WorldWideScience

Sample records for californium 244

  1. Historical review of californium-252 discovery and development

    International Nuclear Information System (INIS)

    This paper discusses the discovery and history of californium 252. This isotope may be synthesized by irradiating plutonium 239, plutonium 242, americium 243, or curium 244 with neutrons in a nuclear reactor. Various experiments and inventions involving 252Cf conducted at the Savannah River Plant are discussed. The evolution of radiotherapy using californium 252 is reviewed

  2. Metabolism and toxicity of californium

    International Nuclear Information System (INIS)

    Metabolism of californium can be compared with that of other transplutonium elements. The most important points are as follows: a fast blood clearance and fast bone uptake more important than liver uptake, a relatively high urinary excretion and kidney retention. Blood clearance of californium can be compared with that of americium. Distribution of californium 252 nitrate after intramuscular injection in rats was studied. There are very few experimental data on acute or long term toxicity of californium. (28 references)

  3. Magnetism in californium

    International Nuclear Information System (INIS)

    A SQUID-based magnetic susceptometer has been constructed for studying small radioactive samples at temperatures below 350 K and in magnetic fields up to 50 kilogauss. The device has been used to study californium (element 98) in a number of solid-state forms: the dhcp metal, several oxides (Cf2O3 in both the bcc and monoclinic structures, Cf7O12, CfO2 and BaCfO3), several monopnictides (CfN, CfAs and CfSb) and the trichloride (in both the hexagonal and orthorhombic structures). All of these materials were studied in polycrystalline form, and hexagonal CfCl3 was studied in single-crystal form as well. The susceptometer has the sensitivity to measure samples containing less than 10 micrograms of californium. The magnetic susceptibilities of all of the californium materials at temperatures above about 100 K are described well by the Curie-Weiss relationship. This behavior is consistent with the assumption that the magnetic 5f electrons are localized and that the paramagnetic behavior can be interpreted in terms of the properties of the free ion. The measured values of the effective paramagnetic moment, μ/sub eff/, for all the californium materials that were studied are reasonably consistent with theoretical values based on intermediate coupling models. All of the californium materials showed some indications of cooperative magnetic effects. The dhcp metal was observed to order ferromagnetically at 52 K, and all of the californium compounds studied showed signs of antiferromagnetic ordering, mostly at temperatures below 25 K. 91 refs., 50 figs., 19 tabs

  4. Californium Multiplier (CFX)

    International Nuclear Information System (INIS)

    The availability of 252Cf as an economical high-intensity neutron source has made it possible to construct compact neutron irradiation devices with widespread applications. The simplest such device consists of a single 252Cf source within a moderating and shielding medium. Higher neutron flux levels can be attained either through the use of more 252Cf or through source multiplication by means of a subcritical uranium assembly. Although the use of larger 252Cf sources to achieve higher neutron flux is technically straightforward, an economic penalty is paid as the source strength is increased. Larger californium sources imply larger initial investments to cover the cost of source material and larger operating costs resulting from the decay of the 252Cf source. A Californium Multiplier, the CFX, which produces a flux enhancement of 30 when compared to a conventional moderated 252Cf system has been designed, licensed, built, and tested by IRT Corporation. Such systems are now available on a commercial basis for both neutron radiography and neutron activation analysis. The first commercial CFX system was installed at the Research Laboratories of Eastman Kodak Company in Rochester, NY, in March 1975. This device, using 1 mg of 252Cf, is very stable and the neutron flux generated by the CFX is very reproducible. The performance characteristics of this system are summarized

  5. Californium--palladium metal neutron source material

    Science.gov (United States)

    Dahlen, B.L.; Mosly, W.C. Jr.; Smith, P.K.; Albenesius, E.L.

    1974-01-22

    Californium, as metal or oxide, is uniformly dispersed throughout a noble metal matrix, provided in compact, rod or wire form. A solution of californium values is added to palladium metal powder, dried, blended and pressed into a compact having a uni-form distribution of californium. The californium values are decomposed to californium oxide or metal by heating in an inert or reducing atmosphere. Sintering the compact to a high density closes the matrix around the dispersed californium. The sintered compact is then mechanically shaped into an elongated rod or wire form. (4 claims, no drawings) (Official Gazette)

  6. Californium-252 Neutron Sources for Medical Applications

    International Nuclear Information System (INIS)

    Californium-252 neutron sources are being prepared to investigate the value of this radionuclide in diagnosing and treating diseases. A source resembling a cell-loaded radium needle was developed for neutron therapy. Since therapy needles are normally implanted in the body, very conservative design criteria were established to prevent leakage of radioactive. Methods are being developed to prepare very intense californium sources that could be used eventually for neutron radiography and for diagnosis by neutron activation analysis. This paper discusses these methods

  7. Production of extra pure curium and californium preparations

    International Nuclear Information System (INIS)

    Preparations of curium-244,245,248 and californium-249,252 are used for the production of ionizing radiation sources for different applications and fundamental nuclear-physical investigations, placing high requirements on the radiochemical and chemical purity of the preparations. Extraction chromatography using di-(2-ethylhexyl)phosphoric acid (D2EHPA) as extractant was chosen to prepare extra pure curium and californium preparations. In order to identify the optimal conditions of Cm-Cf separation and to remove impurities from them (reagent and other impurities), investigations were performed into the effect of impurities (Na+, Ca2+, Al3+, Fe2+, Fe3+ taken as example), extractant and eluent concentration and solution flow rate on the efficiency of mutual purification of Cm and Cf. Both theoretical and experimental estimations were made of the maximum concentration at which the impurities do not affect the process. The conditions chosen allow mutual purification of milligram amounts of Cm and Cf from impurity elements at E(pur) =102 - 103 during a single chromatographic cycle (E(pur) =>103) using a column with 5 - 10 cm3 volume. In this case the production yield exceeds 98%. The purification of milligram amounts of curium and californium from fission products (lanthanides in general, cerium in particular) was performed in D2EHPA-decane-PbO2-HNO3 and D2EHPA-decane-DTPA-H3-Cit extraction chromatography systems. In order to establish the optimal conditions, the effect of [D2EHPA] and eluent on the mutual purification of Cm and Cf and on their purification from cerium and impurity elements was studied in the D2EHPA-decane-PbO2-HNO3 system. During a single chromatographic cycle the mutual purification factors of TPE and of their purification from impurity cations achieve 102-103, from cerium - E(pur) > 10. In the D2EHPA-decane-DTPA-H3Cit system, the effect of concentration of extractant and eluent pH on the efficiency of Cm and Cf purification from lanthanides was

  8. Californium Electrodepositions at Oak Ridge National Laboratory

    Energy Technology Data Exchange (ETDEWEB)

    Boll, Rose Ann [ORNL

    2015-01-01

    Electrodepositions of californium isotopes were successfully performed at Oak Ridge National Laboratory (ORNL) during the past year involving two different types of deposition solutions, ammonium acetate (NH4C2H3O2) and isobutanol ((CH3)2CHCH2OH). A californium product that was decay enriched in 251Cf was recovered for use in super-heavy element (SHE) research. This neutron-rich isotope, 251Cf, provides target material for SHE research for the potential discovery of heavier isotopes of Z=118. The californium material was recovered from aged 252Cf neutron sources in storage at ORNL. These sources have decayed for over 30 years, thus providing material with a very high 251Cf-to-252Cf ratio. After the source capsules were opened, the californium was purified and then electrodeposited using the isobutanol method onto thin titanium foils for use in an accelerator at the Joint Institute for Nuclear Research in Dubna, Russia. Another deposition method, ammonium acetate, was used to produce a deposition containing 1.7 0.1 Ci of 252Cf onto a stainless steel substrate. This was the largest single electrodeposition of 252Cf ever prepared. The 252Cf material was initially purified using traditional ion exchange media, such as AG50-AHIB and AG50-HCl, and further purified using a TEVA-NH4SCN system to remove any lanthanides, resulting in the recovery of 3.6 0.1 mg of purified 252Cf. The ammonium acetate deposition was run with a current of 1.0 amp, resulting in a 91.5% deposition yield. Purification and handling of the highly radioactive californium material created additional challenges in the production of these sources.

  9. Californium-252: a remarkable versatile radioisotope

    Energy Technology Data Exchange (ETDEWEB)

    Osborne-Lee, I.W.; Alexander, C.W.

    1995-10-10

    A product of the nuclear age, Californium-252 ({sup 252}Cf) has found many applications in medicine, scientific research, industry, and nuclear science education. Californium-252 is unique as a neutron source in that it provides a highly concentrated flux and extremely reliable neutron spectrum from a very small assembly. During the past 40 years, {sup 252}Cf has been applied with great success to cancer therapy, neutron radiography of objects ranging from flowers to entire aircraft, startup sources for nuclear reactors, fission activation for quality analysis of all commercial nuclear fuel, and many other beneficial uses, some of which are now ready for further growth. Californium-252 is produced in the High Flux Isotope Reactor (HFIR) and processed in the Radiochemical Engineering Development Center (REDC), both of which are located at the Oak Ridge National Laboratory (ORNL) in Oak Ridge, Tennessee. The REDC/HFIR facility is virtually the sole supplier of {sup 252}Cf in the western world and is the major supplier worldwide. Extensive exploitation of this product was made possible through the {sup 252}Cf Market Evaluation Program, sponsored by the United States Department of Energy (DOE) [then the Atomic Energy Commission (AEC) and later the Energy Research and Development Administration (ERDA)]. This program included training series, demonstration centers, seminars, and a liberal loan policy for fabricated sources. The Market Evaluation Program was instituted, in part, to determine if large-quantity production capability was required at the Savannah River Laboratory (SRL). Because of the nature of the product and the means by which it is produced, {sup 252}Cf can be produced only in government-owned facilities. It is evident at this time that the Oak Ridge research facility can meet present and projected near-term requirements. The production, shipment, and sales history of {sup 252}Cf from ORNL is summarized herein.

