charge and neutron radii, binding energies per particle, have been investigated by Hartree-Fock with eight different Skyrme forces. The obtained results have been compared with the experimental data in literature and relativistic mean field theory (RMFT) results.

  9. Is there an improvement of antibiotic use in China? Evidence from the usage analysis of combination antibiotic therapy for type I incisions in 244 hospitals.

    Science.gov (United States)

    Zhou, Wen-Juan; Luo, Zhen-Ni; Tang, Chang-Min; Zou, Xiao-Xu; Zhao, Lu; Fang, Peng-Qian

    2016-10-01

    The improvement of antibiotic rational use in China was studied by usage analysis of combination antibiotic therapy for type I incisions in 244 hospitals. Five kinds of hospitals, including general hospital, maternity hospital, children's hospital, stomatological hospital and cancer hospital, from 30 provinces were surveyed. A systematic random sampling strategy was employed to select outpatient prescriptions and inpatient cases in 2011 and 2012. A total of 29 280 outpatient prescriptions and 73 200 inpatient cases from 244 hospitals in each year were analyzed. Data were collected with regards to the implementation of the national antibiotic stewardship program (NASP), the overall usage and the prophylactic use of antibiotic for type I incisions. Univariate analysis was used for microbiological diagnosis rate before antimicrobial therapy, prophylactic use of antibiotics for type I incision operation, and so on. For multivariate analysis, the use of antibiotics was dichotomized according to the guidelines, and entered as binary values into logistic regression analysis. The results were compared with the corresponding criteria given by the guidelines of this campaign. The antibiotic stewardship in China was effective in that more than 80% of each kind of hospitals achieved the criteria of recommended antibiotics varieties. Hospital type appeared to be a factor statistically associated with stewardship outcome. The prophylactic use of antibiotics on type I incision operations decreased by 16.22% (Pantibiotic therapy for type I incisions was also decreased. Region and bed size were the main determinants on surgical prophylaxis for type I incision. This national analysis of hospitals on antibiotic use and stewardship allows relevant comparisons for bench marking. More efforts addressing the root cause of antibiotics abuse would continue to improve the rational use of antibiotics in China.

  10. Synthesis of 2',4-dihydroxy-3-methoxychalcone and 2',4',4-trihydroxy-3-methoxychalcone as a candidate anticancer against cervical (WiDr), colon (HeLa), and breast (T47d) cancer cell lines in vitro

    Science.gov (United States)

    Matsjeh, Sabirin; Swasono, Respati Tri; Anwar, Chairil; Solikhah, Eti Nurwening; Lestari, Endang

    2017-03-01

    The compound 2',4-dihydroxy-3-methoxychalcone and 2',4',4-trihydroxy-3-methoxychalcone have been synthesized through Claisen-Schmidt reaction from 2-hydroxyacetophenone and 2,4-dihydroxyacetophenone with 4-hydroxy-3-methoxy benzaldehida (vanillin) in aqueous KOH 40% and KSF montmorillonite as catalyst in methanol. All these products were characterized by FT-IR, TLC Scanner, GC-MS, MS-Direct, and 1H-NMR and 13C-NMR spectrometer. Both of these compounds were tested citotoxycity activity as an anticancer against cervical, colon, and breast cancer cells (Hela, WiDr, and T47D cell lines) using MTT assay in vitro. Dose series given test solution concentration on Hela, WiDr, and T47D cells started from 6,25; 25; 50 and 100 µg/mL with incubation treatment for 24 hours. The result of study showed that the 2',4-dihydroxy-3-methoxychalcone as bright yellow crystal with the melting point of 114-115 °C and the yield of 13.77% and the 2',4',4-trihydroxy-3-methoxychalcone as bright yellow crystals with the melting point of 195-197 °C and the yield of 6%. Other 2',4-dihydroxy-3-methoxychalcone and 2',4',4-trihydroxy-3-methoxychalcone also exhibited cytotoxic activity against the cancer cell lines, with the 2',4',4-trihydroxy-3-methoxychalcone showed greater activities than the 2',4-dihydroxy-3-methoxychalcone in WiDr cell lines. The 2',4-dihydroxy-3-methoxychalcone and 2',4',4-trihydroxy-3-methoxychalcone exhibited strong anticancer activities with IC50 value below 20 µg/mL. The activity of 2',4',4-trihydroxy-3-methoxychalcone showed the most active against Hela and WiDr cell lines with IC50 value 8.53 and 2.66 µg/mL respectively, than T47D cell lines with IC50 value 24.61 µg/mL. The test results cytotoxic of 2',4-dihydroxy-3-methoxychalcone showed the most active against Hela and WiDr cell lines with IC50 value 12.80, 19.57 µg/mL than T47D cell lines with IC50 value of 20.73 µg/mL. IC50 value indicated that 2',4-dihydroxy-3-methoxychalcone and 2',4',4-trihydroxy-3

  11. Vibrational spectroscopic investigations and molecular docking studies of biologically active 2-[4-(4-phenylbutanamido)phenyl]-5-ethylsulphonyl-benzoxazole

    Science.gov (United States)

    Jalaja, K.; Al-Alshaikh, Monirah A.; Mary, Y. Sheena; Panicker, C. Yohannan; El-Emam, Ali A.; Temiz-Arpaci, Ozlem; Alsenoy, C. Van

    2017-11-01

    The optimized molecular structure, vibrational wavenumbers, corresponding vibrational assignments of 2-[4-(4-phenylbutanamido)phenyl]-5-ethylsulphonyl-benzoxazole have been investigated experimentally and theoretically using Gaussian09 software. The wavenumbers were assigned by potential energy distribution and the frontier molecular orbital analysis is used to determine the charge transfer within the molecule. The stability of the molecule arising from hyper-conjugative interaction and charge delocalization has been analyzed using NBO analysis. The MEP analysis shows that the negative electrostatic potential regions are mainly localized over the oxygen's of the carbonyl and sulfonyl groups and nitrogen atom of the benzoxazole ring and are possible sites for electrophilic attack and the positive regions are localized over the NH group as possible sites for nucleophilic attack. From the molecular docking study, the ligand binds at the active sites of the protein by weak non-covalent interactions most prominent of which are H-bonding, cation-π and sigma-π interactions.

  12. Phenotype and 244k array-CGH characterization of chromosome 13q deletions: an update of the phenotypic map of 13q21.1-qter

    DEFF Research Database (Denmark)

    Kirchhoff, Maria; Bisgaard, Anne-Marie; Stoeva, Radka

    2009-01-01

    Partial deletions of the long arm of chromosome 13 lead to variable phenotypes dependant on the size and position of the deleted region. In order to update the phenotypic map of chromosome 13q21.1-qter deletions, we applied 244k Agilent oligonucleotide-based array-CGH to determine the exact...... breakpoints in 14 patients with partial deletions of this region. Subsequently, we linked the genotype to the patient's phenotype. Using this approach, we were able to refine the smallest deletion region linked to short stature (13q31.3: 89.5-91.6 Mb), microcephaly (13q33.3-q34), cortical development...... malformations (13q33.1-qter), Dandy-Walker malformation (DWM) (13q32.2-q33.1), corpus callosum agenesis (CCA) (13q32.3-q33.1), meningocele/encephalocele (13q31.3-qter), DWM, CCA, and neural tube defects (NTDs) taken together (13q32.3-q33.1), ano-/microphthalmia (13q31.3-13qter), cleft lip/palate (13q31.3-13q33...

  13. Design, synthesis, in silico and biological evaluation of novel 2-(4-(4-substituted piperazin-1-yl)benzylidene)hydrazine carboxamides.

    Science.gov (United States)

    Kumari, Shikha; Mishra, Chandra Bhushan; Idrees, Danish; Prakash, Amresh; Yadav, Rajesh; Hassan, Md Imtaiyaz; Tiwari, Manisha

    2017-02-01

    A series of novel 2-(4-(4-substituted piperazin-1-yl)benzylidene)hydrazinecarboxamide derivatives has been successfully designed and synthesized to evaluate their potential as carbonic anhydrase (CA) inhibitors. The inhibitory potential of synthesized compounds against human CAI and CAII was evaluated. Compounds 3a-n exhibited [Formula: see text] values between [Formula: see text] against CAI and [Formula: see text] against CAII. Compound 3g was the most active inhibitor, with an [Formula: see text] value of [Formula: see text] against CAII. Molecular docking studies of compound 3g with CAII showed this compound fits nicely in the active site of CAII and it interacts with the zinc ion ([Formula: see text]) along with three histidine residues in the active site. Molecular dynamics simulation studies of compound 3g complexed with CAII also showed essential interactions which were maintained up to 40 ns of simulation. In vivo sub-acute toxicity study using 3g (300 mg/kg) was found non-toxic in adult Wistar rats.

  14. Indepth interviews with 244 female suicide attempters and their associates in northern China: understanding the process and causes of the attempt.

    Science.gov (United States)

    Li, Xianyun; Phillips, Michael R; Cohen, Alex

    2012-01-01

    Attempted suicide, a deliberate self-directed behavior situated within the unique social world of an individual, is a major risk factor for suicide. Efforts aimed at addressing female suicide must be based on understanding their perceived causes and the meaning of this behavior. This study describes the perceived causes of suicidal behaviors to determine preventive measures of female suicide in China. An in-depth interview about the process and causes of suicidal behavior as well as a detailed structured and a standardized diagnostic interview were administered to 244 female attempters treated at general hospitals and, separately, to their relatives. The perceived three most frequent causes of the attempts were interpersonal conflict (87%), psychological problems (33%), and conflict between others that affected the subject (27%). On average 2.2 causes were identified for each case. The identification in the in-depth interviews of psychological problems as a cause of the attempt was concordant with the results of the independent psychiatric exam identifying a current DSM-IV mental disorder in 38% of cases (Kappa=0.64). Preventive measures of improving interpersonal and problem-solving skills should be developed and assessed for addressing female suicide in China besides expansion of psychiatric services.

  15. Interaction of NF-κB and IκBα, IκBαM, IκBα243N or IκBα244C studied with fluorescent fusion proteins by FRET in living cells

    Science.gov (United States)

    Li, Xian; Chen, Xiaojia; Tang, Yonghong

    2006-09-01

    In this paper, the location and interaction of NF-κB and IκBα (IκBαM, IκBα243N, or IκBα244C) in vivo is investigated by fluorescence resonance energy transfer (FRET). Co-transfection of a YFP-p65 construct with CFP- IκBα, C.FP-lid3aM (S32,36A), or CFP-IκBα243N(i-243) resulted in cytosolic localization of both proteins in almost all of the transfected cells. Co-transfection of YFP-p65 construct with CFP-Iw.Ba244C showed a predominant nuclear fluorescence of the proteins. The interaction between YFP-p65 and CFP-IκBα, CFP-IκBαM, CFP-IκBα243N or CFP-IκBα244C were further studied by acceptor bleaching experiments. When YFP-p65 were bleached, the fluorescence of CFP-IκBα, CFP-IκBm, CFP-IκBα243N increased. However, YFP-p65 and CFP-IκBα244C didn't have FRET and the fluorescence of CFP-IκBα244C were not influenced when YFP-p65 were bleached. This observation suggests that NF-κB interacted with the ankyrin repeat domain of IκBα, and our study domonstrates that the application of fluorescent fusion protein, FRET and acceptor bleaching technique to investigate protein-protein interactions in living cells might expand our understanding of these interactions considerably.

  16. In silico enhanced restriction enzyme based methylation analysis of the human glioblastoma genome using Agilent 244K CpG Island microarrays

    Directory of Open Access Journals (Sweden)

    Anh Tran

    2010-01-01

    Full Text Available Genome wide methylation profiling of gliomas is likely to provide important clues to improving treatment outcomes. Restriction enzyme based approaches have been widely utilized for methylation profiling of cancer genomes and will continue to have importance in combination with higher density microarrays. With the availability of the human genome sequence and microarray probe sequences, these approaches can be readily characterized and optimized via in silico modeling. We adapted the previously described HpaII/MspI based Methylation Sensitive Restriction Enzyme (MSRE assay for use with two-color Agilent 244K CpG island microarrays. In this assay, fragmented genomic DNA is digested in separate reactions with isoschizomeric HpaII (methylation-sensitive and MspI (methylation-insensitive restriction enzymes. Using in silico hybridization, we found that genomic fragmentation with BfaI was superior to MseI, providing a maximum effective coverage of 22,362 CpG islands in the human genome. In addition, we confirmed the presence of an internal control group of fragments lacking HpaII/MspI sites which enable separation of methylated and unmethylated fragments. We used this method on genomic DNA isolated from normal brain, U87MG cells, and a glioblastoma patient tumor sample and confirmed selected differentially methylated CpG islands using bisulfite sequencing. Along with additional validation points, we performed a receiver operating characteristics (ROC analysis to determine the optimal threshold (p ≤ 0.001. Based on this threshold, we identified ~2400 CpG islands common to all three samples and 145 CpG islands unique to glioblastoma. These data provide more general guidance to individuals seeking to maximize effective coverage using restriction enzyme based methylation profiling approaches.

  17. Influence of ABO blood group and Rhesus factor on breast cancer risk: a meta-analysis of 9665 breast cancer patients and 244,768 controls.

    Science.gov (United States)

    Miao, Su-Yu; Zhou, Wenbin; Chen, Ling; Wang, Shui; Liu, Xiao-An

    2014-06-01

    Blood group is an important risk factor for some malignancies, including pancreatic and stomach cancer. However, it is unclear whether the risk of breast cancer is higher in any specific ABO blood type. We searched the electronic database of PubMed, EMBASE, China National Knowledge Infrastructure and the VIP Chinese Journal of Science and Technology for case-control studies about blood type and breast cancer incidence, and a meta-analysis was conducted. Fourteen studies were eligible for assessment on the association of breast cancer with different blood types, including 9665 breast cancer patients and 244,768 controls. Relative to blood type O, women with blood type A (odds ratio (OR) = 1.115, 95% confidence interval (CI) 0.992-1.254), B (OR = 0.983, 95% CI 0.915-1.056) and AB (OR = 1.042, 95% CI 0.881-1.231) had the same breast cancer risk. The risk for women with Rhesus-positive (Rh+) was the same as those with Rh-negative (Rh-) (OR = 0.948, 95% CI 0.667-1.348). Among Caucasians, the OR of blood type A was 1.066 (95% CI, 1.001-1.134, P = 0.522 for heterogeneity). This meta-analysis suggests Caucasians with blood type A may have a higher risk of breast cancer than other Caucasians. No association was found in any other blood type or any other population. Similarly, the Rh factor had no association with the risk of breast cancer. © 2013 Wiley Publishing Asia Pty Ltd.

  18. Dual function of the NK cell receptor 2B4 (CD244 in the regulation of HCV-specific CD8+ T cells.

    Directory of Open Access Journals (Sweden)

    Verena Schlaphoff

    2011-05-01

    Full Text Available The outcome of viral infections is dependent on the function of CD8+ T cells which are tightly regulated by costimulatory molecules. The NK cell receptor 2B4 (CD244 is a transmembrane protein belonging to the Ig superfamily which can also be expressed by CD8+ T cells. The aim of this study was to analyze the role of 2B4 as an additional costimulatory receptor regulating CD8+ T cell function and in particular to investigate its implication for exhaustion of hepatitis C virus (HCV-specific CD8+ T cells during persistent infection. We demonstrate that (i 2B4 is expressed on virus-specific CD8+ T cells during acute and chronic hepatitis C, (ii that 2B4 cross-linking can lead to both inhibition and activation of HCV-specific CD8+ T cell function, depending on expression levels of 2B4 and the intracellular adaptor molecule SAP and (iii that 2B4 stimulation may counteract enhanced proliferation of HCV-specific CD8+ T cells induced by PD1 blockade. We suggest that 2B4 is another important molecule within the network of costimulatory/inhibitory receptors regulating CD8+ T cell function in acute and chronic hepatitis C and that 2B4 expression levels could also be a marker of CD8+ T cell dysfunction. Understanding in more detail how 2B4 exerts its differential effects could have implications for the development of novel immunotherapies of HCV infection aiming to achieve immune control.

  19. 2B4 (CD244) induced by selective CD28 blockade functionally regulates allograft-specific CD8+ T cell responses

    Science.gov (United States)

    Liu, Danya; Krummey, Scott M.; Badell, I. Raul; Wagener, Maylene; Schneeweis, Lumelle A.; Stetsko, Dawn K.; Suchard, Suzanne J.; Nadler, Steven G.

    2014-01-01

    Mounting evidence in models of both autoimmunity and chronic viral infection suggests that the outcome of T cell activation is critically impacted by the constellation of co-stimulatory and co-inhibitory receptors expressed on the cell surface. Here, we identified a critical role for the co-inhibitory SLAM family member 2B4 (CD244) in attenuating primary antigen-specific CD8+ T cell responses in the presence of immune modulation with selective CD28 blockade. Our results reveal a specific up-regulation of 2B4 on antigen-specific CD8+ T cells in animals in which CD28 signaling was blocked. However, 2B4 up-regulation was not observed in animals treated with CTLA-4 Ig (abatacept) or CD28 blockade in the presence of anti–CTLA-4 mAb. 2B4 up-regulation after CD28 blockade was functionally significant, as the inhibitory impact of CD28 blockade was diminished when antigen-specific CD8+ T cells were deficient in 2B4. In contrast, 2B4 deficiency had no effect on CD8+ T cell responses during unmodified rejection or in the presence of CTLA-4 Ig. We conclude that blockade of CD28 signals in the presence of preserved CTLA-4 signals results in the unique up-regulation of 2B4 on primary CD8+ effectors, and that this 2B4 expression plays a critical functional role in controlling antigen-specific CD8+ T cell responses. PMID:24493803

  20. Comment on "Period function and normalizers of vector fields in R with n-1 first integrals" by D. Peralta-Salas [J. Differential Equations 244 (6) (2008) 1287-1303

    Science.gov (United States)

    Prince, G. E.

    In a recent paper by D. Peralta-Salas in this journal (J. Differential Equations 244 (6) (2008) 1287-1303) there appears an incorrect result relating symmetries and first integrals of a vector field. The proof relies on a nonexistent theorem in a paper by Sherring and Prince (Trans. Amer. Math. Soc. 334 (1992) 433-453); the error is corrected in this comment.

  1. A series of chiral coordination polymers containing helicals assembled from a new chiral (R)-2-(4'-(4''-carboxybenzyloxy)phenoxy)propanoic acid: syntheses, structures and photoluminescent properties.

    Science.gov (United States)

    He, Wei-Wei; Yang, Jin; Yang, Yan; Liu, Ying-Ying; Ma, Jian-Fang

    2012-08-28

    Ten new chiral coordination polymers, namely, [Ni(L)(H(2)O)(2)] (1), [Co(L)(H(2)O)(2)] (2), [Cd(L)(H(2)O)] (3), [Cd(L)(phen)] (4), [Mn(2)(L)(2) (phen)(2)]·H(2)O (5), [Cd(2)(L)(2)(biim-4)(2)] (6), [Zn(2)(L)(2)(biim-4)(2)] (7), [Cd(L)(pbib)] (8), [Cd(L)(bbtz)] (9) and [Cd(L)(biim-6)] (10), where phen = 1,10-phenathroline, biim-4 = 1,1'-(1,4-butanediyl)bis(imidazole), pbib = 1,4-bis(imidazole-1-ylmethyl)benzene, bbtz = 1,4-bis(1,2,4-triazol-1-ylmethyl)benzene, biim-6 = 1,1'-(1,6-hexanedidyl)bis(imidazole), and H(2)L = (R)-2-(4'-(4''-carboxybenzyloxy)phenoxy)propanoic acid, have been synthesized under hydrothermal conditions. Their structures have been determined by single-crystal X-ray diffraction analyses and further characterized by infrared spectra (IR), powder X-ray diffraction (PXRD), elemental analyses and thermogravimetric (TG) analyses. Compounds 1 and 2 exhibit similar 1D left-handed helical chains, which are further extended into 3D supramolecular structures through O-H···O hydrogen-bonding interactions, respectively. Compound 3 shows a 2D double-layer architecture containing helical chains. Compound 4 features two types of 2D undulated sheets with helical chains, which are stacked in an ABAB fashion along the c direction. Compound 5 possesses a 1D double chain ribbon structure containing unusual meso-helical chains, which is linked by π-π interactions into a 2D supramolecular layer. These layers are further extended by hydrogen-bonding interactions to form a 3D supramolecular assembly. Compounds 6 and 7 are isostructural and exhibit 2D (4(4))-sql networks with helical chains. Neighboring sheets are further linked by C-H···O hydrogen-bonding interactions to generate 3D supramolecular architectures. Compounds 8-10 are isostructural and display 3D 3-fold interpenetrating diamond frameworks with helical chains. The effects of coordination modes of L anions, metal ions and N-donor ligands on the structures of the coordination polymers have been

  2. Soil washing in combination with homogeneous Fenton-like oxidation for the removal of 2,4,4'-trichlorodiphenyl from soil contaminated with capacitor oil.

    Science.gov (United States)

    Ma, Xiao-Hong; Zhao, Ling; Lin, Zhi-Rong; Dong, Yuan-Hua

    2016-04-01

    Detoxification by chemical oxidation of polychlorinated biphenyls (PCBs) in contaminated soils is very difficult and inefficient because PCBs typically associate with the solid phase or exist as non-aqueous-phase liquids due to their low solubility and slow desorption rates, and thus, they are difficult to remove from soils by using traditional, water-based elution techniques. Surfactant can enhance washing efficiency of PCBs from contaminated soils. This study used Brij 58, Brij 30, Tween 80, and 2-hydroxypropyl-β-cyclodextrin (HPCD) to solubilize 2,4,4'-trichlorodiphenyl (PCB28) from soil contaminated with capacitor oil into solution. The feasibility of PCB28 oxidation in soil washing wastewater through a Fe(3+)-catalyzed Fenton-like reaction was subsequently examined. Washing with 10 g L(-1) Brij 58 solution showed the highest extraction efficiency (up to 61.5 %) compared with that of the three other surfactants. The total concentration of PCB28 in contaminated soil at 25 °C after 48-h extraction was 286 mg L(-1). In contrast to conditions in which no washing agent was added, addition of the four washing agents decreased the efficiency of PCB28 degradation by the Fenton-like reaction, with the decrease due to addition of 10 g L(-1) Brij 58 solution being the smallest. The optimal concentration of H2O2 for preventing its useless decomposition was found to be 50 mM. The efficiency of PCB28 removal was lower when the initial concentration of PCB28 treated in the Fenton-like reaction was higher. The degradation efficiencies of PCB28 at initial concentrations of 0.1, 10, and 176 mg L(-1) in 10 g L(-1) Brij 58 solution at 25 °C and pH 3.0 and 9 h of reaction using 50 mM H2O2 were 64.1, 42.0, and 34.6 %, respectively. This result indicates that soil washing combined with Fenton-like oxidation may be a practical approach for the remediation of PCB-contaminated soil.

  3. Experimental study of the formation of super-heavy compound nuclei in the reaction {sup 58}Fe + {sup 244}Pu {yields} {sup 302} 120; Etude experimentale de la formation de noyaux composes super-lourds dans la reaction {sup 58}Fe + {sup 244}Pu {yields} {sup 302} 120

    Energy Technology Data Exchange (ETDEWEB)

    Amar, N

    2003-11-01

    This work deals with the nuclear mechanisms that take place in the collision of an incident Fe{sup 58} nucleus with a Pu{sup 244} nucleus for an energy that nears that of the Coulomb barrier. The compound nucleus is Z = 120, A 302. We have studied the specificities of the main reaction products and we have taken into account the information conveyed away by the neutrons released in the collision. Measurements have been performed at the U-400 accelerator in Dubna (Russia). 2 detecting systems have been necessary to detect fission fragments and neutrons: the Corset system is made up of 2 telescopes measuring the time of flight of the nuclear fragments and the Demon multi-detector able to draw the energy spectrum of the neutrons detected in coincidence with the fragments. We know that mass asymmetry is no longer a point of difference between fusion-fission and quasi-fission. It seems that fusion-fission fragments have more kinetic energy than quasi-fission fragments. We have made various analysis concerning the neutron emission in order to find the values of temperatures and multiplicities at pre- and post-scission stages with a view to tell fusion-fission events from quasi-fission events. We have deduced that the contribution of fusion-fission events to symmetric partitioning is about 10%. (A.C.)

  4. SALINITY, WATER TEMPERATURE, FLUORESCENCE, PHOTOSYNTHETIC ACTIVE RADIATION (PAR) and other profile data collected in the Gulf of Alaska on the ALPHA HELIX cruises HX242, HX244 and others as part of the NEP project from 2001-04-18 to 2003-08-11 (NODC Accession 0115255)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NODC Accession 0115255 includes profile, biological and physical data collected aboard the ALPHA HELIX during cruises HX242, HX244, HX247, HX271 and HX275 in the...

  5. SILICATE, WATER TEMPERATURE, FLUORESCENCE, PHOTOSYNTHETIC ACTIVE RADIATION (PAR) and other profile and discrete sample data collected in the Gulf of Alaska on the ALPHA HELIX cruises HX242, HX244 and others as part of the NEP project from 2001-04-18 to 2003-08-11 (NODC Accession 0113348)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NODC Accession 0113348 includes profile, discrete sample, biological, chemical and physical data collected aboard the ALPHA HELIX during cruises HX242, HX244, HX247,...

  6. CHLOROPHYLL A, growth rate and graze rate (or grazing rate) site samples data collected in the Gulf of Alaska on the ALPHA HELIX cruises HX242, HX244 and others as part of the NEP project from 2001-04-18 to 2003-08-10 (NODC Accession 0114241)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NODC Accession 0114241 includes site samples and biological data collected aboard the ALPHA HELIX during cruises HX242, HX244, HX247, HX271 and HX275 in the Gulf of...

  7. Automated absolute activation analysis with californium-252 sources

    Energy Technology Data Exchange (ETDEWEB)

    MacMurdo, K.W.; Bowman, W.W.

    1978-09-01

    A 100-mg /sup 252/Cf neutron activation analysis facility is used routinely at the Savannah River Laboratory for multielement analysis of many solid and liquid samples. An absolute analysis technique converts counting data directly to elemental concentration without the use of classical comparative standards and flux monitors. With the totally automated pneumatic sample transfer system, cyclic irradiation-decay-count regimes can be pre-selected for up to 40 samples, and samples can be analyzed with the facility unattended. An automatic data control system starts and stops a high-resolution gamma-ray spectrometer and/or a delayed-neutron detector; the system also stores data and controls output modes. Gamma ray data are reduced by three main programs in the IBM 360/195 computer: the 4096-channel spectrum and pertinent experimental timing, counting, and sample data are stored on magnetic tape; the spectrum is then reduced to a list of significant photopeak energies, integrated areas, and their associated statistical errors; and the third program assigns gamma ray photopeaks to the appropriate neutron activation product(s) by comparing photopeak energies to tabulated gamma ray energies. Photopeak areas are then converted to elemental concentration by using experimental timing and sample data, calculated elemental neutron capture rates, absolute detector efficiencies, and absolute spectroscopic decay data. Calculational procedures have been developed so that fissile material can be analyzed by cyclic neutron activation and delayed-neutron counting procedures. These calculations are based on a 6 half-life group model of delayed neutron emission; calculations include corrections for delayed neutron interference from /sup 17/O. Detection sensitivities of < or = 400 ppB for natural uranium and 8 ppB (< or = 0.5 (nCi/g)) for /sup 239/Pu were demonstrated with 15-g samples at a throughput of up to 140 per day. Over 40 elements can be detected at the sub-ppM level.

  8. Metastable charge-transfer state of californium(iii) compounds.

    Science.gov (United States)

    Liu, Guokui; Cary, Samantha K; Albrecht-Schmitt, Thomas E

    2015-06-28

    Among a series of anomalous physical and chemical properties of Cf(iii) compounds revealed by recent investigations, the present work addresses the characteristics of the optical spectra of An(HDPA)3·H2O (An = Am, Cm, and Cf), especially the broadband photoluminescence from Cf(HDPA)3·H2O induced by ligand-to-metal charge transfer (CT). As a result of strong ion-ligand interactions and the relative ease of reducing Cf(iii) to Cf(ii), a CT transition occurs at low energy (transfer state undergoes radiative and non-radiative relaxations. Broadening of the CT transition arises from strong vibronic coupling and hole-charge interactions in the valence band. The non-radiative relaxation of the metastable CT state results from a competition between phonon-relaxation and thermal tunneling that populates the excited states of Cf(iii).

  9. Interfacial electron transfer dynamics following laser flash photolysis of [Ru(bpy)2((4,4'-PO3H2)2bpy)]2+ in TiO2 nanoparticle films in aqueous environments.

    Science.gov (United States)

    Brennaman, M Kyle; Patrocinio, Antonio Otávio T; Song, Wenjing; Jurss, Jonah W; Concepcion, Javier J; Hoertz, Paul G; Traub, Matthew C; Iha, Neyde Y Murakami; Meyer, Thomas J

    2011-02-18

    Nanosecond laser flash photolysis has been used to investigate injection and back electron transfer from the complex [(Ru(bpy)(2)(4,4'-(PO(3)H(2))(2)bpy)](2+) surface-bound to TiO(2) (TiO(2)-Ru(II)). The measurements were conducted under conditions appropriate for water oxidation catalysis by known single-site water oxidation catalysts. Systematic variations in average lifetimes for back electron transfer, , were observed with changes in pH, surface coverage, incident excitation intensity, and applied bias. The results were qualitatively consistent with a model involving rate-limiting thermal activation of injected electrons from trap sites to the conduction band or shallow trap sites followed by site-to-site hopping and interfacial electron transfer, TiO(2)(e(-))-Ru(3+) → TiO(2)-Ru(2+). The appearance of pH-dependent decreases in the efficiency of formation of TiO(2)-Ru(3+) and in incident-photon-to-current efficiencies with the added reductive scavenger hydroquinone point to pH-dependent back electron transfer processes on both the sub-nanosecond and millisecond-microsecond time scales, which could be significant in limiting long-term storage of multiple redox equivalents. Copyright © 2011 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  10. Interfacial Electron Transfer Dynamics Following Laser Flash Photolysis of [Ru(bpy)2((4,4'-PO3H2)2bpy)]2+ in TiO2 Nanoparticle Films in Aqueous Environments

    Energy Technology Data Exchange (ETDEWEB)

    Brennaman, M. Kyle; Patrocinio, Antonio Otávio T.; Song, Wenjing; Jurss, Jonah W.; Concepcion, Javier J.; Hoertz, Paul G.; Traub, Matthew C.; Murakami Iha, Neyde Y.; Meyer, Thomas J.

    2011-02-16

    Nanosecond laser flash photolysis has been used to investigate injection and back electron transfer from the complex [(Ru(bpy)2(4,4'-(PO3H2)2bpy)]2+ surface-bound to TiO2 (TiO2-RuII). The measurements were conducted under conditions appropriate for water oxidation catalysis by known single-site water oxidation catalysts. Systematic variations in average lifetimes for back electron transfer, <τbet>, were observed with changes in pH, surface coverage, incident excitation intensity, and applied bias. The results were qualitatively consistent with a model involving rate-limiting thermal activation of injected electrons from trap sites to the conduction band or shallow trap sites followed by site-to-site hopping and interfacial electron transfer, TiO2(e-)-Ru3+→TiO2-Ru2+. The appearance of pH-dependent decreases in the efficiency of formation of TiO2-Ru3+ and in incident-photon-to-current efficiencies with the added reductive scavenger hydroquinone point to pH-dependent back electron transfer processes on both the sub-nanosecond and millisecond–microsecond time scales, which could be significant in limiting long-term storage of multiple redox equivalents.

  11. A novel mutation (ASn244Lys) in the peripherin/RDS gene causing autosomal dominant retinitis pigmentosa associated with bull's eye maculopathy detected by nonradioisotopic SSCP

    Energy Technology Data Exchange (ETDEWEB)

    Kikawa, Emi; Nakazawa, Mitsuru; Chida, Yasushi; Shiono, Takashi; Tamai, Makota (Tohoku Univ. of School of Medicine, Sendai (Japan))

    1994-03-01

    Retinitis pigmentosa (RP) is characterized by night blindness, an eventual loss of visual field, a diminished response on the electroretinogram, and pigmentary retinal degeneration. These features are primarily explained by the degeneration of photoreceptors. The recent development of the molecular genetic approach has enabled the identification of genes responsible for parts of autosomal dominant RP (ADRP). Rhodopsin and peripherin/RDS genes, in particular, have been successfully shown to cosegregate with ADRP. The authors, therefore, screened 42 unrelated Japanese patients with ADRP to search for mutations in the peripherin/RDS gene. The method we employed for screening was a nonradioisotopic modification of single-strand conformation polymorphism. Among 42 unrelated patients with ADRP, the DNA from one patient (SY) showed an abnormal pattern in exon 2 on SSCP. The DNA fragments were then amplified from affected and nonaffected members of the same family as SY. The alteration in the DNA sequence that was commonly found in the affected members of the family was identified as a heterozygous transversional change of C to A at the third nucleotide in codon 244, resulting in the amino acid replacement of asparagine residue with lysine residue. None of unaffected family members or 30 normal control individuals had this alteration.

  12. Publications | Page 244 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Through books, articles, research publications, and studies, we aim to widen the impact of our investment and advance development research. We share the results of our funded research, and offer free training materials to guide researchers and institutions. Want more? Explore outputs from more than four decades of ...

  13. Publications | Page 244 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Ask anyone in the town of Manhiça where the telecentre is and they can easily point the way: along the main street, past the general store, down the alleyway next to the evangelical church. The telecentre is also a well-known landmark among... Understanding Obstacles to Peace: Actors, Interests, and Strategies in Africa's ...

  14. Reference: 244 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available hwa|Durst Francis|Feldmann Kenneth A|Feyereisen Ren辿|Goh Chang-Hyo|Kim Ho Bang|Kwon Mi|Schaller Hubert ...c pathway. According to the current gene annotation, the Arabidopsis (Arabidopsis... thaliana) genome contains two putative CYP51 genes, CYP51A1 and CYP51A2. Our studies revealed that CYP51A1 should be considere...d an expressed pseudogene. To study the functional importance of the CYP51A2 gene in plan...-function mutants for CYP51A2 showed multiple defects, such as stunted hypocotyls, short roots, reduced cell

  15. 244. Seudoaneurisma del seno de valsalva

    Directory of Open Access Journals (Sweden)

    J. Montoto López

    2010-01-01

    Presentamos el caso de un varón de 74 años, con varios ingresos cardiológicos previos por infarto de miocardio y clínica sincopal y de dolor torácico atípico, en el que las pruebas diagnósticas angiográficas y de resonancia magnética pusieron de manifiesto un seudoaneurisma de génesis espontánea a nivel del seno coronariano izquierdo. Asociaba, además, dilatación de aorta ascendente e insuficiencia aórtica grave sobre una válvula bicúspide. La corrección se llevó a cabo mediante sustitución valvular aórtica y de aorta ascendente sinusal y tubular proximal mediante tubo valvulado de dacrón (prótesis biológica, con buen resultado quirúrgico. En el periodo postoperatorio precisó implantación de marcapasos definitivo por fibrilación auricular (FA con bloqueo auriculoventricular (AV completo. El paciente se halla, en la actualidad y tras 8 meses de seguimiento, asintomático.

  16. 49 CFR 244.9 - Definitions.

    Science.gov (United States)

    2010-10-01

    ... TRANSPORTATION REGULATIONS ON SAFETY INTEGRATION PLANS GOVERNING RAILROAD CONSOLIDATIONS, MERGERS, AND... means the migration, combination, or unification of one set of railroad operations with another set of... are not connected to the general railroad system of transportation. Safety Integration Plan means a...

  17. Publications | Page 244 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Every two weeks in Guadalajara, in Jalisco State, Mexico, perhaps half a dozen farm producers sell organic foods and household cleaners at a tiny community market, in a friendly participant's ... In the dim light of a makeshift beer hall in Phillipi township, South Africa, tourist Rob Denhom is introduced to a taste like no other.

  18. 50 CFR 216.244 - Mitigation.

    Science.gov (United States)

    2010-10-01

    ..., consistent with the safety of the ship. (xxx) The Navy shall abide by the letter of the “Stranding Response... video (if available). Based on the information provided, NMFS shall determine if, and advise the Navy.../are dead), location, time of first discovery, observed behaviors (if alive), and photo or video (if...

  19. 27 CFR 24.4 - Related regulations.

    Science.gov (United States)

    2010-04-01

    ... Part 16—Alcoholic Beverage Health Warning Statement 27 CFR Part 18—Production of Volatile Fruit-Flavor... the Virgin Islands. 27 CFR Part 27—Importation of Distilled Spirits, Wines and Beer. 27 CFR Part 28...

  20. TMFunction data: 244 [TMFunction[Archive

    Lifescience Database Archive (English)

    Full Text Available istensen LL, Christensen PA, S?rensen ES, Jacobsen C, Moestrup SK, Etzerodt M, Thog... D958N ... YES Ligand binding(Ca binding) ... Low density lipoprotein receptor Homo sapiens Human Andersen OM, Chr

  1. 15 CFR 24.4 - Applicability.

    Science.gov (United States)

    2010-01-01

    ... Commerce and Foreign Trade Office of the Secretary of Commerce UNIFORM ADMINISTRATIVE REQUIREMENTS FOR... National School Lunch Act: (i) School Lunch (section 4 of the Act), (ii) Commodity Assistance (section 6 of...), and (ii) School Breakfast (section 4 of the Act). (6) Entitlement grants for State Administrative...