  10. Californium-252: a remarkable versatile radioisotope

    International Nuclear Information System (INIS)

    A product of the nuclear age, Californium-252 (252Cf) has found many applications in medicine, scientific research, industry, and nuclear science education. Californium-252 is unique as a neutron source in that it provides a highly concentrated flux and extremely reliable neutron spectrum from a very small assembly. During the past 40 years, 252Cf has been applied with great success to cancer therapy, neutron radiography of objects ranging from flowers to entire aircraft, startup sources for nuclear reactors, fission activation for quality analysis of all commercial nuclear fuel, and many other beneficial uses, some of which are now ready for further growth. Californium-252 is produced in the High Flux Isotope Reactor (HFIR) and processed in the Radiochemical Engineering Development Center (REDC), both of which are located at the Oak Ridge National Laboratory (ORNL) in Oak Ridge, Tennessee. The REDC/HFIR facility is virtually the sole supplier of 252Cf in the western world and is the major supplier worldwide. Extensive exploitation of this product was made possible through the 252Cf Market Evaluation Program, sponsored by the United States Department of Energy (DOE) [then the Atomic Energy Commission (AEC) and later the Energy Research and Development Administration (ERDA)]. This program included training series, demonstration centers, seminars, and a liberal loan policy for fabricated sources. The Market Evaluation Program was instituted, in part, to determine if large-quantity production capability was required at the Savannah River Laboratory (SRL). Because of the nature of the product and the means by which it is produced, 252Cf can be produced only in government-owned facilities. It is evident at this time that the Oak Ridge research facility can meet present and projected near-term requirements. The production, shipment, and sales history of 252Cf from ORNL is summarized herein

  11. Californium-252 Neutron Therapy in China

    International Nuclear Information System (INIS)

    Californium-252 brachytherapy, believed to be the most successful source for neutron therapy, gives most of the cures as well as long-term and complication-free survivals. Chinese radiation oncologists were interested in californium neutron therapy (Cf-NT) in the early 1980s, but 252Cf sources for medical use were not available in China until 1992 when a californium joint venture was established by the China Institute of Atomic Energy (Beijing) and the Research Institute for Nuclear Reactors (Dimitrovgrad) of Russia. In 1995, 25 seeds of 252Cf with a strength of 3 μg each were sent to China for preclinical investigation. Three years later, a high dose rate (HDR) 252Cf source was imported and transferred into a home-made remote after-loader for intracavitary treatment in Chongqing, and a clinical trail was started in February 1999. This is the first time that Cf-NT was performed for cancer patients in China. Since then, Cf-NT in China has developed rapidly. It is estimated that one-tenth of those radiation oncology centers with brachytherapy practice will be equipped with californium units in 5 yr. That means more than 30 units will be in use in hospitals. That is significant compared with other countries, but it is just one, on average, for each province or one per 40 million people in China. Progress also has been achieved in the 252Cf treatment delivery equipment. Preliminary clinical trails showed complete response observed in all cases treated, with a rapid clearance of tumors and mild reactions in normal tissues. The short-term results are quite encouraging. To deal with problems due to the demand for Cf-NT in China, attention should be paid to the following particulars: (1) A high-strength miniature source is needed for HDR/MDR interstitial therapy to extend the Cf-NT coverage. (2) Basic work on radiophysics and radiobiology needs to be done, including source calibration, clinical dosimetry, clinical RBE determination, and Cf-NT quality assurance

  12. Californium-252 sales and loans at Oak Ridge National Laboratory

    International Nuclear Information System (INIS)

    The production and distribution in the United States of 252Cf has recently been consolidated at the Oak Ridge National Laboratory (ORNL). The 252Cf Industrial Sales/Loan Program and the 252Cf University Load Program, which were formerly located at the Savannah River Plant (SRP), have been combined with the californium production and distribution activities of the Transuranium Element Production Program at ORNL. Californium-252 is sold to commercial users in the form of bulk californium oxide, palladium-californium alloy pellets, or alloy wires. Neutron source capsules, which are fabricated for loans to DOE or other US government agencies, are still available in all forms previously available. The consolidation of all 252Cf distribution activities at the production site is expected to result in better service to users. In particular, customers for neutrons sources will be ale to select from a wider range of neutron source forms, including custom designs, through a single contact point

  13. EC decay of 244Bk

    Science.gov (United States)

    Sodaye, Suparna; Tripathi, R.; Sudarshan, K.; Sharma, S. K.; Pujari, P. K.; Palit, R.; Mukhopadhyay, S.

    2014-12-01

    Berkelium isotopes have been produced in 11B-induced reaction on 238U. The EC decay of 244Bk → 244Cm has been studied by carrying out the single and coincidence measurements of the γ-rays emitted during the de-excitation of the 244Cm levels. Radiochemical separations have been carried out to minimize the contribution from the fission products and target. The new half-life of 244Bk is obtained as 5.02 ± 0.03 h, which is close to the theoretically calculated value. The relative intensities of the decay γ-rays have been re-evaluated. Based on the coincidence measurements, a tentative partial level scheme for 244Bk → 244Cm decay has been proposed.

  14. EC decay of 244Bk

    International Nuclear Information System (INIS)

    Berkelium isotopes have been produced in 11B-induced reaction on 238U. The EC decay of 244Bk → 244Cm has been studied by carrying out the single and coincidence measurements of the γ-rays emitted during the de-excitation of the 244Cm levels. Radiochemical separations have been carried out to minimize the contribution from the fission products and target. The new half-life of 244Bk is obtained as 5.02 ± 0.03 h, which is close to the theoretically calculated value. The relative intensities of the decay γ-rays have been re-evaluated. Based on the coincidence measurements, a tentative partial level scheme for 244Bk → 244Cm decay has been proposed. (paper)

  15. Californium-252 encapsulation at the Savannah River Laboratory

    International Nuclear Information System (INIS)

    More than 1 g of the neutron-emitting isotope californium-252 has been encapsulated at SRL for worldwide medical, industrial, and research uses. Bulk sales packages have been prepared for the USDOE sales program since 1971. Doubly-encapsulated sources have been prepared for USDOE's market evaluation program since 1968. Californium-252 sources for loan and sales packages satisfy the criteria for Special Form Radioactive Material. Encapsulation is performed in special neutron-shielded containment facilities at SRL. Development of improved source and shipping package designs and processes is continuing. 17 figures

  16. IT 244 UOP Tutorial Courses/ Uoptutorial

    OpenAIRE

    salman

    2015-01-01

    For more course tutorials visit www.uoptutorial.com   IT 244 Week 1 Assignment Principles of Security Paper   IT 244 Week 1 Checkpoint SmartScenario Information Security Security Policies   IT 244 Week 1 Assignment Introduction to the Information Security Policy Paper   IT 244 Week 2 Checkpoint Smart Scenario Trusted Computing Base   IT 244 Week 3 Smart Scenario: Business Continuity Disaster Recovery   IT 244 W...

  17. Production, distribution and applications of californium-252 neutron sources

    International Nuclear Information System (INIS)

    The radioisotope 252Cf is routinely encapsulated into compact, portable, intense neutron sources with a 2.6-yr half-life. A source the size of a person's little finger can emit up to 1011 neutrons s-1. Californium-252 is used commercially as a reliable, cost-effective neutron source for prompt gamma neutron activation analysis (PGNAA) of coal, cement and minerals, as well as for detection and identification of explosives, land mines and unexploded military ordnance. Other uses are neutron radiography, nuclear waste assays, reactor start-up sources, calibration standards and cancer therapy. The inherent safety of source encapsulations is demonstrated by 30 yr of experience and by US Bureau of Mines tests of source survivability during explosions. The production and distribution center for the US Department of Energy (DOE) Californium Program is the Radiochemical Engineering Development Center (REDC) at Oak Ridge National Laboratory (ORNL). DOE sells 252Cf to commercial reencapsulators domestically and internationally. Sealed 252Cf sources are also available for loan to agencies and subcontractors of the US government and to universities for educational, research and medical applications. The REDC has established the Californium User Facility (CUF) for Neutron Science to make its large inventory of 252Cf sources available to researchers for irradiations inside uncontaminated hot cells. Experiments at the CUF include a land mine detection system, neutron damage testing of solid-state detectors, irradiation of human cancer cells for boron neutron capture therapy experiments and irradiation of rice to induce genetic mutations

  18. Production, distribution and applications of californium-252 neutron sources.

    Science.gov (United States)

    Martin, R C; Knauer, J B; Balo, P A

    2000-01-01

    The radioisotope 252Cf is routinely encapsulated into compact, portable, intense neutron sources with a 2.6-yr half-life. A source the size of a person's little finger can emit up to 10(11) neutrons s(-1). Californium-252 is used commercially as a reliable, cost-effective neutron source for prompt gamma neutron activation analysis (PGNAA) of coal, cement and minerals, as well as for detection and identification of explosives, land mines and unexploded military ordinance. Other uses are neutron radiography, nuclear waste assays, reactor start-up sources, calibration standards and cancer therapy. The inherent safety of source encapsulations is demonstrated by 30 yr of experience and by US Bureau of Mines tests of source survivability during explosions. The production and distribution center for the US Department of Energy (DOE) Californium Program is the Radiochemical Engineering Development Center (REDC) at Oak Ridge National Laboratory (ORNL). DOE sells 252Cf to commercial reencapsulators domestically and internationally. Sealed 252Cf sources are also available for loan to agencies and subcontractors of the US government and to universities for educational, research and medical applications. The REDC has established the Californium User Facility (CUF) for Neutron Science to make its large inventory of 252Cf sources available to researchers for irradiations inside uncontaminated hot cells. Experiments at the CUF include a land mine detection system, neutron damage testing of solid-state detectors, irradiation of human cancer cells for boron neutron capture therapy experiments and irradiation of rice to induce genetic mutations. PMID:11003521

  19. Production, Distribution, and Applications of Californium-252 Neutron Sources

    Energy Technology Data Exchange (ETDEWEB)

    Balo, P.A.; Knauer, J.B.; Martin, R.C.

    1999-10-03

    The radioisotope {sup 252}Cf is routinely encapsulated into compact, portable, intense neutron sources with a 2.6-year half-life. A source the size of a person's little finger can emit up to 10{sup 11} neutrons/s. Californium-252 is used commercially as a reliable, cost-effective neutron source for prompt gamma neutron activation analysis (PGNAA) of coal, cement, and minerals, as well as for detection and identification of explosives, laud mines, and unexploded military ordnance. Other uses are neutron radiography, nuclear waste assays, reactor start-up sources, calibration standards, and cancer therapy. The inherent safety of source encapsulations is demonstrated by 30 years of experience and by U.S. Bureau of Mines tests of source survivability during explosions. The production and distribution center for the U. S Department of Energy (DOE) Californium Program is the Radiochemical Engineering Development Center (REDC) at Oak Ridge National Laboratory (ORNL). DOE sells The radioisotope {sup 252}Cf is routinely encapsulated into compact, portable, intense neutron sources with a 2.6- year half-life. A source the size of a person's little finger can emit up to 10 neutrons/s. Californium-252 is used commercially as a reliable, cost-effective neutron source for prompt gamma neutron activation analysis (PGNAA) of coal, cement, and minerals, as well as for detection and identification of explosives, laud mines, and unexploded military ordnance. Other uses are neutron radiography, nuclear waste assays, reactor start-up sources, calibration standards, and cancer therapy. The inherent safety of source encapsulations is demonstrated by 30 years of experience and by U.S. Bureau of Mines tests of source survivability during explosions. The production and distribution center for the U. S Department of Energy (DOE) Californium Program is the Radiochemical Engineering Development Center (REDC) at Oak Ridge National Laboratory(ORNL). DOE sells {sup 252}Cf to commercial

  20. Infrared spectrum of curium-244

    International Nuclear Information System (INIS)

    The spectrum of curium-244 has been observed on the high resolution Fourier-transform spectrometer at Laboratoire Aime Cotton. An electrodeless lamp containing 50 μg of CmI3 was run for 12 hours and 800,000 points were taken. A total of 1743 lines have been ascribed to curium and 87 percent of the lines have been assigned to transitions between known energy levels

  1. 8 CFR 244.2 - Eligibility.

    Science.gov (United States)

    2010-01-01

    ... immigrant except as provided under § 244.3; (e) Is not ineligible under § 244.4; and (f)(1) Registers for... relief from removal; (ii) The applicant has an application for change of status, adjustment of...

  2. 12 CFR 24.4 - Investment limits.

    Science.gov (United States)

    2010-01-01

    ... ENTITIES, COMMUNITY DEVELOPMENT PROJECTS, AND OTHER PUBLIC WELFARE INVESTMENTS § 24.4 Investment limits. (a... 12 Banks and Banking 1 2010-01-01 2010-01-01 false Investment limits. 24.4 Section 24.4 Banks and...) Limited liability. A national bank may not make an investment under this part that would expose the...

  3. 8 CFR 244.4 - Ineligible aliens.

    Science.gov (United States)

    2010-01-01

    ... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Ineligible aliens. 244.4 Section 244.4 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS TEMPORARY PROTECTED STATUS FOR NATIONALS OF DESIGNATED STATES § 244.4 Ineligible aliens. An alien is ineligible for...

  4. 8 CFR 244.6 - Application.

    Science.gov (United States)

    2010-01-01

    ... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Application. 244.6 Section 244.6 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS TEMPORARY PROTECTED STATUS FOR NATIONALS OF DESIGNATED STATES § 244.6 Application. An application for Temporary Protected Status must be...

  5. 8 CFR 244.15 - Travel abroad.

    Science.gov (United States)

    2010-01-01

    ... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Travel abroad. 244.15 Section 244.15 Aliens... NATIONALS OF DESIGNATED STATES § 244.15 Travel abroad. (a) After the grant of Temporary Protected Status... to travel abroad. Permission to travel may be granted by the director pursuant to the...

  6. Dicty_cDB: SLA244 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLA244 (Link to dictyBase) - - - Contig-U16368-1 SLA244Z (Link... to Original site) - - SLA244Z 605 - - - - Show SLA244 Library SL (Link to library) Clone ID SLA244 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLA2-B/SLA244Q.Seq.d/ Representative seq. ID SLA24...4Z (Link to Original site) Representative DNA sequence >SLA244 (SLA244Q) /CSM/SL/SLA2-B/SLA244Q.Seq.d/ XXXXX...CCACTTCATA AATAAAACTTTGATC sequence update 1997. 5. 7 Translated Amino Acid sequence ---QLCKVTQCPTDFSCKMIRGN

  7. Prompt neutron spectrum of the spontaneous fission of californium-252

    International Nuclear Information System (INIS)

    The californium-252 spontaneous fission neutron spectrum was measured in the energy range of 0.01 to 10 MeV by the time-of-flight technique using various neutron detectors. The measurements of 252Cf neutron spectrum at energies of 0.01 to 5 MeV were performed as a function of fission fragment kinetic energy. The mean neutron spectrum energy in the range of 0.7 to 10 MeV was found from the results of measurements. The irregularity in the 252Cf neutron spectrum in the neutron energy range of less than 0.7 MeV compared to theoretical values is discussed. The mechanism of 252Cf neutron emission is also discussed on the basis of neutron yield angle measurements. 12 references

  8. 42 CFR 24.4 - Eligibility.

    Science.gov (United States)

    2010-10-01

    ... implications for clinical research or resulted in a widespread economic effect in the health-care delivery system. In addition, the individual should have been involved in the development of scientific or... 42 Public Health 1 2010-10-01 2010-10-01 false Eligibility. 24.4 Section 24.4 Public Health...

  9. 14 CFR 135.244 - Operating experience.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Operating experience. 135.244 Section 135.244 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF TRANSPORTATION (CONTINUED) AIR CARRIERS AND OPERATORS FOR COMPENSATION OR HIRE: CERTIFICATION AND OPERATIONS OPERATING REQUIREMENTS: COMMUTER AND ON DEMAND OPERATIONS AND...

  10. 27 CFR 70.244 - Payroll period.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 2 2010-04-01 2010-04-01 false Payroll period. 70.244... Excise and Special (Occupational) Tax Limitations § 70.244 Payroll period. For purpose of determining the... established calendar period regularly used by the employer or other person levied upon for payroll or...

  11. Separation of californium from actinides and lanthanides in aqueous solution by electrochemical formation of amalgams

    International Nuclear Information System (INIS)

    The electrochemical reduction of transneptunium elements (Pu to Cf) and rare earths (Eu, Tm) from aqueous complexing solutions to amalgams was studied over a wide range of cathodic potentials in order to achieve optimal separation of californium. The reduction in acetate media (pH 4.5-4.6) at potentials around -1.7 to -1.9 V1 leads to a quantitative extraction of californium into the mercury phase, while more negative potentials are required for the reduction of the lighter transuranium elements and of the lanthanides. Hence, the optimal conditions for the separation of californium from the investigated actinides and lanthanides were determined. Separation factors α between 25 and 90 were found except in the case of Cf/Eu, where poor values (α varying from 7 to 12) were observed. More negative cathodic potentials decrease the selectivity of the reduction process. A similar study with lithium citrate solutions (pH ∝6) shows that satisfactory separation of californium from lighter and heavier actinides is achievable. A separation factor of 88 is obtained for Cf/Am at -1.98 V. The anodic stripping of mixed amalgams (Pu, Am, Cm, Bk, Tm and Cf) Hg in nitric and acetic acid soultions at potentials ranging from +0.1 to -0.7 V proceeds slowly and proved to be ineffective for the separation of californium from light actinides under conditions described. (orig.)

  12. On-line slurry analyses by californium-252

    International Nuclear Information System (INIS)

    In chemical processing technology on-line activation methods gain an increasing importance for process monitoring and control. A method is described according to which the different fluorspar contents at various strategic points of a flotation plant are determined through neutron activation by 100 μg californium-252. A continuous analytical system for onstream process control of slurries was designed and constructed. A compact facility, called SUSAC, allows continuous application of the method on an industrial scale. The main components of the SUSAC facility are the irradiation and measurement cells. The cells are equipped with multistage countercurrent stirrers ensuring a proper radial and vertical distribution of the sample. The hollow shaft of the stirrer of the irradiation cell houses the Cf-source. The NaI-detector has been installed in a recess in the bottom of the measuring cell. The volumes are 9 dm3 for the irradiation cell, 7.5 dm3 for the measuring cell, 1/2 dm3 for the vonnection line and 4 dm3 for feed and drainage lines including the pump. Investigations on the following topics are discussed: selection of stirrers, residence time, flow rate, pulp density, calibration measurements. (T.G.)

  13. Biomedical neutron research at the Californium User Facility for neutron science

    International Nuclear Information System (INIS)

    The Californium User Facility for Neutron Science has been established at Oak Ridge National Laboratory (ORNL). The Californium User Facility (CUF) is a part of the larger Californium Facility, which fabricates and stores compact 252Cf neutron sources for worldwide distribution. The CUF can provide a cost-effective option for research with 252Cf sources. Three projects at the CUF that demonstrate the versatility of 252Cf for biological and biomedical neutron-based research are described: future establishment of a 252Cf-based neutron activation analysis system, ongoing work to produce miniature high-intensity, remotely afterloaded 252Cf sources for tumor therapy, and a recent experiment that irradiated living human lung cancer cells impregnated with experimental boron compounds to test their effectiveness for boron neutron capture therapy

  14. Biomedical neutron research at the Californium User Facility for neutron science

    Energy Technology Data Exchange (ETDEWEB)

    Martin, R.C. [Oak Ridge National Lab., TN (United States); Byrne, T.E. [Roane State Community College, Harriman, TN (United States); Miller, L.F. [Univ. of Tennessee, Knoxville, TN (United States)

    1997-04-01

    The Californium User Facility for Neutron Science has been established at Oak Ridge National Laboratory (ORNL). The Californium User Facility (CUF) is a part of the larger Californium Facility, which fabricates and stores compact {sup 252}Cf neutron sources for worldwide distribution. The CUF can provide a cost-effective option for research with {sup 252}Cf sources. Three projects at the CUF that demonstrate the versatility of {sup 252}Cf for biological and biomedical neutron-based research are described: future establishment of a {sup 252}Cf-based neutron activation analysis system, ongoing work to produce miniature high-intensity, remotely afterloaded {sup 252}Cf sources for tumor therapy, and a recent experiment that irradiated living human lung cancer cells impregnated with experimental boron compounds to test their effectiveness for boron neutron capture therapy.