  2. Analysis of the tumor-promoting potency of 2,4,4'-trichlorobiphenyl and 2,2',4,5,5'-pentachlorobiphenyl in rat liver

    Energy Technology Data Exchange (ETDEWEB)

    Kunz, S.; Schmitz, H.J.; Schrenk, D. [Kaiserslautern Univ. (Germany). Dept. of Food Chemistry and Environmental Toxicology; Buchmann, A.; Schwarz, M. [Tuebingen Univ. (Germany). Inst. of Toxicology; Schilling, B.; Paepke, O. [ERGO Research, Hamburg (Germany); Robertson, L.W.; Lehmler, H.J. [Iowa Univ, Iowa City, IA (United States). Dept. of Occupational and Environmental Health

    2004-09-15

    Polychlorinated biphenyls (PCBs) are potent persistent environmental pollutants exhibiting neurotoxic, teratogenic and tumor-promoting effects in experimental animal models. PCB congeners can be divided into 'dioxin-like' and 'non-dioxin-like' congeners on the basis of their ability to act as aryl hydrocarbon receptor (AhR) agonists. Like the most toxic dioxin congener 2,3,7,8-tetrachlorodibenzo-p-dioxin (TCDD) 'dioxin-like' PCBs bind to the AhR and show characteristic effects on the expression of AhR-regulated genes including the induction of cytochrome P450 (CYP) 1A1. On the other hand, 'non-dioxin-like' PCB congeners have a lower or no binding affinity to the AhR, but exhibit a 'phenobarbital-type' induction of CYP 2B1/2 activity. The tumor-promoting potency of several PCBs has been demonstrated in two-stage initiation-promotion experiments in rat liver. Preneoplastic cell clones, targets for tumor promotion, can be identified as phenotypically altered foci showing characteristic enzyme patterns including the decreased activity of adenosine triphosphatase (ATPase) or the increased expression of the placental form of gluthatione S-transferase (GSTP). In the present study, the effect of the 'non-dioxin-like' 2,4,4'-trichlorobiphenyl (PCB 28) and 2,2',4,5,5'-pentachlorobiphenyl (PCB 101) on the promotion of enzyme-altered hepatic foci was investigated in female Wistar rats after initiation with diethylnitrosamine (DEN).

  3. Ionic 4,4'-Biphenylene-Bridged Bis-ruthenium Complexes [Ru2(4,4'-{C6H2(CH2NMe2)2-2,6}2)(terpy)2]n+(n=2 and 4) and Their Reversible Redox Interconversion: A Molecular Switch

    NARCIS (Netherlands)

    Koten, G. van; Steenwinkel, P.; Grove, D.M.; Veldman, N.; Spek, A.L.

    1998-01-01

    Copper(II)-mediated oxidative coupling of the blue, 18-electron mononuclear complex [RuII{C6H3(CH2NMe2)2-2,6}(terpy)]Cl, 3 (terpy = 2,2';6',2''-terpyridine), affords the unique diamagnetic, binuclear 34-electron complex [(RuIII)2(4,4'-{C6H2(CH2NMe2)2-2,6}2)(terpy)2](CuCl2)4, 5a. This intensely green

  4. Efficacy and safety of an oral contraceptive containing ethinylestradiol 20 µg/drospirenone 3 mg (24/4 regimen in three indications in the People's Republic of China: a comparison with international studies

    Directory of Open Access Journals (Sweden)

    Marr J

    2015-07-01

    Full Text Available Joachim Marr,1 Zirong Huang,2 Baoxi Wang,3 Hongyan Zhang,4 Katrin Roth1 1Bayer Pharma AG, Berlin, Germany; 2Obstetrics and Gynecology Hospital of Fudan University, Shanghai, 3Institute of Dermatology, Chinese Academy of Medical Sciences, Nanjing, Jiangsu, 4Peking University Sixth Hospital, Peking University Institute of Mental Health, Ministry of Health (Peking University, Beijing, People's Republic of China Abstract: While combined oral contraceptives are a popular choice in developed Western countries, they are used by only 1% of women who are married or in a relationship in the People's Republic of China. The purpose of this review is to describe the efficacy and safety of the combined oral contraceptive containing ethinylestradiol (EE 20 µg/drospirenone 3 mg taken in a 24/4 regimen (YAZ®; Bayer HealthCare Pharmaceuticals, Berlin, Germany by Chinese women and to compare these results with those in women assessed in the international studies. Studies of EE 20 µg/drospirenone 3 mg in three different indications (contraception, acne, and premenstrual dysphoric disorder [PMDD] have been conducted in Chinese women. The results of these three studies indicate that the EE 20 µg/drospirenone 3 mg combined oral contraceptive is a good long-term contraceptive option in Chinese women, providing 99% contraceptive protection over the observed 1-year treatment period, and additionally had a favorable effect on moderate acne vulgaris and relieved the symptoms of PMDD. The contraceptive efficacy, improvement in acne, and relief from PMDD symptoms observed in these studies did not differ from the effects observed in other international studies of EE 20 µg/drospirenone 3 mg, indicating that EE 20 µg/drospirenone 3 mg is as effective in Chinese women as in other ethnicities. Further, EE 20 µg/drospirenone 3 mg demonstrated a similar safety and tolerability profile in women enrolled in the Chinese and international trials, with no unexpected adverse

  5. Neutron Protection Factor Determination and Validation for a Vehicle Surrogate Using a Californium Fission Source

    Science.gov (United States)

    2017-06-01

    a 4 mm x 4 mm (0.157" x 0.157") LiI(Eu) crystal with 96% enrichment of lithium -6. The crystal is connected to a photomultiplier tube (PMT) which...32 Figure 17. Lithium -6 Iodide, Europium Doped Scintillation Detector. Source: [27...Alamos National Laboratory LiI(Eu) Lithium Iodide Europium Doped LLD Low Level Discriminator LLNL Lawrence Livermore National Laboratory MASH Monte

  6. 48 CFR 52.244-6 - Subcontracts for Commercial Items.

    Science.gov (United States)

    2010-10-01

    ... clauses in subcontracts for commercial items: (i) 52.203-13, Contractor Code of Business Ethics and... Recovery Act. (iii) 52.219-8, Utilization of Small Business Concerns (MAY 2004) (15 U.S.C. 637(d)(2) and (3... subcontracts to small business concerns) exceeds $650,000 ($1.5 million for construction of any public facility...

  7. Dicty_cDB: AHA244 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available one) Pichia stipitis CBS 6054 chromos... 35 4.8 EU095850_1( EU095850 |pid:none) Turkey coronavirus isolate M...G10, c... 35 4.8 EU095850_2( EU095850 |pid:none) Turkey coronavirus isolate MG10, c... 35 4.8 CP000094_2730(

  8. Dicty_cDB: VSG244 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available |BU498261.1 PfESToab94h09.y1 Plasmodium falciparum 3D7 asexual cDNA Plasmodium falciparum cDNA 5' similar to SW:RAN_PLAFA...|BI815642.1 PfESToaa31a10.y1 Plasmodium falciparum 3D7 asexual cDNA Plasmodium falciparum cDNA 5' similar to SW:RAN_PLAFA...|BI815554.1 PfESToaa29h11.y1 Plasmodium falciparum 3D7 asexual cDNA Plasmodium falciparum cDNA 5' similar to SW:RAN_PLAFA...|BQ452295.1 PfESToaa94h01.y1 Plasmodium falciparum 3D7 asexual cDNA Plasmodium falciparum cDNA 5' similar to SW:RAN_PLAFA

  9. 24.4 news 918-9 MH IF new

    Indian Academy of Sciences (India)

    x

    Physicists in Italy claimed last week to have seen particles of dark matter. Their announcement has got their rivals riled and raises questions about what constitutes evidence of a new particle. Rita Bernabei of the National Institute of. Nuclear Physics in Rome presented her team's latest results on 16 April at an international.

  10. Dark Galaxies and Lost Baryons (IAU S244)

    Science.gov (United States)

    Davies, Jonathan I.; Disney, Michael J.

    2008-05-01

    Preface; Conference prelims; The HI that barked in the night M. J. Disney; The detection of dark galaxies in blind HI surveys J. I. Davies; Red haloes of galaxies - reservoirs of baryonic dark matter? E. Zackrisson, N. Bergvall, C. Flynn, G. Ostlin, G. Micheva and B. Baldwell; Constraints on dark and visible mass in galaxies from strong gravitational lensing S. Dye and S. Warren; Lost baryons at low redshift S. Mathur, F. Nicastro and R. Williams; Observed properties of dark matter on small spatial scales R. Wyse and G. Gilmore; The mass distribution in spiral galaxies P. Salucci; Connecting lost baryons and dark galaxies via QSO absorption lines T. Tripp; ALFALFA: HI cosmology in the local universe R. Giovanelli; The ALFALFA search for (almost) dark galaxies across the HI mass function M. Haynes; HI clouds detected towards Virgo with the Arecibo Legacy Fast ALFA Survey B. Kent; Cosmic variance in the HI mass function S. Schneider; The Arecibo Galaxy Environments Survey - potential for finding dark galaxies and results so far R. Minchin et al.; Free-floating HI clouds in the M81 group E. Brinks, F. Walter and E. Skillman; Where are the stars in dark galaxies J. Rosenberg, J. Salzer and J. Cannon; The halo by halo missing baryon problem S. McGaugh; The local void is really empty R. Tully; Voids in the local volume: a limit on appearance of a galaxy in a dark matter halo A. Tikhonov and A. Klypin; Dim baryons in the cosmic web C. Impey; A census of baryons in galaxy clusters and groups A. Gonzalez, D. Zaritsky and A. Zabludo; Statistical properties of the intercluster light from SDSS image stacking S. Zibetti; QSO strong gravitational lensing and the detection of dark halos A. Maccio; Strong gravitational lensing: bright galaxies and lost dark-matter L. Koopmans; Mapping the distribution of luminous and dark matter in strong lensing galaxies I. Ferreras, P. Saha, L. Williams and S. Burles; Tidal debris posing as dark galaxies P. Duc, F. Bournaud and E. Brinks; Numerical simulation of the dwarf companions of giant galaxies A. Nelson and P. Williams; Delayed galaxies C. Struck, M. Hancock, B. Smith, P. Appleton, V. Charmandaris and M. Giroux; Probe of dark galaxies via disturbed/lopsided isolated galaxies I. Karachentsev, V. Karachentseva, W. Huchtmeier, D. Makarov and S. Kaisin; Star formation thresholds J. Schaye; Scaling relations of dwarf galaxies without supernova-driven winds K. Tassis, A. Kravtsov and N. Gnedin; Star formation in massive low surface brightness galaxies K. O'Neil; Linking clustering properties and the evolution of low surface brightness galaxies D. Bomans and S. Rosenbaum; Too small to form a galaxy: how the UV background determines the baryon fraction M. Hoeft, G. Yepes and S. Gottlober; Star formation in damped Lyman selected galaxies L. Christensen; Dark-matter content of early-type galaxies with planetary nebulae N. Napolitano et al.; Hunting for ghosts: low surface brightnesses from pixels R. Scaramella and S. Sabatini; Baryonic properties of the darkest galaxies E. Grebel; The dwarf low surface brightness population in different environments of the local universe S. Sabatini, J. Davies, S. Roberts and R. Scaramella; Mass modelling of dwarf spheroidal galaxies J. Klimentowski et al.; Evolution of dwarf galaxies in the Centaurus A Group L. Makarova and D. Makarov; A flat faint end of the Fornax cluster galaxy luminosity function S. Mieske, M. Hilker, L. Infante and C. Mendes de Oliveira; Can massive dark halos destroy the discs of dwarf galaxies? B. Fuchs and O. Esquivel; 'Dark galaxies' and local very metal-poor gas-rich galaxies: possible interrelations S. Pustilnik; Morphology and environment of dwarf galaxies in the local universe H. Ann; Arecibo survey of HI emission from disk galaxies at redshift z 0.2 B. Catinella, M. Haynes, J. Gardner, A. Connolly and R. Giovanelli; AGES observations of

  11. Dicty_cDB: VHN244 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 2002.10.25 Translated Amino Acid sequence TSVYINNWRKYKMKISSILFIFIAIIVGLALSQNTIPTYKQNSINWKQFQPLYTNKDDYV...Amino Acid sequence (All Frames) Frame A: TSVYINNWRKYKMKISSILFIFIAIIVGLALSQNTIPTYKQNSINWKQFQPLYTNKDDYV

  12. Dicty_cDB: SFD244 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available RGYAFNRTADFETIRQIKEKLCYVAYDVQQEMKLASETTVLVENYTLPDGRVIKVGQERF QASEALFNPSLVDVEGGGVHEQLFDCITKADRDLQQGFYQHIVLSGGSSMYPGLP...RGYAFNRTADFETIRQIKEKLCYVAYDVQQEMKLASETTVLVENYTLPDGRVIKVGQERF QASEALFNPSLVDVEGGGVHEQLFDCITKADRDLQQGFYQHIVLSGGSSMYPGLP

  13. Dicty_cDB: VSF244 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 201 2e-50 (Q752P7) RecName: Full=Multiprotein-bridging factor 1; &AE01681... 98 2e-19 FM992688_97( FM992688...Full=Multiprotein-bridging factor 1; &CR38095... 95 1e-18 (Q6CIP4) RecName: Full=Multiprotein-bridging factor 1;

  14. Dicty_cDB: VHE244 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 038.1 Dictyostelium dimigraformum 18S rRNA gene, isolate AR5b. 1146 0.0 1 AM168039 |AM168039.1 Dictyostelium...1 Dictyostelium discoideum 18S rRNA gene, isolate NC4. 1154 0.0 1 AM168038 |AM168

  15. Dicty_cDB: SHF244 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available t WO0168911. 38 2e-04 4 BD460610 |BD460610.1 Diagnosis of Diseases Associated with Cell Cycle.... 38 2e-04 4 BD452532 |BD452532.1 Diagnosis of Diseases Associated with Cell Cycle. 38 2e-04 4 A

  16. 244-IJBCS-Article-Dr Obodai E A

    African Journals Online (AJOL)

    RHUMSIKI

    right proportion, other nitrogenous compounds, water, lipids, carbohydrates (as glycogen), minerals and ... percentage protein, fat and ash (i.e. analysis of proximate composition and mineral content, based on AOAC .... amino acids required by the human body. (Love, 1980; Jhaveri et al., 1984; Nettleton,. 1985; Pigott and ...

  17. Dicty_cDB: CHE244 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ing in prelim test: 0 Number of HSP's gapped (non-prelim): 0 length of query: 176 length of database: 80,480,566 effective... HSP length: 17 effective length of query: 159 effective length of database: 78,821,179 effe...ctive search space: 12532567461 effective search space used: 12532567461 T: 0 A: 0 ... of query: 176 length of database: Z,811,932,929 effective HSP length: 22 effective length of query: 154 effective... length of database: Y,960,467,611 effective search space: 6461912012094 effective

  18. 7 CFR 58.244 - Number of samples.

    Science.gov (United States)

    2010-01-01

    ... Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Standards, Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE (CONTINUED) REGULATIONS AND STANDARDS UNDER THE AGRICULTURAL MARKETING ACT OF 1946 AND THE EGG PRODUCTS INSPECTION ACT (CONTINUED) GRADING AND INSPECTION...

  19. 19 CFR 10.244 - Certificate of Origin.

    Science.gov (United States)

    2010-04-01

    ... though D 10.243(a)(2). F Handloomed, handmade, or folklore textile and apparel goods 10.243(a)(3). G... Producer Name & Address: 8. Handloomed, Handmade, or Folklore Article: 9. Name of Short Supply Fabric or... name of the folklore article or should state that the article is handloomed or handmade of handloomed...

  20. 244-IJBCS-Article-Dr Obodai E A

    African Journals Online (AJOL)

    RHUMSIKI

    content was highest, followed by phosphorus and iron content was the least. P. senegalensis ... compounds, water, lipids, carbohydrates (as glycogen), minerals and vitamins. Fish diet has high commercial and medicinal values. (Nunes et al., 1992). The five fish ... determine the biochemical composition of the five marine ...

  1. Dicty_cDB: CHQ244 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available IDMAMMVLPSQERFYFKMNFPLLCLLTETGRLDRESYLSMWKSIPESNERSVEIQVRLPH VDVDSILRRLNSKNIX*ivrkxssxs Translated Amino Aci...d sequence (All Frames) Frame A: kltrtyh*niniihqelifiyl*yffkritihy*svvlv*kk--- ---pi*w*fk*fiifrwwwwwwxss...PLLCLLTETGRLDRESYLSMWKSIPESNERSVEIQVRLPH VDVDSILRRLNSKNIX*ivrkxssxs Frame C: inthislky*ynpsrtyiylfiiff*EDYNT

  2. Dicty_cDB: CHS244 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available mRNA sequence. 117 8e-23 2 CV682907 |CV682907.1 service43_H06_sjs2-16-2B11-T3 SJS Schistosoma japonicum...mRNA sequence. 74 2e-13 2 CV682854 |CV682854.1 service30_G09_sjs2-14-10C09-T3 SJS Schistosoma japonicum

  3. Dicty_cDB: SSF244 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Mus musculus chromosome UNK clone RP23-312E2, WORKING DRAFT SEQUENCE, 3 unordered pieces. 50 0.022 1...Mus musculus chromosome UNK clone RP23-279O5, WORKING DRAFT SEQUENCE, 14 unordered pieces. 50 0.022 1...norvegicus clone RP31-392N9 strain Brown Norway, WORKING DRAFT SEQUENCE, 2 ordered pieces. 44 0.27 2 AQ112874...6 Homo sapiens chromosome 5 clone CTC-287O14, WORKING DRAFT SEQUENCE, 3 ordered pieces. 46 0.35 1 AC008442...|AC129135.4 Rattus norvegicus clone CH230-23C19, WORKING DRAFT SEQUENCE, 2 unordered pieces. 44 0.39 2 dna

  4. Dicty_cDB: SHA244 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available YNLSKLQDPRIEKLPYSIRILLES AVRNCDNFEVHEKDVENILNWENTANKVEIPFKPARVLLQDFTGVPAVVDLAAMRDAMKR LGGDPAKINPLVPV...YNLSKLQDPRIEKLPYSIRILLES AVRNCDNFEVHEKDVENILNWENTANKVEIPFKPARVLLQDFTGVPAVVDLAAMRDAMKR LGGDPAKINPLVPV

  5. Dicty_cDB: SHK244 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available clone: QtrA-12165, 5' end, expressed in brain temporal lobe. 48 0.52 1 CJ470588 |CJ470588.1 Macaca fascicularis...clone: QtrA-12820, 5' end, expressed in brain temporal lobe. 46 2.1 1 dna update 2006. 6. 7 Homology

  6. 1935 15' Quad #244 Aerial Photo Mosaic Index

    Data.gov (United States)

    Earth Data Analysis Center, University of New Mexico — Aerial Photo Reference Mosaics contain aerial photographs that are retrievable on a frame by frame basis. The inventory contains imagery from various sources that...

  7. Dicty_cDB: SHD244 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 2002.10.25 Translated Amino Acid sequence cfnhcnyfmctrckqw*fl*l*ylfss*YXNRPSCSSLFSSATLQTLGSSPRCEYTASNI L...Amino Acid sequence (All Frames) Frame A: cfnhcnyfmctrckqw*fl*l*ylfss*YXNRPSCSSLFSSATLQTLGSSPRCEYTASNI L

  8. Dicty_cDB: VHM244 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Acid sequence iftskskwiklpslfvpers*PTVLLSRKQFVVEVVHPGKANVSKKDLKTTIAKLHKVAD PETIFLFGFKTDFGGGKSTGFGLIYDN...TKPQTS--- ---FYVKIKMDKAAVVVRTRKVLTNRLLSRKQFVVEVVHPGKANVSKKDLKTTIAKLHKV ADPETIFLFGFKTDFGGGKSTGFGLIYDNLEIAKKYEPKYRLA...Frames) Frame A: iftskskwiklpslfvpers*PTVLLSRKQFVVEVVHPGKANVSKKDLKTTIAKLHKVAD PETIFLFGFKTDFGGGKSTGFGLIYDN...*ttnlr--- ---FYVKIKMDKAAVVVRTRKVLTNRLLSRKQFVVEVVHPGKANVSKKDLKTTIAKLHKV ADPETIFLFGFKTDFGGGKSTGFGLIYDNLEIAKKYEPKYRLA

  9. Dicty_cDB: CHA244 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available coat structural protein SP65 (cotE) gene, complete cds. 64 2e-06 2 CN187496 |CN187496.1 UCRCS05_0004I21_r Washington Navel Orange Sto...red Fruit Pulp cDNA Library Citrus sinensis cDNA clone CS_WEb0004I21, mRNA sequence

  10. All projects related to | Page 244 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    2012-02-07

    Research aimed at policymakers in Ukraine, Russia, and Belarus will highlight how tobacco taxation policies can serve public health goals and reduce the burden of tobacco-related diseases and deaths. Start Date: February 7, 2012. End Date: March 12, 2013. Topic: TOBACCO, SMOKING, TAXATION, PUBLIC HEALTH.

  11. 29 CFR 1952.244 - Level of Federal enforcement.

    Science.gov (United States)

    2010-07-01

    ... private contractors at Cape Lisburne Long Range Missile Base, Point Lay Short Range Missile Base, Eareckson Air Station on Shemya Island, Fort Greeley Missile Defense in Delta Junction, the U.S. Coast Guard...

  12. Page 1 244 - D. KRISHNAMURTI (v) Octahydrated hydroxides of ...

    Indian Academy of Sciences (India)

    OH)8 HO. From the point of view of Raman effect studies, only the following correlations existing between the five symmetric repre- sentations of Di and the two symmetric representations of Ch are of interest. They are: (1) Aig-> Ag; (2) Agg--Bg; ...

  13. Dicty_cDB: VSC244 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available gene for cytochrome c, partial sequence, country:Japan:Okinawa. 30 0.12 3 BQ476583 |BQ476583.1 curculio2h12....g Curculio glandium cDNA Curculio glandium cDNA clone curculio2h12 3', mRNA seque

  14. Dicty_cDB: AFM244 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ri iqqvmv*hlhg**vlvh**lhivqclyqkiiylthgdy*vvhygqlvifalfql*kplvl vlvycygvvqvlsqvisqvnsdgle*tnkryhiqh*iglvshvl*rl*fssfslnlqskr ktnipt...vmvlfkyyhrlfhr*irmvwnrqtkgitssikldwfrmycsgcnfllfh*tynrre rrtfllincr--- ---nlqskrktnipthql*ttrklvitesttmaitql

  15. Alternative synthetic route for the heterometallic CO-releasing [Sb@Rh12(CO27]3− icosahedral carbonyl cluster and synthesis of its new unsaturated [Sb@Rh12(CO24]4− and dimeric [{Sb@Rh12Sb(CO25}2Rh(CO2PPh3]7− derivatives

    Directory of Open Access Journals (Sweden)

    Cristina Femoni

    2016-10-01

    Full Text Available The hetero-metallic [Sb@Rh12(CO27]3− cluster has been known as for over three decades thanks to Vidal and co-workers, and represents the first example of an E-centered (E=heteroatom icosahedral rhodium carbonyl cluster. However, its synthesis required high temperature (140–160 °C and elevated CO pressure (400 atm. Applying the redox condensation method for cluster preparation, we herein report a new synthetic, high-yield route for preparing [Sb@Rh12(CO27]3− under much milder conditions of temperature and pressure. Notably, when the same synthesis was carried out under N2 instead of CO atmosphere, the new isostructural but unsaturated derivative [Sb@Rh12(CO24]4− was obtained, for which we report the full X-ray structural characterization. This species represents one of the few examples of an icosahedral cluster disobeying the electron-counting Wade-Mingos rules, possessing less than the expected 170 cluster valence electrons (CVEs. Judging from IR monitoring, the two species can be obtained one from the other by switching between N2 and CO atmosphere, making [Sb@Rh12(CO27]3− a spontaneous CO-releasing molecule. Finally, the study of the chemical reactivity of [Sb@Rh12(CO27]3− with PPh3 allowed us to obtain the new [{Sb@Rh12Sb(CO25}2Rh(CO2PPh3]7− dimeric compound, for which we herein report the full X-ray structural and 31P NMR analyses.

  16. Pharmacological properties of 3-amino-5,6,7,8-tetrahydro-2-[4-[4-(quinolin-2-yl)piperazin-1-yl]butyl]quinazolin-4(3H)-one (TZB-30878), a novel therapeutic agent for diarrhea-predominant irritable bowel syndrome (IBS) and its effects on an experimental IBS model.

    Science.gov (United States)

    Tamaoki, Satoru; Yamauchi, Yukinao; Nakano, Youichi; Sakano, Sayuri; Asagarasu, Akira; Sato, Michitaka

    2007-09-01

    3-Amino-5,6,7,8-tetrahydro-2-[4-[4-(quinolin-2-yl)piperazin-1-yl]butyl]quinazolin-4(3H)-one (TZB-30878) is a novel compound with both 5-hydroxytryptamine (5-HT)(1A) agonism and 5-HT(3) antagonism effects. We hypothesized that TZB-30878 might have benefits from these dual effects as a medication for diarrhea-predominant irritable bowel syndrome (d-IBS), and these studies were designed to confirm the pharmacological properties of TZB-30878 and its efficacy in an IBS-like animal model. The binding assays demonstrated that [(3)H]TZB-30878 selectively binds to human 5-HT(1A) and 5-HT(3) receptors, with K(d) values of 0.68 +/- 0.03 and 8.90 +/- 1.73 nM, respectively. Systemic administration of TZB-30878 inhibited 5-HT-induced bradycardia in a dose-dependent manner in rats. In behavioral assays TZB-30878 produced signs of 5-HT syndrome in rats. These results suggest that TZB-30878 has dual effects as a 5-HT(1A) receptor agonist and a 5-HT(3) receptor antagonist. Finally, we evaluated the effects of TZB-30878 on wrap restraint stress-induced defecation in an IBS-like model in rats. TZB-30878 (1-10 mg/kg p.o.) normalized stress-induced defecation in a dose-dependent manner, whereas the 5-HT(1A) agonist tandospirone (30 and 100 mg/kg p.o.) and the 5-HT(3) antagonist alosetron (1-10 mg/kg p.o.) did not show such effects. Furthermore, this efficacy of TZB-30878 was partly antagonized by a 5-HT(1A) antagonist, [O-methyl-3H]-N-(2-(4-(2-methoxyphenyl)-1-piperazinyl)ethyl)-N-(2-pyridinyl)cyclohexanecarboxamide trihydrochloride (WAY-100635). These results suggest that 5-HT(1A) receptor agonism and 5-HT(3) receptor antagonism contribute to the efficacy of TZB-30878 in the IBS-like model. The efficacy of TZB-30878 supports the concept that the presence of both actions, namely 5-HT(1A) receptor agonism and 5-HT(3) receptor antagonism, could be an important mechanism in the treatment of d-IBS.

  17. Multiple Nonconformities in Ice-Walled Lake Successions Indicate Periods with Cold Summers (24.4 - 22.5 ka, 21.1 - 19.2 ka, 18.5 - 18.1 ka) during the Last Deglaciation in Northeastern Illinois, USA

    Science.gov (United States)

    Curry, B. B.

    2014-12-01

    Unprecedented age control on many last glacial stratigraphic units and morainal ice-margin positions are interpreted from AMS radiocarbon ages of tundra plant macrofossils archived in low-relief ice-walled lake plain (IWLP) deposits the Lake Michigan Lobe (south-central Laurentide Ice Sheet). IWLPs are periglacial features that formed on morainal dead-ice permafrost. Lacustrine sediment, and the fossils contained therein, had physical and temporal proximity to the glacier which formed the underlying moraine. In modern ice-walled lakes, as the lake's ice cover begins to melt, moats form which allows access of sloughing tundra-mantled active layer sediment (soil) into the lakes. Multiple AMS ages from two sites with proglacial sediment buried by glacial max LIS diamicton, and IWLPs reveal evidence of episodic plant growth and sedimentation including ca. 24.0 to 24.4 ka (post Shelby Phase), 22.5 to 21.1 ka (post Livingston Phase), 18.1 to 17.4 ka (post Woodstock Phase). Although presently based on negative evidence, the associated nonconformities (listed in title) indicate periods when cold conditions did not promote development of the estival moat. Although the evidence does not preclude tundra growth during the cold summers, there was little landscape modification due to limited thawing of the active layer. At approximately the onset of the 19.2-18.5 "warm" period, at least two large deglacial discharge events flooded the Fox and Kankakee tributary valleys of the Illinois River. The latter, known as the Kankakee Torrent, occurred at 19.05 - 18.85 ka (σ1 range) at the Oswego channel complex. The temporal coincidence of the torrents and sedimentation in ice-walled lakes suggests that the post-Livingston Phase nonconformity (21.1 - 19.2 ka) was a period of lessened meltwater discharge through subglacial conduits (tunnel valleys) as the frozen toe promoted formation of subglacial lakes, buildup of pore-water pressures, and the release of subglacial water as "torrents

  18. Poweo 2006 consolidated revenue at euro 244 million, up 121%; Poweo chiffre d'affaires 2006 de 244 millions euro, en hausse de 121%

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2007-01-15

    POWEO, the leading independent energy operator in France, presents in this document its key business indicators for the 4. quarter of 2006 and the full year: POWEO records again a strong rise of its annual revenue, exceeding its euro 220 million target. This progression relates to all the business components. The particularly soft climatic conditions recorded in France at the end of the year did not result in a significant fall of revenue compared to initial forecasts. The number of customer sites amounts to 80.300 at December 31, 2006, in progression of 23% compared to the end of 2005. The customer base remained overall stable during the second half of 2006, POWEO limiting voluntarily the acquisition of customers in electricity during the preparation of the opening to competition of the residential market due to take place on July 1, 2007. The gas customer base for its part more than doubled compared to end June 2006, with more than 5.000 customer sites transferred as at December 31, 2006. The Energy Management net margin, realised or un-realised, amounted to euro 49.7 million in 2006, recognised as revenue under IFRS standards. This includes the euro 22 million exceptional capital gain mentioned in previous financial releases in 2006, as well as a euro 7.9 million un-realised capital gain resulting from the transfer of some contracts into the Energy Management portfolio further to the capacity swap agreement with EDF announced publicly on January 3, 2007. The services provided by POWEO to its customers enjoy a high level of acceptance and represented revenue of euro 2.9 million in 2006. As from 2007, the revenue realised through these services will be presented separately from other components of revenue in order to better reflect its expected growth. The services offering will be indeed a key element of the marketing strategy of POWEO in the years to come, with a potentially significant impact on the results taking into account their level of gross margin which is structurally high. POWEO announced on January 3, 2007 to have concluded with EDF a long-term industrial agreement relating to a power generation capacity exchange, which will allow POWEO to have access from 2007 to 2021 to base-load electricity generated by EDF nuclear power plants. POWEO actively prepares the launch of its offering to residential customers, with in particular a communication campaign planned from next March to June in order to increase its notoriety and to create the conditions necessary to its commercial success on this segment. In parallel POWEO will dedicate specific sales resources to the acquisition of large accounts in industry and services. The public opinion poll carried out in the 4. quarter 2006 by BVA at the request of the Commission of Regulation of the Energy (CRE), and whose results have been just published, indicates that POWEO is already enjoying a global notoriety of 24% near companies only consuming electricity and 37% near companies consuming both electricity and gas. In addition, according to a TNS Sofres study ordered by POWEO, the assisted notoriety of the company near the specific segment of residential customers targeted by POWEO amounts to 13%. These results make POWEO feel confident in its ability to grow significantly its customer base in 2007.

  19. catena-Poly[[diaqua[μ2-4-(4-carboxyphenoxybenzoato](μ2-4,4′-oxydibenzoatopraseodymium(III] monohydrate

    Directory of Open Access Journals (Sweden)

    Ping Li

    2013-11-01

    Full Text Available In the title compound, {[Pr(C14H8O5(C14H9O5(H2O2]·H2O}n, the PrIII cation is eight-coordinated by six carboxyl O atoms from both a monoanionic 4-(4-carboxyphenoxybenzoate and a dianionic 4,4′-oxydibenzoate ligand (four bridging with two from a bidentate chelate interaction, and two O-atom donors from water molecules. A single water molecule of solvation is also present. The complex units are linked through carboxyl O:O′ bridges giving a two-dimensional sheet polymer lying parallel to (001. An overall three-dimensional network structure is generated through intermolecular carboxylic acid and water O—H...O hydrogen bonds and weak C—H...O interactions.

  20. Measurements of the neutron capture cross sections and incineration potentials of minor-actinides in high thermal neutron fluxes: Impact on the transmutation of nuclear wastes; Mesures des sections efficaces de capture et potentiels d'incineration des actinides mineurs dans les hauts flux de neutrons: Impact sur la transmutation des dechets

    Energy Technology Data Exchange (ETDEWEB)

    Bringer, O

    2007-10-15

    This thesis comes within the framework of minor-actinide nuclear transmutation studies. First of all, we have evaluated the impact of minor actinide nuclear data uncertainties within the cases of {sup 241}Am and {sup 237}Np incineration in three different reactor spectra: EFR (fast), GT-MHR (epithermal) and HI-HWR (thermal). The nuclear parameters which give the highest uncertainties were thus highlighted. As a result of fact, we have tried to reduce data uncertainties, in the thermal energy region, for one part of them through experimental campaigns in the moderated high intensity neutron fluxes of ILL reactor (Grenoble). These measurements were focused onto the incineration and transmutation of the americium-241, the curium-244 and the californium-249 isotopes. Finally, the values of 12 different cross sections and the {sup 241}Am isomeric branching ratio were precisely measured at thermal energy point. (author)

  1. 75 FR 26739 - Information Collection Requirement; Defense Federal Acquisition Regulation Supplement; Part 244...

    Science.gov (United States)

    2010-05-12

    ... No: 2010-11284] DEPARTMENT OF DEFENSE Defense Acquisition Regulations System Information Collection... making decisions to grant, withhold, or withdraw purchasing system approval at the conclusion of a purchasing system review. Withdrawal of purchasing system approval would necessitate Government consent to...

  2. 7 CFR 2.44 - Administrator, Risk Management Agency and Manager, Federal Crop Insurance Corporation.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 1 2010-01-01 2010-01-01 false Administrator, Risk Management Agency and Manager... Secretary for Farm and Foreign Agricultural Services to the Administrator, Risk Management Agency, and... for the transaction of the business of the Federal Crop Insurance Corporation and the Risk Management...

  3. 40 CFR 421.244 - Standards of performance for new sources.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 28 2010-07-01 2010-07-01 true Standards of performance for new... Nickel Subcategory Pollutant or pollutant property Maximum for any 1 day Maximum for monthly average mg... range of 7.5 to 10.0 at all times. (b) Acid reclaim leaching filtrate. NSPS for the Secondary Nickel...

  4. Crystal structure of (E-2-[4-(4-hydroxyphenylbutan-2-ylidene]hydrazine-1-carbothioamide

    Directory of Open Access Journals (Sweden)

    Adriano Bof de Oliveira

    2015-01-01

    Full Text Available The title compound, C11H15N3OS, is a thiosemicarbazone derivative of the raspberry ketone rheosmin [systematic name: 4-(4-hydroxyphenylbutane-2-one]. The molecule deviates from planarity, with the bridging C—C—C=N torsion angle equal to −101.3 (2°. The maximum deviation from the mean plane of the non-H atoms of the thiosemicarbazone fragment [C=N—N—C(= S—N] is 0.085 (5 Å for the Schiff base N atom, and the dihedral angle between this mean plane and the aromatic ring is 50.31 (8°. In the crystal, molecules are linked by N—H...O, N—H...S and O—H...S hydrogen bonds, forming a three-dimensional structure, with the molecules stacked along [011].

  5. : tous les projets | Page 244 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Sujet: Climate change, ADAPTATION TO CHANGE, RIVER BASINS, FLOODS, LAND USE, PLANNING, RISK MANAGEMENT. Région: Argentina, South America, Uruguay, North and Central America. Programme: Changements climatiques. Financement total : CA$ 414,000.00. Répercussions de la variabilité du climat sur ...

  6. SU-F-T-244: Radiotherapy Risk Estimation Based On Expert Group Survey

    Energy Technology Data Exchange (ETDEWEB)

    Koo, J; Yoon, M [Korea University, Seoul (Korea, Republic of); Chung, W; Chung, M; Kim, D [Kyung Hee University Hospital at Gangdong, Gangdong-gu, Seoul (Korea, Republic of)

    2016-06-15

    Purpose: To evaluate the reliability of RPN (Risk Priority Number) decided by expert group and to provide preliminary data for adapting FMEA in Korea. Methods: 1163 Incidents reported in ROSIS for 11 years were used as a real data to be compared with, and were categorized into 146 items. The questionnaire was composed of the 146 items and respondents had to valuate ‘occurrence (O)’, ‘severity (S)’, ‘detectability (D)’ of each item on a scale from 1 to 10 according to the proposed AAPM TG-100 rating scales. 19 medical physicists from 19 different organizations in Korea had participated in the survey. Because the number of ROSIS items was not evenly spread enough to be classified into 10 grades, 1–5 scale was chosen instead of 1–10 and survey result was also fit to 5 grades to compare. Results: The average O,S,D were 1.77, 3.50, 2.13, respectively and the item which had the highest RPN(32) was ‘patient movement during treatment’ in the survey. When comparing items ranked in the top 10 of each survey(O) and ROSIS database, two items were duplicated and ‘Simulation’ and ’Treatment’ were the most frequently ranked RT process in top 10 of survey and ROSIS each. The Chronbach α of each RT process were ranged from 0.74 to 0.99 and p-value was <0.001. When comparing O*D, the average difference was 1.4. Conclusion: This work indicates the deviation between actual risk and expectation. Considering that the respondents were Korean and ROSIS is mainly composed of incidents happened in European countries and some of the top 10 items of ROSIS cannot be applied in radiotherapy procedure in Korea, the deviation could have been came from procedural difference. Moreover, if expert group was consisted of experts from various parts, expectation might have been more accurate. Therefore, further research on radiotherapy risk estimation is needed.