  15. Proposed Californium-252 User Facility for Neutron Science at Oak Ridge National Laboratory

    International Nuclear Information System (INIS)

    The Radiochemical Engineering Development Center (REDC) at ORNL has petitioned to establish a Californium-252 User Facility for Neutron Science for academic, industrial, and governmental researchers. The REDC Californium Facility (CF) stores the national inventory of sealed 252Cf neutron source for university and research loans. Within the CF, the 252Cf storage pool and two uncontaminated hot cells currently in service for the Californium Program will form the physical basis for the User Facility. Relevant applications include dosimetry and experiments for neutron tumor therapy; fast and thermal neutron activation analysis of materials; experimental configurations for prompt gamma neutron activation analysis; neutron shielding and material damage studies; and hardness testing of radiation detectors, cameras, and electronics. A formal User Facility simplifies working arrangements and agreements between US DOE facilities, academia, and commercial interests

  16. Emergence of californium as the second transitional element in the actinide series.

    Science.gov (United States)

    Cary, Samantha K; Vasiliu, Monica; Baumbach, Ryan E; Stritzinger, Jared T; Green, Thomas D; Diefenbach, Kariem; Cross, Justin N; Knappenberger, Kenneth L; Liu, Guokui; Silver, Mark A; DePrince, A Eugene; Polinski, Matthew J; Van Cleve, Shelley M; House, Jane H; Kikugawa, Naoki; Gallagher, Andrew; Arico, Alexandra A; Dixon, David A; Albrecht-Schmitt, Thomas E

    2015-01-01

    A break in periodicity occurs in the actinide series between plutonium and americium as the result of the localization of 5f electrons. The subsequent chemistry of later actinides is thought to closely parallel lanthanides in that bonding is expected to be ionic and complexation should not substantially alter the electronic structure of the metal ions. Here we demonstrate that ligation of californium(III) by a pyridine derivative results in significant deviations in the properties of the resultant complex with respect to that predicted for the free ion. We expand on this by characterizing the americium and curium analogues for comparison, and show that these pronounced effects result from a second transition in periodicity in the actinide series that occurs, in part, because of the stabilization of the divalent oxidation state. The metastability of californium(II) is responsible for many of the unusual properties of californium including the green photoluminescence. PMID:25880116

  17. Fissile analysis of Hanford waste using Californium Multiplier/Delayed Neutron Counter system

    International Nuclear Information System (INIS)

    Measurement of low-level (10 ng/g or lower) fissile material (mainly plutonium) in Hanford waste and process samples is becoming increasingly important. A system has been designed consisting of a Californium Multiplier (CFX) and a Delayed Neutron Counter (DNC) to characterize these samples. This report describes hardware and analytical capability of the CFX/DNC system

  18. Study of the shielding for spontaneous fission sources of Californium-252

    International Nuclear Information System (INIS)

    A shielding study is made to attenuate, until maximum permissible levels, the neutrons radiation and photons emitted by spontaneous fission coming from a source of Californium-252. The compound package by a database (Library DLC-23) and the ANISNW code is used, in it version for personal computer. (Author)

  19. Hazard evaluation for 244-AR vault facility

    International Nuclear Information System (INIS)

    This document presents the results of a hazard identification and evaluation performed on the 244-AR Vault Facility to close a USQ (USQ No. TF-98-0785, Potential Inadequacy in Authorization Basis (PIAB): To Evaluate Miscellaneous Facilities Listed in HNF-2503 And Not Addressed In The TWRS Authorization Basis) that was generated as part of an evaluation of inactive TWRS facilities

  20. Hazard Evaluation for 244-CR Vault

    International Nuclear Information System (INIS)

    This document presents the results of a hazards identification and evaluation performed on the 244-CR Vault to close a USQ (USQ No.TF-98-0785, Potential Inadequacy in Authorization Basis (PIAB): To Evaluate Miscellaneous Facilities Listed In HNF-2503 And Not Addressed In The TWRS Authorization Basis) that was generated as part of an evaluation of inactive TWRS facilities

  1. Californium (252Cf) and its use as neutron source in science medicine and technology

    International Nuclear Information System (INIS)

    The application of radionuclides in science and nuclear techniques basically is related to unstable isotopes, which are produced from stable elements in nuclear reactor. Their specifications are various from view point of application . Using of physical and chemical properties of radionuclides in chemistry, for with marking the organic compounds we can exactly explain the mechanism of chemical reactions in medical, biology and bio-chemistry. In these cases the behaviour of radionuclides is very important and the selection of the suitable radionuclides is determined between the elements for investigation aims. The special specification of radio-nuclides analysis such as, half-life, kind of ray and energy should be considered with an special accuracy as well as the laws security regulations from view point of ray-protection should be completely observed mean time working these radio-nuclides. It should be considered that application of radio-isotopes is very important from their special specifications point of view. Applying the radionuclides from technology point of view in sciences and nuclear techniques aren't only limited to three analyses of α, β, and γ, but we can use the share of neutron which are produced from spli ting of heavy nucleus such as Californium252 as a neutron source in the depths of the sea and also determining the concentration of low quantity elements on moon and other spheres. The radioisotope of Californium252 is a neutron useful radiator for investigation in nuclear medical and technology because of automatically rapid split to 3.2% Californium252 radiates 1.34 * 109N/m in each mil/GH which suitable replacement for neutron sources based on (a, n) reaction, for example, Radium-Brellium or Amersium-Brellium. The energy distribution of radiated neutrons from analyzing of Californium252 like the spectrum of neutron which is produced from splitting of U235, Pu239 nucleus has the maximum energy in quantity, En=1 MeV in the range of 1.5 MeV. The

  2. 244-AR Vault Interim Stabilization Project Plan

    International Nuclear Information System (INIS)

    The 244-AR Vault Facility, constructed between 1966 and 1968, was designed to provide lag storage and treatment for the Plutonium-Uranium Extraction Facility (PUREX) tank farm sludges. Tank farm personnel transferred the waste from the 244-AR Vault Facility to B Plant for recovery of cesium and strontium. B Plant personnel then transferred the treatment residuals back to the tank farms for storage of the sludge and liquids. The last process operations, which transferred waste supporting the cesium/strontium recovery mission, occurred in April 1978. After the final transfer in 1978, the 244-AR facility underwent a cleanout. However, 2,271 L (600 gal) of sludge were left in Tank 004AR from an earlier transfer from Tank 241-AX-104. When the cleanout was completed, the facility was placed in a standby status. The sludge had been transferred to Tank 004AR to support Pacific Northwest National Laboratory [PNNL] vitrification work. Documentation of waste transfers suggests that a portion of the sludge may have been moved from Tank 004AR to Tank 002AR in preparation for transfer back to the AX Tank Farm; however, quantities of the sludge that were moved to Tank 002AR from that transfer must be estimated

  3. Tank 244A tank characterization plan

    International Nuclear Information System (INIS)

    The Double-Shell Tank (DST) System currently receives waste from the Single-Shell Tank (SST) System in support of SST stabilization efforts or from other on-site facilities which generate or store waste. Waste is also transferred between individual DSTs. The mixing or commingling of potentially incompatible waste types at the Hanford Site must be addressed prior to any waste transfers into the DSTs. The primary goal of the Waste Compatibility Program is to prevent the formation of an Unreviewed Safety Question (USQ) as a result of improper waste management. Tank 244A is a Double Contained Receiver Tank (DCRT) which serves as any overflow tank for the East Area Farms. Waste material is able to flow freely between the underground storage tanks and tank 244A. Therefore, it is necessary to test the waste in tank 244A for compatibility purposes. Two issues related to the overall problem of waste compatibility must be evaluated: Assurance of continued operability during waste transfer and waste concentration and Assurance that safety problems are not created as a result of commingling wastes under interim storage. The results of the grab sampling activity prescribed by this Tank Characterization Plan shall help determine the potential for four kinds of safety problems: criticality, flammable gas accumulation, energetics, and corrosion and leakage

  4. Contribution to clinical dosimetry of californium 252 sources used at Gustave Roussy institute

    International Nuclear Information System (INIS)

    The main characteristics of californium 252 sources are presented in the first part of the report. Dose measurements around Californium sources were performed with a pair of ionization multiplication chambers: the first one has an Aluminium wall and is filled with Argon, the second one a plastic tissue-equivalent gas. A set of experiments was performed in order to investigate the relative influence of beta rays on the response of both chambers. Besides the experimental work a computer program was written to calculate the dose distribution around the actual sources made of a series of small active sources placed in catheters. Theoretical data around small sources can be found in the litterature. The comparison between experimental results and theoretical ones has shown a good agreement. The computer program will be included as a sub-routine in the more general computer program used for patients treated with interstitial therapy

  5. 27 CFR 28.244 - Shipment to manufacturing bonded warehouse.

    Science.gov (United States)

    2010-04-01

    ... bonded warehouse. 28.244 Section 28.244 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX... Export Consignment § 28.244 Shipment to manufacturing bonded warehouse. Distilled spirits and wines withdrawn for shipment to a manufacturing bonded warehouse shall be consigned to the proprietor of...