  7. Stability of 244−260Fm isotopes against alpha and cluster radioactivity

    Indian Academy of Sciences (India)

    [22] M Jones, R P Schuman, J P Butler, G Cowper, T A Eastwood and H G Jackson,. Phys. Rev. 102, 203 (1956). [23] E K Hulet, R W Hoff, J E Evans and R W Lougheed, Phys. Rev. Lett. 13, 343 (1964). [24] T Sikkeland, A Ghiorso, R Latimer and A E Larsh, Phys. Rev. 140, B277 (1965). [25] K P Santhosh and Antony Joseph, ...

  8. Page 1 244 B. R. SUBBARAo AND G. K. V. GowrDA Statistical ...

    Indian Academy of Sciences (India)

    That the longevity of the females is largely influenced by temperature is apparent. Humidity has little effect on the longevity of the female parasite and so also the interatcion between temperature and humidity. It is also seen that a rise in temperature beyond 35 C. Suddenly brings down the span of life of females. Apparently ...

  9. 40 CFR 98.244 - Monitoring and QA/QC requirements.

    Science.gov (United States)

    2010-07-01

    ... standard method published by a consensus-based standards organization (e.g., ASTM, API, etc.), or follow... to any standard method published by a consensus-based standards organization (e.g., ASTM, API, etc... laboratory, or by the supplier of a feedstock. (i) ASTM D1945-03, Standard Test Method for Analysis of...

  10. 9 CFR 354.244 - Temperatures and cooling and freezing procedures.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Temperatures and cooling and freezing... and cooling and freezing procedures. Temperatures and procedures which are necessary for cooling and freezing of rabbits in accordance with sound commercial practice shall be maintained in the coolers and...

  11. U. S. Atlantic Fleet, Eighth Amphibious Force. Operation Plan Number 2-44

    Science.gov (United States)

    1944-01-01

    8217 , • , . , (c) 84»3 . YELLOW Beach Assault Group,. Commodore Edgar • 84.3*1 Transport^ Unit, commodore Edgar ^g . , . r APA SAMUEL CHASE (26), HEOTICO (-13...F) : 2’ APA . ’ - ’ /, XAP ANNE ARUNDEL (76), TEURSTON (77) , .2 ’ZAP \\\\ • A&V OBERON .(14), ANDROlvEDA (15) 2 AKi ’ ’HMS HIGHWAY ’ ’.’ . ... 1 LSD...suffering underwater damage make emergency requests,for assist^ . ’, ance from nearby ships or7 salvage "units,;’ Norma ?.ly, re quests, for

  12. Page 1 244 MoHAMMED KESHAVARZI AND KENNETH A. KLINE ...

    Indian Academy of Sciences (India)

    yn” — kº") Yi (ksa). 2iynkºji' (kxa) 2iynka Yi' (kxa). (yn” — ka”) Ji (kºb) (yn” — kº) Yı (kºb). 2iynk2] 1. (k2b) 2iynkº Ya' (k25). # kJ (ka) #ky, (ko). –ºw, (ka) – #yay, (ka).

  13. [Bacterial dermohypodermitis: a retrospective single-center study of 244 cases in Guinea].

    Science.gov (United States)

    Cisse, M; Keïta, M; Toure, A; Camara, A; Machet, L; Lorette, G

    2007-10-01

    Dermo-hypodermal bacterial infections (erysipelas, cellulitis and necrotizing fasciitis) are frequent and may be life-threatening. A retrospective study of a period of 4 years and 6 months (1 June 1999 to 31 December 2003) was carried out at the Donka University Hospital centre (Conakry-Guinea) in order to analyze the epidemiological, clinical and therapeutic characteristics of bacterial dermohypodermitis in a hospital environment. Two hundred and forty-four patients (188 women and 56 men) were hospitalized for bacterial dermohypodermitis. Mean age was 38 years. The site of dermohypodermitis comprised the entire lower limbs in 4 cases (2%), legs and feet in 200 cases (82%), thighs in 12 cases (4%), buttocks in 4 cases (2%) and upper limbs in 24 cases (10%). A previous history of dermohypodermitis, chronic alcoholism, use of non-steroidal anti inflammatory drugs, obesity and lymphoedema was identified. Necrotizing bacterial dermohypodermitis and necrotizing fasciitis were the main complications and were seen in 31 patients. These conditions were generally associated with use of non-steroidal anti inflammatory drugs (90% vs. 25%) (OR=27, CI 95=8-94), delayed initiation of suitable treatment and use of traditional medicine. Our study shows female predominance of bacterial dermohypodermitis. This is explained by cutaneous atrophy in women resulting from use of depigmenting drugs that facilitate skin breaks, thus allowing ingress of bacteria. NSAID intake, while frequent in our series, was far higher in the fasciitis group, suggesting a potentially aggravating role of these drugs.

  14. SU-E-T-244: High Spatial Resolution EBT2 Film Dosimetry.

    Science.gov (United States)

    Poppinga, D; Schoenfeld, A; Poppe, B; Chofor, N

    2012-06-01

    The purpose of this study was to measure depth dose curves and dose effects near high-Z interfaces with radiochromic EBT-2 films reaching a spatial resolution superior to conventional methods with no quality losses. The setup is made of two 12cm stacks of RW3, fixing an EBT2 film in a vertical position. To measure a depth dose curve, the setup was irradiated with a 15MV photon beam (Siemens Primus). Since the film is positioned parallel to the beam propagation, the depth dose curve is measured with only one film per depth. Additionally, a dental gold alloy probe was inserted in the RW3 stack at 6cm depth and the dose enhancement in front of the probe was measured with the method described above. Hereby, the bottom edge of the film touches the probe's surface.The irradiated films were digitized with a resolution of 72dpi using an Epson 10000XL flatbed scanner with a transparency unit and alignment frames. With this setup, the spatial resolution is only limited by the scanning resolution. In order to verify the new measurement method, comparisons of the measured depth dose curves with the conventional method of placing the film orthogonal to the beam propagation showed deviations of lesser than 3%.The comparison of the dental gold measurements with Monte Carlo simulations shows a systematic lower measured dose which is still within 5% consistency. However attention has to be paid in the experimental setup and film preparation. The introduced method shows significant advantages to conventional orthogonal EBT2 film positioning. It shows a very high spatial resolution and the area of interest is only limited by the film size. The method will be used in further studies, to investigate dose profiles and dose effects near interfaces and in inhomogeneities. © 2012 American Association of Physicists in Medicine.

  15. Characteristics of 244 patients with keratoconus seen in an optometric contact lens practice.

    Science.gov (United States)

    Shneor, Einat; Millodot, Michel; Blumberg, Sharon; Ortenberg, Ilya; Behrman, Shmuel; Gordon-Shaag, Ariela

    2013-03-01

    The purpose of this study was to describe the characteristics of keratoconic patients seen in a specialised contact lens practice from a general population with a high prevalence of the disease. Patients attending a contact lens practice for management of keratoconus were asked to complete a questionnaire. Data were collected on demographic characteristics, general health, family history, eye rubbing, allergy, asthma, eczema, education level, history of keratoplasty and smoking. Two hundred and forty-four patients completed the questionnaire. There was a male bias (54.5 per cent). The majority of the patients (78.7 per cent) wore contact lenses, of whom 67.7 per cent wore hard, 13 per cent soft and 4.2 per cent scleral contact lenses. Some of the patients (21.3 per cent) had undergone corneal graft surgery. Eighteen per cent had an associated systemic disease, the most common of which was type 2 diabetes, although this disease was less prevalent, but not significantly, in the keratoconic sample than in the general population (p = 0.19). The prevalence of eye rubbing (65.6 per cent) was similar to other studies. Compared to the general population, asthma (13.2 per cent) was slightly, but not significantly, less prevalent (p = 0.17), eczema (6.6 per cent) was significantly less (p history of the disease (27.9 per cent) and most were better educated than the general population. The results of this survey concur with those of other studies with regard to most known characteristics of keratoconus; however, the proportion of asthma and eczema tended to be less than in other surveys and may be linked to the environmental influence of a hot and sunny country. The high prevalence of positive family history of the disease in this cohort suggests a genetic influence. © 2012 The Authors. Clinical and Experimental Optometry © 2012 Optometrists Association Australia.

  16. 244G>A(rs673) polymorphisms at the promoter region of the TNF-α

    African Journals Online (AJOL)

    Tumour Necrosis Factor (TNF-α) is a multifunctional pro-inflammatory cytokine that has been shown to play an important role in the pathogenesis of malaria. The level of expression of this cytokine is however suggested to be under genetic control. This study evaluated the frequency of two single nucleotide polymorphisms ...

  17. Multi-layer canard cycles and translated power functions (vol 244, pg 1329, 2008) Correction

    OpenAIRE

    Dumortier, Freddy; Roussarie, Robert

    2008-01-01

    The paper deals with two-dimensional slow-fast systems and more specifically with multi-layer canard cycles. These are canard cycles passing through n layers of fast orbits, with n⩾2. The canard cycles are subject to n generic breaking mechanisms and we study the limit cycles that can be perturbed from the generic canard cycles of codimension n. We prove that this study can be reduced to the investigation of the fixed points of iterated translated power functions.

  18. Frank B. Weber, The Evasive Neutral, Columbia & Londres, University of Missouri Press, 1979, 244p.

    OpenAIRE

    ARTUNKAL, Tugrul

    2005-01-01

    A la lumière des documents d'archives que l'auteur déploie au grand jour, et surtout de ceux des affaires étrangères britanniques et allemandes, la politique extérieure turque apparaît dans toute son ambivalence et ses tergiversations. Ceci tant à la veille que tout au long de la dernière guerre mondiale.

  19. A retrospective study of californium-252 neutron brachytherapy combined with EBRT versus 3D-CRT in the treatment of esophageal squamous cell cancer.

    Science.gov (United States)

    Wang, Qifeng; Li, Tao; Lang, Jinyi; Wang, Jie; Wang, Jian; Liu, Huiming; Jia, Xitang; Liu, Bo; Wang, C-K Chris

    2015-10-24

    We conducted a retrospective analysis on 884 patients who were diagnosed with esophageal squamous cell carcinoma (ESCC) and treated with either the neutron brachytherapy in combination with external beam radiotherapy (NBT + EBRT) or 3-dimensional conformal radiation therapy (3D-CRT) to determine the differences in efficacy and morbidity between the two treatment groups. The 884 ESCC patients treated with either NBT + EBRT or 3D-CRT between 2002 and 2012 were retrospectively reviewed and analyzed. Multivariable Cox regression was used to compare oncologic outcomes of the two groups of patients in the context of other clinically relevant variables. The acute and chronic toxicities associated with the two groups were compared using Fisher exact and log-rank tests, respectively. Among the 884 patients, 545 received NBT + EBRT and 339 received 3D-CRT (i.e. EBRT-only). The age range is 39-95 years (median 66). The follow-up time range is 3-145 months (median 32). The analysis shows that the NBT + EBRT group has higher overall survival rate and local control rate than that of the 3D-CRT group. The acute toxicity effects were acceptable for both groups of patients with the NBT + EBRT group showing higher rates of leukopenia and thrombocytopenia and the 3D-CRT group showing higher rates on fistula and massive bleeding. The patients treated with NBT + EBRT showed better oncologic outcomes than those treated with 3D-CRT. The toxicity effects were acceptable for both groups with the NBT + EBRT group showing higher rates on the acute effects and the 3D-CRT group showing higher rates on the late effects.

  20. Accurate determination of Curium and Californium isotopic ratios by inductively coupled plasma quadrupole mass spectrometry (ICP-QMS) in 248Cm samples for transmutation studies

    Energy Technology Data Exchange (ETDEWEB)

    Gourgiotis, A.; Isnard, H.; Aubert, M.; Dupont, E.; AlMahamid, I.; Cassette, P.; Panebianco, S.; Letourneau, A.; Chartier, F.; Tian, G.; Rao, L.; Lukens, W.

    2011-02-01

    The French Atomic Energy Commission has carried out several experiments including the mini-INCA (INcineration of Actinides) project for the study of minor-actinide transmutation processes in high intensity thermal neutron fluxes, in view of proposing solutions to reduce the radiotoxicity of long-lived nuclear wastes. In this context, a Cm sample enriched in {sup 248}Cm ({approx}97 %) was irradiated in thermal neutron flux at the High Flux Reactor (HFR) of the Laue-Langevin Institute (ILL). This work describes a quadrupole ICP-MS (ICP-QMS) analytical procedure for precise and accurate isotopic composition determination of Cm before sample irradiation and of Cm and Cf after sample irradiation. The factors that affect the accuracy and reproducibility of isotopic ratio measurements by ICP-QMS, such as peak centre correction, detector dead time, mass bias, abundance sensitivity and hydrides formation, instrumental background, and memory blank were carefully evaluated and corrected. Uncertainties of the isotopic ratios, taking into account internal precision of isotope ratio measurements, peak tailing, and hydrides formations ranged from 0.3% to 1.3%. This uncertainties range is quite acceptable for the nuclear data to be used in transmutation studies.

  1. Radiological Characterization Technical Report on Californium-252 Sealed Source Transuranic Debris Waste for the Off-Site Source Recovery Project at Los Alamos National Laboratory

    Energy Technology Data Exchange (ETDEWEB)

    Feldman, Alexander [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2014-04-24

    This document describes the development and approach for the radiological characterization of Cf-252 sealed sources for shipment to the Waste Isolation Pilot Plant. The report combines information on the nuclear material content of each individual source (mass or activity and date of manufacture) with information and data on the radionuclide distributions within the originating nuclear material. This approach allows for complete and accurate characterization of the waste container without the need to take additional measurements. The radionuclide uncertainties, developed from acceptable knowledge (AK) information regarding the source material, are applied to the summed activities in the drum. The AK information used in the characterization of Cf-252 sealed sources has been qualified by the peer review process, which has been reviewed and accepted by the Environmental Protection Agency.

  2. Ines Lei Corvette, L'ita iano regionale di Sardegna, Fenomeni Linguistici num. 3, Bologna, Zanichelli 1983, IV + 244 pp.

    Directory of Open Access Journals (Sweden)

    Pavao Tekavčić

    1983-01-01

    Full Text Available L'Autrice del volume, professore associate di linguistica presso la Facoltà di Magistero dell'Università di Cagliari, ci ha dato già in precedenza alcuni notevoli contributi allo studio della complessa situazione linguistica in Sardegna (La metafonesi ne l'italiano regionale di Sardegna, "Lingua e stile" X/1975/; Neutralizzazione e ridondanza fonologiaa nei dialetti sardi, "Lingua e stile" XII/1977/; Dittonghi e iato nel campidanese, "Rivista italiana di dialettologia" IV/1979-1980/; Variétés et minorités linguistiques en Sardaigne, "Peuples Méditerranéens" XIII/1980/, dedicandosi nel contempo anche adaltri temi (l'arabo, i disturbi del linguaggio, la semantica del linguaggio della letteratura ecc.. Malgrado questa larghezza di interessi scientifici il dominic principale dell'Autrice re­sta la Sardegna, e anche l'opera qui recensita è una specie di sintesi dei suoi studi linguistici sardi condotti finora. Il tema è l'italiano regionale di Sardegna(IRS, nei suoi molteplici rapporti con i principali dialetti(D sardi da un late, con l'italiano standard (IS dall'altro. Oggigiorno in Italia, un'opera simile non può non essere impostata principalmente dal punta di vista sociolinguistico, non soltanto perché la sociolinguistica è uno degli indirizzi linguistici più attuali, rna anche e soprattutto perché in Italia, terra di mille e uno dia­ letti, studi sull'italiano regionale, sull'italiano standard, sull'educazione linguistica ecc. senza l'angolazione sociolinguistica semplicemente non sono possibili.

  3. Poly[[diaquabis(μ2-4,4′-bipyridinemanganese(II] bis[2-(2-carboxyphenyldisulfanylbenzoate

    Directory of Open Access Journals (Sweden)

    Shao-Ming Fang

    2009-05-01

    Full Text Available The title complex, {[Mn(C10H8N22(H2O2](C14H9O4S22}n, contains an octahedrally coordinated MnII cation and 2-(2-carboxyphenyldisulfanylbenzoate anions. The MnII center is situated on a crystallographic center of inversion and is coordinated by four 4,4′-bipyridine (4,4′-bipy ligands and two water molecules. The 4,4′-bipy ligands act as bridging ligands, producing a fishing-net-like two-dimensional framework. In the crystal structure, this positively charged framework is charge balanced by 2-(2-carboxyphenyldisulfanylbenzoate anions that form a separate anionic two-dimensional framework via intermolecular O—H...O hydrogen bonds and C—H...π stacking interactions. Additional intermolecular O—H...O hydrogen bonds link the cationic and anionic frameworks to form the three-dimensional crystal structure.

  4. Quality Improvement Efforts among Early Childhood Education Programs Participating in Iowa's Quality Rating System. REL 2017-244

    Science.gov (United States)

    Hawkinson, Laura E.; Faria, Ann-Marie; Bouacha, Nora; Lee, Dong Hoon; Metzger, Ivan

    2017-01-01

    This report describes the quality improvement efforts of early childhood education programs participating in Iowa's Quality Rating System (QRS). It identifies supports and barriers to quality improvement and examines how quality improvement supports and activities relate to changes in program quality ratings across time. The study team developed…

  5. SU-E-T-244: Designing Low-Z Targets To Enhance Surface Dose: A Monte Carlo Simulation

    Energy Technology Data Exchange (ETDEWEB)

    Kelly, R [Nova Scotia Cancer Centre, Halifax, NS (Canada); Robar, J [Capital District Health Authority, Halifax, NS (Canada); Parsons, D [Dalhousie University, Halifax, Nova Scotia (Canada)

    2015-06-15

    Purpose: Recent developments in The Varian Truebeam linac platform allows for the introduction of low-Z targets into the beam line for the imaging purposes. We have proposed using a low-Z target for radiation therapy purposes to enhance the surface dose during radiation treatment. The target arm of the Varian Truebeam accelerator consists of multiple targets with are linearly translated into the beam line. We have designed two Low-Z targets made of carbon: 1) a step target consisting of three steps of 15%, 30% and 60% CSDA range for 2.5 MeV electrons Figure 1a; 2) and a ramp target, an incline plane 2cm long with thicknesses ranging from 0% to 60% CSDA range, Figure 1b. The purpose of this work will determine the spectral characteristics of these target designs and determine if they have practical clinical applications for enhancing surface dose. Methods: To calculate the spectral characteristics of these targets, a standard Monte Carlo model of a Varian Clinac accelerator was used. Simulations were performed with a carbon step target, and a carbon ramp target, located at the same position as the electron foil in the rotating carousel. Simulations were carried out using a 2.5 MeV electron beam. Results: The step target design produced spectral characteristics which were similar to spectral model using a single disk target of the same thickness. The ramp target provides a means to have positional variation of the spectral components of the beam, however, the electron component as 60% CSDA us much broader than the step target. Conclusion: The carbon step-target provides a spectral distribution which is similar to a carbon disk of comparable thickness. The spectral distribution from the ramp-target can be modified as a function of position to provide a wide range of low energy electrons for surface dose enhancement.

  6. 49 CFR 244.13 - Subjects to be addressed in a Safety Integration Plan involving an amalgamation of operations.

    Science.gov (United States)

    2010-10-01

    ... communication standards; (3) Emergency response procedures; and (4) Information technology systems and personnel... freight cars of all types; (4) Dispatchers or operators; (5) Employees who inspect and maintain signal and train control devices and systems; (6) Hazardous materials personnel, including information technology...

  7. NA22 Model Cities Project - LL244T An Intelligent Transportation System-Based Radiation Alert and Detection System

    Energy Technology Data Exchange (ETDEWEB)

    Peglow, S

    2004-02-24

    The purpose of this project was twofold: first, provide an understanding of the technical foundation and planning required for deployment of Intelligent Transportation System (ITS)-based system architectures for the protection of New York City from a terrorist attack using a vehicle-deployed nuclear device; second, work with stakeholders to develop mutual understanding of the technologies and tactics required for threat detection/identification and establish guidelines for designing operational systems and procedures. During the course of this project we interviewed and coordinated analysis with people from the New Jersey State Attorney General's office, the New Jersey State Police, the Port Authority of New York/New Jersey, the Counterterrorism Division of the New York City Police Department, the New Jersey Transit Authority, the State of New Jersey Department of Transportation, TRANSCOM and a number of contractors involved with state and federal intelligent transportation development and implementation. The basic system architecture is shown in the figure below. In an actual system deployment, radiation sensors would be co-located with existing ITS elements and the data will be sent to the Traffic Operations Center. A key element of successful system operation is the integration of vehicle data, such as license plate, EZ pass ID, vehicle type/color and radiation signature. A threat data base can also be implemented and utilized in cases where there is a suspect vehicle identified from other intelligence sources or a mobile detector system. Another key aspect of an operational architecture is the procedures used to verify the threat and plan interdiction. This was a major focus of our work and discussed later in detail. In support of the operational analysis, we developed a detailed traffic simulation model that is described extensively in the body of the report.

  8. Arnaud Balvay, La Révolte des Natchez, Paris, Éditions du Félin, 2008, 244p.

    OpenAIRE

    Havard, Gilles

    2009-01-01

    Par une curieuse omission, les Natchez, ces Amérindiens de la basse vallée du Mississippi qui, au début du XVIIIe siècle, vivaient au contact des colons français de la Louisiane (à quelque 150 kilomètres au nord-ouest de la Nouvelle-Orléans), ont échappé à notre mémoire collective. Vraisemblablement, explique l’historien Arnaud Balvay, auteur du présent livre, « parce qu’ils sont le symbole d’une rencontre manquée » (p. 182). Cet oubli peut pourtant paraître paradoxal. Aucun groupe amérindie...

  9. Comparison of photosensitivity in germanium doped silica fibers using 244 nm and 266 nm continuous wave lasers

    DEFF Research Database (Denmark)

    Jensen, Jesper Bo; Varming, Poul; Liu, B.

    2001-01-01

    Diode pumped continuous-wave UV lasers offer an interesting alternative to frequency doubled argon-ion lasers. We report the first photosensitivity comparison using these lasers on deuterium loaded standard telecommunication fibers and unloaded experimental fibers....

  10. Bis{benzyl 2-[4-(4-methoxyphenylbutan-2-ylidene]hydrazinecarbodithioato-κ2N2,S}nickel(II

    Directory of Open Access Journals (Sweden)

    Ming-Yueh Tan

    2012-06-01

    Full Text Available The complete molecule of the title complex, [Ni(C19H21N2OS22], is generated by the application of twofold symmetry. The NiII atom is N,S-chelated by two hydrazinecarbodithioate ligands, which provide an N2S2 donor set that defines a distorted square-planar geometry, the S atoms being approximately cis. The conformation of the chelate ring is an envelope with the NiII atom being the flap atom. The dihedral angle between the least-squares planes through the chelate rings = 30.10 (6°. Supramolecular chains propagated by glide symmetry along the c axis and mediated by C—H...N contacts feature in the crystal packing.

  11. ARL: A Bimonthly Report on Research Library Issues and Actions from ARL, CNI, and SPARC. Number 244

    Science.gov (United States)

    Barrett, G. Jaia, Ed.

    2006-01-01

    ARL is the bimonthly report on research library issues and actions from ARL (Association of Research Libraries), CNI (Coalition of Networked Information), and SPARC (Scholarly Publishing and Academic Resources Coalition). ARL reports on current issues of interest to academic and research library administrators, staff, and users; higher education…

  12. Poly[[diaqua-μ2-4,4′-bipyridyl-μ2-o-phthalato-nickel(II] dihydrate

    Directory of Open Access Journals (Sweden)

    Bing Li

    2008-02-01

    Full Text Available In the title layer complex, {[Ni(C8H4O4(C10H8N2(H2O2]·2H2O}n, the Ni atom has a distorted octahedral environment, defined by the phthalate and 4,4′-bipyridyl ligands which link the Ni atoms, forming a square lattice in the bc plane. This extends into a three-dimensional supramolecular network through O—H...O hydrogen-bonding interactions. The Ni atom lies on, and both ligands are bisected by, a crystallographic twofold axis.

  13. Page 1 244 M K Saha et al. As the frequency is measured by flºſt ...

    Indian Academy of Sciences (India)

    differential phase shifts and a better calibration procedure using an aircraft with a flash and a beacon. 6.2. Tone-ranging system. The tone-ranging system was calibrated with the satellite for zero distance. The system was put into operation 15 days after launching. The tone-ranging data are straightforward and can be used ...

  14. Use of methyltrioctyl/decylammonium bis 2,4,4-(trimethylpentyl)phosphinate ionic liquid (ALiCY IL) on the boron extraction in chloride media

    OpenAIRE

    Fortuny Sanromá, Agustín; Coll Ausió, Mª Teresa; Sastre Requena, Ana María

    2012-01-01

    Recent restriction of boron concentration in drinking water has produced some problems in the seawater desalinization plants because the rejection of boron in most of the plants is inadequate. Three ionic liquids derived from Cyanex 272 as an anion with different cations (from Aliquat 336, Cyphos IL 101 and Cyphos IL 167) were prepared to be used as boron extractants. Liquid–liquid extraction experiments were carried out to evaluate the viability of boron separation from high chlo...

  15. Poly[[bis(μ2-4,4′-bipyridine[μ2-(2,4-dichlorophenoxyacetato]copper(I] nitrate

    Directory of Open Access Journals (Sweden)

    Shi-Zhu Liu

    2010-02-01

    Full Text Available The title compound, {[Cu2(C8H5Cl2O3(C10H8N22]NO3}n was prepared by reacting copper(II nitrate with 4,4′-bipyridine (4,4′-bipy and (2,4-dichlorophenoxyacetic acid under solvothermal conditions. Each of two copper(I atoms in the asymmetric unit is three-coordinated by two N atoms from two 4,4′-bipy ligands and one O atom from the (2,4-dichlorophenoxyacetate ligand. As both ligands act as bridging ligands, a double-stranded chain structure is observed.

  16. Alarming increase in the registration of degenerative rotator cuff-related lesions a nationwide epidemiological study investigating 244,519 patients

    DEFF Research Database (Denmark)

    Monrad, Nina; Ganestam, Ann; Kallemose, Thomas

    2017-01-01

    the incidence of shoulder lesions in Denmark from 1996 to 2013 with focus on sex, age and geographical area. METHODS: The Danish National Patient Registry was searched retrospectively to find the number of shoulder lesions in Denmark during the period 1996-2013. Regional population data were retrieved from...

  17. 49 CFR 173.244 - Bulk packaging for certain pyrophoric liquids (Division 4.2), dangerous when wet (Division 4.3...

    Science.gov (United States)

    2010-10-01

    ... 105J500I Chloropicrin 105J500I112J500I Chlorosulfonic acid 105J500I112J500I Dimethyl sulfate... 105J500I112J500I Titanium tetrachloride 105J500I112J500I Note 1: Each tank car must have a reclosing pressure...

  18. Distribution of sup 137 Cs, sup 90 Sr, sup 238 Pu, sup 239 Pu, sup 241 Am and sup 244 Cm in Pond B, Savannah River Site

    Energy Technology Data Exchange (ETDEWEB)

    Whicker, F.W. (Colorado State Univ., Fort Collins, CO (USA)); Pinder, J.E. III; Bowling, J.W. (Savannah River Ecology Lab., Aiken, SC (USA)); Alberts, J.J. (Georgia Univ., Sapelo Island, GA (USA). Marine Inst.); Brisbin, I.L. Jr. (Savannah River Ecology Lab., Aiken, SC (USA))

    1989-05-01

    The gradual senescence of present-day operating nuclear facilities, and resultant contamination of aquatic and terrestrial ecosystems, emphasize the importance of understanding the behavior of radionuclides in the environment. Observations and deductions concerning mechanisms of radionuclide transport can contribute significantly to knowledge of fundamental ecological processes. This study emphasized the ecosystem-level distribution of several long-lived radionuclides in an abandoned reactor cooling impoundment after a twenty year period of chemical and biological equilibration. 90 refs., 14 figs., 5 tabs.

  19. Takotsubo cardiomyopathy associated with sepsis due to Pseudomonas aeruginosa pneumoniadoi: 10.12662/2317-3076jhbs.v3i4.169.p242-244.2015

    Directory of Open Access Journals (Sweden)

    Márcio da Silva Pereira

    2015-12-01

    Full Text Available The authors describe a case report of a 71 year-old female patient admitted at the emergency service due to severe precordial chest pain associated with dyspnea and sweating. The electrocardiogram performed on admission showed ST elevation on V2 and V3 leads and the ventriculography revealed left ventricular apical ballooning, denoting the diagnosis of Takotsubo Cardiomyopathy. At the eighth day of hospitalization, although the heart function was recovered, the patient died due the clinical complications of a septic shock.

  20. Multibeam collection for TN244: Multibeam data collected aboard Thomas G. Thompson from 2009-12-05 to 2009-12-08, Seattle, WA to Seattle, WA

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set is part of a larger set of data called the Multibeam Bathymetry Database (MBBDB) where other similar data can be found at...

  1. SU-E-J-244: Development and Validation of a Knowledge Based Planning Model for External Beam Radiation Therapy of Locally Advanced Non-Small Cell Lung Cancer

    Energy Technology Data Exchange (ETDEWEB)

    Liu, Z; Kennedy, A [Sarah Cannon, Nashville, TN (United States); Larsen, E; Hayes, C; Grow, A [North Florida Cancer Center, Gainesville, FL (United States); Bahamondes, S.; Zheng, Y; Wu, X [JFK Comprehensive Cancer Institute, Lake Worth, FL (United States); Choi, M; Pai, S [Good Samaritan Hospital, Los Gatos, CA (United States); Li, J [Doctors Hospital of Augusta, Augusta, GA (United States); Cranford, K [Trident Medical Center, Charleston, SC (United States)

    2015-06-15

    Purpose: The study aims to develop and validate a knowledge based planning (KBP) model for external beam radiation therapy of locally advanced non-small cell lung cancer (LA-NSCLC). Methods: RapidPlan™ technology was used to develop a lung KBP model. Plans from 65 patients with LA-NSCLC were used to train the model. 25 patients were treated with VMAT, and the other patients were treated with IMRT. Organs-at-risk (OARs) included right lung, left lung, heart, esophagus, and spinal cord. DVH and geometric distribution DVH were extracted from the treated plans. The model was trained using principal component analysis and step-wise multiple regression. Box plot and regression plot tools were used to identify geometric outliers and dosimetry outliers and help fine-tune the model. The validation was performed by (a) comparing predicted DVH boundaries to actual DVHs of 63 patients and (b) using an independent set of treatment planning data. Results: 63 out of 65 plans were included in the final KBP model with PTV volume ranging from 102.5cc to 1450.2cc. Total treatment dose prescription varied from 50Gy to 70Gy based on institutional guidelines. One patient was excluded due to geometric outlier where 2.18cc of spinal cord was included in PTV. The other patient was excluded due to dosimetric outlier where the dose sparing to spinal cord was heavily enforced in the clinical plan. Target volume, OAR volume, OAR overlap volume percentage to target, and OAR out-of-field volume were included in the trained model. Lungs and heart had two principal component scores of GEDVH, whereas spinal cord and esophagus had three in the final model. Predicted DVH band (mean ±1 standard deviation) represented 66.2±3.6% of all DVHs. Conclusion: A KBP model was developed and validated for radiotherapy of LA-NSCLC in a commercial treatment planning system. The clinical implementation may improve the consistency of IMRT/VMAT planning.

  2. A Meta-Analysis of Contemporary Lesion Modification Strategies During Percutaneous Coronary Intervention in 244,795 Patients From 22 Studies.

    Science.gov (United States)

    Danek, Barbara Anna; Karatasakis, Aris; Karacsonyi, Judit; Alharbi, Waleed; Roesle, Michele; Rangan, Bavana V; Burke, M Nicholas; Banerjee, Subhash; Brilakis, Emmanouil S

    2017-12-01

    Outcomes with use of lesion-modification strategies in the drug-eluting stent era have received limited study. We conducted a meta-analysis of 22 studies published between 2004-2016 reporting outcomes after use of rotational atherectomy, cutting-balloon, and scoring-balloon angioplasty. In observational trials, acute luminal gain was higher after lesion modification as compared with control (standardized mean difference, 0.23 mm; 95% confidence interval [CI], 0.01-0.44; P=.04), with no difference in acute gain in randomized studies. Compared with control, lesion modification was associated with lower restenosis in randomized trials (odds ratio [OR], 0.64; 95% CI, 0.45-0.90; P=.01). Ninety-day incidence of major adverse cardiovascular event (MACE) was higher after lesion modification in observational studies (OR, 1.39; 95% CI, 1.05-1.83; P=.02), but similar in randomized trials. Ninety-day incidence of target-lesion or target-vessel revascularization (TLR-TVR) and myocardial infarction (MI) was similar. Ninety-day incidence of death was higher after lesion modification in observational studies (OR, 1.42; 95% CI, 1.04-1.95; P=.03), but similar in randomized trials. At 1 year, the MACE rate was similar for lesion modification compared with control in observational studies, but lower after lesion modification in randomized trials (OR, 0.65; 95% CI, 0.48-0.88; Plesion modification in observational studies, but lower in randomized trials (OR, 0.64; 95% CI, 0.46-0.88; Plesion modification compared with control.

  3. Crystal structures of ethyl {2-[4-(4-isopropylphenylthiazol-2-yl]phenyl}carbamate and ethyl {2-[4-(3-nitrophenylthiazol-2-yl]phenyl}carbamate

    Directory of Open Access Journals (Sweden)

    Elena V. Sukhonosova

    2016-09-01

    Full Text Available The title compounds, C21H22N2O2S (I and C18H15N3O4S (II, are structural analogs of the alkaloid Thiosporine B. Both molecules adopt a near-planar V-shaped conformation, which is consolidated by intramolecular N—H...N and C—H...O hydrogen bonds. The crystal structure of (I consists of mlecular stacks along the a axis, in which the molecules are linked to each other by π(S...π(C interactions. In the crystal of (II, molecules are linked into chains by C—H...O hydrogen bonds and the chains are cross-linked into (100 sheets by π–π stacking interactions.

  4. CCDC 914601: Experimental Crystal Structure Determination : catena-(bis(mu~2~-4,4'-Ethyne-1,2-diyldipyridine)-(mu~2~-hexafluorosilicato)-copper(ii) methanol solvate)

    KAUST Repository

    Nugent, P.

    2013-01-01

    An entry from the Cambridge Structural Database, the world’s repository for small molecule crystal structures. The entry contains experimental data from a crystal diffraction study. The deposited dataset for this entry is freely available from the CCDC and typically includes 3D coordinates, cell parameters, space group, experimental conditions and quality measures.

  5. CCDC 914600: Experimental Crystal Structure Determination : catena-(bis(mu~2~-4,4'-Ethyne-1,2-diyldipyridine)-(mu~2~-hexafluorosilicato)-copper(ii) unknown solvate)

    KAUST Repository

    Nugent, P.

    2013-01-01

    An entry from the Cambridge Structural Database, the world’s repository for small molecule crystal structures. The entry contains experimental data from a crystal diffraction study. The deposited dataset for this entry is freely available from the CCDC and typically includes 3D coordinates, cell parameters, space group, experimental conditions and quality measures.

  6. BUENO, Zuleika de Paula. Leia o livro, veja o filme, compre o disco: a formação do cinema juvenil brasileiro Maringá (PR): EDUEM, 2016 (244 p.)

    OpenAIRE

    REA Editor

    2016-01-01

    Este livro aborda a produção cinematográfica direcionada ao público jovem no Brasil num determinado período histórico, no caso, o final da década de 1950 e o início dos anos 1990. O que se entende aqui por cinema juvenil é o resultado de uma determinada configuração de processos produtivos, estruturas narrativas, formas de sociabilidade e práticas de consumo existentes no cinema brasileiro que coloca o jovem no centro do debate cultural.

  7. BUENO, Zuleika de Paula. Leia o livro, veja o filme, compre o disco: a formação do cinema juvenil brasileiro Maringá (PR: EDUEM, 2016 (244 p.

    Directory of Open Access Journals (Sweden)

    REA Editor

    2016-07-01

    Full Text Available Este livro aborda a produção cinematográfica direcionada ao público jovem no Brasil num determinado período histórico, no caso, o final da década de 1950 e o início dos anos 1990. O que se entende aqui por cinema juvenil é o resultado de uma determinada configuração de processos produtivos, estruturas narrativas, formas de sociabilidade e práticas de consumo existentes no cinema brasileiro que coloca o jovem no centro do debate cultural.

  8. Poly[[aqua(μ2-4,4′-bipyridine-κ2N:N′[μ3-3-bromo-2-(carboxylatomethylbenzoato-κ3O1:O1′:O2]cadmium] monohydrate

    Directory of Open Access Journals (Sweden)

    Yangmei Liu

    2012-08-01

    Full Text Available In the title compound, {[Cd(C9H5BrO4(C10H8N2(H2O]·H2O}n, the CdII atom has a distorted octahedral coordination geometry. Two N atoms from two 4,4′-bipyridine (bipy ligands occupy the axial positions, while the equatorial positions are furnished by three carboxylate O atoms from three 3-bromo-2-(carboxylatomethylbenzoate (bcb ligands and one O atom from a water molecule. The bipy and bcb ligands link the CdII atoms into a three-dimensional network. O—H...O hydrogen bonds and π–π interactions between the pyridine and benzene rings [centroid–centroid distance = 3.736 (4 Å] are present in the crystal.

  9. SU-E-J-244: Validation of a 6D-Robotic-Couch and Image Guidance Radiation Therapy (IGRT) System for Localization in World's First Single-Room Proton Therapy System

    Energy Technology Data Exchange (ETDEWEB)

    Rankine, L; Klein, E [Washington University, Saint Louis, MO (United States); Grantham, K [University of Missouri, Columbia, MO (United States); Goddu, S [Washington University, St. Louis, MO (United States); Cessac, R [Mevion Medical Systems, Littleton, MA (United States); Baker, K [Barne-Jewish Hospital, St. Louis, MO (United States); Santanam, L [Washington University School of Medicine, St.louis, MO (United States)

    2014-06-01

    Purpose: The Mevion S250 proton therapy unit is equipped with a 6D-robotic couch and IGRT system (Verity). The patient alignment process allows corrections in six degrees of freedom: translation (x,y,z), pitch, roll, and yaw (θ,ϑ,ψ). Geometric accuracy of couch corrections and imaging vs. radiation isocenter coincidence were quantified before clinical implementation. Methods: A commercial phantom with sixteen 2mm tungsten BBs was rigidly couch-mounted and imaged with CT. Seventeen rigid translations/rotations of known magnitude were digitally applied to the original CT image using commercial software, validated with Varian OBI system. For each altered image, phantom was mounted on robotic couch in original position, then Verity 2D:2D match (PA-LLAT) was performed using DRRs from altered images. Corrections were recorded and applied, phantom was imaged a second time and residual corrections recorded. Physical measurements verified that applied couch corrections coincided with both physical couch shifts/rotations and known CT image translations/rotations. Additionally, image vs. radiation isocenter coicidence was quantified over couch treatment angles (±90° from setup position) using radiochromic film and an image-guided couch star-shot. Posterior-anterior and left-lateral kV radiographs were taken before each beam was delivered to verify imaging/radiation isocentricity. Results: Verity suggested couch corrections and known CT shifts/rotations agreed within ±1mm (average: Δ lat=0.5mm; Δ vert=0.4mm; Δ long=0.3mm) and ± 0.4° (average: Δ pitch=0.24° Δ roll=0.01°; Δ yaw=0.10°). Physical couch measurements and Verity applied corrections agreed within ± 1mm (average: Δlat=0.5mm; Δvert=0.4mm; Δlong=0.2mm) and ±0.2° (average: Δpitch=0.03°; Δ roll=0.04°; Δ yaw=0.04°). The directionality of all translations and rotations were qualitatively verified. The image vs. radiation isocenter coincidence was <1mm and radiation-isocenter precision was <1mm over the 180° of couch motion, as indicated by film analysis. Conclusion: The Verity IGRT software and 6D-couch combination on the Mevion S250 was verified as accurate within 1mm and 0.5°. This complies with the TG-142 standards for a stereotactic radiotherapy IGRT system. Rob Cessac is employed as Product Manager for Mevion Medical Systems.

  10. Responsabilidade socioambiental corporativa e indicador de maturidade mediando desempenho estratégico para as organizações DOI:10.5007/2175-8077.2010v12n26p244

    Directory of Open Access Journals (Sweden)

    Giovanni de Araujo Gomes

    2010-07-01

    Full Text Available O ambiente de negócios tem apresentado constantes desafios aos dirigentes de empresas. Nesse contexto, a permanente vigilância, reflexo da competitividade e busca de produtividade, faz com as atenções estejam voltadas aos fatores antecedentes e, consequentemente, para a dimensão Responsabilidade Socioambiental Corporativa (RSAC. O trabalho analisa e estima a intensidade das relações entre os fatores valor da marca, reputação da empresa, satisfação dos interessados (stakeholders e riscos de externalidades, como satélites explicativos da RSAC. E, além dos testes de aderência no modelo relacional, propõe e testa uma equação para dimensionar o grau de Maturidade em Responsabilidade Socioambiental Corporativa Setorial (RSAC, procurando analisar e identificar, em que estágio a RSAC afeta os construtos finais enquanto retorno estratégico para as organizações. Esta pesquisa foi realizada no setor da construção civil de Minas Gerais, representado por seus gestores, e os dados coletados por meio de um survey usando um questionário com questões estruturadas com variação likert. Os dados foram avaliados mediante análise de equações estruturais usando o LVPLS. Para a mensuração das ações em Responsabilidade Socioambiental, utilizaram-se os modelos conhecidos nas organizações e academia, tais como o Índice de Sustentabilidade Empresarial, os Dow Jones Indexes, o indicador do Instituto Ethos e a representação teórica de Hopkins (1997.

  11. National Dam Inspection Program. Pinetree Lake Dam NDI ID number PA-00784, DER ID number 45-244. Delaware River Basin, Dry Sawmill Run. Monroe County, Pennsylvania. Phase I Inspection Report.

    Science.gov (United States)

    1980-04-01

    is encased in concrete, continued rusting would nc. be a hazard to the dam. b. Design and Construction Data. The design engineer stated that a formal...DATA: Drainage Sub- Area Cp Ct L L a L’ T2 Map Plate area (square miles miies miles hours Area miles) ( (2) (3) (4) (5) (6) (8) A t- 2.. QO. AlO f 36

  12. A randomised study comparing the effect on ovarian activity of a progestogen-only pill (POP) containing desogestrel and a new POP containing drospirenone in a 24/4 regimen

    DEFF Research Database (Denmark)

    Duijkers, Ingrid J M; Heger-Mahn, Doris; Drouin, Dominique

    2015-01-01

    OBJECTIVES: Progestogen-only pills (POPs) are safer with respect to cardiovascular risks than contraceptives containing estrogens. Despite the increased contraceptive efficacy of a desogestrel-only pill compared with a traditional POP, POPs are still not widely used due to an unpredictable bleeding......, to assess the effects on cervical mucus permeability and bleeding. METHODS: Sixty-four healthy volunteers with proven ovulatory cycles were randomised and treated with either the drospirenone-only or the desogestrel-only pill during two 28-day cycles. Follicular diameter, endometrial thickness, and serum....... The median number of bleeding and spotting days was lower in the drospirenone group. CONCLUSIONS: The new drospirenone-only pill inhibited ovulation as effectively as the desogestrel-only pill despite the 4-day hormone-free interval....

  13. Poly[[diaqua(μ2-4,4′-dipyridyl sulfide-κ2N:N′(4,4′-dipyridyl sulfide-κN(2-hydroxy-5-sulfonatobenzoato-κO1nickel(II] dihydrate

    Directory of Open Access Journals (Sweden)

    Jun-Xia Li

    2008-10-01

    Full Text Available The asymmetric unit of the title helical coordination polymer, {[Ni(C7H4O6S(C10H8N2S2(H2O2]·2H2O}n, is comprised of an NiII ion, one 5-sulfosalicylic acid dianion (HSSA, two 4,4′-dipyridylsulfide (4,4′-dps ligands, and two coordinated and two uncoordinated water molecules. The NiII ion is coordinated by two water molecules, one carboxylate O atom of the HSSA dianion and three N atoms from three 4,4′-dps ligands in a distorted octahedral environment. Half of the 4,4′-dps ligands are μ2-bridging ligands which link adjacent NiII centers, forming a one-dimensional helical structure along the b axis. This helical structure is further stabilized by O—H...O intra- and intermolecular hydrogen bonds.

  14. Report on the behalf of the Economy, Sustainable Development and Land Planning Commission on the bill project related to the follow-up of environmental consequences of French nuclear tests in French Polynesia - Nr 244; Rapport fait au nom de la commission de l'economie, du developpement durable et de l'amenagement du territoire sur la proposition de loi relative au suivi des consequences environnementales des essais nucleaires francais en Polynesie francaise - No. 244

    Energy Technology Data Exchange (ETDEWEB)

    Courteau, Roland

    2012-01-11

    In a first part of this report, the author recalls the history of the creation of the Pacific experiment centre and the test campaign which took place without a real consultation of local populations. He comments the end of nuclear tests while giving an overview of site dismantling and of radioactive materials which have been left there. Then, he addresses the environmental consequences of the nuclear tests in French Polynesia: follow-up system, follow-up of radiological consequences, risks related to subsoil steadiness, necessity of better information of local populations and acknowledgement of test effects. He presents the bill project concerning the return of both atolls within the authority of French Polynesia. The discussion of the bill project articles is reported

  15. 40 CFR Appendix A to Subpart A of... - Switcher Locomotives

    Science.gov (United States)

    2010-07-01

    ... 6-539. S11 6-539. S12 6-539T. S13 6-251C. RSD-1 6-539. RSC-13 6-539. RSC-24 12-244 RS1 6-539T. RS2 1 12-244. RS3 1 12-244. RS10 1 12-244. RSC-2 1 12-244. RS3 1 12-244. RSD-4 1 12-244. RSD-5 1 12-244. T6...

  16. Discovery of isotopes of the transuranium elements with 93≤Z≤98

    Energy Technology Data Exchange (ETDEWEB)

    Fry, C.; Thoennessen, M., E-mail: thoennessen@nscl.msu.edu

    2013-01-15

    One hundred and five isotopes of the transuranium elements neptunium, plutonium, americium, curium, berkelium, and californium have been observed so far; the discovery of these isotopes is described. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  17. Separation of Transplutonium Elements from Neutron Irradiated Americium-241

    National Research Council Canada - National Science Library

    UENO, Kaoru; WATANABE, Kenju; SAGAWA, Chiaki; ISHIMORI, Tomitaro

    1974-01-01

    .... The ratios of the amounts present of these isotopes were determined by mass spectrometry. It was not possible to identify 249Bk in the berkelium fraction owing to the interference from other β-ray emitting nuclides. In the californium fraction, both spontaneous fission and a-activities due to 250, 252 were observed.

  18. Neutron-Activated Gamma-Emission: Technology Review

    Science.gov (United States)

    2012-01-01

    flux sources developed for boron neutron capture therapy ( BNCT ), found to be an experimental success in cancer treatment (26). 30 Improved flux on...achievable Am americium API associated particle imaging B boron Be beryllium BNCT boron neutron capture therapy C carbon Cf californium Cl

  19. Interfacial Electron Transfer Dynamics Following Laser Flash Photolysis of [Ru(bpy)2((4,4'-PO3H2)2bpy)]2+ in TiO2 Nanoparticle Films in Aqueous Environments

    Energy Technology Data Exchange (ETDEWEB)

    Brennaman, Kyle M. [Univ. of North Carolina, Chapel Hill, NC (United States); Patrocinio, Antonio O. T. [Universidade de Sao Paulo (Brazil); Song, Wenjing [Univ. of North Carolina, Chapel Hill, NC (United States); Jurss, Jonah W. [Univ. of North Carolina, Chapel Hill, NC (United States); Concepcion, Javier J. [Univ. of North Carolina, Chapel Hill, NC (United States); Hoertz, Paul G. [RTI International, Research Triangle Park, NC (United States); Traub, Matthew C. [Univ. of North Carolina, Chapel Hill, NC (United States); Murakami Iha, Neyde Y. [Universidade de Sao Paulo (Brazil); Meyer, Thomas J. [Univ. of North Carolina, Chapel Hill, NC (United States)

    2011-02-16

    Nanosecond laser flash photolysis has been used to investigate injection and back electron transfer from the complex [(Ru(bpy)2(4,4'-(PO3H2)2bpy)]2+ surface-bound to TiO2 (TiO2-RuII). The measurements were conducted under conditions appropriate for water oxidation catalysis by known single-site water oxidation catalysts. Systematic variations in average lifetimes for back electron transfer, <τbet>, were observed with changes in pH, surface coverage, incident excitation intensity, and applied bias. The results were qualitatively consistent with a model involving rate-limiting thermal activation of injected electrons from trap sites to the conduction band or shallow trap sites followed by site-to-site hopping and interfacial electron transfer, TiO2(e-)-Ru3+{yields}TiO2-Ru2+. The appearance of pH-dependent decreases in the efficiency of formation of TiO2-Ru3+ and in incident-photon-to-current efficiencies with the added reductive scavenger hydroquinone point to pH-dependent back electron transfer processes on both the sub-nanosecond and millisecond–microsecond time scales, which could be significant in limiting long-term storage of multiple redox equivalents.

  20. catena-Poly[{μ3-4,4′,6,6′-tetrabromo-2,2′-[butane-1,4-diylbis(nitrilomethanylylidene]diphenolato}{μ2-4,4′,6,6′-tetrabromo-2,2′-[butane-1,4-diylbis(nitrilomethanylylidene]diphenolato}dicopper(II

    Directory of Open Access Journals (Sweden)

    Hadi Kargar

    2012-07-01

    Full Text Available The asymmetric unit of the title coordination polymer consists of a dinuclear neutral complex molecule of formula [Cu2(C18H14Br4N2O22]n. One of the CuII ions is coordinated in a distorted square-planar geometry, whereas the other is coordinated in a distorted square-pyramidal geometry, the long apical Cu—O bond [2.885 (4 Å] of the square-pyramidal coordination being provided by a symmetry-related O atom creating a one-dimensional polymer along [010]. π–π stacking interactions [centroid–centroid distance = 3.783 (4 Å] and short interchain Br...Br interactions [3.6142 (12–3.6797 (12 Å] are observed.

  1. Discovery of a novel 5-HT(3) antagonist/5-HT(1A) agonist 3-amino-5,6,7,8-tetrahydro-2-{4-[4-(quinolin-2-yl)piperazin-1-yl]butyl}quinazolin-4(3H)-one (TZB-30878) as an orally bioavailable agent for irritable bowel syndrome.

    Science.gov (United States)

    Asagarasu, Akira; Matsui, Teruaki; Hayashi, Hiroyuki; Tamaoki, Satoru; Yamauchi, Yukinao; Minato, Kouichi; Sato, Michitaka

    2010-11-11

    We have prepared a series of quinazolinone derivatives linked with piperazinylquinoline for the treatment of irritable bowel syndrome (IBS). Using pharmacophore analysis, we designed and synthesized compounds which bind to both serotonin receptor subtype 1A (5-HT(1A)) and subtype 3 (5-HT(3)). Quinazolinone derivatives with a sulfur atom in the linker showed high affinity in in vitro assays, but low in vivo activity. Focusing on the linker to improve the pharmacokinetic profile, the sulfur atom in the linker was replaced with a methylene group. Further optimization led to the discovery of compound 17m (TZB-30878) ( J. Pharmacol. Exp. Ther. 2007 , 322 , 1315 - 1323 , Patent WO2005082887 (A1), 2005 ), a novel 5-HT(1A) agonist/5-HT(3) antagonist in the 3-aminoquinazolinone series. In in vivo functional assays, 17m dose dependently inhibited the Bezold-Jarisch reflex and induced 5-HT(1A)-mediated behaviors, and in an IBS animal model, 17m significantly inhibited stress-induced defecation. Pretreatment by WAY-100635 (5-HT(1A) antagonist) significantly attenuated but did not abolish the inhibitory effects of 17m. These results suggested that 17m exerted inhibitory effects via both 5-HT(1A) agonistic and 5-HT(3) antagonistic activities and that 17m would be useful as a therapeutic agent for IBS.

  2. Solid-State Neutron Multiplicity Counting System Using Commercial Off-the-Shelf Semiconductor Detectors

    Energy Technology Data Exchange (ETDEWEB)

    Rozhdestvenskyy, S. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

    2017-08-09

    This work iterates on the first demonstration of a solid-state neutron multiplicity counting system developed at Lawrence Livermore National Laboratory by using commercial off-the-shelf detectors. The system was demonstrated to determine the mass of a californium-252 neutron source within 20% error requiring only one-hour measurement time with 20 cm2 of active detector area.

  3. Cold valleys in the radioactive decay of 248−254Cf isotopes

    Indian Academy of Sciences (India)

    Geiger–Nuttal plots of log10(T1/2) vs. Q−1/2 for 48−52Ca emitting from various californium isotopes. Acknowledgement. One of the authors (KPS) would like to thank University Grants Commis- sion, Govt. of India for the financial support under project No. MRP(S)-. 352/2005(X Plan)/KLKA 002/UGC-SWRO. References.

  4. Directed evolution of the periodic table: probing the electronic structure of late actinides.

    Science.gov (United States)

    Marsh, M L; Albrecht-Schmitt, T E

    2017-07-25

    Recent investigations of the coordination chemistry and physical properties of berkelium (Z = 97) and californium (Z = 98) have revealed fundamental differences between post-curium elements and lighter members of the actinide series. This review highlights these developments and chronicles key findings and concepts from the last half-century that have helped usher in a new understanding of the evolution of electronic structure in the periodic table.

  5. Open Source: Potential in Latin America for Radiological Weapons

    Science.gov (United States)

    2010-03-01

    terrorist group would need to acquire a radioactive isotope with a relatively short half-life. 36,37 As an aside, the IAEA verified that depleted...cns.miis.edu/npr/pdfs/123salama.pdf (accessed March 3, 2010), Useful RDD isotopes include cobalt-60, strontium-90, yttrium-90, iridium-192, cesium-137...plutonium-238, radium -226, americium-241, and californium-252. 37 Hansell and Salama, “Does intent equal capability?,” 640-641. 38 Internation Atomic

  6. Gclust Server: 78984 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available Sequences Related Sequences(325) 244 PUTATIVE HIGH-AFFINITY BRANCHED-CHAIN AMINO ACID TRANSPORT ATP-BINDING...length 244 Representative annotation PUTATIVE HIGH-AFFINITY BRANCHED-CHAIN AMINO ACID TRANSPORT ATP-BINDING

  7. 76 FR 71926 - Defense Federal Acquisition Regulation Supplement: Applicability of Hexavalent Chromium Policy to...

    Science.gov (United States)

    2011-11-21

    ... policy addressing the serious human health and environmental risks related to the use of hexavalent... prescribed at 223.7306. * * * * * PART 244--SUBCONTRACTING POLICIES AND PROCEDURES 3. Revise section 244.403...

  8. Dicty_cDB: Contig-U10474-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available t = 1e-83 Identities = 244/244 (100%) Strand = Plus / Plus Query: 17 ctttcncatggggatatngnagctaaagntanaaaanatttatccna...|||| Sbjct: 17 ctttcncatggggatatngnagctaaagntanaaaanatttatccnatggnaaaaatnaa 76 Query: 77 aacccacntgcnnaacata...aattattnccccccatcnttagnctatccctaggnccnaaa 136 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| S...bjct: 77 aacccacntgcnnaacataaattattnccccccatcnttagnctatccctaggnccnaaa 136 Query: ...ngnagctaaagntanaaaanatttatccnatggnaaaaatnaa 76 ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||

  9. ORF Alignment: NC_002944 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available AAMPGSRLEIFEGSGHFPFHDDPARFIDVVERFIDS 297 ... VWGTKDVVVPVRHAWMAHAAMPGSRLEIFEGSGHFPFHDDPARFIDVVERFIDS Sbjct: 241 VWGTKDVVVPVRHAWMAHAAMPGSRLEIFEGSGHFPFHDDPARFIDVVERFIDS 294 ...A Sbjct: 121 YQFPHLVERLILVGAGGVTKDVNFVLRWASLPLGSEAIALLRLPLVLPAVQLMGRVLGTA 180 ... Query: 244 VWGTKDVVVPVRHAWMAH

  10. Kinship and Y-chromosome analysis of 7th century human remains: novel DNA extraction and typing procedure for ancient material.

    Science.gov (United States)

    Vanek, Daniel; Saskova, Lenka; Koch, Hubert

    2009-06-01

    To develop novel DNA extraction and typing procedure for DNA identification of the 7th century human remains, determine the familiar relationship between the individuals, estimate the Y-chromosome haplogroup, and compare the Y-chromosome haplotype with the contemporary populations. DNA from preserved femur samples was extracted using the modified silica-based extraction technique. Polymerase chain reaction amplification was performed using human identification kits MiniFiler, Identifiler, and Y-filer and also laboratory-developed and validated Y-chromosome short tandem repeat (STR) pentaplexes with short amplicons. For 244A, 244B, 244C samples, full autosomal DNA profiles (15 STR markers and Amelogenin) and for 244D, 244E, 244F samples, MiniFiler profiles were produced. Y-chromosome haplotypes consisting of up to 24 STR markers were determined and used to predict the Y-chromosome haplogroups and compare the resulting haplotypes with the current population. Samples 244A, 244B, 244C, and 244D belong to Y-chromosome haplogroup R1b and the samples 244E and 244F to haplogroup G2a. Comparison of ancient haplotypes with the current population yielded numerous close matches with genetic distance below 2. Application of forensic genetics in archaeology enables retrieving new types of information and helps in data interpretation. The number of successfully typed autosomal and Y-STR loci from ancient specimens in this study is one of the largest published so far for aged samples.

  11. PROCEEDINGS OF THE SYMPOSIUM COMMEMORATING THE 25th ANNIVERSARY OF ELEMENTS 97 and 98 HELD ON JAN. 20, 1975

    Energy Technology Data Exchange (ETDEWEB)

    Seaborg, Glenn T.; Street Jr., Kenneth; Thompson, Stanley G.; Ghiorso, Albert

    1976-07-01

    This volume includes the talks given on January 20, 1975, at a symposium in Berkeley on the occasion of the celebration of the 25th anniversary of the discovery of berkelium and californium. Talks were given at this symposium by the four people involved in the discovery of these elements and by a number of people who have made significant contributions in the intervening years to the investigation of their nuclear and chemical properties. The papers are being published here, without editing, in the form in which they were submitted by the authors in the months following the anniversary symposium, and they reflect rather faithfully the remarks made on that occasion.

  12. Composition containing transuranic elements for use in the homeopathic treatment of aids

    Energy Technology Data Exchange (ETDEWEB)

    Lustig, D.

    1996-04-18

    A homeopathic remedy consisting of a composition containing one or more transuranic elements, particularly plutonium, for preventing and treating acquired immunodeficiency syndrome (AIDS) in humans, as well as seropositivity for human immunodeficiency virus (HIV). Said composition is characterized in that it uses any chemical or isotopic form of one or more transuranic elements (neptunium, plutonium, americium, curium, berkelium, californium or einsteinium), particularly plutonium, said form being diluted and dynamized according to conventional homeopathic methods, particularly the so-called Hahnemann and Korsakov methods, and provided preferably but not exclusively in the form of lactose and/or saccharose globules or granules impregnated with the active principle of said composition. (author).

  13. Advanced development of the spectrum sciences Model 5005-TF, single-event test fixture

    Energy Technology Data Exchange (ETDEWEB)

    Ackermann, M.R.; Browning, J.S. (Sandia National Labs., Albuquerque, NM (USA)); Hughlock, B.W. (Boeing Aerospace and Electronics Co., Seattle, WA (USA)); Lum, G.K. (Lockheed Missiles and Space Co., Sunnyvale, CA (USA)); Tsacoyeanes, W.C. (Draper (Charles Stark) Lab., Inc., Cambridge, MA (USA)); Weeks, M.D. (Spectrum Sciences, Inc., Santa Clara, CA (USA))

    1990-09-01

    This report summarizes the advanced development of the Spectrum Sciences Model 5005-TF, Single-Event Test Fixture. The Model 5005-TF uses a Californium-252 (Cf-252) fission-fragment source to test integrated circuits and other devices for the effects of single-event phenomena. Particle identification methods commonly used in high-energy physics research and nuclear engineering have been incorporated into the Model 5005-TF for estimating the particle charge, mass, and energy parameters. All single-event phenomena observed in a device under test (DUT) are correlated with an identified fission fragment, and its linear energy transfer (LET) and range in the semiconductor material of the DUT.

  14. TOWARD AN IMPROVED UNDERSTANDING OF STRUCTURE AND MAGNETISM IN NEPTUNIUM AND PLUTONIUM PHOSPHONATES AND SULFONATES

    Energy Technology Data Exchange (ETDEWEB)

    Albrecht-Schmitt, Thomas

    2012-03-01

    This grant supported the exploratory synthesis of new actinide materials with all of the actinides from thorium to californium with the exceptions of protactinium and berkelium. We developed detailed structure-property relationships that allowed for the identification of novel materials with selective ion-exchange, selective oxidation, and long-range magnetic ordering. We found novel bonding motifs and identified periodic trends across the actinide series. We identified structural building units that would lead to desired structural features and novel topologies. We also characterized many different spectroscopic trends across the actinide series. The grant support the preparation of approximately 1200 new compounds all of which were structurally characterized.

  15. Detection of rare earth elements in Powder River Basin sub-bituminous coal ash using laser-induced breakdown spectroscopy (LIBS)

    Energy Technology Data Exchange (ETDEWEB)

    Tran, Phuoc [National Energy Technology Lab. (NETL), Pittsburgh, PA, (United State; Mcintyre, Dustin [National Energy Technology Lab. (NETL), Pittsburgh, PA, (United State

    2015-10-01

    We reported our preliminary results on the use of laser-induced breakdown spectroscopy to analyze the rare earth elements contained in ash samples from Powder River Basin sub-bituminous coal (PRB-coal). We have identified many elements in the lanthanide series (cerium, europium, holmium, lanthanum, lutetium, praseodymium, promethium, samarium, terbium, ytterbium) and some elements in the actinide series (actinium, thorium, uranium, plutonium, berkelium, californium) in the ash samples. In addition, various metals were also seen to present in the ash samples

  16. Dicty_cDB: Contig-U09533-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 000581 |pid:none) Ostreococcus lucimarinus CCE9901... 231 3e-59 AF252391_1( AF252391 |pid:none) Sporothrix s..._1( AF116453 |pid:none) Sporothrix schenckii cyclin-depend... 244 6e-63 AY815214_...ycle 2... 244 4e-63 A42823( A42823 )cell division control-related protein kinase p58cl... 244 4e-63 AF116453

  17. Dicty_cDB: SFG632 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available nuda voucher Rnu elongatio... 244 1e-63 AF240828_1( AF240828 |pid:none) Scolopendra polymorpha elongation ..... AY026074 |pid:none) Monosiga brevicollis elongation fa... 244 1e-63 AY310293_1( AY310293 |pid:none) Scolo...pendra viridis voucher Svi el... 244 1e-63 AY310283_1( AY310283 |pid:none) Rhysida

  18. ORF Alignment: NC_004459 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ... vulnificus CMCP6] ... Length = 244 ... Query: 35 ... WMQFNLMAAIDELPGESSHDYLEMEFGGRSGIFDLYGYVDVFNLTXXXXXX...XXXXXXIFM 94 ... WMQFNLMAAIDELPGESSHDYLEMEFGGRSGIFDLYGYVDVFNLT ... ...IFM Sbjct: 1 ... WMQFNLMAAIDELPGESSHDYLEMEFGGRSGIFDLYGYVDVFNLTSDKGSDKSGKDKIFM 60 ... Query: 155 GSDVMVPWLGKIGLNLY

  19. ORF Alignment: NC_003413 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available TVLIRRECFKKAGLFDPKLPSSQDWDM 183 ... VSQQNERIIGKRLPRFRGNVYGELLKENFIGSPTVLIRRECFKKAGLFDPKLPSSQDWDM Sbjc...t: 121 VSQQNERIIGKRLPRFRGNVYGELLKENFIGSPTVLIRRECFKKAGLFDPKLPSSQDWDM 180 ... Query: 244 GL 245 ... GL Sbjct: 241 GL 242 ...TVSVIIPTHNRAKLLKRAIISVLNQTFEDFEIIVVDDASSDNTPNIIESIKDSRIRYIR 60 ... Query: 124 VSQQNERIIGKRLPRFRGNVYGELLKENFIGSP

  20. Great Lakes Research Review, 1982. Appendices.

    Science.gov (United States)

    1982-11-01

    Process Control and Upgrading of Effluent Filtration Operations 234 C 81-35 WTC Treatment of Blast Furnaces Scrubber Water 235 C 81-36/77 WTC...C.P.N. Removal System 154 C 243 WTC Removal of NH3 -NO3from Industrial Effluents 155 C 244 WTC Biological Nitrification of Industrial Wastes 156 C 244

  1. DBSecSys: A Database of Burkholderia mallei Secretion Systems

    Science.gov (United States)

    2014-07-16

    network edges (gray and green lines). Memišević et al. BMC Bioinformatics 2014, 15:244 Page 7 of 9 http://www.biomedcentral.com/1471-2105/15/244... Rosario Quispe Saji G, Costa MO, Netto DS, Lima NC, Klein CC, Vasconcelos AT, Nicolas MF: AtlasT4SS: A curated database for type IV secretion systems

  2. AcEST: DK962938 [AcEST

    Lifescience Database Archive (English)

    Full Text Available _RUTGR Chalcone synthase 3 OS=Ruta graveolens GN=C... 249 1e-65 sp|Q9ZRR8|CHS1_CASGL Chalcone synthase OS=Ca...mine amara GN=CHS... 244 2e-64 sp|Q9FSB9|CHS1_RUTGR Chalcone synthase 1 OS=Ruta graveolens GN=C... 244 3e-64

  3. The Road to Market Society

    DEFF Research Database (Denmark)

    Christiansen, Christian O.; Cockburn, Patrick Joseph

    2014-01-01

    Book review of Michael J. Sandel, What Money Can't Buy: The Moral Limits of Markets. London: Penguin Group, 2012, 244 pp., $16.46. ISBN 9781846144714 (hbk).......Book review of Michael J. Sandel, What Money Can't Buy: The Moral Limits of Markets. London: Penguin Group, 2012, 244 pp., $16.46. ISBN 9781846144714 (hbk)....

  4. GETDB: 103730 [GETDB

    Lifescience Database Archive (English)

    Full Text Available of leg/antenna discs, - lethal - comment1:A, comment2:44C4-C5 - - - - Show 10373... Also known as - Original Comments comment1:A, comment2:44C4-C5 Disc (Image) - Disc (number) 0 Embryo (Image

  5. 77 FR 39141 - Defense Federal Acquisition Regulation Supplement: Applicability of Hexavalent Chromium Policy to...

    Science.gov (United States)

    2012-06-29

    ... implement in the DFARS the DoD policy addressing the serious human health and environmental risks related to... 223.7306. * * * * * PART 244--SUBCONTRACTING POLICIES AND PROCEDURES 0 3. Revise section 244.403 to... Chromium (MAY 2011), if the subcontract is for supplies, maintenance and repair services, or construction...

  6. Browse Title Index

    African Journals Online (AJOL)

    Items 201 - 244 of 244 ... Vol 16, No 1 (2004), The Recent Severe Acute Respiratory Syndrome (SARS) Epidemic – A Critical Review, Abstract. SO Ike, CJ Chukwuka, ME Ohanu, EN Ofoegbu. Vol 19, No 1 (2007), The Undergraduate Training in Ophthalmology: the University of Nigeria Nsukka Medical Students\\' View, Abstract.

  7. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 23; Issue 2. Issue front cover thumbnail Issue back cover thumbnail ... pp 183-195 General Article. On the Relationship of Mathematics to the Real World · Deepak Dhar ... pp 244-244 Information and Announcements. Physics Training and Talent Search.

  8. Bull. Chem. Soc. Ethiop. 1997, 11(1)

    African Journals Online (AJOL)

    Chem. 1988, 247, 203. Girault, H. 11.1.; Schiffrin, DJ. J. Electroanal. Chem. 1988, 244, 15. Geblewicz, G.; Schiffrin, DJ. J. Electroanal. Chem. 1988, 244, 27. Samec, Z.; Marecek,V.; Weber, 1.; Homolka, D. J. Electroanal. Chem. 1981, 126, 105. Maeda, K.; Kihara. S.; Suzuki, M.; Matsui, M. J. Electroanal. Chem. 1991, 303, 171.

  9. Applications of Text Analysis Tools for Spoken Response Grading

    Science.gov (United States)

    Crossley, Scott; McNamara, Danielle

    2013-01-01

    This study explores the potential for automated indices related to speech delivery, language use, and topic development to model human judgments of TOEFL speaking proficiency in second language (L2) speech samples. For this study, 244 transcribed TOEFL speech samples taken from 244 L2 learners were analyzed using automated indices taken from…

  10. Study of factor XI deficiency in Khuzestan cattle population of Iran ...

    African Journals Online (AJOL)

    Additionally, all cows were confirmed by DNA sequencing to determine existence of mutant FXI allele. Normal cattle have only one DNA fragment of 244 bp while heterozygous cattle exhibited two DNA fragments of 320 and 244 bp for the FXI gene deficiency. The results of this study showed that none of the animals were ...

  11. 10 - 16 Alli PRELIMINARY PHYTOCHEMICAL

    African Journals Online (AJOL)

    DR. AMIN

    W.H.O., 2002). The control of these diseases has pose new challenges because of the emergence .... black congealed mass. 2.08. 05. S. dulcis. Water black solid. 2.44. 06. ,,. Methanol black solid. 5.20. 07. ,,. Hexane black congealed mass. 1.244.

  12. Drug: D01888 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D01888 Drug Safrazine hydrochloride (JAN) C11H16N2O2. HCl 244.0979 244.7179 D01888.gif Antidepressant withdr...awal drug monoamine oxidase (MAO) inhibitor [HSA:4128 4129] [KO:K00274] hsa00260(41

  13. Morphological and physiological characteristics of transgenic cherry tomato mutant with HBsAg gene.

    Science.gov (United States)

    Guan, Z J; Guo, B; Huo, Y L; Hao, H Y; Wei, Y H

    2011-08-01

    HBsAg gene was previously introduced into cherry tomato (Lycopersicum esculentum var. cerasiforme) by Agrobacterium-mediated transformation. To investigate the side effect of HBsAg gene in cherry tomato, we analyzed morphological and physiological characteristics of the transgenic mutant N244. The process was performed under field conditions. The results suggested that the mutant N244 exhibited morphological, cytological and physiological variation. First of all, compared with the wild plants NK, N244 had fleshy and dark green leaves, the fewer notches of leaf edge, more adventitious roots and barren seeds. Moreover, the chromosome of N244 were found to be triploid (n = 36) by flow cytometric analysis. Furthermore, N244 has obvious physiological alterations, as compared to NK. It was speculated that transformation of the genes probably led to ploidy variation, and further caused phenotype and physiological changes of plants. Our study will reveal side effects of the mutants, and promote cultivation of transgenic plants in the field.

  14. A gas secondary electron detector

    CERN Document Server

    Drouart, A; Alamanos, N; Auger, F; Besson, P; Bougamont, E; Bourgeois, P; Lobo, G; Pollacco, E C; Riallot, M

    2002-01-01

    A new Secondary Electron gas Detector (SED) is under development to be used in conjunction with an emissive foil to detect low energy heavy ions as an alternative to micro-channel plates. It could measure position and time of flight. Secondary electrons are accelerated to 10 keV so that they can cross through the 0.9 mu m Mylar entrance window. The electrons then are multiplied in the isobutane gas of the detector at 4-10 Torr. A time resolution of 150 ps and a spatial resolution of 3 mm have been obtained by using californium fission fragments on a prototype detector of 7x7 cm sup 2. The advantage of the SED against MCP is that its size is not limited. Our final goal is to build a large size detector (15x40 cm sup 2) that will operate at the focal plane of the VAMOS magnetic spectrometer at GANIL.

  15. Environmental assessment of the thermal neutron activation explosive detection system for concourse use at US airports

    Energy Technology Data Exchange (ETDEWEB)

    Jones, C.G.

    1990-08-01

    This document is an environmental assessment of a system designed to detect the presence of explosives in checked airline baggage or cargo. The system is meant to be installed at the concourse or lobby ticketing areas of US commercial airports and uses a sealed radioactive source of californium-252 to irradiate baggage items. The major impact of the use of this system arises from direct exposure of the public to scattered or leakage radiation from the source and to induced radioactivity in baggage items. Under normal operation and the most likely accident scenarios, the environmental impacts that would be created by the proposed licensing action would not be significant. 44 refs., 19 figs., 18 tabs.

  16. Chelation and stabilization of berkelium in oxidation state +IV

    Science.gov (United States)

    Deblonde, Gauthier J.-P.; Sturzbecher-Hoehne, Manuel; Rupert, Peter B.; An, Dahlia D.; Illy, Marie-Claire; Ralston, Corie Y.; Brabec, Jiri; de Jong, Wibe A.; Strong, Roland K.; Abergel, Rebecca J.

    2017-09-01

    Berkelium (Bk) has been predicted to be the only transplutonium element able to exhibit both +III and +IV oxidation states in solution, but evidence of a stable oxidized Bk chelate has so far remained elusive. Here we describe the stabilization of the heaviest 4+ ion of the periodic table, under mild aqueous conditions, using a siderophore derivative. The resulting Bk(IV) complex exhibits luminescence via sensitization through an intramolecular antenna effect. This neutral Bk(IV) coordination compound is not sequestered by the protein siderocalin—a mammalian metal transporter—in contrast to the negatively charged species obtained with neighbouring trivalent actinides americium, curium and californium (Cf). The corresponding Cf(III)-ligand-protein ternary adduct was characterized by X-ray diffraction analysis. Combined with theoretical predictions, these data add significant insight to the field of transplutonium chemistry, and may lead to innovative Bk separation and purification processes.