  6. Dicty_cDB: VHQ244 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available kfqyldektkiskisrgaiagivvgcvvavsligsiafyyhhknkkv nlff*klk*nltirf Frame C: knfnlkkikekthqn*isknkneifisifthitil...ces producing significant alignments: (bits) Value N ( BJ446630 ) Dictyostelium discoideum cDNA...ive seq. ID VHQ244P (Link to Original site) Representative DNA sequence >VHQ244 (VHQ244Q) /CSM/VH/VHQ2-B/VHQ...nsgictcdnehigngceikfieckhkcstkhgicdndsgnckcdtqtkgltceesrll iesldsinskggtiniigyfgnttslltikig...esqcknikvfnettlkcdigegkgihni tiidddlsftainkfqyldektkiskisrgaiagivvgcvvavsligsi

  7. Safety Analysis Report for Packaging (SARP) of the Oak Ridge National Laboratory TRU Californium Shipping Container

    International Nuclear Information System (INIS)

    An analytical evaluation of the Oak Ridge National Laboratory TRU Californium Shipping Container was made in order to demonstrate its compliance with the regulations governing off-site shipment of packages that contain radioactive material. The evaluation encompassed five primary categories: structural integrity, thermal resistance, radiation shielding, nuclear criticality safety, and quality assurance. The results of this evaluation demonstrate that the container complies with the applicable regulations

  8. Emergence of californium as the second transitional element in the actinide series

    OpenAIRE

    Cary, Samantha K.; Vasiliu, Monica; Baumbach, Ryan E.; Stritzinger, Jared T.; GREEN, THOMAS D.; Diefenbach, Kariem; Cross, Justin N.; Knappenberger, Kenneth L.; Liu, Guokui; Silver, Mark A.; DePrince, A. Eugene; Polinski, Matthew J.; Van Cleve, Shelley M.; House, Jane H.; Kikugawa, Naoki

    2015-01-01

    A break in periodicity occurs in the actinide series between plutonium and americium as the result of the localization of 5f electrons. The subsequent chemistry of later actinides is thought to closely parallel lanthanides in that bonding is expected to be ionic and complexation should not substantially alter the electronic structure of the metal ions. Here we demonstrate that ligation of californium(III) by a pyridine derivative results in significant deviations in the properties of the resu...

  9. Measurements of integral cross sections in the californium-252 fission neutron spectrum

    International Nuclear Information System (INIS)

    In a low-scattering arrangement cross sections averaged over the californium-252 spontaneous fission neutron spectrum were measured. The reactions 27Al(n,α)46Ti, 47Ti, 48Ti(n,p), 54Fe,56Fe(n,p), 58Ni(n,p), 64Zn(n,p), 115In(n,n') were studied in order to obtain a consistent set of threshold detectors used in fast neutron flux density measurements. Overall uncertainties between 2 and 2.5% could be achieved; corrections due to neutron scattering in source and samples are discussed

  10. Measurement of californium-252 gamma photons depth dose distribution in tissue equivalent material. Vol. 4

    International Nuclear Information System (INIS)

    Phantom of tissue equivalent material with and without bone was used measuring depth dose distribution of gamma-rays from californium-252 source. The source was positioned at center of perspex walled phantom. Depth dose measurements were recorded for X, Y and Z planes at different distances from source. TLD 700 was used for measuring the dose distribution. Results indicate that implantation of bone in tissue equivalent medium cause changes in the gamma depth dose distribution which varies according to variation in bone geometry. 9 figs

  11. Dicty_cDB: VSJ244 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VS (Link to library) VSJ244 (Link to dictyBase) - - - Contig-U13740-1 VSJ244P (Link to Original ... 01 2 U36450 |U36450.1 E. coli/yeast shuttle vector pAD -GAL4, complete sequence. 40 0.002 2 AC124819 |AC12 ...

  12. 40 CFR 52.244 - Motor vehicle emissions budgets.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 3 2010-07-01 2010-07-01 false Motor vehicle emissions budgets. 52.244... (CONTINUED) APPROVAL AND PROMULGATION OF IMPLEMENTATION PLANS California § 52.244 Motor vehicle emissions budgets. (a) Approval of the motor vehicle emissions budgets for the following ozone rate-of-progress...

  13. Spontaneous Partitioning of Californium from Curium: Curious Cases from the Crystallization of Curium Coordination Complexes

    Energy Technology Data Exchange (ETDEWEB)

    Cary, Samantha K.; Silver, Mark A.; Liu, Guokui; Wang, Jamie C.; Bogart, Justin A.; Stritzinger, Jared T.; Arico, Alexandra A.; Hanson, Kenneth; Schelter, Eric J.; Albrecht-Schmitt, Thomas E.

    2015-12-07

    The reaction of 248CmCl3 with excess 2,6-pyridinedicarboxylic acid (DPA) under mild solvothermal conditions results in crystallization of the tris-chelate complex Cm(HDPA)3·H2O. Approximately half of the curium remains in solution at the end of this process, and evaporation of the mother liquor results in crystallization of the bis-chelate complex [Cm(HDPA)- (H2DPA)(H2O)2Cl]Cl·2H2O. 248Cm is the daughter of the α decay of 252Cf and is extracted in high purity from this parent. However, trace amounts of 249,250,251Cf are still present in all samples of 248Cm. During the crystallization of Cm(HDPA)3·H2O and [Cm(HDPA)(H2DPA)(H2O)2Cl]Cl·2H2O, californium(III) spontaneously separates itself from the curium complexes and is found doped within crystals of DPA in the form of Cf(HDPA)3. These results add to the growing body of evidence that the chemistry of californium is fundamentally different from that of earlier actinides.

  14. 48 CFR 52.244-6 - Subcontracts for Commercial Items.

    Science.gov (United States)

    2010-10-01

    ... clauses in subcontracts for commercial items: (i) 52.203-13, Contractor Code of Business Ethics and... component level. Editorial Note: For Federal Register citations affecting 52.244-6, see the List of...

  15. Dicty_cDB: SHK244 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SH (Link to library) SHK244 (Link to dictyBase) - - - Contig-U16526-1 SHK244P (Link to Original ... .1 Influenza A virus (swine/Cotes d'Armor/1515/99 (H1N1 )) partial N1NA gene for Neuraminidase, genomic RNA ... .1 Influenza A virus (swine/Cotes d'Armor/1482/99 (H1N1 )) partial N1NA gene for Neuraminidase, genomic RNA ...

  16. Dicty_cDB: SHD244 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SH (Link to library) SHD244 (Link to dictyBase) - - - Contig-U16526-1 SHD244P (Link to Original ... .1 Influenza A virus (swine/Cotes d'Armor/1515/99 (H1N1 )) partial N1NA gene for Neuraminidase, genomic RNA ... .1 Influenza A virus (swine/Cotes d'Armor/1482/99 (H1N1 )) partial N1NA gene for Neuraminidase, genomic RNA ...

  17. Double-contained receiver tank 244-TX, grab samples, 244TX-97-1 through 244TX-97-3 analytical results for the final report

    International Nuclear Information System (INIS)

    This document is the final report for the double-contained receiver tank (DCRT) 244-TX grab samples. Three grabs samples were collected from riser 8 on May 29, 1997. Analyses were performed in accordance with the Compatibility Grab Sampling and Analysis Plan (TSAP) and the Data Quality Objectives for Tank Farms Waste Compatibility Program (DQO). The analytical results are presented in a table

  18. Fast and efficient charge breeding of the Californium rare isotope breeder upgrade electron beam ion source

    Energy Technology Data Exchange (ETDEWEB)

    Ostroumov, P. N., E-mail: ostroumov@anl.gov; Barcikowski, A.; Dickerson, C. A.; Perry, A.; Sharamentov, S. I.; Vondrasek, R. C.; Zinkann, G. P. [Argonne National Laboratory, Argonne, Illinois 60439 (United States); Pikin, A. I. [Brookhaven National Laboratory, Upton, New York 11973 (United States)

    2015-08-15

    The Electron Beam Ion Source (EBIS), developed to breed Californium Rare Isotope Breeder Upgrade (CARIBU) radioactive beams at Argonne Tandem Linac Accelerator System (ATLAS), is being tested off-line. A unique property of the EBIS is a combination of short breeding times, high repetition rates, and a large acceptance. Overall, we have implemented many innovative features during the design and construction of the CARIBU EBIS as compared to the existing EBIS breeders. The off-line charge breeding tests are being performed using a surface ionization source that produces singly charged cesium ions. The main goal of the off-line commissioning is to demonstrate stable operation of the EBIS at a 10 Hz repetition rate and a breeding efficiency into single charge state higher than 15%. These goals have been successfully achieved and exceeded. We have measured (20% ± 0.7%) breeding efficiency into the single charge state of 28+ cesium ions with the breeding time of 28 ms. In general, the current CARIBU EBIS operational parameters can provide charge breeding of any ions in the full mass range of periodic table with high efficiency, short breeding times, and sufficiently low charge-to-mass ratio, 1/6.3 for the heaviest masses, for further acceleration in ATLAS. In this paper, we discuss the parameters of the EBIS and the charge breeding results in a pulsed injection mode with repetition rates up to 10 Hz.

  19. Fast and efficient charge breeding of the Californium rare isotope breeder upgrade electron beam ion source

    International Nuclear Information System (INIS)

    The Electron Beam Ion Source (EBIS), developed to breed Californium Rare Isotope Breeder Upgrade (CARIBU) radioactive beams at Argonne Tandem Linac Accelerator System (ATLAS), is being tested off-line. A unique property of the EBIS is a combination of short breeding times, high repetition rates, and a large acceptance. Overall, we have implemented many innovative features during the design and construction of the CARIBU EBIS as compared to the existing EBIS breeders. The off-line charge breeding tests are being performed using a surface ionization source that produces singly charged cesium ions. The main goal of the off-line commissioning is to demonstrate stable operation of the EBIS at a 10 Hz repetition rate and a breeding efficiency into single charge state higher than 15%. These goals have been successfully achieved and exceeded. We have measured (20% ± 0.7%) breeding efficiency into the single charge state of 28+ cesium ions with the breeding time of 28 ms. In general, the current CARIBU EBIS operational parameters can provide charge breeding of any ions in the full mass range of periodic table with high efficiency, short breeding times, and sufficiently low charge-to-mass ratio, 1/6.3 for the heaviest masses, for further acceleration in ATLAS. In this paper, we discuss the parameters of the EBIS and the charge breeding results in a pulsed injection mode with repetition rates up to 10 Hz

  20. Design of a homogeneous subcritical nuclear reactor based on thorium with a source of californium 252

    International Nuclear Information System (INIS)