  17. The CARIBU EBIS control and synchronization system

    Science.gov (United States)

    Dickerson, Clayton; Peters, Christopher

    2015-01-01

    The Californium Rare Isotope Breeder Upgrade (CARIBU) Electron Beam Ion Source (EBIS) charge breeder has been built and tested. The bases of the CARIBU EBIS electrical system are four voltage platforms on which both DC and pulsed high voltage outputs are controlled. The high voltage output pulses are created with either a combination of a function generator and a high voltage amplifier, or two high voltage DC power supplies and a high voltage solid state switch. Proper synchronization of the pulsed voltages, fundamental to optimizing the charge breeding performance, is achieved with triggering from a digital delay pulse generator. The control system is based on National Instruments realtime controllers and LabVIEW software implementing Functional Global Variables (FGV) to store and access instrument parameters. Fiber optic converters enable network communication and triggering across the platforms.

  18. Off-line commissioning of EBIS and plans for its integration into ATLAS and CARIBU

    Energy Technology Data Exchange (ETDEWEB)

    Ostroumov, P. N., E-mail: ostroumov@anl.gov; Barcikowski, A.; Dickerson, C. A.; Mustapha, B.; Perry, A.; Sharamentov, S. I.; Vondrasek, R. C.; Zinkann, G. [Argonne National Laboratory, Argonne, Illinois 60439 (United States)

    2016-02-15

    An Electron Beam Ion Source Charge Breeder (EBIS-CB) has been developed at Argonne to breed radioactive beams from the CAlifornium Rare Isotope Breeder Upgrade (CARIBU) facility at Argonne Tandem Linac Accelerator System (ATLAS). The EBIS-CB will replace the existing ECR charge breeder to increase the intensity and significantly improve the purity of reaccelerated radioactive ion beams. The CARIBU EBIS-CB has been successfully commissioned offline with an external singly charged cesium ion source. The performance of the EBIS fully meets the specifications to breed rare isotope beams delivered from CARIBU. The EBIS is being relocated and integrated into ATLAS and CARIBU. A long electrostatic beam transport system including two 180° bends in the vertical plane has been designed. The commissioning of the EBIS and the beam transport system in their permanent location will start at the end of this year.

  19. Populations of selected microbial and fungal species growing on the surface of rape seeds following treatment with desiccants or plant growth regulators.

    Science.gov (United States)

    Frac, Magdalena; Jezierska-Tys, Stefania; Tys, Jerzy

    2010-01-01

    The aim of this study was to determine the effects of desiccants and plant growth regulators on selected microbial species affecting rape seeds, with special emphasis on the growth of fungi and identification of the genus and species composition. The experimental material in the study was seeds of winter rape cv. Californium that were collected from the field during combine harvest. The chemical agents applied, both desiccants and growth regulators, generally decreased the populations of bacteria occurring on the surface of rape seeds. The responses of fungi depended upon the type of agent applied and were manifested as either stimulation or inhibition of the growth of the fungal species. The fungi isolated from the surface of rape seeds were characteristic of those found in the field environment (Cladosporium and Penicillium) and typical for those present on the surface of rape seeds (Alternaria).

  20. Reliability of semiconductor and gas-filled diodes for over-voltage protection exposed to ionizing radiation

    Directory of Open Access Journals (Sweden)

    Stanković Koviljka

    2009-01-01

    Full Text Available The wide-spread use of semiconductor and gas-filled diodes for non-linear over-voltage protection results in a variety of possible working conditions. It is therefore essential to have a thorough insight into their reliability in exploitation environments which imply exposure to ionizing radiation. The aim of this paper is to investigate the influence of irradiation on over-voltage diode characteristics by exposing the diodes to californium-252 combined neutron/gamma radiation field. The irradiation of semiconductor over-voltage diodes causes severe degradation of their protection characteristics. On the other hand, gas-filled over-voltage diodes exhibit a temporal improvement of performance. The results are presented with the accompanying theoretical interpretations of the observed changes in over-voltage diode behaviour, based on the interaction of radiation with materials constituting the diodes.

  1. Triton and alpha-particle contribution from LiF converter for neutron dosimeter

    CERN Document Server

    Camacho, M E; Balcazar, M

    1999-01-01

    A personnel neutron dosimeter prototype based on chemical and electrochemical etched CR-39 detector, combined with LiF converter, has been calibrated using an ICRP-like phantom, under a heavy-water moderated Californium source neutron spectra; A conversion factor of 1.052+-126 spots cm sup - sup 2 mSv sup - sup 1 was obtained. The sealing properties of the detector holder showed a ten-fold reduction in radon background when it was tested in a high radon atmosphere. A convenient mechanical shock resistance was achieved in LiF converters by sintering to 11 tons pressure LiF powder at 650 deg. C, during one hour.

  2. Study of reproducibility of measurements with the spectrometer of Bonner multispheres

    Energy Technology Data Exchange (ETDEWEB)

    Azevedo, G.A.; Pereira, W.W.; Patrao, K.C.S.; Fonseca, E.S., E-mail: geisadeazevedo@gmail.com, E-mail: walsan@ird.gov.br, E-mail: karla@ird.gov.br, E-mail: evaldo@ird.gov.br [Instituto de Radionprotecao e Dosimetria (IRD/CNEN-RJ), Rio de Janeiro, RJ (Brazil)

    2013-07-01

    This work aims to study the metrological behavior of the Bonner Multisphere Spectrometer (BMS) of the LN / LNMRI / IRD - Laboratorio Metrologia de Neutrons / Laboratorio Nacional de Metrologia e Radiacao Ionizante / Instituto de Radioprotecao e Dosimetria, for measurements in repeatability and reproducibility conditions. Initially, a simulation was done by applying the Monte Carlo method, using the MCNP code and respecting the ISO 8529-1 (2001), using the sources of Californium ({sup 252} Cf), Americium-Beryllium ({sup 241} AmBe) and californium in heavy water (Cf + D{sub 2}O), all located at a distance of 100 cm from the neutron detector ({sup 6}Li (Eu) - crystal scintillator). In this program, the counting of neutrons that are captured by the detector was made. The source is located in the center of a sphere of radius 300 cm. Analyzes the impact of these neutrons in a point of the sphere wall, which in this case acted as a neutron detector and from there, it is estimated the number of neutrons that collide in the whole sphere. The purpose is to obtain the neutron count for different energy bands in a solid field of neutrons, since they have a spectrum ranging from a low to a high energy that can also vary within a particular environment. Wishes to obtain new fields with different sources and moderators materials to be used as new reference fields. Measurements are being conducted for these fields, with the aim of analyzing the variability conditions of the measurement (repeatability and reproducibility) in LEN - Laboratorio de Espectrometria de Neutrons of the LN/LMNRI/IRD. Thus, the spectrometer will be used to improve both the knowledge of the spectrum as the standard of neutrons of the lab, proving that a spectrometry is essential for correct measurement.

  3. Involvement of people with dementia in making decisions about their lives: a qualitative study that appraises shared decision-making concerning daycare

    NARCIS (Netherlands)

    Groen-van de Ven, L.M.; Smits, C.; Graaff, F. de; Span, M.; Eefsting, J.; Jukema, J.; Vernooij-Dassen, M.

    2017-01-01

    OBJECTIVE: To explore how people with dementia, their informal caregivers and their professionals participate in decision making about daycare and to develop a typology of participation trajectories. DESIGN: A qualitative study with a prospective, multiperspective design, based on 244 semistructured

  4. Risk Factors for Occupational Knee-Related Disability Among Enlisted Women in the U.S. Army

    National Research Council Canada - National Science Library

    Sulsky, S

    2002-01-01

    ...: A case control study of 692 cases of knee related disability discharge and 2080 incidence density matched controls nested within the population of all 244,000 enlisted women on active duty in the US Army, 1980-97...

  5. Partial genetic characterization of Sedlec virus (Orthobunyavirus, Bunyaviridae)

    Czech Academy of Sciences Publication Activity Database

    Bakonyi, T.; Kolodziejek, J.; Rudolf, Ivo; Berčič, R.; Nowotny, N.; Hubálek, Zdeněk

    2013-01-01

    Roč. 19, October (2013), s. 244-249 ISSN 1567-1348 Institutional support: RVO:68081766 Keywords : Sedlec virus * Leanyer virus * Simbu group * Orthobunyavirus * Acrocephalus Subject RIV: EE - Microbiology, Virology Impact factor: 3.264, year: 2013

  6. Stanislav Markus. Property, Predation, and Protection: Piranha Capitalism in Russia and Ukraine

    Directory of Open Access Journals (Sweden)

    Paul Babie

    2016-09-01

    Full Text Available Stanislav Markus. Property, Predation, and Protection: Piranha Capitalism in Russia and Ukraine. Cambridge: Cambridge UP, 2015. xii, 244 pp. Illustrations. Tables. Bibliography. Index. $95.00, cloth.

  7. When Contact Is Not Enough: Affecting First Year Medical Students’ Image towards Older Persons

    National Research Council Canada - National Science Library

    Kusumastuti, Sasmita; van Fenema, Esther; Polman-van Stratum, Eugenie C. F; Achterberg, Wilco; Lindenberg, Jolanda; Westendorp, Rudi G. J

    2017-01-01

    ...) and the Attitudes toward Old People (AOP; 34 positions) questionnaires. Participants Before and after a care internship involving interpersonal contact, 252 and 244 first-year medical students at the Leiden University Medical Centre (LUMC...

  8. Pseudorca crassidens (Owen), ein Beitrag zur vergleichenden Anatomie der Cetaceen

    NARCIS (Netherlands)

    Slijper, E.J.

    1939-01-01

    INHALTSÜ BERSICHT Abschnitt 1 Einleitung; Material .... 243 I Strandung .... 243 II Material .... 244 Abschnitt 2 Nomenklatur; Geographische Verbreitung; Lebensweise .... 245 I Nomenklatur .... 245 II Geographische Verbreitung .... 246 III Lebensweise .... 249 Abschnitt 3 Äussere Form; Wachstum ....

  9. Material Resources Availability, Parent Subject Perception and ...

    African Journals Online (AJOL)

    Prof

    2348136196731; +2348051303915. E-mail: dryemioyekanmi@gmail.com ... perception and students' students' achievement (r=.244); and positive significant .... consider career for their children based on the job prospect and how the course is ranked.

  10. Academic dishonesty and attitudes towards academic dishonest acts: support for cognitive dissonance theory.

    Science.gov (United States)

    Storch, Eric A; Storch, Jason B

    2003-02-01

    The present study examined the relation between self-reported academic dishonesty and attitudes towards dishonest academic behaviors in 244 college students. Analysis suggested that self-reported academic dishonesty and approval of academic dishonest behaviors were positively correlated.

  11. Increasing the Oral Bioavailability of Poorly Water-soluble Valsartan Using Non-ordered Mesoporous Silica Microparticles

    National Research Council Canada - National Science Library

    P Bahirat Santosh

    2016-01-01

      Aim: To evaluate the use of mesoporous silica SYLOID® 244 FP to increase the dissolution rate of valsartan, antihypertensive poorly water soluble, Biopharmaceutical Classification System Class II drug...

  12. Komisjoni kiuste avaldas Holland valimistulemuse / Arko Olesk

    Index Scriptorium Estoniae

    Olesk, Arko, 1981-

    2004-01-01

    Euroopa Komisjoni keelule ja karistusähvardusele vaatamata avaldasid Hollandi võimud europarlamendi valimiste tulemused, mille kohaselt said valitsevad kristlikud demokraadid 24,4 protsenti ja opositsioonilised sotsiaaldemokraadid 23,6 protsenti häältest

  13. Dissent on Core Beliefs: Religious and Secular Perspectives ...

    African Journals Online (AJOL)

    Abstract. Dissent on Core Beliefs: Religious and Secular Perspectives By Simone Chambers and Peter Nosco (Editors) Cambridge: Cambridge University Press 2015, 244 pages. ISBN 978-1-107-10152-4. Reviewer: Jaco Beyers, University of Pretoria ...

  14. Crystallization kinetics of amorphous Tex(Bi2Se3)1–x glasses

    Indian Academy of Sciences (India)

    Unknown

    . Department of Applied Sciences and Humanities, Moradabad Institute of Technology, Moradabad 244 001, India. MS received 25 May 2004; revised 2 September 2004. Abstract. The activation energy plays a dominant role in deciding the ...

  15. Potential of cassava flour as a gelling agent in media for plant tissue ...

    African Journals Online (AJOL)

    Administrator

    African Journal of Biotechnology Vol. 3 (4), pp. 244-247, April ... has important applications in plant biotechnology. The technology is ... include micropropagation, virus elimination, plant ... marine algae such as Gelidiella and Gracilaria species.

  16. 77 FR 29450 - Actions on Special Permit Applications

    Science.gov (United States)

    2012-05-17

    ...). commerce human and Inc. d/b/a animal tissue Pacific samples in non- Scientific specification Transport... 172; Subpart special permit to Goods, a E; 173.118; authorize an Division of 173.244; additional mode...

  17. Actinide transmutation in nuclear reactors

    Energy Technology Data Exchange (ETDEWEB)

    Ganev, I.K.; Lopatkin, A.V.; Naumov, V.V.; Tocheny, L.V.

    1993-12-31

    Of some interest is the comparison between the actinide nuclide burning up (fission) rates such as americium 241, americium 242, curium 244, and neptunium 237, in the reactors with fast or thermal neutron spectra.

  18. ORF Alignment: NC_005877 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ... torridus DSM 9790] sp|Q6L0V5|COBQ_PICTO Probable cobyric ... acid synthase ... Length = 187 ... Query: 244 IGIVRYPYME...NYSDFDPLIFNEKAFYIKNKEDLKRCDVIILPGSKDVFHDLEYINSNGIA 303 ... IGIVRYPYME...NYSDFDPLIFNEKAFYIKNKEDLKRCDVIILPGSKDVFHDLEYINSNGIA Sbjct: 1 ... IGIVRYPYMENYSDFDPLIFNEKAFYIK

  19. 77 FR 6573 - Announcement of Funding Awards; Fair Housing Initiatives Program Fiscal Year 2011

    Science.gov (United States)

    2012-02-08

    ... 60430. Fair Housing Center of Metropolitan Detroit, Clifford Schrupp, 313-963-1274....... 5 299,525.00... Borelli, 559-244-2950........ 9 259,034.00 333 W. Shaw Avenue, Suite 14, Fresno, CA 93704. Greater Napa...

  20. Protein (Cyanobacteria): 517207156 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 27:244 ... 7-cyano-7-deazaguanine reductase filamentous cyanobacterium ESFC-1 MNSMSSETEVAQTPEVKYGERAIADCELITF... WP_018395974.1 NZ_KB904821 1117:4682 ... 1150:39727 1301283:59529 44887:1731 ... 11284

  1. [Review of the necropsy studies by the U.S. Fish and Wildlife Service on animals from the Rocky Mountain Arsenal : 1993

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — USFWS personnel recorded 244 instances of wildlife mortality at the Rocky Mountain Arsenal (RMA). Since 1990, records of these animal mortalities were kept in the...

  2. Moderna mimo centra

    Czech Academy of Sciences Publication Activity Database

    Hnídková, Vendula

    2017-01-01

    Roč. 96, č. 4 (2017), s. 242-244 ISSN 0042-4544 Institutional support: RVO:68378033 Keywords : modern architecture * Josep Lluis Sert * Fondation Maeght Subject RIV: AL - Art, Architecture , Cultural Heritage

  3. Chatterjee, Prof. Mitali

    Indian Academy of Sciences (India)

    Jadavpur), FNASc, FRCP (London). Date of birth: 2 November 1960. Specialization: Pharmacology, Immunology, Parasitology Address: Department of Pharmacology, Institute of PG Medical Education & Research, 244-B, Acharya JC Bose Road, ...

  4. Precision Relative Positioning for Automated Aerial Refueling from a Stereo Imaging System

    Science.gov (United States)

    2015-03-01

    employ stereo vision systems to enhance the capability for refueling manned aircraft. This research examines the use of stereo vision for precision...4 2.1 Stereo Vision ...25 2.4.4 Stereo Vision . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 25 III

  5. Investigating Traffic Avoidance Maneuver Preferences of Unmanned Aircraft Operators

    Science.gov (United States)

    2016-06-13

    Safe 1 Specialist, Lincoln Laboratory, 244 Wood Street; mariakuffner@ll.mit.edu. 2...Subcontractor, Lincoln Laboratory, 244 Wood Street, Lexington, MA, 02420; randal.guendel@ll.mit.edu, Senior Member AIAA. 3 Associate, Human Factors, 1900...Preventive Alert • 75-second look-ahead time • 35-second modified tau • 1-nm HMD/DMOD, 700-ft vertical separation Tone 3 Corrective Alert • 75-second

  6. Research

    African Journals Online (AJOL)

    ebutamanya

    27 avr. 2016 ... Deux cas de résistance à la rifampicine ont été détectées. Conclusion: Le geneXpert a été d'un grand apport pour le diagnostic de la tuberculose pulmonaire et extrapulmonaire mais la bacilloscopie reste incontournable. Pan African Medical Journal. 2016; 23:244 doi:10.11604/pamj.2016.23.244.7442.

  7. EST Table: FS918452 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available FS918452 E_FL_fufe_44G17_F_0 10/09/28 46 %/244 aa ref|XP_975194.1| PREDICTED: similar to something.../253 aa gnl|Amel|GB19080-PA 10/09/10 46 %/244 aa gi|91081571|ref|XP_975194.1| PREDICTED: similar to something about silencing protein 10 [Tribolium castaneum] FS937283 fufe ...

  8. GAO Strategic Plan 2007-2012

    Science.gov (United States)

    2007-01-01

    Financial Services Industry and Its Regulators to Maintain a Stable and Efficient Financial System in the Face of...United States can influence improvements in the world financial system; 2.4.4 assess the ability of the financial services industry and its...activities    GAO Strategic Plan 2007-2012 GAO-07-1SP118 Performance Goal 2.4.4 Assess the Ability of the Financial Services Industry and

  9. Activation of non-canonical Wnt/JNK pathway by Wnt3a is associated with differentiation fate determination of human bone marrow stromal (mesenchymal) stem cells

    DEFF Research Database (Denmark)

    Qiu, Weimin; Chen, Li; Kassem, Moustapha

    2011-01-01

    patterns induced by Wnt3a treatment in two hMSC lines: hMSC-LRP5(T253) and hMSC-LRP5(T244) cells carrying known mutations of Wnt co-receptor LRP5 (T253I or T244M) that either enhances or represses canonical Wnt signaling, respectively. Wnt3a treatment of hMSC activated not only canonical Wnt signaling...

  10. Drug: D07261 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D07261 Drug Pidotimod (INN); Pilimod (TN) C9H12N2O4S 244.0518 244.2676 D07261.gif I...PLASTIC AND IMMUNOMODULATING AGENTS L03 IMMUNOSTIMULANTS L03A IMMUNOSTIMULANTS L03AX Other immunostimulants L03AX05 Pidotimod... D07261 Pidotimod (INN) CAS: 121808-62-6 PubChem: 51091599 Ligan

  11. Page 1 468 VJ Modi, J L C Sun, L S Shupe and A S Solyomyari way ...

    Indian Academy of Sciences (India)

    Turbulent flow tests were conducted in a boundary layer tunnel (1.58 x 2.44 × 24.4 m) with 20.74 m roughness boards in- stalled in the test-section upstream of the model to produce desired boundary layer thickness and turbulence intensity as shown in figure 9. The average wind velocity. Was measured by a hot-wire ...

  12. Dietary Supplements and Young Teens: Misinformation and Access Provided by Retailers.

    Science.gov (United States)

    Herriman, Maguire; Fletcher, Laura; Tchaconas, Alexis; Adesman, Andrew; Milanaik, Ruth

    2017-02-01

    Despite the American Academy of Pediatrics' recommendations against pediatric use of creatine and testosterone boosters, research suggests that many young teenagers take these dietary supplements. Our objective was to determine to what extent health food stores would recommend and/or sell creatine and testosterone boosters to a 15-year-old boy customer. Research personnel posing as 15-year-old high school athletes seeking to increase muscle strength contacted 244 health food stores in the United States via telephone. Researchers asked the sales attendant what supplements he/she would recommend. If a sales attendant did not mention creatine or testosterone boosters initially, each of these supplements was then specifically asked about. Supplement recommendations were recorded. Sales attendants were also asked if a 15-year-old could purchase these products on his own in the store. A total of 67.2% (164/244) of sales attendants recommended creatine: 38.5% (94/244) recommended creatine without prompting, and an additional 28.7% (70/244) recommended creatine after being asked specifically about it. A total of 9.8% (24/244) of sales attendants recommended a testosterone booster. Regarding availability for sale, 74.2% (181/244) of sales attendants stated a 15-year-old was allowed to purchase creatine, whereas 41.4% (101/244) stated one could purchase a testosterone booster. Health food store employees frequently recommend creatine and testosterone boosters for boy high school athletes. In response to these findings, pediatricians should inform their teenage patients, especially athletes, about safe, healthy methods to improve athletic performance and discourage them from using creatine or testosterone boosters. Retailers and state legislatures should also consider banning the sale of these products to minors. Copyright © 2017 by the American Academy of Pediatrics.

  13. N-glycosylation-negative catalase: a useful tool for exploring the role of hydrogen peroxide in the endoplasmic reticulum.

    Science.gov (United States)

    Lortz, S; Lenzen, S; Mehmeti, I

    2015-03-01

    Disulfide bond formation during protein folding of nascent proteins is associated with the generation of H2O2 in the endoplasmic reticulum (ER). Approaches to quantifying H2O2 directly within the ER failed because of the oxidative environment in the ER lumen, and ER-specific catalase expression to detoxify high H2O2 concentrations resulted in an inactive protein owing to N-glycosylation. Therefore, the N-glycosylation motifs at asparagine-244 and -439 of the human catalase protein were deleted by site-directed mutagenesis. The ER-targeted expression of these variants revealed that the deletion of the N-glycosylation motif only at asparagine-244 (N244) was associated with the maintenance of full enzymatic activity in the ER. Expression of catalase N244 in the ER (ER-Catalase N244) was ER-specific and protected the cells significantly against exogenously added H2O2. With the expression of ER-Catalase N244, a highly effective H2O2 inactivation within the ER was achieved for the first time. Catalase has a high H2O2-inactivation capacity without the need of reducing cofactors, which might interfere with the ER redox homeostasis, and is not involved in protein folding. With these characteristics ER-Catalase N244 is an ideal tool to explore the impact of ER-generated H2O2 on the generation of disulfide bonds or to study the induction of ER-stress pathways through protein folding overload and accumulation of H2O2. Copyright © 2014 Elsevier Inc. All rights reserved.

  14. Enhancement of epoxide hydrolase production by (60) Co gamma and UV irradiation mutagenesis of Aspergillus niger ZJB-09103.

    Science.gov (United States)

    Jin, Huo-Xi; OuYang, Xiao-Kun; Hu, Zhong-Ce

    2017-05-01

    An effective epoxide hydrolase (EH) production strain was mutagenized using (60) Co gamma and UV irradiation. Among positive mutant strains, the EH activity of C2-44 reached 33.7 U/g, which was 267% as much as that of the original Aspergillus niger ZJB-09103. Compared with the wild type, there were significant changes in morphology for C2-44, including the color of mycelia on the slants and the shape of conidial head. In addition, glucose and soybean cake were the optimal carbon and nitrogen source in terms of EH activity for the mutant C2-44 instead of soluble starch and peptone for the wild-type strain. The reaction time required to reach 99% enantiomeric excesses of (S)-epichlorohydrin from racemic substrate was shortened significantly by the mutant C2-44. This phenomenon was probably explained by the higher Vmax for hydrolysis of racemic epichlorohydrin by C2-44 compared with Aspergillus niger ZJB-09103. © 2016 International Union of Biochemistry and Molecular Biology, Inc.

  15. Role of miR-100 in the radioresistance of colorectal cancer cells

    Science.gov (United States)

    Yang, Xiao-Dong; Xu, Xiao-Hui; Zhang, Shu-Yu; Wu, Yong; Xing, Chun-Gen; Ru, Gan; Xu, Hong-Tao; Cao, Jian-Ping

    2015-01-01

    The prognosis of radioresistant colorectal cancer (CRC) is generally poor. Abnormal expression of microRNAs (miRNAs) is involved in the radiosensitivity of various tumor cells as these RNAs regulate biological signaling pathways. However, radioresistance-associated miRNAs in CRC have not yet been identified. In this study, we filtered out HCT116 and CCL-244 from seven CRC cell lines that showed the highest difference in radiosensitivity in a clonogenic assay. MiRNA sequencing identified 33 differentially expressed miRNAs (13 up-regulated and 20 down-regulated) in CCL-244 and 37 in HCT116 (20 up-regulated and 17 down-regulated) cells. MiR-100 was significantly down-regulated in CCL-244 cells after X-ray irradiation but not in HCT116 cells. Quantitative real-time PCR showed that the expression of miR-100 in CRC tissues was significantly lower than that in normal tissues. Thus, miR-100 seems to be involved in the radioresistance of CCL-244 cells. MiR-100 up-regulation sensitized CCL-244 cells to X-ray irradiation, which probably led to apoptosis and DNA double-strand breaks in these. In conclusion, to our knowledge, this is the first study to show that miR-100 may play an important role in regulating the radiosensitivity of CRC, and it may act as a new clinical target for CRC radiotherapy. PMID:25973296

  16. The biokinetics and radiotoxicology of curium: a comparison with americium.

    Science.gov (United States)

    Ménétrier, F; Taylor, D M; Comte, A

    2008-05-01

    The human and animal data on the biokinetics of (242)Cm and (244)Cm are reviewed and shown to be very similar to those for (241)Am. Liver and skeleton are the main organs of deposition and the retention of curium in the skeleton is very prolonged in all the species examined. Retention of both curium and americium in the liver appears to be species-dependent, being relatively rapidly removed from the liver of rats, and probably humans, but being tenaciously retained in dogs and some other species. The radiotoxicity of curium is also reviewed and it is shown that, as with (241)Am, lung and bone tumour induction are the major hazards from inhaled and systemically deposited (244)Cm. The use of chelating agents for the treatment of accidental contamination of the human body with (242,244)Cm is also discussed.

  17. Using the voids. Evidence for an antenna effect in dye-sensitized mesoporous TiO2 thin films.

    Science.gov (United States)

    Hoertz, Paul G; Goldstein, Anna; Donley, Carrie; Meyer, Thomas J

    2010-11-18

    Composite structures of Ru(bpy)(2)(4,4'-(PO(3)H(2))(2)bpy)(2+) surface bound to nanocrystalline TiO(2) with an overlayer of Ru(bpy)(3)(2+) ion exchanged into Nafion, FTO|nanoTiO(2)-[Ru(bpy)(2)(4,4'-(PO(3)H(2))(2)bpy)](2+)/Nafion,Ru(bpy)(3)(2+) (FTO = fluorine-doped tin oxide), have been prepared and characterized. Steady-state emission and time-resolved lifetime measurements demonstrate that energy transfer occurs from Nafion,Ru(bpy)(3)(2+*) to adsorbed Ru(bpy)(2)(4,4'-(PO(3)H(2))(2)bpy)(2+) with an efficiency of ∼0.49. Energy transfer sensitizes photoinjection by the adsorbed metal-to-ligand charge transfer (MLCT) excited state by an "antenna effect."

  18. Golden Eagle mortality at a utility-scale wind energy facility near Palm Springs, California

    Science.gov (United States)

    Lovich, Jeffrey E.

    2015-01-01

    Golden Eagle (Aquila chrysaetos) mortality associated with wind energy turbines and infrastructure is under-reported and weakly substantiated in the published literature. I report two cases of mortality at a utility-scale renewable energy facility near Palm Springs, California. The facility has been in operation since 1984 and included 460 65KW turbines mounted on 24.4 m or 42.7 m lattice-style towers with 8 m rotor diameters. One mortality event involved a juvenile eagle that was struck and killed by a spinning turbine blade on 31 August, 1995. The tower was 24.4 m high. The other involved an immature female that was struck by a spinning blade on another 24.4 m tower on 17 April, 1997 and was later euthanized due to the extent of internal injuries. Other raptor mortalities incidentally observed at the site, and likely attributable to turbines, included three Red-tailed Hawks (Buteo jamaicensis) found near turbines.

  19. Combined influence of teichoic acids from Staphylococcus aureus and heterometallik Cu/Cd ethylenediamine complex on peritoneal macrophages and tumor cells.

    Science.gov (United States)

    Nikulina, V V; Garmanchuk, L V; Senchylo, N V; Nikolaenko, T V; Dzhus, O I; Ostapchenko, L I; Khranovska, N M

    2014-01-01

    We investigated the effects of teichoic acid (TA) from Staphylococcus aureus Wood 46 on tumor growth and metastasis of the experimental Lewis lung carcinoma (LLC) in mice. Intranasal administration of TA alone aggravated both tumor growth and metastasis, whereas combined administration of TA with a synthetic bimetallic (copper : cadmium) ethylene diamine complex PO244 resulted in pronounced antitumor and antimetastatic effects. The group of animals subjected to the combined treatment with TA and PO244 manifested the highest degree of lymphocyte infiltration into the tumor tissue, compared to the control group and those exposed to TA or PO244 alone. Moreover, the combined treatment negatively affected the adhesive properties of peritoneal macrophages in the LLC bearing mice. Co-cultivation of the isolated macrophages with primary LLC cultures revealed significant (p < 0.05) cytotoxic and cytostatic effects, detected as an increased level of apoptosis and a reduced fraction of replicating cells.

  20. Cloned defective interfering influenza virus protects ferrets from pandemic 2009 influenza A virus and allows protective immunity to be established.

    Directory of Open Access Journals (Sweden)

    Nigel J Dimmock

    Full Text Available Influenza A viruses are a major cause of morbidity and mortality in the human population, causing epidemics in the winter, and occasional worldwide pandemics. In addition there are periodic outbreaks in domestic poultry, horses, pigs, dogs, and cats. Infections of domestic birds can be fatal for the birds and their human contacts. Control in man operates through vaccines and antivirals, but both have their limitations. In the search for an alternative treatment we have focussed on defective interfering (DI influenza A virus. Such a DI virus is superficially indistinguishable from a normal virus but has a large deletion in one of the eight RNAs that make up the viral genome. Antiviral activity resides in the deleted RNA. We have cloned one such highly active DI RNA derived from segment 1 (244 DI virus and shown earlier that intranasal administration protects mice from lethal disease caused by a number of different influenza A viruses. A more cogent model of human influenza is the ferret. Here we found that intranasal treatment with a single dose of 2 or 0.2 µg 244 RNA delivered as A/PR/8/34 virus particles protected ferrets from disease caused by pandemic virus A/California/04/09 (A/Cal; H1N1. Specifically, 244 DI virus significantly reduced fever, weight loss, respiratory symptoms, and infectious load. 244 DI RNA, the active principle, was amplified in nasal washes following infection with A/Cal, consistent with its amelioration of clinical disease. Animals that were treated with 244 DI RNA cleared infectious and DI viruses without delay. Despite the attenuation of infection and disease by DI virus, ferrets formed high levels of A/Cal-specific serum haemagglutination-inhibiting antibodies and were solidly immune to rechallenge with A/Cal. Together with earlier data from mouse studies, we conclude that 244 DI virus is a highly effective antiviral with activity potentially against all influenza A subtypes.

  1. Erwinia teleogrylli sp. nov., a Bacterial Isolate Associated with a Chinese Cricket.

    Directory of Open Access Journals (Sweden)

    Bo Liu

    Full Text Available A bacterial isolate (SCU-B244T was obtained in China from crickets (Teleogryllus occipitalis living in cropland deserted for approximately 10 years. The isolated bacteria were Gram-negative, facultatively anaerobic, oxidase-negative rods. A preliminary analysis of the 16S rRNA gene sequence indicated that the strain belongs to either the genus Erwinia or Pantoea. Analysis of multilocus sequence typing based on concatenated partial atpD, gyrB and infB gene sequences and physiological and biochemical characteristics indicated that the strain belonged to the genus Erwinia, as member of a new species as it was distinct from other known Erwinia species. Further analysis of the 16S rRNA gene showed SCU-B244T to have 94.71% identity to the closest species of that genus, Erwinia oleae (DSM 23398T, which is below the threshold of 97% used to discriminate bacterial species. DNA-DNA hybridization results (5.78±2.52% between SCU-B244T and Erwinia oleae (DSM 23398T confirmed that SCU-B244T and Erwinia oleae (DSM 23398T represent different species combined with average nucleotide identity values which range from 72.42% to 74.41. The DNA G+C content of SCU-B244T was 55.32 mol%, which also differs from that of Erwinia oleae (54.7 to 54.9 mol%. The polyphasic taxonomic approach used here confirmed that the strain belongs to the Erwinia group and represents a novel species. The name Erwinia teleogrylli sp. nov. is proposed for this novel taxon, for which the type strain is SCU-B244T (= CGMCC 1.12772T = DSM 28222T = KCTC 42022T.

  2. New data on transuranium elements in the ecosystem of the Yenisei river floodplain

    Energy Technology Data Exchange (ETDEWEB)

    Bolsunovsky, A. [Russian Academy of Sciences, Siberian Branch, Krasnoyarsk (Russian Federation). Inst. of Biophysics; Ermakov, A.; Sobolev, A. [SIA ' RADON' , Moscow (Russian Federation)

    2007-07-01

    The aim of the study is to investigate levels of transuranium elements in the ecosystem of the Yenisei river floodplain in the vicinity of the Mining-and-Chemical Combine of Rosatom. For the first time, the transuranium isotopes {sup 243,244}Cm have been detected in sediment, floodplain soil, and a berry shrub (Ribes nigrum - the blackcurrant) in the floodplain of the Yenisei river. The highest level of curium isotopes registered in the sediment of the Yenisei river is 21.4Bq/kg (dry), which is more than twice higher than maximum curium levels reported for soils sampled not far from the Chernobyl Nuclear Plant. Blackcurrant plants growing on radioactively contaminated soils contain the same transuranium elements as the soil (plutonium isotopes, americium, and curium). The highest activity concentrations of all transuranic elements have been found in ashed roots of the blackcurrant plants: {sup 239,240}Pu - 9.3Bq/kg, {sup 241}Am - 6.9Bq/kg, and {sup 243,244}Cm - 1.8Bq/kg. The highest soil-plant transfer factor (TF) for {sup 243,244}Cm is determined for roots - 0.073; the TF of {sup 243,244}Cm in berries is 0.027. The TF for {sup 239,240}Pu in berries is 0.006, which is several times lower than the TF for {sup 243,244}Cm. Analysis of our results and the literature data suggests that TFs for {sup 243,244}Cm are higher than those for {sup 239,240}Pu and {sup 241}Am. (orig.)

  3. Occupational Survey Report Airborne Communications and Electronics Systems AFSC 1A3X1

    Science.gov (United States)

    2002-08-01

    Mrs. Karen Tilghman provided computer-programming support, and Ms. Dolores Navarro provided administrative support. Major Jose Caussade, Chief, Airman...40 2.41 MEDICAL/ DENTAL CARE FOR AD MEMBER 53 2.44 58 2.56 49 2.44 MEDICAL/ DENTAL CARE FOR FAMILY MEMBERS 32 2.18 46 2.63 42 2.49 BASE HOUSING 9 2.00...RETIREMENT BENEFITS PAY AND ALLOWANCES JOB SECURITY JOB SECURITY MEDICAL/ DENTAL CARE FOR AD MEMBER PAY AND ALLOWANCES MILITARY LIFESTYLE JOB SECURITY

  4. Qualitative Event-Based Fault Isolation under Uncertain Observations

    Science.gov (United States)

    2014-10-02

    TB) ISH236 ESH244A IT240 (iB) E240 ( vB ) E242 CB236 EY244 EY260 CB 2 8 0 E Y 2 8 1 IT281 (idc) E281 (vdc) CB262 E265 (vrms) CB266 IT267 (irms) E Y...in transient operating regions. IEEE Transactions on Systems, Man, and Cybernetics, Part A: Systems and Humans , 29(6), 554-565. Narasimhan, S...with the Intelligent Systems Group at the University of Val- ladolid, Spain. He has been visiting re- searcher at the Institute for Software Integrated

  5. Comparison of fission and capture cross sections of minor actinides

    CERN Document Server

    Nakagawa, T

    2003-01-01

    The fission and capture cross sections of minor actinides given in JENDL-3.3 are compared with other evaluated data and experimental data. The comparison was made for 32 nuclides of Th-227, 228, 229, 230, 233, 234, Pa-231, 232, 233, U-232, 234, 236, 237, Np-236, 237, 238, Pu-236, 237, 238, 242, 244, Am-241, 242, 242m, 243, Cm-242, 243, 244, 245, 246, 247 and 248. Given in the present report are figures of these cross sections and tables of cross sections at 0.0253 eV and resonance integrals.