    Full text: One of the energy alternatives to fossil fuels which do not produce greenhouse gases is the nuclear energy. One of the drawbacks of this alternative is the generation of radioactive wastes of long half-life and its relation to the generation of nuclear materials to produce weapons of mass destruction. An option to these drawbacks of nuclear energy is to use Thorium as part of the nuclear fuel which it becomes in U233 when capturing neutrons, that is a fissile material. In this paper Monte Carlo methods were used to design a homogeneous subcritical reactor based on thorium. As neutron reflector graphite was used. The reactor core is homogeneous and is formed of 70% light water as moderator, 12% of enriched uranium UO2(NO3)4 and 18% of thorium Th(NO3)4 as fuel. To start the nuclear fission chain reaction an isotopic source of californium 252 was used with an intensity of 4.6 x 107 s-1. In the design the value of the effective multiplication factor, whose value turned out keff <1 was calculated. Also, the neutron spectra at different distances from the source and the total fluence were calculated, as well as the values of the ambient dose equivalent in the periphery of the reactor. (Author)

  1. Fast and efficient charge breeding of the Californium rare isotope breeder upgrade electron beam ion source.

    Science.gov (United States)

    Ostroumov, P N; Barcikowski, A; Dickerson, C A; Perry, A; Pikin, A I; Sharamentov, S I; Vondrasek, R C; Zinkann, G P

    2015-08-01

    The Electron Beam Ion Source (EBIS), developed to breed Californium Rare Isotope Breeder Upgrade (CARIBU) radioactive beams at Argonne Tandem Linac Accelerator System (ATLAS), is being tested off-line. A unique property of the EBIS is a combination of short breeding times, high repetition rates, and a large acceptance. Overall, we have implemented many innovative features during the design and construction of the CARIBU EBIS as compared to the existing EBIS breeders. The off-line charge breeding tests are being performed using a surface ionization source that produces singly charged cesium ions. The main goal of the off-line commissioning is to demonstrate stable operation of the EBIS at a 10 Hz repetition rate and a breeding efficiency into single charge state higher than 15%. These goals have been successfully achieved and exceeded. We have measured (20% ± 0.7%) breeding efficiency into the single charge state of 28+ cesium ions with the breeding time of 28 ms. In general, the current CARIBU EBIS operational parameters can provide charge breeding of any ions in the full mass range of periodic table with high efficiency, short breeding times, and sufficiently low charge-to-mass ratio, 1/6.3 for the heaviest masses, for further acceleration in ATLAS. In this paper, we discuss the parameters of the EBIS and the charge breeding results in a pulsed injection mode with repetition rates up to 10 Hz. PMID:26329185

  2. Neutron activation analysis at the Californium User Facility for Neutron Science

    International Nuclear Information System (INIS)

    The Californium User Facility (CUF) for Neutron Science has been established to provide 252Cf-based neutron irradiation services and research capabilities including neutron activation analysis (NAA). A major advantage of the CUF is its accessibility and controlled experimental conditions compared with those of a reactor environment The CUF maintains the world's largest inventory of compact 252Cf neutron sources. Neutron source intensities of ≤ 1011 neutrons/s are available for irradiations within a contamination-free hot cell, capable of providing thermal and fast neutron fluxes exceeding 108 cm-2 s-1 at the sample. Total flux of ≥109 cm-2 s-1 is feasible for large-volume irradiation rabbits within the 252Cf storage pool. Neutron and gamma transport calculations have been performed using the Monte Carlo transport code MCNP to estimate irradiation fluxes available for sample activation within the hot cell and storage pool and to design and optimize a prompt gamma NAA (PGNAA) configuration for large sample volumes. Confirmatory NAA irradiations have been performed within the pool. Gamma spectroscopy capabilities including PGNAA are being established within the CUF for sample analysis

  3. Long-term effects of an intracavitary treatment with californium-252 on normal tissue

    International Nuclear Information System (INIS)

    About one hundred fifty swine were exposed to either radium-226 or californium-252 sources in the uterine cervix to determine an RBE for both acute and long-term effects. That value for early changes in the tissues at risk in the treatment of cervical cancer was between 6.2 and 6.8. The incidence of complications increased with time after exposure, especially among animals treated with 252Cf. Analysis of rectal injury showed that ulceration occurred frequently within a year postexposure at doses between 1600 and 2400 rad calculated at 2 cm lateral to the source midline. Fat necrosis and smooth muscle atrophy, resulting in a local rectal stricture, were delayed changes observed in some animals. The lower ureter was the site for a greater frequency of complications than the GI tract. Ureteral stricture often occurred at doses of 1200 rad from 252Cf and 7000 rad from 226Ra. Observation of delayed effects in the uterine-cervix in animals held up to 4 years postexposure indicate that the RBE for 252Cf may be increased to a value as high as 18, while repair may have even decreased it to about 5.6 in the rectum. Fifty swine are still being observed for long-term effects after doses above 800 rad from 252Cf and 5000 rad from 226Ra

  4. Manganese determination om minerals by activation analysis, using the californium-252 as a neutron source

    International Nuclear Information System (INIS)

    Neutron Activation Analysis, using a Californium-252 neutron source, has been applied for the determination of manganese in ores such as pyrolusite, rodonite (manganese silicate)' and blending used in dry-batteries The favorable nuclear properties of manganese, such as high thermal neutron cross-section for the reaction 55Mn (n.gamma)56 Mn, high concentration of manganese in the matrix and short half - life of 56Mn, are an ideal combination for non-destructive analysis of manganese in ores. Samples and standards of manganese dioxide were irradiated for about 20 minutes, followed by a 4 to 15 minutes decay and counted in a single channel pulse-height discrimination using a NaI(Tl) scintillation detector. Counting time was equal to 10 minutes. The interference of nuclear reactions 56Fe(n,p)56Mn and 59 Co (n, α)56 were studied, as well as problems in connection with neutron shadowing during irradiation, gamma-rays attenuation during counting and influence of granulometry of samples. One sample,was also analysed by wet-chemical method (sodium bismuthate) in order to compare results. As a whole, i t was shown that the analytical method of neutron activation for manganese in ores and blending, is a method simple, rapid and with good precision and accuracy. (author)

  5. Five-year cure of cervical cancer treated using californium-252 neutron brachytherapy

    International Nuclear Information System (INIS)

    Female pelvic carcinoma is one of the common malignancies seen at the University of Kentucky Medical Center and often presents in an advanced stage. In 1976, the authors began to test californium-252 neutron brachytherapy (NT) for its efficacy for control of primary and recurrent advanced uterine, cervix, and vaginal cancers. The first protocol used was 5000-5500 rad of whole pelvis irradiation followed by 1-2 Cf-252 insertions using a single tandem placed in the utero-cervico-vaginal region. Of 27 patients with primary carcinomas treated, 10 are alive and well 5 year later (37%). Two of two recurrent tumors were locally controlled but failed later. These patients had advanced cervical, vaginal, or endometrial carcinomas. In 1977, a transitional year, treatment of only unfavorable stages and presentations with NT was initiated. Similar results were obtained with NT as compared to conventional photon therapy (PT). Further improvement in treatment results can be anticipated as NT brachytherapy is used for advanced cancer therapy by more effective treatment schedules and radiation doses. Cf-252 can be used as a radium substitute and achieved similar rates of tumor control and 5-year survivals. 21 references, 2 tables

  6. Uptake and distribution of californium-252 chloride administered intraperitoneally, intravenously or intratracheally and the effect of in vivo DTPA chelation on intratracheal instillation in the rat

    International Nuclear Information System (INIS)

    The first phase of this investigation, comprising of three groups of animals, was designed to study the fate of californium-252 chloride administered intraperitoneally, intravenously or intratracheally. The second phase, which consisted of two groups of animals, was designed to examine the effectiveness of DTPA chelation therapy in accelerating the excretion and preventing the deposition of californium-252 chloride instilled into the lungs of rats. Immediately following the dose administration of 2 uCi of californium-252 chloride which was dissolved in 0.2 ml of 0.9% NaCl at pH 3.5, each rat was placed in a metabolism cage. Each rat in the first group of phase II was given intraperitoneal injection of CaNa3 DTPA (50 mg/kg) and each rat in the second group was given intraperitoneal injections of 0.9% NaCl. Injections of the DTPA or the NaCl sham were initiated immediately after the intratracheal administration of californium-252 chloride and were continued every three days until sacrifice. Following intraperitoneal, intravenous or intratracheal administration, the whole body retention of californium as a function of time was described by a three component exponential equation. For each mode of administration the short term component exhibited a biological half-life of between 5 and 10 hours; the intermediate component between 4 and 6 days; and the long term component between 200 and 300 days. The organ data obtained following intraperitoneal and intravenous administration were indistinguishable. On day one, the liver retained about 9% of the administered dose and the kidneys retained 2.4%. Retention for these organs decreased to about 1% by day 32. The femurs maintained an almost constant level of 4.5% of the injected dose over the 32 days. The lungs, spleen, heart, and testes showed significant retention of californium

  7. ENEA results in the international comparison organized by BIPM for the measurament of neutron fluxes of a Californium source

    International Nuclear Information System (INIS)

    During the period between May 1978 and August 1984 under the auspices of Section III of CCEMRI of CIPM it has been carried out the international intercomparison of Californium neutron source emission rate. The previous intercomparison was based on Ra-Be (α -n) source measuraments, which took place between 1959 and 1965, and the results showed a total spread of +- 3%. Owing to the better accuracy achived over the following decade the Ra-Be intercomparison was no longer representative of the state of the art, therefore it was decided to arrange the intercomparison based on Californium which in the meantime reached a wide use in the world. Contributions to the intercomparison were received from fourteen laboratories representative of twelve Nations plus the BIPM. The results put into evidence a considerable advance on accuracy in the neutron source emission rate measuraments. The standard deviation of the residuals obtained from least square fit of normalized data resulted +- 0,57%. In the present report it is widely described the Manganese bath method used at ENEA, CRE Casaccia in Roma, and the experimental procedure followed for its absolute calibration. All measuraments are reported and analysed, including those effectuated for corrective factors determination. The final results obtained at ENEA for the circulated Californium source is (3,457 +- 0,013) 10*H7 neutron/s. The analysis of data from all partecipantes has been effectuated and concluded by J. Axton in March 1986 and the conclusions which have been showed in the present report put in evidence the satisfactory results achived by the ENEA