  6. The National Shipbuilding Research Program. Development of Non-Polluting, Solvent-Free, Liquid Resin Coating Systems For Ships

    Science.gov (United States)

    1974-01-01

    for urethane coatings. Mobay suggested incorporation of Zeolith L Paste, which acts as a moisture scavenger. The paste contains 50 parts synthetic... zeolithe (molecular sieves to absorb moisture) dispersed in 50 parts castor oil. Levels of addition were studied which would be just sufficient to...Midtranol 4012 Molywhite 101 Iron Oxide B-5095 Cab-O-5il M-5 Zeolith L Paste 33LV Accelerator T-12 Accelerator lb 32.6 24.4 24.4 0.5 6.5 0.2 0.1

  7. Compensated bismuth-loaded plastic scintillators for neutron detection using low-energy pseudo-spectroscopy

    Energy Technology Data Exchange (ETDEWEB)

    Dumazert, Jonathan, E-mail: jonathan.dumazert@cea.fr [CEA, LIST, Laboratoire Capteurs Architectures Electroniques, 91191 Gif-sur-Yvette (France); Coulon, Romain; Bertrand, Guillaume H.V.; Normand, Stéphane [CEA, LIST, Laboratoire Capteurs Architectures Electroniques, 91191 Gif-sur-Yvette (France); Méchin, Laurence [CNRS, UCBN, Groupe de Recherche en Informatique, Image, Automatique et Instrumentation de Caen, 14050 Caen (France); Hamel, Matthieu [CEA, LIST, Laboratoire Capteurs Architectures Electroniques, 91191 Gif-sur-Yvette (France)

    2016-05-21

    Gadolinium-covered modified plastic scintillators show a high potential for the deployment of cost-effective neutron detectors. Taking advantage of the low-energy photon and electron signature of thermal neutron captures in gadolinium-155 and gadolinium-157 however requires a background correction. In order to display a trustable rate, dual compensation schemes appear as an alternative to Pulse Shape Discrimination. This paper presents the application of such a compensation scheme to a two-bismuth loaded plastic scintillator system. A detection scintillator interacts with incident photon and fast neutron radiations and is covered with a gadolinium converter to become thermal neutron-sensitive as well. In the meantime, an identical compensation scintillator, covered with terbium, solely interacts with the photon and fast neutron part of incident radiations. After the acquisition and the treatment of the counting signals from both sensors, a hypothesis test determines whether the resulting count rate after subtraction falls into statistical fluctuations or provides a robust image of neutron activity. A laboratory prototype is tested under both photon and neutron radiations, allowing us to investigate the performance of the overall compensation system. The study reveals satisfactory results in terms of robustness to a cesium-137 background and in terms of sensitivity in presence of a californium-252 source.

  8. Systematic studies of the fundamental chemistry of pyrochlore oxides. An{sub 2}Zr{sub 2}O{sub 7} [An=Pu, Am, Cm, Bk and Cf

    Energy Technology Data Exchange (ETDEWEB)

    Haire, R.G.; Assefa, Z. [Oak Ridge National Laboratory, Oak Ridge, TN (United States); Raison, P.E. [Commissariat a l' Energie Atomique, CEA-Cadarache DRN/DEC/SPUA/LACA (France)

    2002-11-01

    Our efforts to pursue the fundamental science of actinide pyrochlore oxides, An{sub 2}Zr{sub 2}O{sub 7}, (An=plutonium through californium), are presented. We have addressed their structural and chemical behavior via X-ray diffraction, Raman spectroscopy and by considering the pseudo-oxidation potentials of the actinides. The structure, fundamental chemistry, ionic radii and the electronic configuration of the specific actinide involved in these oxide systems all have a significant impact on their science. We are also exploring a calculational approach based on valence-bond relationships to assess the position of the oxygen atoms located at the general crystallographic position. The oxygen position is important regarding the chemical behavior and thermal stability of these materials. Also considered is the structural stability of the materials regarding self-irradiation, and with some compounds, their resistance towards oxidation. These aspects will be discussed using a systematic evaluation of the five-actinide systems together with comparable lanthanide systems studied. (author)

  9. 1982 US-CEC neutron personnel dosimetry intercomparison study

    Energy Technology Data Exchange (ETDEWEB)

    Swaja, R.E.; Sims, C.S.; Greene, R.T.; Schraube, H.; Burger, G.

    1983-11-01

    A neutron personnel dosimetry intercomparison study was conducted during April 19-23, 1982, as a joint effort between the United States and the Commission of European Communities. Dosimeters from 48 participating agencies were mounted on cylindrical phantoms and exposed to a range of low-level dose equivalents (0.48-13.91 mSv neutron and 0.02-1.32 mSv gamma) in nine different radiation fields. Exposure conditions considered in this study included four mixed-field spectra produced using the Health Physics Research Reactor, four monoenergetic neutron fields generated by accelerators, and one 15-cm D/sub 2/O-moderated californium source spectrum. In general, neutron results reported by the participating agencies were consistent with expected dosimeter performance based on energy response characteristics of the detection systems. Albedo dosimeters, which were the most popular neutron monitoring systems used in this study, provided the best overall accuracy for all exposure conditions. Film, Cr-39 recoil track, and Th-232 fission track systems generally underestimated dose equivalents relative to reference values. Associated gamma measurements showed that TLD monitors produced more accurate results than film dosimeters although both systems overestimated gamma dose equivalents in mixed radiation fields. 24 references, 10 figures, 19 tables.

  10. Application of the backward extrapolation method to pulsed neutron sources

    Energy Technology Data Exchange (ETDEWEB)

    Talamo, Alberto; Gohar, Yousry

    2018-01-01

    Particle detectors operated in pulse mode are subjected to the dead-time effect. When the average of the detector counts is constant over time, correcting for the dead-time effect is simple and can be accomplished by analytical formulas. However, when the average of the detector counts changes over time it is more difficult to take into account the dead-time effect. When a subcritical nuclear assembly is driven by a pulsed neutron source, simple analytical formulas cannot be applied to the measured detector counts to correct for the dead-time effect because of the sharp change of the detector counts over time. This work addresses this issue by using the backward extrapolation method. The latter can be applied not only to a continuous (e.g. californium) external neutron source but also to a pulsed external neutron source (e.g. by a particle accelerator) driving a subcritical nuclear assembly. The backward extrapolation method allows to obtain from the measured detector counts both the dead-time value and the real detector counts.

  11. The cross sections of fusion-evaporation reactions: the most promising route to superheavy elements beyond Z=118

    Science.gov (United States)

    Jadambaa, Khuyagbaatar

    2017-11-01

    The synthesis of superheavy elements beyond oganesson (Og), which has atomic number Z = 118, is currently one of the main topics in nuclear physics. An absence of sufficient amounts of target material with atomic numbers heavier than californium (Z = 98) forces the use of projectiles heavier than 48Ca (Z = 20), which has been successfully used for the discoveries of elements with Z = 114 - 118 in complete fusion reactions. Experimental cross sections of 48Ca with actinide targets behave very differently to "cold" and "hot" fusion-evaporation reactions, where doubly-magic lead and deformed actinides are used as targets, respectively. The known cross sections of these reactions have been analysed compared to calculated fission barriers. It has been suggested that observed discrepancies between the cross sections of 48Ca-induced and other fusionevaporation reactions originate from the shell structure of the compound nucleus, which lies in the island of the stability. Besides scarcely known data on other reactions involving heavier projectiles, the most promising projectile for the synthesis of the elements beyond Og seems to be 50Ti. However, detailed studies of 50Ti, 54Cr, 58Fe and 64Ni-induced reactions are necessary to be performed in order to fully understand the complexities of superheavy element formation.

  12. Report to the DOE nuclear data committee. [EV RANGE 10-100; CROSS SECTIONS; PHOTONEUTRONS; NEUTRONS; GAMMA RADIATION; COUPLED CHANNEL THEORY; DIFFERENTIAL CROSS SECTIONS; MEV RANGE 01-10; ; CAPTURE; GAMMA SPECTRA; THERMAL NEUTRONS; COMPUTER CALCULATIONS; DECAY; FISSION PRODUCTS; FISSION YIELD; SHELL MODELS; NUCLEAR DATA COLLECTIONS

    Energy Technology Data Exchange (ETDEWEB)

    Struble, G.L.; Haight, R.C.

    1981-03-01

    Topics covered include: studies of (n, charged particle) reactions with 14 to 15 MeV neutrons; photoneutron cross sections for /sup 15/N; neutron radiative capture; Lane-model analysis of (p,p) and (n,n) scattering on the even tin isotopes; neutron scattering cross sections for /sup 181/Ta, /sup 197/Au, /sup 209/Bi, /sup 232/Th, and /sup 238/U inferred from proton scattering and charge exchange cross sections; neutron-induced fission cross sections of /sup 245/Cm and /sup 242/Am; fission neutron multiplicities for /sup 245/Cm and /sup 242/Am; the transport of 14 MeV neutrons through heavy materials 150 < A < 208; /sup 249/Cm energy levels from measurement of thermal neutron capture gamma rays; /sup 231/Th energy levels from neutron capture gamma ray and conversion electron spectroscopy; new measurements of conversion electron binding energies in berkelium and californium; nuclear level densities; relative importance of statistical vs. valence neutron capture in the mass-90 region; determination of properties of short-lived fission products; fission yield of /sup 87/Br and /sup 137/I from 15 nuclei ranging from /sup 232/Th to /sup 249/Cf; evaluation of charged particle data for the ECPL library; evaluation of secondary charged-particle energy and angular distributions for ENDL; and evaluated nuclear structure libraries derived from the table of isotopes. (GHT)

  13. Activation analysis of ITER blanket first wall

    Energy Technology Data Exchange (ETDEWEB)

    Lopatkin, A.; Muratov, V. [RDIPE (NIKIET), Moscow (Russian Federation)

    1998-09-01

    To analyze the activation of ITER blanket structural components, the authors have prepared the AUCDAS code that calculates changes in nuclide concentrations and radioactivity characteristics during neutron irradiation and during cooling. UCDAS takes into account all neutron reactions and decay types, the prepared library of constants contains nuclear data of nuclides from hydrogen to californium. A comparative analysis of the results as obtained using UCDAS code and the widely known FISPACT code is given. The analysis of decay heat, gas generation and activity of ITER blanket first wall`s structural components was carried out. The beryllium coating, copper alloy and stainless steel were analysed. Calculations were performed for the first plasma burning pulse, 6 months and 1 year of operation in accordance with the ITER scenario. The materials recommended by ITER central team and their Russian analogs were considered: TGR and B1 (beryllium coating), GlidCop AL-25 Ds and Br-MKX (copper alloy), 316LN-IG and 12Cr18Ni10Ti (stainless steel). It has been demonstrated that there is a difference in all of the considered characteristics between the above materials. It is caused by impurities which are present in the materials. The report also considers the accumulation of gases (H, D, T, He{sup 3}, He{sup 4}) in the above materials. Besides, the change in the activity of irradiated materials during the cooling of up to 10{sup 7} years was calculated. (orig.) 7 refs.

  14. Toward achieving flexible and high sensitivity hexagonal boron nitride neutron detectors

    Science.gov (United States)

    Maity, A.; Grenadier, S. J.; Li, J.; Lin, J. Y.; Jiang, H. X.

    2017-07-01

    Hexagonal boron nitride (h-BN) detectors have demonstrated the highest thermal neutron detection efficiency to date among solid-state neutron detectors at about 51%. We report here the realization of h-BN neutron detectors possessing one order of magnitude enhancement in the detection area but maintaining an equal level of detection efficiency of previous achievement. These 3 mm × 3 mm detectors were fabricated from 50 μm thick freestanding and flexible 10B enriched h-BN (h-10BN) films, grown by metal organic chemical vapor deposition followed by mechanical separation from sapphire substrates. Mobility-lifetime results suggested that holes are the majority carriers in unintentionally doped h-BN. The detectors were tested under thermal neutron irradiation from californium-252 (252Cf) moderated by a high density polyethylene moderator. A thermal neutron detection efficiency of ˜53% was achieved at a bias voltage of 200 V. Conforming to traditional solid-state detectors, the realization of h-BN epilayers with enhanced electrical transport properties is the key to enable scaling up the device sizes. More specifically, the present results revealed that achieving an electrical resistivity of greater than 1014 Ωṡcm and a leakage current density of below 3 × 10-10 A/cm2 is needed to fabricate large area h-BN detectors and provided guidance for achieving high sensitivity solid state neutron detectors based on h-BN.

  15. Design of the low energy beam transport line between CARIBU and the EBIS charge breeder

    Energy Technology Data Exchange (ETDEWEB)

    Perry, A., E-mail: aperry4@hawk.iit.edu [Argonne National Laboratory, Argonne, IL 60439, USA and Illinois Institute of Technology, Chicago, IL 60616 (United States); Ostroumov, P. N.; Barcikowski, A.; Dickerson, C.; Kondrashev, S. A.; Mustapha, B.; Savard, G. [Argonne National Laboratory, Argonne, IL 60439 (United States)

    2015-01-09

    An Electron Beam Ion Source Charge Breeder (EBIS-CB) has been developed to breed radioactive beams from the CAlifornium Rare Isotope Breeder Upgrade (CARIBU) facility at ATLAS. The EBIS-CB will replace the existing ECR charge breeder to increase the intensity and improve the purity of reaccelerated radioactive ion beams. The EBIS-CB is in the final stage of off-line commissioning. Currently, we are developing a low energy beam transport (LEBT) system to transfer CARIBU beams to the EBIS-CB. As was originally planned, an RFQ cooler-buncher will precede the EBIS-CB. Recently, it was decided to include a multi-reflection time-of-flight (MR-TOF) mass-spectrometer following the RFQ. MR-TOF is a relatively new technology used to purify beams with a mass-resolving power up to 3×10{sup 5} as was demonstrated in experiments at CERN/ISOLDE. Very high purity singly-charged radioactive ion beams will be injected into the EBIS for charge breeding and due to its inherent properties, the EBIS-CB will maintain the purity of the charge bred beams. Possible contamination of residual gas ions will be greatly suppressed by achieving ultra-high vacuum in the EBIS trap. This paper will present and discuss the design of the LEBT and the overall integration of the EBIS-CB into ATLAS.

  16. Analysis of patents on mining technology

    Energy Technology Data Exchange (ETDEWEB)

    Menyailo, N.I.; Grishchenko, A.N.; Ratner, M.V.; Kobylyanskii, A.Ya.; Tyshlek, E.G.

    1987-09-01

    Analyses the current work being carried out with the aim of developing and perfecting coal mining technology with regard to improving safety and working conditions (equipment is currently responsible for 6.3% of all hazards in coal mines) by examining patents of class ES 21 S produced in the USSR, USA, UK, FRG, Japan and France between 1970-1984. By far the majority of patents is concerned with improving technology and productivity and a disappointing number deals with safety matters (only 7.2% of the patents for new cutter loader designs deal with dust suppression systems and most of these come from the FRG; no patents for powered mining complexes deal with the problem of noise and vibration reduction). The patents with the most direct relevance to health and safety concern remote control devices for mining equipment, in particular, devices based on radioactive isotopes (e.g. cesium-137, americum-241, selenium-75, californium-252) but measures for monitoring them and protecting against them are not found.

  17. MinT: Middleware for Cooperative Interaction of Things

    Directory of Open Access Journals (Sweden)

    Soobin Jeon

    2017-06-01

    Full Text Available This paper proposes an Internet of Things (IoT middleware called Middleware for Cooperative Interaction of Things (MinT. MinT supports a fully distributed IoT environment in which IoT devices directly connect to peripheral devices easily construct a local or global network, and share their data in an energy efficient manner. MinT provides a sensor abstract layer, a system layer and an interaction layer. These enable integrated sensing device operations, efficient resource management, and active interconnection between peripheral IoT devices. In addition, MinT provides a high-level API to develop IoT devices easily for IoT device developers. We aim to enhance the energy efficiency and performance of IoT devices through the performance improvements offered by MinT resource management and request processing. The experimental results show that the average request rate increased by 25% compared to Californium, which is a middleware for efficient interaction in IoT environments with powerful performance, an average response time decrease of 90% when resource management was used, and power consumption decreased by up to 68%. Finally, the proposed platform can reduce the latency and power consumption of IoT devices.

  18. MinT: Middleware for Cooperative Interaction of Things

    Science.gov (United States)

    Jeon, Soobin; Jung, Inbum

    2017-01-01

    This paper proposes an Internet of Things (IoT) middleware called Middleware for Cooperative Interaction of Things (MinT). MinT supports a fully distributed IoT environment in which IoT devices directly connect to peripheral devices easily construct a local or global network, and share their data in an energy efficient manner. MinT provides a sensor abstract layer, a system layer and an interaction layer. These enable integrated sensing device operations, efficient resource management, and active interconnection between peripheral IoT devices. In addition, MinT provides a high-level API to develop IoT devices easily for IoT device developers. We aim to enhance the energy efficiency and performance of IoT devices through the performance improvements offered by MinT resource management and request processing. The experimental results show that the average request rate increased by 25% compared to Californium, which is a middleware for efficient interaction in IoT environments with powerful performance, an average response time decrease of 90% when resource management was used, and power consumption decreased by up to 68%. Finally, the proposed platform can reduce the latency and power consumption of IoT devices. PMID:28632182

  19. An Account of Oak Ridge National Laboratory's Thirteen Research Reactors

    Energy Technology Data Exchange (ETDEWEB)

    Rosenthal, Murray Wilford [ORNL

    2009-08-01

    The Oak Ridge National Laboratory has built and operated 13 nuclear reactors in its 66-year history. The first was the graphite reactor, the world's first operational nuclear reactor, which served as a plutonium production pilot plant during World War II. It was followed by two aqueous-homogeneous reactors and two red-hot molten-salt reactors that were parts of power-reactor development programs and by eight others designed for research and radioisotope production. One of the eight was an all-metal fast burst reactor used for health physics studies. All of the others were light-water cooled and moderated, including the famous swimming-pool reactor that was copied dozens of times around the world. Two of the reactors were hoisted 200 feet into the air to study the shielding needs of proposed nuclear-powered aircraft. The final reactor, and the only one still operating today, is the High Flux Isotope Reactor (HFIR) that was built particularly for the production of californium and other heavy elements. With the world's highest flux and recent upgrades that include the addition of a cold neutron source, the 44-year-old HFIR continues to be a valuable tool for research and isotope production, attracting some 500 scientific visitors and guests to Oak Ridge each year. This report describes all of the reactors and their histories.

  20. Neutron Detector Signal Processing to Calculate the Effective Neutron Multiplication Factor of Subcritical Assemblies

    Energy Technology Data Exchange (ETDEWEB)

    Talamo, Alberto [Argonne National Lab. (ANL), Argonne, IL (United States). Nuclear Engineering Division; Gohar, Yousry [Argonne National Lab. (ANL), Argonne, IL (United States). Nuclear Engineering Division

    2016-06-01

    This report describes different methodologies to calculate the effective neutron multiplication factor of subcritical assemblies by processing the neutron detector signals using MATLAB scripts. The subcritical assembly can be driven either by a spontaneous fission neutron source (e.g. californium) or by a neutron source generated from the interactions of accelerated particles with target materials. In the latter case, when the particle accelerator operates in a pulsed mode, the signals are typically stored into two files. One file contains the time when neutron reactions occur and the other contains the times when the neutron pulses start. In both files, the time is given by an integer representing the number of time bins since the start of the counting. These signal files are used to construct the neutron count distribution from a single neutron pulse. The built-in functions of MATLAB are used to calculate the effective neutron multiplication factor through the application of the prompt decay fitting or the area method to the neutron count distribution. If the subcritical assembly is driven by a spontaneous fission neutron source, then the effective multiplication factor can be evaluated either using the prompt neutron decay constant obtained from Rossi or Feynman distributions or the Modified Source Multiplication (MSM) method.

  1. Fast neutron tomography with real-time pulse-shape discrimination in organic scintillation detectors

    Energy Technology Data Exchange (ETDEWEB)

    Joyce, Malcolm J., E-mail: m.joyce@lancaster.ac.uk [Department of Engineering, Lancaster University, Lancaster, Lancashire LA1 4YW (United Kingdom); Agar, Stewart [Department of Engineering, Lancaster University, Lancaster, Lancashire LA1 4YW (United Kingdom); Aspinall, Michael D. [Hybrid Instruments Ltd., Gordon Manley Building, Lancaster Environment Centre, Lancaster University, Lancaster LA1 4YW (United Kingdom); Beaumont, Jonathan S.; Colley, Edmund; Colling, Miriam; Dykes, Joseph; Kardasopoulos, Phoevos; Mitton, Katie [Department of Engineering, Lancaster University, Lancaster, Lancashire LA1 4YW (United Kingdom)

    2016-10-21

    A fast neutron tomography system based on the use of real-time pulse-shape discrimination in 7 organic liquid scintillation detectors is described. The system has been tested with a californium-252 source of dose rate 163 μSv/h at 1 m and neutron emission rate of 1.5×10{sup 7} per second into 4π and a maximum acquisition time of 2 h, to characterize two 100×100×100 mm{sup 3} concrete samples. The first of these was a solid sample and the second has a vertical, cylindrical void. The experimental data, supported by simulations with both Monte Carlo methods and MATLAB®, indicate that the presence of the internal cylindrical void, corners and inhomogeneities in the samples can be discerned. The potential for fast neutron assay of this type with the capability to probe hydrogenous features in large low-Z samples is discussed. Neutron tomography of bulk porous samples is achieved that combines effective penetration not possible with thermal neutrons in the absence of beam hardening.

  2. Report on the workshop "Decay spectroscopy at CARIBU: advanced fuel cycle applications, nuclear structure and astrophysics". 14-16 April 2011, Argonne National Laboratory, USA.

    Energy Technology Data Exchange (ETDEWEB)

    Kondev, F.; Carpenter, M.P.; Chowdhury, P.; Clark, J.A.; Lister, C.J.; Nichols, A.L.; Swewryniak, D. (Nuclear Engineering Division); (Univ. of Massachusetts); (Univ. of Surrey)

    2011-10-06

    A workshop on 'Decay Spectroscopy at CARIBU: Advanced Fuel Cycle Applications, Nuclear Structure and Astrophysics' will be held at Argonne National Laboratory on April 14-16, 2011. The aim of the workshop is to discuss opportunities for decay studies at the Californium Rare Isotope Breeder Upgrade (CARIBU) of the ATLAS facility with emphasis on advanced fuel cycle (AFC) applications, nuclear structure and astrophysics research. The workshop will consist of review and contributed talks. Presentations by members of the local groups, outlining the status of relevant in-house projects and availabile equipment, will also be organized. time will also be set aside to discuss and develop working collaborations for future decay studies at CARIBU. Topics of interest include: (1) Decay data of relevance to AFC applications with emphasis on reactor decay heat; (2) Discrete high-resolution gamma-ray spectroscopy following radioactive decya and related topics; (3) Calorimetric studies of neutron-rich fission framgents using Total ABsorption Gamma-Ray Spectrometry (TAGS) technique; (4) Beta-delayed neutron emissions and related topics; and (5) Decay data needs for nuclear astrophysics.

  3. The cross sections of fusion-evaporation reactions: the most promising route to superheavy elements beyond Z=118

    Directory of Open Access Journals (Sweden)

    Jadambaa Khuyagbaatar

    2017-01-01

    Full Text Available The synthesis of superheavy elements beyond oganesson (Og, which has atomic number Z = 118, is currently one of the main topics in nuclear physics. An absence of sufficient amounts of target material with atomic numbers heavier than californium (Z = 98 forces the use of projectiles heavier than 48Ca (Z = 20, which has been successfully used for the discoveries of elements with Z = 114 - 118 in complete fusion reactions. Experimental cross sections of 48Ca with actinide targets behave very differently to “cold” and “hot” fusion-evaporation reactions, where doubly-magic lead and deformed actinides are used as targets, respectively. The known cross sections of these reactions have been analysed compared to calculated fission barriers. It has been suggested that observed discrepancies between the cross sections of 48Ca-induced and other fusionevaporation reactions originate from the shell structure of the compound nucleus, which lies in the island of the stability. Besides scarcely known data on other reactions involving heavier projectiles, the most promising projectile for the synthesis of the elements beyond Og seems to be 50Ti. However, detailed studies of 50Ti, 54Cr, 58Fe and 64Ni-induced reactions are necessary to be performed in order to fully understand the complexities of superheavy element formation.

  4. Intracavitary moderator balloon combined with (252)Cf brachytherapy and boron neutron capture therapy, improving dosimetry in brain tumour and infiltrations.

    Science.gov (United States)

    Brandão, S F; Campos, T P R

    2015-07-01

    This article proposes a combination of californium-252 ((252)Cf) brachytherapy, boron neutron capture therapy (BNCT) and an intracavitary moderator balloon catheter applied to brain tumour and infiltrations. Dosimetric evaluations were performed on three protocol set-ups: (252)Cf brachytherapy combined with BNCT (Cf-BNCT); Cf-BNCT with a balloon catheter filled with light water (LWB) and the same set-up with heavy water (HWB). Cf-BNCT-HWB has presented dosimetric advantages to Cf-BNCT-LWB and Cf-BNCT in infiltrations at 2.0-5.0 cm from the balloon surface. However, Cf-BNCT-LWB has shown superior dosimetry up to 2.0 cm from the balloon surface. Cf-BNCT-HWB and Cf-BNCT-LWB protocols provide a selective dose distribution for brain tumour and infiltrations, mainly further from the (252)Cf source, sparing the normal brain tissue. Malignant brain tumours grow rapidly and often spread to adjacent brain tissues, leading to death. Improvements in brain radiation protocols have been continuously achieved; however, brain tumour recurrence is observed in most cases. Cf-BNCT-LWB and Cf-BNCT-HWB represent new modalities for selectively combating brain tumour infiltrations and metastasis.

  5. Intracavitary moderator balloon combined with 252Cf brachytherapy and boron neutron capture therapy, improving dosimetry in brain tumour and infiltrations

    Science.gov (United States)

    Brandão, S F

    2015-01-01

    Objective: This article proposes a combination of californium-252 (252Cf) brachytherapy, boron neutron capture therapy (BNCT) and an intracavitary moderator balloon catheter applied to brain tumour and infiltrations. Methods: Dosimetric evaluations were performed on three protocol set-ups: 252Cf brachytherapy combined with BNCT (Cf-BNCT); Cf-BNCT with a balloon catheter filled with light water (LWB) and the same set-up with heavy water (HWB). Results: Cf-BNCT-HWB has presented dosimetric advantages to Cf-BNCT-LWB and Cf-BNCT in infiltrations at 2.0–5.0 cm from the balloon surface. However, Cf-BNCT-LWB has shown superior dosimetry up to 2.0 cm from the balloon surface. Conclusion: Cf-BNCT-HWB and Cf-BNCT-LWB protocols provide a selective dose distribution for brain tumour and infiltrations, mainly further from the 252Cf source, sparing the normal brain tissue. Advances in knowledge: Malignant brain tumours grow rapidly and often spread to adjacent brain tissues, leading to death. Improvements in brain radiation protocols have been continuously achieved; however, brain tumour recurrence is observed in most cases. Cf-BNCT-LWB and Cf-BNCT-HWB represent new modalities for selectively combating brain tumour infiltrations and metastasis. PMID:25927876

  6. Investigation of Workplace-like Calibration Fields via a Deuterium-Tritium (D-T) Neutron Generator.

    Science.gov (United States)

    Mozhayev, Andrey V; Piper, Roman K; Rathbone, Bruce A; McDonald, Joseph C

    2017-04-01

    Radiation survey meters and personal dosimeters are typically calibrated in reference neutron fields based on conventional radionuclide sources, such as americium-beryllium (Am-Be) or californium-252 (Cf), either unmodified or heavy-water moderated. However, these calibration neutron fields differ significantly from the workplace fields in which most of these survey meters and dosimeters are being used. Although some detectors are designed to yield an approximately dose-equivalent response over a particular neutron energy range, the response of other detectors is highly dependent upon neutron energy. This, in turn, can result in significant over- or underestimation of the intensity of neutron radiation and/or personal dose equivalent determined in the work environment. The use of simulated workplace neutron calibration fields that more closely match those present at the workplace could improve the accuracy of worker, and workplace, neutron dose assessment. This work provides an overview of the neutron fields found around nuclear power reactors and interim spent fuel storage installations based on available data. The feasibility of producing workplace-like calibration fields in an existing calibration facility has been investigated via Monte Carlo simulations. Several moderating assembly configurations, paired with a neutron generator using the deuterium tritium (D-T) fusion reaction, were explored.

  7. Production of medical radioisotopes in the ORNL High Flux Isotope Reactor (HFIR) for cancer treatment and arterial restenosis therapy after PTCA

    Energy Technology Data Exchange (ETDEWEB)

    Knapp, F.F. Jr.; Beets, A.L.; Mirzadeh, S.; Alexander, C.W.; Hobbs, R.L.

    1998-06-01

    The High Flux Isotope Reactor (HFIR) at the Oak Ridge National Laboratory (ORNL) represents an important resource for the production of a wide variety of medical radioisotopes. In addition to serving as a key production site for californium-252 and other transuranic elements, important examples of therapeutic radioisotopes which are currently routinely produced in the HFIR for distribution include dysprosium-166 (parent of holmium-166), rhenium-186, tin-117m and tungsten-188 (parent of rhenium-188). The nine hydraulic tube (HT) positions in the central high flux region permit the insertion and removal of targets at any time during the operating cycle and have traditionally represented a major site for production of medical radioisotopes. To increase the irradiation capabilities of the HFIR, special target holders have recently been designed and fabricated which will be installed in the six Peripheral Target Positions (PTP), which are also located in the high flux region. These positions are only accessible during reactor refueling and will be used for long-term irradiations, such as required for the production of tin-117m and tungsten-188. Each of the PTP tubes will be capable of housing a maximum of eight HT targets, thus increasing the total maximum number of HT targets from the current nine, to a total of 57. In this paper the therapeutic use of reactor-produced radioisotopes for bone pain palliation and vascular brachytherapy and the therapeutic medical radioisotope production capabilities of the ORNL HFIR are briefly discussed.

  8. Domain-General and Domain-Specific Creative-Thinking Tests: Effects of Gender and Item Content on Test Performance

    Science.gov (United States)

    Hong, Eunsook; Peng, Yun; O'Neil, Harold F., Jr.; Wu, Junbin

    2013-01-01

    The study examined the effects of gender and item content of domain-general and domain-specific creative-thinking tests on four subscale scores of creative-thinking (fluency, flexibility, originality, and elaboration). Chinese tenth-grade students (234 males and 244 females) participated in the study. Domain-general creative thinking was measured…

  9. 'n Begronde bedieningsmodel vir die diakonia van die gemeente

    African Journals Online (AJOL)

    15 Feb 2012 ... 'n model (Pastoral Family Model) (2008:235–237). Hy gee ook belangrike aspekte van die toepassing van die model weer (2008:244–247), maar .... geleenthede is gereël waar lidmate die sinodebesluite kon bespreek, asook die rigting waarin die kerkraad dink met die oog op 'n nuwe bedieningsmodel.

  10. Download this PDF file

    African Journals Online (AJOL)

    EGOLUM

    2011-12-22

    244-50. 20. Hussain AM and Khan FA. Anesthetic reasons for cancellation of elective surgical in patients on the day of surgery in a teaching hospital. Journal Pakistan Medical. Association 2005; 55:374-8. 21. Paschoal ML and ...

  11. Drug: D03888 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D03888 Drug Domiodol (USAN) C5H9IO3 243.9596 244.0276 D03888.gif Mucolytic ATC code...ND COLD PREPARATIONS R05C EXPECTORANTS, EXCL. COMBINATIONS WITH COUGH SUPPRESSANTS R05CB Mucolytics R05CB08 Domiodol D03888 Domiodo

  12. 309-IJBCS-Article-Dr S A Montcho

    African Journals Online (AJOL)

    Dr Gatsing

    water season and in favour of the length (b<3, negative allometric growth) during the high water season. .... from 0.43 to 2.44 (average: 1.136±0.490). The figures 5 and 6 illustrate its variation by size classes and synchronisation with the river water level. The highest means of K are ..... Cascading effects of introduced.

  13. Domain Modeling: NP_006016.1 [SAHG[Archive

    Lifescience Database Archive (English)

    Full Text Available NP_006016.1 chr12 THE STRUCTURE OF XENDOU: A SPLICING INDEPENDENT SNORNA PROCESSING... ENDORIBONUCLEASE c2c1wc_ chr12/NP_006016.1/NP_006016.1_holo_99-366.pdb blast 244H,250V,354G,361A,362T PO4 0 ...

  14. File list: Oth.ALL.50.BACH2.AllCell [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Oth.ALL.50.BACH2.AllCell hg19 TFs and others BACH2 All cell types SRX1048454,SRX244...190,SRX1048477 http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/Oth.ALL.50.BACH2.AllCell.bed ...

  15. File list: Oth.ALL.20.BACH2.AllCell [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Oth.ALL.20.BACH2.AllCell hg19 TFs and others BACH2 All cell types SRX1048454,SRX244...190,SRX1048477 http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/assembled/Oth.ALL.20.BACH2.AllCell.bed ...

  16. A new bioactive ursane-type triterpenoid from Croton ...

    Indian Academy of Sciences (India)

    2.1 General experimental procedure. Melting points were determined by open capillary method and were uncorrected. ... reaction mixture was then poured into 50mL of ice cold water, worked up with ether, dried over anhydrous ... powder of melting point (mp) 244–246. ◦. C, [α]D +4.0,. UV inactive, showed strong absorption ...

  17. Hierarchy of Needs; Building a Path to Peace

    Science.gov (United States)

    2010-03-01

    observations of man’s cruelty and viciousness during multiple, devastating wars, yet still focuses on the healthy individual. Self interest, whether it is...8,27,31,35-36. 26 Ibid., 35-36, 191. 27 Ibid., 39-40. 23 28 Ibid., 244-245. 29Robert Wright, The Moral Animal ; The New Science of Evolutionary

  18. Microstructure-Based Computational Modeling of Mechanical Behavior of Polymer Micro/Nano Composites

    Science.gov (United States)

    2013-12-01

    damage. This phenomenon can be attributed to the fact that, the straight CNTs are similar to rebars in reinforced concrete . But here, the polymer...2002. Influence of the fibre -matrix interface on the behaviour of polypropylene reinforced by short glass fibres above glass transition...244  8.2 Computational Methods for Assessing CNT- Reinforced Composites

  19. The Drift toward Problem Behavior during the Transition to Adolescence: The Contributions of Youth Disclosure, Parenting, and Older Siblings

    Science.gov (United States)

    Low, Sabina; Snyder, James; Shortt, Joann Wu

    2012-01-01

    Prospective associations of mothers' parenting processes, youth disclosure, and youth problem behavior were examined in a longitudinal design following 244 adolescent sibling dyads over a 3-year period. For both siblings, authoritative parenting was positively associated with youth disclosure and was negatively related to problem behavior, and…

  20. Teachers of Poor Communities: The Tale of Instructional Media Use in Primary Schools of "Gedeo" Zone, Southern Ethiopia

    Science.gov (United States)

    Abdo, Mehadi; Semela, Tesfaye

    2010-01-01

    The purpose of this study was to investigate the impact of working conditions at school on teachers' level of instructional media use in the primary school system of Gedeo Zone, southern Ethiopia. The survey was made on a sample of 139 (24.4% female and male 75.6%) teachers who were randomly drawn from 9 primary schools (four rural and five urban…

  1. Public Key Infrastructure Increment 2 (PKI Inc 2)

    Science.gov (United States)

    2016-03-01

    2016 Major Automated Information System Annual Report Public Key Infrastructure Increment 2 (PKI Inc 2) Defense Acquisition Management...6615 DSN Phone: 244-4900 DSN Fax: Date Assigned: July 1, 2015 Program Information Program Name Public Key Infrastructure Increment 2 (PKI Inc 2... Public Key Infrastructure (PKI) is a critical enabling technology for Information Assurance (IA) services to support seamless secure information flows

  2. 78 FR 24239 - Temporary Mailing Promotion

    Science.gov (United States)

    2013-04-24

    ... Mail Flats, Standard Mail Carrier Route, Standard Mail Flats, In-County Periodicals, Outside County Periodicals, and Package Services Bound Printed Matter Flats (collectively, Qualifying Mail). Id. at 3. To be.... Pricing Class of mail authority (%) First-Class Mail 0.077 Standard Mail 0.158 Periodicals 0.244 Package...

  3. Beta-2 Microglobulin Kidney Disease Test

    Science.gov (United States)

    ... 2017) Biomarkers and Genetics in Peripheral Artery Disease. Clinical Chemistry Jan 2017, 63 (1) 236-244. Giuseppe Coppolino, Davide Bolignano, Laura Rivoli, et al. (2014) Tumour Markers and Kidney Function: A Systematic Review. BioMed Research International Volume 2014 (2014), Article ID 647541, 9 ...

  4. Risk and Urban School Transition in Early Adolescence

    Science.gov (United States)

    Ward, Sharon; Sylva, Judith; Gresham, Frank M.; Wantz-Sutton, Jacqueline L.

    2007-01-01

    This is a comparison study of 244 early adolescents attending sixth grade at either an urban elementary school or an urban middle school. Utilizing four data collection instruments, it compares the adolescent groups' degrees of loneliness, levels of positive self-concept, academic competence, problem behaviors, and social skills. Results indicate…

  5. Sierra Leone Journal of Biomedical Research Original Article

    African Journals Online (AJOL)

    User

    1 Joint Medical Unit, 34 Military Hospital, Wilberforce Barracks, Freetown, Sierra Leone. 2.Connaught ... to implement these measures. Key words: .... Optimizing quality of care remains a persistent challenge. Total health expenditure is approximately $95 per capita of which 24.4% comes from donors, 6.8% from government ...