  8. Feasibility and market potential of protein determination of wheat using californium-252

    International Nuclear Information System (INIS)

    To evaluate the feasibility of protein determination by capture gamma-ray analysis using californium-252 neutrons, an in-situ protein analysis system for use by grain handlers has been examined. Three 227 kilogram (approximately) lots of wheat were used to determine the amount of nitrogen present. Protein analyses by the Kjeldahl method were obtained from samples taken before and after the capture gamma-ray analyses. The 5.267-MeV gamma-ray was selected for use in this study as a compromise between efficiency and interference from other elements. The associated counting equipment was a multichannel analyzer with pulse shaping electronic and analysis computing equipment. A linear regression program was used to compare the regions of interest to the Kjeldahl protein averages. The counts composing each peak were summed and normalized using the total count of the hydrogen peak. The normalized nitrogen percentages indicate a significant correlation between the spectral regions and the Kjeldahl analyses. To a first approximation, the value of wheat is the wheat protein. At the present time, protein testing of wheat is destructive, cumbersome, and time-consuming as compared to the potential for capture gamma-ray analysis testing. Assuming that such a protein analysis unit can analyze 42 tonne of wheat per hour, over 120 units would be needed to monitor one-half the U.S. annual wheat production. A 0.5% improvement in processor realizations and grain throughput value of $167.00 per tonne will result in a projected savings of $150,000 per year per unit

  9. Oxygen enhancement ratio (OER) and therapeutic gain factor (GF) for californium-252 at low dose rate

    International Nuclear Information System (INIS)

    The potential benefit of the introduction of californium-252 in interstitial and intracavitary therapy is related to the greater efficiency of its neutron emission against anoxic cancer cells. In that respect, the oxygen enhancement ratio (OER) of the 252Cf emission has been determined for a continuous low dose rate irradiation. The biological system is growth inhibition in Vicia faba bean roots. A new Vicia faba ''BelB'' strain has been used, which better tolerates long periods (up to about 10 hours) of anoxia. In a first series of experiments, for a 252Cf (Dsub(n+γ)) dose rate of 0.11 Gy.h-1, an OER of 1.4+-0.1 was observed (the γ contribution Dγ to the total absorbed dose Dsub(n+γ) was 0.35 at the position of the root tips). In a second series of experiments, in somewhat different geometrical conditions with a 252Cf (Dsub(n+γ)) dose rate of 0.13 Gy.h-1, an OER of 1.5+-0.1 was observed (Dγ/Dsub(n+γ)=0.42). The OER values observed for similar irradiation times, with iridium-192 γ-rays, were 2.3+-0.2 and 2.6+-0.1 respectively, which leads to therapeutic gain factors (GF) of 1.6 and 1.7 respectively. These GF values are slightly lower than those previously obtained (GF=1.8) on the same system, with d(50)-Be p(75)-Be and 15 MeV neutron beams

  10. Application of TSH bioindicator for studying the biological efficiency of neutrons from californium-252 source

    International Nuclear Information System (INIS)

    The effectiveness of neutrons from a Californium-252 source in the induction of various abnormalities in the Tradescantia clone 4430 stamen hair cells (TSH-assay) was studied. The special attention was paid to check whether any enhancement in effects caused by process of boron neutron capture is visible in the cells enriched with boron ions. Two chemicals (borax and BSH) were applied to introduce boron-10 ions into cells. Inflorescence, normal or pretreated with chemicals containing boron, were irradiated in the air with neutrons from a Cf-252 source at KAERI, Taejon, Korea. To estimate the relative biological effectiveness (RBE) in the induction of gene mutations of the neutron beam under the study, Tradescantia inflorescences, without any chemical pretreatment, were irradiated with various doses of X-rays. The ranges of radiation doses used were 0-0.1 Gy in neutrons and 0-0.5 Gy in X-rays. After the time needed to complete the postirradiation repair Tradescantia cuttings were transferred to Cracow, where screening of gene and lethal; mutations, cell cycle alterations in somatic cells have been done, and dose response relationships were figured. The maximal RBE values were estimated in the range of 4.6-6.8. Alterations of RBE value were observed; from 6.8 to 7.8 in the case of plants pretreated with 240 ppm of B-10 from borax, and 4.6 to 6.1 in the case of 400 ppm of B-10 from BSH. Results showed a slight, although statistically insignificant increase in biological efficacy of radiation from the Cf-252 source in samples pretreated with boron containing chemicals. (author)

  11. Dicty_cDB: CHO244 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHO244 (Link to dictyBase) - - - Contig-U16708-1 - (Link to Original site) ... AV065281 |AV065281.1 Mus musculus adult male small intestine ... cDNA, partial sequence, clone 2010015E09. 40 7.2 1 ... AV062105 |AV062105.1 Mus musculus adult male small intestine ... cDNA, partial sequence, clone 2010002D17. 40 7.2 1 ...

  12. 27 CFR 24.244 - Use of acid to stabilize standard wine.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Use of acid to stabilize standard wine. 24.244 Section 24.244 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY LIQUORS WINE Storage, Treatment and Finishing of Wine § 24.244 Use of acid to stabilize standard...

  13. 8 CFR 244.11 - Renewal of application; appeal to the Board of Immigration Appeals.

    Science.gov (United States)

    2010-01-01

    ... of Immigration Appeals. 244.11 Section 244.11 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS TEMPORARY PROTECTED STATUS FOR NATIONALS OF DESIGNATED STATES § 244.11 Renewal of application; appeal to the Board of Immigration Appeals. If a charging document is served on the alien with...

  14. Motivation for the determination of the 244Cm effective neutron capture cross-section

    International Nuclear Information System (INIS)

    Measurement of the effective neutron capture cross-section of 244Cm was tried, and the irradiation test of the 244Cm sample was performed for 1 cycle. Gamma- and alpha-rays measurements were performed to analyze the productions from the 244Cm(n,γ) and fission reactions. (author)

  15. Divalent and trivalent gas-phase coordination complexes of californium: evaluating the stability of Cf(ii).

    Science.gov (United States)

    Dau, Phuong D; Shuh, David K; Sturzbecher-Hoehne, Manuel; Abergel, Rebecca J; Gibson, John K

    2016-08-01

    The divalent oxidation state is increasingly stable relative to the trivalent state for the later actinide elements, with californium the first actinide to exhibit divalent chemistry under moderate conditions. Although there is evidence for divalent Cf in solution and solid compounds, there are no reports of discrete complexes in which Cf(II) is coordinated by anionic ligands. Described here is the divalent Cf methanesulfinate coordination complex, Cf(II)(CH3SO2)3(-), prepared in the gas phase by reductive elimination of CH3SO2 from Cf(III)(CH3SO2)4(-). Comparison with synthesis of the corresponding Sm and Cm complexes reveals reduction of Cf(III) and Sm(III), and no evidence for reduction of Cm(III). This reflects the comparative 3+/2+ reduction potentials: Cf(3+) (-1.60 V) ≈ Sm(3+) (-1.55 V) ≫ Cm(3+) (-3.7 V). Association of O2 to the divalent complexes is attributed to formation of superoxides, with recovery of the trivalent oxidation state. The new gas-phase chemistry of californium, now the heaviest element to have been studied in this manner, provides evidence for Cf(II) coordination complexes and similar chemistry of Cf and Sm. PMID:27424652

  16. Hypoxic versus normoxic external-beam irradiation of cervical carcinoma combined with californium-252 neutron brachytherapy. Comparative treatment results of a 5-year randomized study

    Czech Academy of Sciences Publication Activity Database

    Tačev, T.; Vacek, Antonín; Ptáčková, B.; Strnad, V.

    2005-01-01

    Roč. 181, č. 5 (2005), s. 273-284. ISSN 0179-7158 Institutional research plan: CEZ:AV0Z50040507 Keywords : cervical carcinoma * hypoxyradiotherapy * californium-252 Subject RIV: BO - Biophysics Impact factor: 3.490, year: 2005

  17. Solving the Hydration Structure of the Heaviest Actinide Aqua Ion Known: The Californium(III) Case

    Energy Technology Data Exchange (ETDEWEB)

    Den Auwer, Ch.; Guillaumont, D. [CEA Marcoule, Nucl Energy Div, Radiochem Proc Dept, SCPS LILA, 30 (France); Galbis, E.; Pappalardo, Rafael R.; Marcos Sanchez, E. [Univ Seville, Dept Quim Fis, E-41012 Seville (Spain); Hernandez-Cobos, J. [Inst Ciencias Fis, Cuernavaca 62251, Morelos (Mexico); Le Naour, C.; Simoni, E. [Univ Paris Sud, Inst Phys Nucl Orsay, Paris (France)

    2010-07-01

    In summary, the first MC simulation of the trivalent cation of californium, based on an exchangeable hydrated ion-water intermolecular potential, has been shown to extend and improve the hydrated ion model. Likewise, the CfL{sub III}-edge EXAFS spectrum of an acidic 1 mm Cf(ClO{sub 4}){sub 3} aqueous solution recorded under optimized experimental conditions has greatly improved the signal/noise ratio of the only previously recorded spectrum. The comparison of the experimental EXAFS spectrum with the two computed ones, obtained from two different intermolecular potentials that predict eight (BP86) or nine (MP2) water molecules in the first coordination shell, leads to the conclusion that the lowest hydration number is preferred. Then, as Cf{sup III} is the heaviest actinide aqua ion for which there is experimental information, the actinide contraction is supported by the present study. (For U{sup III}, R{sub U-O}=2.56 Angstroms, and CN=9{+-}1; for Pu{sup III}, R{sub Pu-O}=2.51 Angstroms and CN=9{+-}1; for Cm{sup III}, R{sub Cm-O}=2.47 Angstroms and CN=9{+-}1). The role of the second hydration shell is important in defining the structure and dynamics of the Cf{sup III} aqua ion, but the contribution of second-shell water molecules to the EXAFS signal as back-scatters is marginal. Finally, this work gives an illustrative example of the benefits which can be achieved from the combination of experimental X-ray absorption spectroscopy and computer simulations. The usefulness of the simultaneous analysis of the results as well as the importance of the structural statistical average has been clearly demonstrated herein. Each technique independently was not adequate. We believe that this study traces out a still poorly explored combined methodology which may be extremely useful for many other complexes and chemical problems. A systematic theoretical and experimental examination of the other known actinide cations on the same basis should be undertaken to confirm the

  18. Operability test procedure for 244-U DCRT. Revision 1

    Energy Technology Data Exchange (ETDEWEB)

    Erhart, M.F.