  6. EST Table: DC437406 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available DC437406 E_FL_epM-_19I12_F_0 10/09/28 93 %/244 aa ref|NP_001036933.1| molting fluid... carboxypeptidase A [Bombyx mori] dbj|BAD60916.1| molting fluid carboxypeptidase A [Bombyx mori] 10/09/01 47

  7. : tous les projets | Page 371 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Sujet: Capacity building, ECONOMIC ANALYSIS, ECONOMIC POLICY, ECONOMIC PLANNING, BRAIN DRAIN, International cooperation. Région: Lebanon, Middle East, Central Asia, Far East Asia, South Asia. Programme: Emploi et croissance. Financement total : CA$ 244,900.00. Amélioration de la capacité d'analyse ...

  8. All projects related to | Page 413 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Topic: Capacity building, ECONOMIC ANALYSIS, ECONOMIC POLICY, ECONOMIC PLANNING, BRAIN DRAIN, International cooperation. Region: Lebanon, Middle East, Central Asia, Far East Asia, South Asia. Program: Employment and Growth. Total Funding: CA$ 244,900.00. Upgrading Lebanese Economic Analytical ...

  9. Midway Atoll Site P1A 12/3/2002 10-11M

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — One-meter-square (1 meter x 1 meter) benthic substrate at Midway Atoll, site P1A (28.244 N, 177.323 W), between 10 and 11 meters along a permanent transect.

  10. Morphogical effects of sodium azide on tomato ( Lycopersicon ...

    African Journals Online (AJOL)

    Dry seeds of tomato (Lycopersicon esculentun Mill), varieties T106, T244 and T420 obtained from the Institute of Agriculture Research, Ahmadu Bello University Zaria, Nigeria were treated with sodium azide at concentrations of 1.0, 2.0 and 4.0 mM aimed at determining the effects of the mutagen on the morphological ...

  11. Pramana – Journal of Physics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Pramana – Journal of Physics; Volume 65; Issue 2. Volume 65, Issue 2. August 2005, pages 165-358. pp 165-176 Research Articles. Quantum states with continuous spectrum ... derivatives. pp 215-244 Research Articles. Relativistic theory of inverse beta-decay of polarized neutron in strong magnetic field.

  12. Concussion Education for High School Football Players: A Pilot Study

    Science.gov (United States)

    Manasse-Cohick, Nancy J.; Shapley, Kathy L.

    2014-01-01

    This survey study compared high school football players' knowledge and attitudes about concussion before and after receiving concussion education. There were no significant changes in the Concussion Attitude Index. Results revealed a statistically significant difference in the athletes' scores for the Concussion Knowledge Index, "t"(244)…

  13. Changing School Board Governance in Primary Education through School Inspections

    Science.gov (United States)

    Ehren, Melanie C. M.; Honingh, M. E.; Hooge, E. H.; O'Hara, J.

    2016-01-01

    This paper addresses if, and to what extent, the current working methods of the Dutch Inspectorate of Education affect the governance of school boards in schools for primary education. A key facet of the working method is the inspection meeting with the school board. Drawing upon a large quantitative study (n = 244) we are able to identify some…

  14. Shame, Internalized Heterosexism, Lesbian Identity, and Coming out to Others: A Comparative Study of Lesbians in Mainland China and Hong Kong

    Science.gov (United States)

    Chow, Pizza Ka-Yee; Cheng, Sheung-Tak

    2010-01-01

    The purpose of this study was to investigate coming out to family and friends and their relationships to shame, internalized heterosexism, lesbian identity, and perceived social support in Chinese lesbians from 2 different cultural settings--Mainland China (N = 244) and Hong Kong (N = 234). Results of structural equation modeling showed that, in…

  15. Wallace and Natural Selection, 1858

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 13; Issue 3. Wallace and Natural Selection, 1858. Sahotra Sarkar. General Article Volume 13 Issue 3 March 2008 pp 236-244. Fulltext. Click here to view fulltext PDF. Permanent link: http://www.ias.ac.in/article/fulltext/reso/013/03/0236-0244. Keywords.

  16. THE RATE OF SPONTANEOUS MUTATION

    Indian Academy of Sciences (India)

    The Rate of Spontaneous Mutation of a Human Gene. (Published on 1935 J. Genet. 31, 317-326). J. B. S. Haldane. J. Genet. Classic Volume 83 Issue 3 December 2004 pp 235-244. Fulltext. Click here to view fulltext PDF. Permanent link: http://www.ias.ac.in/article/fulltext/jgen/083/03/0235-0244. Author Affiliations.

  17. A- and C-weighted sound levels as predictors of the annoyance caused by shooting sounds, for various facade attenuation types

    NARCIS (Netherlands)

    Vos, J.

    2003-01-01

    In a previous study on the annoyance caused by a great variety of shooting sounds [J. Acoust. Soc. Am. 109, 244-253 (2001)], it was shown that the annoyance, as rated indoors with the windows closed, could be adequately predicted from the outdoor A-weighted and C-weighted sound-exposure levels [ASEL

  18. Accessibility of women farmers to agricultural information in South ...

    African Journals Online (AJOL)

    Furthermore, the women farmers were accessible to technical information on improved seeds (x = 2.59), storage methods (x = 2.44), but poor access to operating farm machinery (x =0.49) and weather forecast (x =0.68). With regard to economic information they were accessible to market locations (x =2.40), but had low ...

  19. Children's Moral Self-Concept: The Role of Aggression and Parent-Child Relationships

    Science.gov (United States)

    Sengsavang, Sonia; Krettenauer, Tobias

    2015-01-01

    This study examined the role of aggressiveness and parenting in the development of children's moral self-concept. Participants were 198 elementary school children and their parents (M = 8.65 years, SD = 2.44). Participants completed a structured moral self puppet interview and a questionnaire about their relationship to parents. Parents completed…

  20. Germline polymorphisms in an enhancer of PSIP1 are associated with progression-free survival in epithelial ovarian cancer

    DEFF Research Database (Denmark)

    French, Juliet D; Johnatty, Sharon E; Lu, Yi

    2016-01-01

    to chemotherapy, we carried out a multi-phase genome-wide association study (GWAS) in 1,244 women diagnosed with serous EOC who were treated with the same first-line chemotherapy, carboplatin and paclitaxel. We identified two SNPs (rs7874043 and rs72700653) in TTC39B (best P=7x10-5, HR=1.90, for rs7874043...

  1. Suitability of Groundwater Quality for Irrigation with Reference to ...

    African Journals Online (AJOL)

    The purpose of the project has been to assess the suitability of groundwater quality for irrigation purpose in the Hantebet catchment (24.4 km2), Tigray region, northern Ethiopia. The total numbers of hand dug wells in the area are 154. Out of these, 110 are functional and the remaining dried out. Stratified and random ...

  2. Academic Self-Efficacy Beliefs of Undergraduate Mathematics Education Students

    Science.gov (United States)

    Turgut, Melih

    2013-01-01

    The present paper investigated academic self-efficacy beliefs of undergraduate mathematics education students with respect to gender, academic performance and grade level. The participants were a total of 244 undergraduate students (195 females and 49 males) enrolled to department of mathematics education (57 freshmen, 106 sophomores and 81…

  3. Effect of pesticide application rate on yield of vegetables and soil ...

    African Journals Online (AJOL)

    Lindane is listed among the Prior Informed Consent (PIC) pesticides, and agricultural uses of lindane have been banned in 52 countries due to its hazardous nature. However, lindane is still widely used in vegetable cultivation in Ghana. The effect of increasing rates of application of lindane (156.0, 244.0 and 312.0 g ha-1), ...

  4. Changes in the air cell volume of artificially incubated ostrich eggs ...

    African Journals Online (AJOL)

    A total of 2160 images of candled, incubated ostrich eggs were digitized to determine the percentage of egg volume occupied by the air cell at different stages of incubation. The air cell on average occupied 2.5% of the volume of fresh eggs. For eggs that hatched successfully, this volume increased to an average of 24.4% ...

  5. R-ES-ONANCE

    Indian Academy of Sciences (India)

    Another Feather in. HOckel's Cap. Photon Rao. The simple Huckel rule, which states that conjugated cyclic systems having 4n + 2 :rc electrons (n being an integer) are aromatic, is one of those rules which have really stood the · ... structure, the Ga-Ga bond length of this mol- ecule (2.44 A) is among the shortest known.

  6. 40 CFR 799.9630 - TSCA developmental neurotoxicity.

    Science.gov (United States)

    2010-07-01

    ... Teratology 10:237-244 (1988). (4) Campbell, B.A. and Haroutunian, V. Effects of age on long-term memory... separation as an external sign of pubertal development in the male rat. Biology of Reproduction 17:298-303... fetal period. Neurobehavioral Toxicology 1:129-135 (1979). (20) Spear, N.E. and Campbell, B.A. (eds...

  7. 77 FR 12626 - Self-Regulatory Organizations; New York Stock Exchange LLC; Notice of Filing of Proposed Rule...

    Science.gov (United States)

    2012-03-01

    ... Application Process for Approved Persons, and Making Related Technical and Conforming Changes February 24...-4. I. Self-Regulatory Organization's Statement of the Terms of Substance of the Proposed Rule Change..., eliminate the application process for approved persons, and make related technical and conforming changes...

  8. Neuroinvasive disease and West Nile virus infection, North Dakota, USA, 1999-2008.

    Science.gov (United States)

    Carson, Paul J; Borchardt, Stephanie M; Custer, Brian; Prince, Harry E; Dunn-Williams, Joan; Winkelman, Valerie; Tobler, Leslie; Biggerstaff, Brad J; Lanciotti, Robert; Petersen, Lyle R; Busch, Michael P

    2012-04-01

    To determine risk for West Nile virus (WNV) neuroinvasive disease in North Dakota, we tested plasma samples from blood donors for WNV IgG and compared infection rates with reported WNV neuroinvasive disease incidence. We estimate that 1 in 244 WNV infections leads to neuroinvasive disease; risk is substantially increased among men and older persons.

  9. 28 CFR 90.101 - What definitions apply for the grant program?

    Science.gov (United States)

    2010-07-01

    ... WOMEN Grants To Combat Violent Crimes Against Women on Campuses § 90.101 What definitions apply for the... reasonable time. Section 101, Public Law 105-244, 20 U.S.C. 1001. (c) Sexual assault means any conduct... organization that assists domestic violence or sexual assault victims, including campus women's centers, rape...

  10. Qualitative Analysis of Student Perceptions of E-Portfolios in a Teacher Education Program

    Science.gov (United States)

    Parker, Michele; Ndoye, Abdou; Ritzhaupt, Albert D.

    2012-01-01

    In the last decade, e-portfolios have moved to the forefront of teacher preparation programs across the United States. With its widespread use, faculty and administrators need to understand teacher candidates' perspectives to meet their needs. In the present study, the researchers gathered in-depth information from 244 students who were required…

  11. STD care in the South African private health sector | Schneider ...

    African Journals Online (AJOL)

    Objectives. To establish the accessibility and quality of sexually transmitted disease (SID) care provided by private general practitioners (GPs) and workplace health services in South Africa. Design. Structured telephone interviews were conducted with a random national sample of 120 GPs and 244 occupational health ...

  12. Karyotype studies on Tagetes erecta L. and Tagetes patula L ...

    African Journals Online (AJOL)

    Karyotypes of nine Tagetes erecta L. accessions and three Tagetes patula L. accessions were studied. The chromosome numbers of T. erecta and T. patula were 2n=2x=24 and 2n=4x=48, respectively. The karyotype formulae of T. erecta L. 'Scarletade' and 'Perfection Yellow' are 2n=2x=24=4sm+20m; '9901AB' and ...

  13. First ever production of a transactinide element in Switzerland

    Energy Technology Data Exchange (ETDEWEB)

    Jost, D.T.; Dressler, R.; Eichler, B.; Piguet, D.; Tuerler, A.; Gaeggeler, H.W. [Paul Scherrer Inst. (PSI), Villigen (Switzerland); Thoerle, P.; Trautmann, N.; Zauner, S. [Mainz Univ. (Germany)

    1997-09-01

    The transactinide element {sup 261}Rf was produced for the first time at the PSI Phillips cyclotron in the reaction {sup 244}Pu({sup 22}Ne,5n). At bombarding energy of 116 MeV the production cross section was 3 nb. (author) 2 figs., 1 tab., 1 ref.

  14. The clinical utility of echocardiography as a cardiological diagnostic ...

    African Journals Online (AJOL)

    Results: Of the 244 (76.0%) clinically diagnosed as HHD, 188 (58.6%) were confirmed by echocardiography. For RHD 9 (2.8%) were diagnosed clinically while on echocardiography, 13 (4.1%) were diagnosed. All the 31 (9.7%) cases of dilated cardiomyopathy were confirmed on echocardiography. No case of ischemic ...

  15. An analysis of language problems identified in writing by low ...

    African Journals Online (AJOL)

    ... analysis of some marked first-year scripts was undertaken, and the results were categorised into four prominent types of errors. Then there are some suggestions for appropriate remediation tasks to assist legal students to overcome each type of error. (S/ern Af Linguistics & Applied Language Stud: 2002 20(4): 233-244) ...

  16. Experimental Demonstration of Photon Efficient Coherent Temporal Combining for Data Rate Scaling

    Science.gov (United States)

    2016-02-15

    Schieler, B. S. Robinson, and S. A. Hamilton MIT Lincoln Laboratory, 244 Wood St., Lexington, MA 02421 ABSTRACT The next generation free-space...that enabled matched filtering at the receiver and also provided a strong clock tone to aid in the clock recovery process. The drive signal for the

  17. ANALYSIS OF INDEXED-GUIDED HIGHLY BIREFRINGENT ...

    African Journals Online (AJOL)

    Research. 2008, 80, 307-320. [5] Nozhat N. and Granpayeh N. Progress In Electromagnetics Research. 2009, 99, 225-. 244. [6] Chau et al. Progress In Electromagnetics Research B. 2010, 22, 39-52. [7] SUN Y. S. et al. Japanese Journal of Applied Physics. 2008, 47(5), 3755–3759. [8] Zhang X., Zhao J. Nucl. Instr. and Meth ...

  18. Normalization of the psychometric hepatic encephalopathy score for ...

    African Journals Online (AJOL)

    The variables that affected the results of the test were included in the multiple linear regression models and formulas were constructed to predict the expected ... Among the patients with MHE, 11 (11/45, 24,4%) had Child-Pugh classification (CTP) A and 8 (8/15, 53.3%) had CTP B. No differences in age and education years ...

  19. An Application of the Rasch Measurement Theory to an Assessment of Geometric Thinking Levels

    Science.gov (United States)

    Stols, Gerrit; Long, Caroline; Dunne, Tim

    2015-01-01

    The purpose of this study is to apply the Rasch model to investigate both the Van Hiele theory for geometric development and an associated test. In terms of the test, the objective is to investigate the functioning of a classic 25-item instrument designed to identify levels of geometric proficiency. The dataset of responses by 244 students (106…

  20. Data of evolutionary structure change: 1DR0B-1AI3A [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available y>51.34600067138672 58.03799819946289 > -0.244...84766 53.59400177001953 tion> -0.4729999899864197 0.8799999952316284 -0.21199999749660492 -0.15700000524520874 0.9649999737739563 > 0.5...x> 94.88500213623047 50.819000244140625 > -0.7110000252723694 0...0.9909999966621399 > 1.8812370300292969 3.7197890281677246

  1. Dicty_cDB: Contig-U06632-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available WORKING ... 38 6.1 4 ( DQ832718 ) Phytophthora ramorum mitochondrion, complete genome. 36 6.2 5 ( CR962124...mth2-44c15... 38 6.2 3 ( EU427470 ) Phytophthora ramorum strain CBS 101553 mitochondr... 36 6.3 5 ( AX346874

  2. Epidemiological Study and Treatment Outcome of Primary Ocular ...

    African Journals Online (AJOL)

    2016-12-13

    Dec 13, 2016 ... customized ocular prosthesis with the help of prosthetics department. Among 35 cases of squamous cell carcinoma, 23 (65.71%) were of limbal origin, 7 (20%) cases were only conjunctival origin and 5 (14.28%) cases were from the lid. The average age of presentation was 24.4 years. Among these 35 ...

  3. Development of a Hard-Patch Approach for Scarf Repair of Composite Structure

    Science.gov (United States)

    2006-06-01

    aerofoil ) section with significant skin thickness variation, both in the cordwise and spanwise direction. B. A similar HS from an Australian aircraft was...has a symmetrical aerofoil section, Figure 1, with a surface area of 44 sq ft per side and an aspect ratio of 2.44. The skins are made of AS4/3501

  4. Perception of Female Doctors\\' Clinical Practice and Teaching in ...

    African Journals Online (AJOL)

    More women are in medicine. The study aimed at examining medical students' perception of female doctors' clinical practice and teaching as it relates to their gender. The study's design was simple randomized using well-structured questionnaires. One hundred and sixtyone medical students with a mean age of 24.4 ± 2 ...

  5. EST Table: FS893448 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available er dense fiber protein 2 (Outer dense fiber of sperm tails protein 2) (84 kDa out...ogy 10/09/10 43 %/244 aa gnl|Amel|GB14311-PA 10/09/10 46 %/243 aa gi|91078946|ref|XP_974065.1| PREDICTED: similar to Out

  6. Validation of PROBA-V GEOV1 and MODIS C5 & C6 fAPAR Products in a Deciduous Beech Forest Site in Italy

    Czech Academy of Sciences Publication Activity Database

    Nestola, E.; Sanchez-Zapero, J.; Latorre, C.; Mazzenga, F.; Matteucci, G.; Calfapietra, Carlo; Camacho, F.

    2017-01-01

    Roč. 9, č. 2 (2017), č. článku 126. ISSN 2072-4292 Institutional support: RVO:86652079 Keywords : fAPAR * validation * PROBA-V GEOV1 * MODIS C5 * MODIS C6 * beech forest * up-scaling * GCOS requirements * in-situ comparison and evaluation Subject RIV: EH - Ecology, Behaviour Impact factor: 3.244, year: 2016

  7. Construction and Validation of an Observational Scale of Neighborhood Characteristics

    Science.gov (United States)

    McDonell, James R.; Waters, Tracy J.

    2011-01-01

    This paper reports the development and validation of the Neighborhood Observation Scale, a 41 item measure of neighborhood physical appearance, social appearance, safety, and amenities. Three independent ratings were collected on each of 244 neighborhoods in 132 census block groups in five South Carolina counties, for a total of 732 observations.…

  8. Agglomeration of mesoporous silica by melt and steam granulation. Part I: a comparison between disordered and ordered mesoporous silica.

    Science.gov (United States)

    Vialpando, Monica; Albertini, Beatrice; Passerini, Nadia; Bergers, Daan; Rombaut, Patrick; Martens, Johan A; Van Den Mooter, Guy

    2013-11-01

    The objective of this study was to compare agglomerations by melt and steam granulation of ordered, COK-12, and disordered, Syloid(®) 244 FP (244), mesoporous silica material. Poloxamer 188 (P188) and polyvinylpyrrolidone K25 (PVP) were chosen as binders for melt and steam granulation, respectively. The poorly water-soluble compound, itraconazole (ITZ), was selected for the development of an immediate-release oral dosage form. Steam granulation resulted in the largest granules, however, the slowest release. Compression behavior and tablet properties of steam-granulated material prepared with COK-12 and 244 were similar. As determined by X-ray powder diffraction, melt granulation resulted in the most ITZ to extract from the pores during processing. However, the enhanced release rate was still maintained when compared with the crystalline form. Moreover, no additional drug extraction was observed following the 6 month storage in 25°C/60% relative humidity (RH) and 40°C/75%RH. P188 diffraction peaks were present in the 244 melt-granulated material, but disappeared because of the degradation following 1 week in 40°C/75%RH conditions. The differential scanning calorimetry analysis indicated that the degradation of P188 already occurred during the granulation process itself. Based on these results, steam granulation with PVP is the preferred method over melt granulation with P188. © 2013 Wiley Periodicals, Inc. and the American Pharmacists Association.

  9. Appearance Concerns and Smoking in Young Men and Women: Going beyond Weight Control

    Science.gov (United States)

    Grogan, Sarah; Hartley, Louise; Conner, Mark; Fry, Gary; Gough, Brendan

    2010-01-01

    Aim: This study was designed to investigate the link between appearance concerns and smoking in young men and women. Methods: A total of 244, 17-34-year-olds completed the Multidimensional Body-Self Relations Questionnaire Appearance Sub-Scales (MBSRQ-AS). Findings: Smokers scored significantly lower than non-smokers on appearance evaluation and…

  10. The Development of Fundamental Movement Skills by Children Aged Six to Nine

    Science.gov (United States)

    Lin, Shu-Jung; Yang, Shu-Chu

    2015-01-01

    The main purpose of the present study is to elucidate any differences which may exist in the FMSs of children between the ages of six and nine. Purposive sampling was used to recruit a total of 485 participants (244 boys and 241 girls) in Chiayi City and Chiayi County. All of the participants were between the ages of six and nine and had no…

  11. Examining Holland's Person-Environment Fit, Workplace Aggression, Interpersonal Conflict, and Job Satisfaction

    Science.gov (United States)

    Pseekos, A. Chantelle; Bullock-Yowell, Emily; Dahlen, Eric R.

    2011-01-01

    The researchers examined the impact of person-environment (P-E) fit, as defined by Holland's (1997) theory, on interpersonal conflict at work (ICAW) and workplace aggression. In addition, previous relationships found in the job satisfaction literature were examined in the present sample of 244 United States employees. Internet-based surveys were…

  12. Effectiveness of liquid organic-nitrogen fertilizer in enhancing ...

    African Journals Online (AJOL)

    user

    2011-03-21

    Mar 21, 2011 ... 2Department of Forest Management, Faculty of Forestry, Universiti Putra Malaysia,43400 UPM Serdang Selangor,. Malaysia. Accepted 21 January ... Previous data showed that, uptake of P by corn increased more ..... Prentice Hall, Inc. Upper Saddle River, New Jersey, United. State of America, pp. 217-244.

  13. 76 FR 13239 - Notice of Intent to Grant Exclusive License

    Science.gov (United States)

    2011-03-10

    ...: Theodore U. Ro, Intellectual Property Attorney, Office of Chief Counsel, 2101 NASA Parkway. Phone (281) 244..., Production of Functional Proteins: Balance of Shear Stress and Gravity and NASA Case No. MSC- 22859-1 to GNet... will not be made available to the public for inspection and, to the extent permitted by law, will not...

  14. 28 CFR 90.103 - What are the eligibility requirements for the grant program?

    Science.gov (United States)

    2010-07-01

    ...) VIOLENCE AGAINST WOMEN Grants To Combat Violent Crimes Against Women on Campuses § 90.103 What are the... the Higher Education Amendments of 1998, as amended, Public Law 105-244, 112 Stat. 1741, 20 U.S.C... Rights and Privacy Act (FERPA) of 1974, as amended by section 951 of the Higher Education Amendments of...

  15. DESAIN DAN PERANCANGAN ALAT PENGEPRES GERAM SAMPAH MESIN PERKAKAS

    Directory of Open Access Journals (Sweden)

    Nur Indah

    2017-02-01

    Full Text Available Sayatan geram tidak beraturan diruang lingkup perusahaan jasa permesinan dapat membahayakan para operator dan karyawan yang ada diruang lingkup perusahaan jasa permesinan, peralatan yang dirancang  membantu proses mengepresan geram sampah mesin perkakas sehingga geram sampah mesin perkakas setelah di press terlihat rapih, tidak perlu mennggunakan tempat luas dan memudahkan pada saat dipindahkan atau pengangkutan lebih lanjut. Perancangan ini menggunakan solidworks dengan spesifikasi Kapasitas maksimal 2 ton Perancangan alat pengepres geram ini berukuran 24,4 cm × 24,4 cm ×  61,9 cm untuk blok ruang pengepresan 24,4 cm × 24,4 cm × 30 cm. Tinggi kaki penyangga atau kaki rangka 6 cm, hal ini bertujuan agar pada saat dioperasikan alat lebih kokoh tidak bergoyang. Tinngi sampah geram sebelum di pres 30 cm, maka volume awal 331,89 m3 dan tinggi sampah geram setelah di pres 13 cm, maka volume akhir menjadi 68,77 m3, Dengan penurunan sampah geram pada alat pengepres perubahan bentuk sampai 14,64 %.

  16. G Growth isolat h respo ted fro dif onse o om Ara fferent of regio ...

    African Journals Online (AJOL)

    SAM

    Azad P (2004). Screening of native Rhizobium strains for sustainable crop production in pulse-rice cropping system. In Biotechnology in. Sustainable and Organic Farming (Eds. Yadav AK, Chaudhary SR,. Talukdar NC), Shree Publishers and Distributors, New Delhi. pp. 244-. 248. Barboza F, Correa NS, Rosas SB (2000).

  17. Synthesis and characterization of CdS and CdSe nanoparticles ...

    Indian Academy of Sciences (India)

    2 [E = S (1), Se (2); M = Cd; Ox = 2-(4,4-dimethyl-2-oxazolinyl)benzene] by thermolysing in tri--octylphosphine oxide (TOPO) at 280°C, and their characterization by X-ray powder diffraction (XRD), transmission electron microscope (TEM) and ...

  18. Journal of Astrophysics and Astronomy | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Astrophysics and Astronomy. A. V. Ananth. Articles written in Journal of Astrophysics and Astronomy. Volume 21 Issue 3-4 September-December 2000 pp 241-244 Session V – Vector Magnetic Fields, Prominences, CMEs & Flares. Stokes Polarimetry at the Kodaikanal Tower Tunnel Telescope.

  19. Indexes to Volume 73

    Indian Academy of Sciences (India)

    232Th, 222Rn and 220Rn concentrations in various natural honey samples using nuclear track detectors: Impact on the adult consumers. M A Misdaq and A Mortassim. 859–879. Stability of 244−260Fm isotopes against alpha and cluster radioactivity. K P Santhosh, R K Biju and Sabina Sahadevan. 1059–1072. Atomic and ...

  20. Relacion entre los factores de riesgo de enfermedades crónicas no trasmisibles y la sensibilidad a la insulina en adultos jóvenes de 18 a 39 años de la ciudad de Cali-Colombia

    National Research Council Canada - National Science Library

    Mildrey Mosquera; Alberto Pradilla; Beatriz Gracia; Martha Liliana Cruz; Andrés Felipe Sánchez; Cecilia Aguilar de Plata

    2007-01-01

    ... la prevalencia de resistencia a insulina(RI) y factores de riesgo(FR) para el desarrollo de enfermedades crnicas no transmisibles(ECNT). El objetivo del estudio fue determinar asociacin entre FR de ECNT y el grado de sensibilidad a insulina (SI)I en adultos jvenes aparentemente sanos. Se seleccionaron por conveniencia 97 sujetos (244.66 aos), de quienes...

  1. Prevalence of obesity among diabetics seen in a tertiary health care ...

    African Journals Online (AJOL)

    Background: Obesity is a leading determinant for diabetes mellitus. The objective of this study was to assess the prevalence of overweight/obesity among diabetic patients seen at a tertiary hospital in South-South Nigeria. Methods: A retrospective study of 244 diabetic patients seen between January 2010 and June 2012.

  2. Short Communications

    African Journals Online (AJOL)

    primary habitat**. Green-headed Oriole Oriolus chlorocephalus. 4 ‡. 1 forest interior. Black-bellied Starling Lamprotornis corruscus. 2.83 + 0.29. 4 forest edge, secondary growth. Stripe-cheeked Greenbul Andropadus milanjensis. 2.68 + 0.78 ‡. 6 forest interior. Shelley's Greenbul A. masukuensis. 2.44 + 0.80. 3 forest interior.

  3. 48 CFR 2152.070 - Applicable clauses.

    Science.gov (United States)

    2010-10-01

    ...-23Assignment of Claims 52.232-33Payment by Electronic Funds Transfer—Central Contractor Registration 52.233... 52.242-13Bankruptcy 52.244-5Competition in Subcontracting 52.245-2Government Property (Fixed-Price Contracts) 52.246-4Inspection of Services—Fixed Price 52.246-25Limitation of Liability—Services 52.247...

  4. se-p-te-mber-19-9-6

    Indian Academy of Sciences (India)

    Kathryn Phillips. Penguin Books, 1994 pp.ix+244, $11.95. As an amphibian biologist, reading the book. Tracking the Vanishing Frogs churned up mix- ed feelings in me. On the one hand, I was relieved to learn that people have started thinking seriously about the issue of declining amphibian populations. On the other hand, ...

  5. FRECUENCIA DEL BURNOUT EN POLICÍAS DE LA CIUDAD DE MÉXICO

    National Research Council Canada - National Science Library

    José Miguel Sánchez-Nieto

    2012-01-01

    ... una mayor frecuencia fue la baja realización personal. Palabras clave: Burnout, policía, síndrome del trabajador quemado, estrés en el trabajo. ABSTRACT This study reports Burnout's frequency in the Preventive Police from Mexico City and sociodemographic variable that are associated to it. The sample consisted of244 officers from 20 to 58...

  6. Animal health care delivery to small ruminants in peri-urban Ghana ...

    African Journals Online (AJOL)

    The study aimed at defining the problems of small ruminant keepers in peri-urban areas of Ghana regarding animal health care (AHC), and assessing the quality of the structure and process of the AHC system. Small ruminant keepers in four regions were surveyed using a questionnaire. In all 244 respondents in the Central ...

  7. Management of patients with rheumatic fever and rheumatic heart ...

    African Journals Online (AJOL)

    McLaren M, Markowitz M, Gerber M. Rheumatic heart disease in developing countries. Ann. Intern Med 1994; 120: 243-244. 2. Marcus R, Sareli P, Pocock W, Barlow J. The spectrum of severe rheumatic mitral valve disease in a developing country. Correlations among clinical presentation, surgical pathologic findings and ...

  8. Oral health knowledge, perceptions and behaviour among nursing ...

    African Journals Online (AJOL)

    Aim: The purpose of the study was to investigate oral health knowledge, perceptions and behaviour amongst nursing students in a Nigerian tertiary hospital. Materials and methods: The study was conducted at University of Nigeria Teaching Hospital on 244 respondents aged 17 to 40 years, using self administered ...

  9. Deployment Area Selection and Land Withdrawal/Acquisition. M-X/MPS (M-X/Multiple Protective Shelter) Environmental Technical Report. Archaeology.

    Science.gov (United States)

    1981-10-02

    Ranch H-546/26LN244 Cathedral Gorge 1-575 Cedar District (aka Delamar) T-16 - 271 * 9 0 -r ---- r--- SITE NAME SITE NUMBER Cherokee (aka Viola) H-51...surveyors road HR2021 9 S Frisco Branch of the Los Angeles and Salt Lake Railroad HR2022 Frisco - Ely mail route HR2023 Gilmer and Salisbury Stage Line

  10. Predictors of HIV Testing and Intention to Test Among Hispanic Farmworkers in South Florida

    Science.gov (United States)

    Fernandez, M. Isabel; Collazo, Jose B.; Bowen, G. Stephen; Varga, Leah M.; Hernandez, Nilda; Perrino, Tatiana

    2005-01-01

    Context and Purpose: This study examined the predictors of HIV testing and factors associated with intention to accept a free HIV test among 244 Hispanic migrant/seasonal farmworkers in South Florida. Methods: Time and space sampling procedures were used to recruit participants in public venues. Bilingual staff interviewed eligible respondents in…

  11. Social Work Students and Faculty: Testing the Convergence of Perspectives on Student Writing Abilities

    Science.gov (United States)

    Cronley, Courtney; Kilgore, Christopher D.

    2016-01-01

    Students (n = 244, 76% MSSW) and faculty members (n = 40, 36% tenure or tenure track) at a social work program at a large public southern U.S. university were surveyed to assess within- and between-group differences in perspectives on student writing. Faculty members expressed significantly greater concern with student writing than students.…

  12. InterPro search result: AK058438 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK058438 001-015-F09 IPR008921 DNA polymerase III clamp loader subunit, C-terminal ...superfamily SSF48019 DNA polymerase III clamp loader subunits, C-terminal domain T136-244 0.00045 ...

  13. Tienerafrikaans | Marais | Journal for Language Teaching

    African Journals Online (AJOL)

    ... (slangy language) as Stenström (2000) indicated for British teenagers' English, but that it differs in certain respects, due to Afrikaans teenagers' command of varieties of English and of Afrikaans. Keywords: Afrikaans, teen-speak, slang, slanguage, slangy language. Journal for Language Teaching Vol. 39(2) 2005: 244-259 ...

  14. Results from GRACE/SUSY at one-loop

    Indian Academy of Sciences (India)

    3Seikei University, Musashino, Tokyo 180-8633, Japan. 4Meiji Gakuin University, Totsuka, Yokohama 244-8539, Japan. 5The Graduate University for Advanced Studies, Hayama, Kanagawa 240-0193, Japan. ∗E-mail: yasui@tmc-ipd.ac.jp. Abstract. We report the recent development on the SUSY calculations with the help.

  15. 76 FR 73475 - Immigration Benefits Business Transformation, Increment I; Correction

    Science.gov (United States)

    2011-11-29

    ..., 207, 208, 211, 212, 213a, 244; 245, 324; 335 RIN 1615-AB83 Immigration Benefits Business Transformation, Increment I; Correction AGENCY: U.S. Citizenship and Immigration Services, DHS. ACTION: Final... to enable U.S. Citizenship and Immigration Services (USCIS) to transform its business processes. The...

  16. Use and Perception of Electronic Cigarettes among College Students

    Science.gov (United States)

    Trumbo, Craig W.; Harper, Raquel

    2013-01-01

    Objective: This study provides insight into how electronic cigarettes (e-cigarettes) may affect the social normative environment for tobacco use among college students. Participants: Participants were 244 freshman and sophomore students. Methods: Students completed an online self-report survey in April 2011. Results: There is a higher acceptance…

  17. Ammonia differentially suppresses the cAMP chemotaxis of anterior ...

    Indian Academy of Sciences (India)

    Unknown

    metabolism of the slime mold Dictyostelium discoideum during growth and morphogenesis; Biol. Bull. 107 226–235. Gross J D, Bradbury J, Kay R R and Peacey M J 1983 Intra- cellular pH and the control of cell differentiation in Dictyo- stelium discoideum; Nature (London) 303 244–245. Gross J D, Peacey M J and von ...

  18. Occupational Fields 68 (Weather Service) and 70 (Aviation Operations) MOSs 6072, 6075, 6076, 6077, 6078, 6079 (Ground Support Equipment) Task Analysis.

    Science.gov (United States)

    1979-08-01

    243. COMPUTE ALTITUDE OF RAWINSCNDE BALLOON 244. ENCODE CATA OF RAiINSONDE SCUNDINGS 245. ASSEMBLE/CISASSEMBLE RADCME 246. OPERATE GMO VAN (RACAR... DIGESTIBLE (FOD) 473. CRIVE RUNwAY SwEEPER 474. MIX PAINTS 475. BRUSH PAINT GSE 476. PREPARE GSE FOR PAINTING 26 477. SPRAY PAINT GSE 478. REMOVE/REPLACE

  19. Comparing Three South African Student Cohorts on Their Attitudes to the Rights of Working Women

    Science.gov (United States)

    Patel, Cynthia Joan

    2016-01-01

    This study compares three cohorts (1998-1999, 2005-2006 and 2010) of undergraduate psychology students at a South African university on the level of support for working women (women in paid employment) on various issues considered to be feminist. Cohort 1 (n?=?244), cohort 2 (n?=?311) and cohort 3 (n?=?266) completed an adapted version of a…

  20. Student Motivational Skill Training Package: Evaluation for Air Force Technical Training.

    Science.gov (United States)

    1982-12-01

    British Journal of Educational Psychology, 1977, 47(3), 244-257. Fullan , M., & Pomfret, A. Research on curriculum and instruction implementa- tion...an integral part of the entire program. After a review of educational research programs, Fullan and Pomfret (1977, p. 394) conclude that "if there is

  1. TNT Equivalency of Bulk Nitrocellulose

    Science.gov (United States)

    1981-03-01

    Whien Dato Enlotod) &,1W SUMMARY Nitrocellulose, 13.157 nitrogen MIL-N-244A Grade C (Lot number RAD78F0015027) was detonated in configurations...weight factored out, the calculated TNT equivalencies were tabularized and plotted as functions of sample scaled distance. TEST RESULTS Data sheets for

  2. Biofilms on Indwelling Urologic Devices: Microbes and Antimicrobial ...

    African Journals Online (AJOL)

    hanumantp

    Dr. Prasanta Kumar Maiti,. Department of Microbiology,. Institute of Post Graduate Medical. Education and Research, 244,. AJC Bose Road, Kolkata ‑ 700 020,. West Bengal, India. E‑mail: prasantamaiti123@rediffmail. com. Introduction. Among all currently used medical devices urinary catheters and stents are the most ...

  3. Mindfulness May Moderate the Relationship Between Intrinsic Motivation and Physical Activity: A Cross-Sectional Study

    OpenAIRE

    Ruffault, Alexis; Bernier, Marjorie; Juge, Nicolas; Fournier, Jean

    2016-01-01

    International audience; This study aims to characterize the relationships between intrinsic motivation towards physical activity, mindfulness, and physical activity level. We measured self-reported mindfulness, motivational regulation towards exercise, and physical activity level in 280 French students. Analyses conducted on 244 participants revealed that self-reported mindfulness moderates the relationship between intrinsic motivation towards exercise and physical activity levels. These find...

  4. 48 CFR 2152.370 - Use of the matrix.

    Science.gov (United States)

    2010-10-01

    ....409(b) Protecting the Government's Interest when Subcontracting with Contractors Debarred, Suspended... records retention M 2152.216-70 2116.270-1(a) Fixed price with limited cost redetermination—risk charge A... Bankruptcy M 2152.243-70 2143.205 Changes M FAR 52.244-5 FAR 44.204(c) Competition in Subcontracting M 2152...

  5. It should not hurt to be a child : prevalence of child maltreatment across the globe

    NARCIS (Netherlands)

    Stoltenborgh, Marije

    2012-01-01

    In this thesis we describe, combine and compare results of a series of meta-analyses on the prevalence of child sexual, physical, and emotional abuse and of physical and emotional neglect, including 244 publications and 577 prevalence rates for the various types of maltreatment. Child maltreatment

  6. 49 CFR 1106.2 - Definitions.

    Science.gov (United States)

    2010-10-01

    ... TRANSPORTATION RULES OF PRACTICE PROCEDURES FOR SURFACE TRANSPORTATION BOARD CONSIDERATION OF SAFETY INTEGRATION... Administration at 49 CFR 244.9, means the migration, combination, or unification of one set of railroad... the agency within the Department of Transportation responsible for railroad safety. Safety Integration...

  7. Student and Faculty Perceptions about Mandatory Influenza Vaccinations on a Health Sciences Campus

    Science.gov (United States)

    Looper, Philip; George, David; Johnson, Eric J.; Conway, Susan E.

    2017-01-01

    Objective: To examine the perceptions among faculty and health professional students regarding mandatory vaccination policies on a health sciences campus. Participants: A total of 296 faculty and 244 students completed surveys during Fall 2015. Methods: The online survey administered to individuals who received the influenza vaccine during the…

  8. InterProScan Result: DC542935 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available DC542935 DC542935_1_ORF2 54106EE82C244B29 SUPERFAMILY SSF103473 MFS general substra...te transporter 2.2e-25 T IPR016196 Major facilitator superfamily, general substrate transporter ...

  9. Characterization of the pH-Mediated solubility of Bacillus thuringiensis var. san diego native δ-endotoxin crystals

    Science.gov (United States)

    C. N. Koller; L. S. Bauer; R. M. Hollingworth

    1992-01-01

    Native crystals of Bacillus thuringiensis var. san diego, a coleopteran-specific δ-endotoxin, were metabolically labeled with [35S]methionine. Specific activity was 82,000 CPM/μg (2.44 Ci/mmol). Using a universal buffer formulated with the same ionic strength at every pH, we determined that...

  10. Catalog of thermal waters in New Mexico. Hydrologic report 4

    Energy Technology Data Exchange (ETDEWEB)

    Summers, W.K.

    1976-01-01

    Waters at 67 locations in New Mexico discharge at anomalous temperatures. Details on these thermal water resources such as the location, temperature, discharge rate, field pH, and specific conductance are presented in 29 tables and 47 figures. Included also are 244 chemical analyses of water from 38 areas.

  11. 78 FR 36295 - Buy America Waiver Notification

    Science.gov (United States)

    2013-06-17

    ....png ). There is no indication of how much of this 40 percent United States/Canadian content is United...+Labeling+Act+ (AALA)+Reports). Vehicles meeting the criteria for final assembly under the AALA is one... section 117 of the SAFETEA-LU Technical Corrections Act of 2008 (Pub. L. 110-244, 122 Stat. 1572), the...

  12. Cryptanalysis of the full Spritz stream cipher

    DEFF Research Database (Denmark)

    Banik, Subhadeep; Isobe, Takanori

    2016-01-01

    and a long-term bias in the first two bytes of every cycle of N keystream bytes, where N is the size of the internal permutation. Our attacks are able to distinguish a keystream of the full Spritz from a random sequence with samples of first two bytes produced by 244.8 multiple key-IV pairs or 260...

  13. Orofacial cleft risk is increased with maternal smoking and specific detoxification-gene variants

    DEFF Research Database (Denmark)

    Shi, Min; Christensen, Kaare; Weinberg, Clarice R

    2007-01-01

    Maternal smoking is a recognized risk factor for orofacial clefts. Maternal or fetal pharmacogenetic variants are plausible modulators of this risk. In this work, we studied 5,427 DNA samples, including 1,244 from subjects in Denmark and Iowa with facial clefting and 4,183 from parents, siblings,...

  14. RESEARCH ARTICLE Application of high resolution SNP arrays in ...

    Indian Academy of Sciences (India)

    User

    The deleted region encompassed 15 genes, including SAE1, a SUMO-1 activating enzyme subunit, which may be related to cleft lip and palate. Kirchhoff et al. (2009) applied a 244k Agilent oligonucleotide-based array-CGH to determine the exact breakpoints in 14 patients with partial deletions of chromosome 13q21.1-qter ...

  15. Dicty_cDB: Contig-U11048-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available r... 51 1e-04 AP009256_831( AP009256 |pid:none) Bifidobacterium adolescentis ATC... 51 1e-04 AP009324_1043( ... 0.003 AP009256_244( AP009256 |pid:none) Bifidobacterium adolescentis ATC... 46 0

  16. 40 CFR 89.416 - Raw exhaust gas flow.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 20 2010-07-01 2010-07-01 false Raw exhaust gas flow. 89.416 Section... Procedures § 89.416 Raw exhaust gas flow. The exhaust gas flow shall be determined by one of the methods...) Measurement of the air flow and the fuel flow by suitable metering systems (for details see SAE J244. This...

  17. Untitled

    African Journals Online (AJOL)

    2002-07-01

    Jul 1, 2002 ... it was 44.6%. Of the 215 eligible children who sought treatment in a health facility where Vaccination could be offered, 59.6% missed an opportunity to be vaccinated while. 24.4% of the children missed an opportunity during routine vaccination sessions. Reasons for non-completion of vaccination included ...

  18. Browse Title Index

    African Journals Online (AJOL)

    Items 1 - 50 of 244 ... EDO Mangete, BB Kombo. Vol 27, No 1-2 (2015), Allopurinol induced Stevens - Johnson syndrome in a .... Vol 25, No 1-2 (2013), Challenges of Managing Orbital Floor Blow–out Fracture in a Developing Country, Abstract. JFA Owoeye, BJ Adekoya, K Chaha, BG Balogun, VA Olatunji, SO Ajike, OO ...

  19. Delineating shallow ground water irrigated areas in the Atankwidi ...

    African Journals Online (AJOL)

    user

    Very high spatial resolution (VHSR) Quickbird imagery (0.61 to 2.44 m) was used to identify: (a) .... Satellite sensor data. The Quickbird imagery was purchased through Landsat Science. Team allocations. The characteristics of this image are shown in ... on the equations and algorithms presented in (Markham and Barker.

  20. Typing of Staphylococcus aureus strains isolated from milk cows ...

    African Journals Online (AJOL)

    Surveys conducted in Senegal have shown a strong association of staphylococci with subclinical mastitis in dairy cows. This study aimed to characterise Staphylococcus aureus strains identified in the dairy farms in Dakar. Of a total of 244 Staphylococcus spp isolates col ected from 135 lactating cows with subclinical ...

  1. epidemiological study of urinary schistosomiasis among primary ...

    African Journals Online (AJOL)

    The prevalence of Schistosoma haematobium infection was investigated among primary school pupils in Ekiti State by questionnaire survey in 601 schools between 1997 and 1998. A total of 9,551 (24.4%) were positive by the survey. 3483 (22.4%) of the girls and 6,069 (25.7%) of the boys were infected. The prevalence of ...

  2. User apathy towards library resources and Service: a case study of ...

    African Journals Online (AJOL)

    This study was conducted in the University of Calabar Library, Calabar, Nigeria using survey research design. The population of the study consisted of all registered undergraduate library users between the 2014 and 2015. The total population of the study was 5,244 users. Accidental sampling technique was used to select ...

  3. enugu to school based sex education.

    African Journals Online (AJOL)

    Objective: To assess the knowledge and attitude to sex education among secondary school teachers in Enugu. Materials and Methods: ... respondents were of the opinion that teachers needed to be trained to provide sex education to students and 244. (81 .3%) admitted ... affection, intimacy, body image and gender roles 1.

  4. Cognitive specialization for verbal vs. spatial ability in men and women : Neural and behavioral correlates

    NARCIS (Netherlands)

    Yeo, Ronald A.; Ryman, Sephira G.; Thompson, Melissa E.; van den Heuvel, Martijn P.|info:eu-repo/dai/nl/304820466; de Reus, Marcel A.|info:eu-repo/dai/nl/413970728; Pommy, Jessica; Seaman, Brandi; Jung, Rex E.

    2016-01-01

    An important dimension of individual differences, independent of general cognitive ability (GCA), is specialization for verbal or spatial ability. In this study we investigated neuroanatomic, network, and personality features associated with verbal vs. spatial ability. Healthy young adults (N = 244)

  5. Characterization of the functional epitope on the urokinase receptor. Complete alanine scanning mutagenesis supplemented by chemical cross-linking

    DEFF Research Database (Denmark)

    Gårdsvoll, Henrik; Gilquin, Bernard; Le Du, Marie Hélène

    2006-01-01

    a comprehensive alanine scanning mutagenesis of uPAR combined with low resolution distance constraints defined within the complex using chemical cross-linkers as molecular rulers. The kinetic rate constants for the interaction between pro-uPA and 244 purified uPAR mutants with single-site replacements were...

  6. Does Sex Influence the Diagnostic Evaluation of Autism Spectrum Disorder in Adults?

    Science.gov (United States)

    Wilson, C. Ellie; Murphy, Clodagh M.; McAlonan, Grainne; Robertson, Dene M.; Spain, Debbie; Hayward, Hannah; Woodhouse, Emma; Deeley, P. Quinton; Gillan, Nicola; Ohlsen, J. Chris; Zinkstok, Janneke; Stoencheva, Vladimira; Faulkner, Jessica; Yildiran, Hatice; Bell, Vaughan; Hammond, Neil; Craig, Michael C.; Murphy, Declan G. M.

    2016-01-01

    It is unknown whether sex influences the diagnostic evaluation of autism spectrum disorder, or whether male and female adults within the spectrum have different symptom profiles. This study reports sex differences in clinical outcomes for 1,244 adults (935 males and 309 females) referred for autism spectrum disorder assessment. Significantly, more…

  7. Microbiologically Influenced Corrosion in Copper and Nickel Seawater Piping Systems

    Science.gov (United States)

    1990-09-01

    169. London: Newnes-Butterworths. nickel alloys. Biologia Marina , Proceedings of 5th Interna- Southwell, C. R. and Alexander, A. L. 1967. Corrosion of...sulfur accumulated within the region of the pit and lization in fouling diatoms. Botanica Marina . 24(4): reacted with the iron and nickel in the alloy

  8. Parallel Decompositions for Network-Structured Problems

    Science.gov (United States)

    1994-04-10

    sabbtical. With my greatest appreciation fnr your support during this project. Smrnerely ynrrR, Stavroo A. Zenioa cc: Offiep of Research Administration ...Matematica Pura e Aplicada . Diazil. 1993, (280 pages), ISBN 85-244- 0074-9. [21 I. Krwss, M. Pinr, T. Thompson, and S.A. Zcnio3. A large scale modcl for naval

  9. Domain Modeling: NP_067638.3 [SAHG[Archive

    Lifescience Database Archive (English)

    Full Text Available NP_067638.3 chr12 Crystal Structure of the Ankyrin Repeat Domain of Trpv1 p2pnna_ chr12/NP_067638....3/NP_067638.3_holo_148-395.pdb blast 155F,187E,192K,197K,200L,201N,231F,236Y,239Q,244I,247E,272F ATP 0 ...

  10. Gclust Server: 87214 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available 87214 SCE_YDR364C=CDC40 Cluster Sequences Related Sequences(244) 455 Pre-mRNA splicing factor, important...quence length 455 Representative annotation Pre-mRNA splicing factor, important for catalytic step II of pre

  11. Sleep, Sleepiness and Medical College Students: A Comparative ...

    African Journals Online (AJOL)

    Travel time of Hostellers was a maximum 40 minutes while day scholars was up to 4 hours/day. Poor sleep quality was reported by 20.7% students and Excessive Day time Sleepiness (ESS) by 24.4% students. More number of MBBS day scholars reported poor sleep quality and ESS than the hostellers. No student reported ...

  12. Investigating Associations between School Climate and Bullying in Secondary Schools: Multilevel Contextual Effects Modeling

    Science.gov (United States)

    Konishi, Chiaki; Miyazaki, Yasuo; Hymel, Shelley; Waterhouse, Terry

    2017-01-01

    This study examined how student reports of bullying were related to different dimensions of school climate, at both the school and the student levels, using a contextual effects model in a two-level multilevel modeling framework. Participants included 48,874 secondary students (grades 8 to 12; 24,244 girls) from 76 schools in Western Canada.…

  13. General practitioners' attitude to sport and exercise medicine services: a questionnaire-based survey.

    Science.gov (United States)

    Kassam, H; Tzortziou Brown, V; O'Halloran, P; Wheeler, P; Fairclough, J; Maffulli, N; Morrissey, D

    2014-12-01

    Sport and exercise medicine (SEM) aims to manage sporting injuries and promote physical activity. This study explores general practitioners' (GPs) awareness, understanding and utilisation of their local SEM services. A questionnaire survey, including patient case scenarios, was administered between February and May 2011. 693 GPs working in Cardiff and Vale, Leicester and Tower Hamlets were invited to participate. 244 GPs responded to the questionnaire (35.2% response rate). Less than half (46%; 112/244) were aware of their nearest SEM service and only 38% (92/244) had a clear understanding on referral indications. The majority (82%; 199/244) felt confident advising less active patients about exercise. There were divergent management opinions about the case scenarios of patients who were SEM referral candidates. Overall, GPs were significantly more likely to refer younger patients and patients with sport-related problems rather than patients who would benefit from increasing their activity levels in order to prevent or manage chronic conditions (pclinics but of those who had 75% (70/93) rated the service as good. There is a lack of awareness and understanding among GPs on the role of SEM within the National Health Service which may be resulting in suboptimal utilisation especially for patients who could benefit from increasing their activity levels. Published by the BMJ Publishing Group Limited. For permission to use (where not already granted under a licence) please go to http://group.bmj.com/group/rights-licensing/permissions.

  14. Sedative and Anticonvulsant Activities of the Ethanol Root Extract of ...

    African Journals Online (AJOL)

    , Moradabad-244 001, U.P., 2Department of. Pharmaceutical ... Purpose: To investigate the sedative, hypnotic and anticonvulsant activities of the ethanol extract of the roots of the ... Flemingia is a genus of flowering plants in the legume family ...

  15. Phenolic compounds of Dragon's blood from Dracaena draco.

    Science.gov (United States)

    González, A G; León, F; Sánchez-Pinto, L; Padrón, J I; Bermejo, J

    2000-09-01

    Three new compounds, 2,4,4'-trihydroxydihydrochalcone (1), 3-(4-hydroxybenzyl)-5,7-dimethoxychroman (2), and 7-hydroxy-3-(4-hydroxybenzyl)chromone (3), were isolated from the resin "Dragon's blood" obtained from Dracaena draco along with 18 known compounds. The structures of 1, 2, and 3 were determined using MS and NMR techniques.

  16. Patterns of Parenting during Adolescence: Perceptions of Adolescents and Parents.

    Science.gov (United States)

    Paulson, Sharon E.; Sputa, Cheryl L.

    1996-01-01

    Explores differences in maternal and paternal parenting styles and involvement, the differences between parents' and adolescents' perceptions of parenting style and involvement, and changes in parenting style and involvement between the adolescents' 9th and 12th grade years. Subjects were 244 ninth graders from the Southeast and Midwest. Discusses…

  17. 48Ca induced reactions for the synthesis of isotopes 284–292Fl

    Science.gov (United States)

    Santhosh, K. P.; Safoora, V.

    2017-12-01

    The production cross sections for the synthesis of superheavy elements 284–292Fl (Z = 114) using the fusion reactions 48Ca+236-244Pu were systematically calculated. Using Coulomb and proximity potentials as the interaction barrier, we calculated the capture cross section, probability of CN formation, survival probability of excited compound nuclei, fusion cross section, and evaporation residue (ER) cross section for these reactions at energies near and above the Coulomb barrier. Our calculated ER cross section values for the reactions 48Ca+240Pu→288Fl, 48Ca+242Pu→290Fl and 48Ca+244Pu→292Fl are in excellent agreement with available experimental values. The predicted maximum value of the ER cross section in 2n, 3n, 4n, and 5n channels for all the reactions 48Ca+236–244Pu→284–292Fl are listed. It was found that the reactions 48Ca +243Pu→291Fl and 48Ca +244Pu→292Fl were more favorable with a maximum ER cross section of 6.924 (3n) and 9.033 pb (4n), respectively. Our studies will be useful for future experiments to synthesize the isotopes of element Fl that have not been synthesized so far.

  18. Antioxidant activity, total phenolic and flavonoid contents of the ...

    African Journals Online (AJOL)

    Phytochemical analysis of MWPE showed presence of major classes of phytochemicals. In vitro antioxidant activities of the crude extracts were significant and comparable with the standard ascorbic acid.The high contents of total phenolic compounds (244.14 ± 1.62 mg GAE/g of dry extract) and total flavonoids (66.24 ± 2.22 ...

  19. The effect of pulmonary tuberculosis on neurocognitive function in ...

    African Journals Online (AJOL)

    To examine group differences in neurocognitive status, we used Wilcoxon ranked sum tests to compare the performance between groups on neuropsychological test battery. Results: Out of 324, only 244 were studied. Results indicated significant neurocognitive impairment in PTB+/HIV+ group than PTB-/HIV+ in the GDS, ...

  20. Dicty_cDB: Contig-U08029-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available |pid:none) Agrotis ipsilon cytoplasmic actin ... 247 9e-64 FJ372564_1( FJ372564 |pid:none) Sedum alfredii i... mRNA for cytoplasmic gamma-actin. 244 4e-63 FJ372563_1( FJ372563 |pid:none) Sedum alfredii isolate Heact1 a

  1. Special Course on Aerothermodynamics of Hypersonic Vehicles

    Science.gov (United States)

    1989-06-01

    Roquefort , T.: ’Ecoulement Tridimensionnel Hypersonique aur une Combinaison D’Ellipsoldes’. CET, Poitiers, Rapport No. 4R0MF86, 1967. [166] Riedelbauch, S...J.L. Transition de bord d’attaque en 6coulement hyper- AYMER de la CHEVALIERE D. sonique. ALZIARY de ROQUEFORT T. 244me Colloque d’Arothermodynamique

  2. Psychosocial outcome in patients at clinical high risk of psychosis: a prospective follow-up

    NARCIS (Netherlands)

    Salokangas, Raimo K. R.; Nieman, Dorien H.; Heinimaa, Markus; Svirskis, Tanja; Luutonen, Sinikka; From, Tiina; von Reventlow, Heinrich Graf; Juckel, Georg; Linszen, Don; Dingemans, Peter; Birchwood, Max; Patterson, Paul; Schultze-Lutter, Frauke; Klosterkötter, Joachim; Ruhrmann, Stephan

    2013-01-01

    In patients at clinical high risk (CHR) of psychosis, transition to psychosis has been the focus of recent studies. Their broader outcome has received less attention. We studied psychosocial state and outcome in CHR patients. In the European Prediction of Psychosis Study, 244 young help-seeking CHR

  3. 78 FR 59475 - Architectural Barriers Act Accessibility Guidelines; Outdoor Developed Areas

    Science.gov (United States)

    2013-09-26

    ... INFORMATION CONTACT: William Botten, Access Board, 1331 F Street NW., Suite 1000, Washington, DC 20004-1111... do not have walls and would not be able to comply with the technical requirements for toilet... are available for individuals with disabilities until all the camping units are occupied. F244.2.1...

  4. Post-Traumatic Stress and Alcohol-Related Problems Following a College Shooting: Effect of Help-Seeking

    Science.gov (United States)

    Siebert, Erin C.; Stewart, David G.; Hu, Emily M.; Estoup, Ashley C.; Underbrink, Erin G.; Moore, Lindsay S.

    2018-01-01

    Our aim was to test the hypothesized relationships between trauma exposure and alcohol-related problems, mediated by PTS symptoms, moderated by prior trauma exposure and help-seeking. Participants were 244 members of a private university who were enrolled or employed at the school on the date of a campus shooting. Online measures were distributed…

  5. Self-Esteem Trajectories and Their Social Determinants in Adolescents with Different Levels of Cognitive Ability

    Science.gov (United States)

    Morin, Alexandre J. S.; Arens, A. Katrin; Tracey, Danielle; Parker, Philip D.; Ciarrochi, Joseph; Craven, Rhonda G.; Maïano, Christophe

    2017-01-01

    This study examines the development of self-esteem in a sample of 138 Australian adolescents (90 males; 48 females) with cognitive abilities in the lowest 15% (L-CA) and a matched sample of 556 Australian adolescents (312 males; 244 females) with average to high levels of cognitive abilities (A/H-CA). These participants were measured annually…

  6. 77 FR 25723 - Extension and Redesignation of Somalia for Temporary Protected Status

    Science.gov (United States)

    2012-05-01

    ... on movement and operations of aid agencies, and corruption were factors that hampered delivery of... under good cause for late re-registration. However, applicants are urged to re-file within 45 days of... Act; 8 U.S.C. 1254a(c)(3)(C); 8 CFR 244.17(c). For more information on good cause for late re...

  7. RF cavities of CESAR (2 MeV electron storage ring).

    CERN Multimedia

    Service Photo; CERN PhotoLab

    1968-01-01

    RF cavity. There were 2 identical ones: one for stacking (accumulation) procedures; the other for scanning with "empty buckets" (measurement of beam density distribution). Both were operated at h=2 (2nd harmonic of the revolution frequency), i.e. at around 24.4 MHz. Voltage, frequency and phase were programmed with analogue circuits.

  8. CESAR, 2 MeV electron storage ring; construction period; RF cavity.

    CERN Multimedia

    Service Photo; CERN PhotoLab

    1962-01-01

    RF cavity. There were 2 identical ones: one for stacking (accumulation) procedures; the other for scanning with "empty buckets" (measurement of beam density distribution). Both were operated at h=2 (2nd harmonic of the revolution frequency), i.e. at around 24.4 MHz. Voltage, frequency and phase were programmed with analogue circuits.

  9. Disease: H01327 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available 103] ... ICD-10: B08.5 MeSH: D006557 MedlinePlus: 000969 PMID:17671037 (description) ... AUTHORS ... Chen KT, Chang HL, Wan...ot-mouth disease and herpangina caused by enterovirus 71 in Taiwan, 1998-2005. ... JOURNAL ... Pediatrics 120:e244-52 (2007) DOI:10.1542/peds.2006-3331

  10. Physicochemical attributes of oils from seeds of different plants in ...

    African Journals Online (AJOL)

    The iodine values of the oils (31.50-85.00 mg iodine/100 g) placed them in the non-drying class. The saponification values of all the seven oils (161.29-244.97 mg KOH/g oil) suggest their usefulness in the industry as shaving cream. KEY WORDS: Seed, Oil, Physico-chemical, Attributes, Plant, Nigeria. Bull. Chem. Soc.

  11. 75 FR 24734 - Extension of the Designation of Honduras for Temporary Protected Status and Automatic Extension...

    Science.gov (United States)

    2010-05-05

    ... an environmental disaster within that country, specifically the devastation resulting from Hurricane... underemployed in 2008. The 2009 political crisis exacerbated the effects of the global economic downturn in... living conditions in Honduras as the result of an environmental disaster. See section 244(b)(1)(B) of the...

  12. Drug: D04103 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D04103 Drug Etoformin hydrochloride (USAN) ... C8H19N5. HCl D04103.gif ... Antidiabetic... agent ... DG01685 ... Insulin sensitizer ... DG01684 ... Biguanide antidiabetic Unclassified ... DG02044 ... Hypoglycemics ... ... DG01684 ... Biguanide antidiabetic ... Biganides ... CAS: 53597-26-5 PubChem: 47206055 ChEMBL: CHEMBL2106592 LigandBox: D04103 NIKKAJI: J244.891B ...

  13. Attitudes of Undergraduate Students to the Uses of Animals.

    Science.gov (United States)

    Stanisstreet, Martin; And Others

    1993-01-01

    A survey of 244 British university undergraduates in biology, computer science, and English investigated attitudes about various uses of animals, including killing animals to make luxury clothing, killing of animals for food, general and medical research using animals, and captivity. Response differences by discipline, gender, and age were also…

  14. A 31-residue peptide induces aggregation of tau's microtubule-binding region in cells

    Science.gov (United States)

    Stöhr, Jan; Wu, Haifan; Nick, Mimi; Wu, Yibing; Bhate, Manasi; Condello, Carlo; Johnson, Noah; Rodgers, Jeffrey; Lemmin, Thomas; Acharya, Srabasti; Becker, Julia; Robinson, Kathleen; Kelly, Mark J. S.; Gai, Feng; Stubbs, Gerald; Prusiner, Stanley B.; Degrado, William F.

    2017-09-01

    The self-propagation of misfolded conformations of tau underlies neurodegenerative diseases, including Alzheimer's. There is considerable interest in discovering the minimal sequence and active conformational nucleus that defines this self-propagating event. The microtubule-binding region, spanning residues 244-372, reproduces much of the aggregation behaviour of tau in cells and animal models. Further dissection of the amyloid-forming region to a hexapeptide from the third microtubule-binding repeat resulted in a peptide that rapidly forms fibrils in vitro. We show that this peptide lacks the ability to seed aggregation of tau244-372 in cells. However, as the hexapeptide is gradually extended to 31 residues, the peptides aggregate more slowly and gain potent activity to induce aggregation of tau244-372 in cells. X-ray fibre diffraction, hydrogen-deuterium exchange and solid-state NMR studies map the beta-forming region to a 25-residue sequence. Thus, the nucleus for self-propagating aggregation of tau244-372 in cells is packaged in a remarkably small peptide.

  15. 75 FR 41093 - FM Table of Allotments, Maupin, Oregon

    Science.gov (United States)

    2010-07-15

    ... of Maupin Broadcasting Company, requesting the deletion of Channel 244C2 at Maupin, Oregon. We are... Order, MB Docket No. 09-130, adopted June 25, 2010, and released June 28, 2010. The full text of this... Street, SW, Room CY-B402, Washington, DC 20554, 800-378-3160 or via the company's website, http://www...

  16. THE BACTERIOLOGICAL SAFETY AND ANTIMICROBIAL ...

    African Journals Online (AJOL)

    GB

    2013-03-01

    Mar 1, 2013 ... the bacteriological quality of waters used for soaking white lupin. Key Words: ... insects and other household rodents, which may ..... Meng J. Retail meat and poultry as a reservoir of antimicrobial- resistant Escherichia coli. Food Microbiol,. 2004; 21: 244-255. 9. Muleta D, Ashenafi M. Bacteriological profile.

  17. 76 FR 21810 - Defense Federal Acquisition Regulation Supplement; Acquisition of Commercial Items (DFARS Case...

    Science.gov (United States)

    2011-04-19

    ... the legislation that does not conflict with existing requirements established to ensure the government... rule at lower tiers would be impracticable and could cause significant delays in the negotiation and... potential conflict with DFARS part 244. The respondent stated that if the rule applies to subcontracts, it...

  18. Influence of behaviour and risk factors on motor performance in preterm infants at age 2 to 3 years.

    NARCIS (Netherlands)

    Janssen, A.J.; Nijhuis-Van der Sanden, M.W.G.; Akkermans, R.P.; Oostendorp, R.A.B.; Kollee, L.A.A.

    2008-01-01

    The aim of this cross-sectional study was to determine the influence of test-taking behaviour and risk factors for delayed motor performance in 437 preterm infants (244 males, 193 females; < or = 32 weeks of gestation) at the corrected age of 2 to 3 years (mean 29mo [SD 3.3]). Other mean (SD)

  19. Data of evolutionary structure change: 1JH5I-2AZ5A [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available ID> I 1JH5I LYTDK-----TYAMG ...>EE -----EEEEE> ATOM 9622 CA LEU I 59 -64.244 97.997...ain> 2AZ5A LFKGQGCPSTHVLLT >EEEE EE... 2AZ5A IAVSY----QTKVN ...>E ---- EEE > ATOM 526 CA ILE A 83 -19.844 60.232 51

  20. Motivational structure and alcohol use of university students across four nations

    NARCIS (Netherlands)

    Cox, W. Miles; Schippers, Gerard M.; Klinger, Eric; Skutle, Arvid; Stuchlíková, Iva; Man, Frantisek; King, Amy L.; Inderhaug, Ragnhild

    2002-01-01

    OBJECTIVE: The ability of motivational structure and other variables to predict alcohol consumption was assessed in university students (N = 370; 244 women) in the Czech Republic, The Netherlands, Norway and the United States. METHOD: Motivational structure was assessed with the Motivational

  1. AcEST: DK947152 [AcEST

    Lifescience Database Archive (English)

    Full Text Available _DROME THO complex subunit 5 OS=Drosophila melano... 32 2.7 sp|O76199|TX25A_PHONI Neurotoxin Pn2-5A OS=Phone... 500 EE+ F +V E + Q Sbjct: 226 EEQSFTAEVVGYESEAQMQ 244 >sp|O76199|TX25A_PHONI Neurotoxin Pn2-5A OS=Phoneutri

  2. Gclust Server: 75341 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available 244 putative branched-chain amino acid transport system ATP-binding protein 1 1.00e-99 0.0 0.0 0.0 6.67...annotation putative branched-chain amino acid transport system ATP-binding protein Number of Sequences 1 Homologs

  3. Do daily and seasonal trends in leaf solar induced fluorescence reflect changes in photosynthesis, growth or light exposure

    Czech Academy of Sciences Publication Activity Database

    Wyber, R.; Malenovský, Zbyněk; Ashcroft, M. B.; Osmond, C. B.; Robinson, S. A.

    2017-01-01

    Roč. 9, č. 6 (2017), č. článku 604. ISSN 2072-4292 Institutional support: RVO:67179843 Keywords : Light induced fluorescence transient * Photosynthetic active radiation * Photosynthetic yield * Pulse amplitude modulation * Remote sensing of vegetation Subject RIV: EH - Ecology, Behaviour Impact factor: 3.244, year: 2016

  4. The Supreme Court’s Role in Defining the Jurisdiction of Military Courts: A Study and Proposal

    Science.gov (United States)

    2005-01-01

    courts-martial. See United States v. Jacoby , 29 C.M.R. 244 (C.M.A. 1960) (holding that the Bill of Rights apply to Soldiers unless explicitly or...corpus has served as a means of reviewing the legality of executive detention.”); see also Roberto Iraola, Enemy Combatants, the Courts, and the

  5. Download this PDF file

    African Journals Online (AJOL)

    in River Ase, Bagridae was the most dominant family accounting for 24.4% of the total ... Based on the location of human settlements and the drainage characteristics of the ... The whole fishing operation was monitored from a boat fitted with an ...

  6. Browse Author Index

    African Journals Online (AJOL)

    Items 101 - 150 of 244 ... Musila, F. Musiliu, Olayide Popoola · Musiomi, TM · Muthakia, Gerald K. Muthengia, Wachira J. Mutothia, FU · Mutuku, Raphael N · Mutuku, Raphael N. Mutuku, Raphael N. Mwangi, GM · Mwangi, JK · Mwangi, JM · Mwangi, John K. Mwea, Sixtus Kinyua · Mwea, SK · Mwero, JN · Mwishwa, YHB ...

  7. 27 CFR 21.64 - Formula No. 37.

    Science.gov (United States)

    2010-04-01

    ...-five fluid onces of eucalyptol, N.F. XII, 30 avoirdupois ounces of thymol, N.F., and 20 avoirdupois... pharmaceuticals, not U.S.P. or N.F. 244.Antispetic solutions, U.S.P. or N.F. 410.Disinfectants, insecticides...

  8. Dicty_cDB: SHG136 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available lium discoideum ORFveg106 mRNA, complete cds. 52 0.003 1 AC154920 |AC154920.3 Muntiacus muntjak vaginalis cl...AC168948 |AC168948.2 Muntiacus muntjak vaginalis clone CH244-253D19, WORKING DRAFT SEQUENCE, 4 ordered piece

  9. Drug: D01301 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D01301 Drug Metenolone enanthate (JP16); Methenolone enanthate (USAN); Primobolan d...nts affecting individual organs 24 Hormones 244 Anabolic steroid preparations 2449 Others D01301 Metenolone ...ANABOLIC STEROIDS A14AA Androstan derivatives A14AA04 Metenolone D01301 Metenolone enanthate (JP16); Metheno...ptors 3-Ketosteroid receptor androgen receptor [HSA:367] [KO:K08557] Metenolone [

  10. 75 FR 36300 - Enhancing Airline Passenger Protections

    Science.gov (United States)

    2010-06-25

    ... receive this notice in an alternative format may be made by contacting the above named individuals... rulemaking using the social networking pilot project, Regulation Room, established by DOT in partnership with... recordkeeping requirements. 14 CFR Part 244 Air carriers, Consumer protection, Tarmac delay data. 14 CFR Part...

  11. Dicty_cDB: VFD159 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available robrachium rosenbergii beta-act... 236 e-113 (Q54HE9) RecName: Full=Putative actin-...1( AY763403 |pid:none) Tretomphalus sp. B123 clone nTRE35... 244 e-119 AY651918_1( AY651918 |pid:none) Mac

  12. DOCTORS LIFESTYLE IN ENUGU, NIGERIA M. N. AGHAJI ...

    African Journals Online (AJOL)

    hi-tech

    2000-09-09

    Sep 9, 2000 ... of alcoholic drink consumption, weekly participation in leisure physical activity, the most recent weight and height measurents. Results: The rate of alcohol misuse was F=3.3%, M=10.0%; tobacco use was F=2.2%,. M=24.4% while only males currently smoked cigarettes (21.9%). The prevalence of over.

  13. Doctors lifestyle in Enugu, Nigeria | Aghaji | East African Medical ...

    African Journals Online (AJOL)

    Main outcome measures: Self-reported data on tobacco use, cigarette smoking, weekly unit of alcoholic drink consumption, weekly participation in leisure physical activity, the most recent weight and height measurents. Results: The rate of alcohol misuse was F=3.3%, M=10.0%; tobacco use was F=2.2%, M=24.4% while ...

  14. “Expect More Floods In 2013”: An analysis of flood preparedness in ...

    African Journals Online (AJOL)

    Chi-square test was used to establish significant variations in the level of flood preparedness, the level of awareness of NIMET flood warning, flood risk perception and subscription to flood insurance. Findings show that the levels of awareness about NIMET flood warning (36.4%), flood risk perception (24.4%), flood ...

  15. Journal of Chemical Sciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Chemical Sciences. Nikhil Guchhait. Articles written in Journal of Chemical Sciences. Volume 113 Issue 3 June 2001 pp 235-244 Physical and Theoretical. Benzyl alcohol-ammonia (1:1) cluster structure investigated by combined IR-UV double resonance spectroscopy in jet and ab initio ...

  16. 76 FR 23109 - Enhancing Airline Passenger Protections

    Science.gov (United States)

    2011-04-25

    ... from airlines, airports and other industry entities on whether there are any special operational... April 25, 2011 Part IV Department of Transportation 14 CFR Parts 244, 250, 253 Et al. Enhancing Airline..., 253, 259, and 399 RIN 2105-AD92 Enhancing Airline Passenger Protections AGENCY: Office of the...

  17. Effect Of Feeding Hordeum jabatum Hay Supplemented With ...

    African Journals Online (AJOL)

    The fermentation profiles and nutrient digestibility of Leucaena leucocephala as a supplement to Hordeum jabatum hay was investigated using twelve castrated sheep averaging 24.4 ± 2.2 kg body weight (BW). Six of the sheep were fistulated at the rumen and used for ruminal pH, ammonia and volatile fatty acid ...

  18. 76 FR 12979 - Submission for OMB Review: Comment Request; Questionnaire Cognitive Interviewing and Pretesting...

    Science.gov (United States)

    2011-03-09

    ... 1, 1995, unless it displays a currently valid OMB control number. Proposed Collection: Title... most common evaluation method is the cognitive interview, in which a questionnaire design specialist... at $244,000 and include cost of NCI staff to plan, conduct, and analyze outcomes of questionnaire...

  19. TropJrnal Vol 27 No2 4Intnet publicatn

    African Journals Online (AJOL)

    Administrator

    . Inter. Fam Plann Persp 1998; 24(4): 156-164. 4. Unuigbe J.A.,Oronsaye A.U., Orhue A.A.. Preventable factors in abortion related mortality in Africa. Focus on abortion deaths in Benin-. City Nigeria. Trop J Obstet Gynaecol 1988;. 1:36-39. 5.

  20. Thrilling but Pointless: General JO Shelby’s 1863 Cavalry Raid

    Science.gov (United States)

    2013-12-13

    crime known to the code of war and the punishment is death. Anyone caught in the act will be immediately shot, and any one accused of this crime will......Crittenden, a fellow Kentuckian, had been a guest at Shelby’s wedding and Shelby “viewed his present affiliations as a disgrace to their native state.”244