    1995-03-13

    This OPT will insure the operability of various systems and their general equipment, used in the operation of the 244-U DCRT. Systems that will be tested include the following: Leak Detection Systems; Heat Trace System; Vessel Temperature Measurement System; Dip Tube Water System; Weight Factor and Specific Gravity System; Instrument Air System; Vessel Liquid Level System; Vessel Liquid Transfer System; and Exhauster Differential Pressure Indicating Controller System. The tests will cover checks on equipment operation and electrical interlocks, but will not cover checks on associated annunciator alarms which are covered in a separate OTP.

  19. Operability test procedure for 244-U DCRT. Revision 1

    International Nuclear Information System (INIS)

    This OPT will insure the operability of various systems and their general equipment, used in the operation of the 244-U DCRT. Systems that will be tested include the following: Leak Detection Systems; Heat Trace System; Vessel Temperature Measurement System; Dip Tube Water System; Weight Factor and Specific Gravity System; Instrument Air System; Vessel Liquid Level System; Vessel Liquid Transfer System; and Exhauster Differential Pressure Indicating Controller System. The tests will cover checks on equipment operation and electrical interlocks, but will not cover checks on associated annunciator alarms which are covered in a separate OTP

  20. Plutonium-244 in the early solar system and xenology

    Energy Technology Data Exchange (ETDEWEB)

    Kuroda, P.K. [Arkansas Univ., Fayetteville (United States). Dept. of Chem. Eng.; Myers, W.A. [Arkansas Univ., Fayetteville (United States). Dept. of Chem. Eng.

    1995-06-01

    Isotopic compositions of the anomalous xenon components, such as the so-called xenon-H L and the s-type xenon, can be explained in terms of a two-component model in which they are regarded as representing the isotopic composition of a mixture of the {sup 244}Pu fission xenon component and a trapped xenon component, whose isotopic composition resembles that of the atmospheric xenon, but is often markedly altered by a combined effect of (a) mass-fractionation, (b) spallation and (c) neutron-capture reactions caused primarily by the 10 keV (stellar temperature) neutrons. (orig.)

  1. Plutonium-244 in the early solar system and xenology

    International Nuclear Information System (INIS)

    Isotopic compositions of the anomalous xenon components, such as the so-called xenon-H L and the s-type xenon, can be explained in terms of a two-component model in which they are regarded as representing the isotopic composition of a mixture of the 244Pu fission xenon component and a trapped xenon component, whose isotopic composition resembles that of the atmospheric xenon, but is often markedly altered by a combined effect of a) mass-fractionation, b) spallation and c) neutron-capture reactions caused primarily by the 10 keV (stellar temperature) neutrons. (orig.)

  2. Design, construction, and characterization of a facility for neutron capture gamma ray analysis of sulfur in coal using californium-252

    International Nuclear Information System (INIS)

    A study of neutron capture gamma ray analysis of sulfur in coal using californium-252 as a neutron source is reported. Both internal and external target geometries are investigated. The facility designed for and used in this study is described. The external target geometry is found to be inappropriate because of the low thermal neutron flux at the sample location, which must be outside the biological shielding. The internal target geometry is found to have a sufficient thermal neutron flux, but an excessive gamma ray background. A water filled plastic facility, rather than the paraffin filled steel one used in this study, is suggested as a means of increasing flexibility and decreasing the beackground in the internal target geometry

  3. Preparation of powdered CR244 adhesive type chloroprene rubber%CR244粘接型粉末氯丁橡胶的制备

    Institute of Scientific and Technical Information of China (English)

    朱家顺; 王炼石; 梁启浩

    2003-01-01

    用凝聚法制备出粉末粘接型氯丁橡胶(PCR244).研究了包覆剂性质对PCR244粒径分布的影响,并用SEM对所得PCR244的形貌及断面进行了观察分析.研究表明,在CR244粉末化体系中,包覆剂必须具有一定的交联程度才能起粉末化作用.在研究范围内,包覆剂的θg对粒径小于0.9mm产物的成粉率几乎无影响,均达到98.6%以上.SEM分析表明,PCR244宏观粒子表面粗糙,粒子内外均分布着大量空隙,其形成过程可分为三个主要阶段,即在包覆剂作用下,首先由胶乳初级粒子聚结成次级粒子,再由次级粒子凝聚成团粒,最后团粒相互结合成宏观粒子PCR244.

  4. 49 CFR 244.11 - Contents of a Safety Integration Plan.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Contents of a Safety Integration Plan. 244.11... ADMINISTRATION, DEPARTMENT OF TRANSPORTATION REGULATIONS ON SAFETY INTEGRATION PLANS GOVERNING RAILROAD CONSOLIDATIONS, MERGERS, AND ACQUISITIONS OF CONTROL Safety Integration Plans § 244.11 Contents of a...

  5. 8 CFR 244.5 - Temporary treatment benefits for eligible aliens.

    Science.gov (United States)

    2010-01-01

    ... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Temporary treatment benefits for eligible aliens. 244.5 Section 244.5 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION... for eligible aliens. (a) Prior to the registration period. Prior to the registration...

  6. 17 CFR 244.100 - General rules regarding disclosure of non-GAAP financial measures.

    Science.gov (United States)

    2010-04-01

    ... disclosure of non-GAAP financial measures. 244.100 Section 244.100 Commodity and Securities Exchanges... discloses material information that includes a non-GAAP financial measure, the registrant must accompany... unreasonable efforts, for forward-looking information, of the differences between the non-GAAP...

  7. Operational experience with the Argonne National Laboratory Californium Rare Ion Breeder Upgrade facility and electron cyclotron resonance charge breeder

    Science.gov (United States)

    Vondrasek, R.; Clark, J.; Levand, A.; Palchan, T.; Pardo, R.; Savard, G.; Scott, R.

    2014-02-01

    The Californium Rare Ion Breeder Upgrade (CARIBU) of the Argonne National Laboratory Argonne Tandem Linac Accelerator System (ATLAS) facility provides low-energy and accelerated neutron-rich radioactive beams to address key nuclear physics and astrophysics questions. A 350 mCi 252Cf source produces fission fragments which are thermalized and collected by a helium gas catcher into a low-energy particle beam with a charge of 1+ or 2+. An electron cyclotron resonance (ECR) ion source functions as a charge breeder in order to raise the ion charge sufficiently for acceleration in the ATLAS linac. The ECR charge breeder has achieved stable beam charge breeding efficiencies of 10.1% for 23Na7+, 17.9% for 39K10+, 15.6% for 84Kr17+, and 12.4% for 133Cs27+. For the radioactive beams, a charge breeding efficiency of 11.7% has been achieved for 143Cs27+ and 14.7% for 143Ba27+. The typical breeding times are 10 ms/charge state, but the source can be tuned such that this value increases to 100 ms/charge state with the best breeding efficiency corresponding to the longest breeding times—the variation of efficiencies with breeding time will be discussed. Efforts have been made to characterize and reduce the background contaminants present in the ion beam through judicious choice of q/m combinations. Methods of background reduction are being investigated based upon plasma chamber cleaning and vacuum practices.

  8. Long-term effects of an intracavitary treatment with californium-252 on normal tissue. [Swine, /sup 226/Ra

    Energy Technology Data Exchange (ETDEWEB)

    Sullivan, M.F.; Beamer, J.L.; Mahony, T.D.; Cross, F.T.; Lund, J.E.; Endres, G.W.R.

    1976-01-01

    About one hundred fifty swine were exposed to either radium-226 or californium-252 sources in the uterine cervix to determine an RBE for both acute and long-term effects. That value for early changes in the tissues at risk in the treatment of cervical cancer was between 6.2 and 6.8. The incidence of complications increased with time after exposure, especially among animals treated with /sup 252/Cf. Analysis of rectal injury showed that ulceration occurred frequently within a year postexposure at doses between 1600 and 2400 rad calculated at 2 cm lateral to the source midline. Fat necrosis and smooth muscle atrophy, resulting in a local rectal stricture, were delayed changes observed in some animals. The lower ureter was the site for a greater frequency of complications than the GI tract. Ureteral stricture often occurred at doses of 1200 rad from /sup 252/Cf and 7000 rad from /sup 226/Ra. Observation of delayed effects in the uterine-cervix in animals held up to 4 years postexposure indicate that the RBE for /sup 252/Cf may be increased to a value as high as 18, while repair may have even decreased it to about 5.6 in the rectum. Fifty swine are still being observed for long-term effects after doses above 800 rad from /sup 252/Cf and 5000 rad from /sup 226/Ra.

  9. 10 CFR 72.244 - Application for amendment of a certificate of compliance.

    Science.gov (United States)

    2010-01-01

    ... INDEPENDENT STORAGE OF SPENT NUCLEAR FUEL, HIGH-LEVEL RADIOACTIVE WASTE, AND REACTOR-RELATED GREATER THAN CLASS C WASTE Approval of Spent Fuel Storage Casks § 72.244 Application for amendment of a...

  10. Results with the electron cyclotron resonance charge breeder for the 252Cf fission source project (Californium Rare Ion Breeder Upgrade) at Argonne Tandem Linac Accelerator System

    International Nuclear Information System (INIS)

    The construction of the Californium Rare Ion Breeder Upgrade, a new radioactive beam facility for the Argonne Tandem Linac Accelerator System (ATLAS), is nearing completion. The facility will use fission fragments from a 1 Ci 252Cf source; thermalized and collected into a low-energy particle beam by a helium gas catcher. In order to reaccelerate these beams, an existing ATLAS electron cyclotron resonance (ECR) ion source was redesigned to function as an ECR charge breeder. Thus far, the charge breeder has been tested with stable beams of rubidium and cesium achieving charge breeding efficiencies of 9.7% into 85Rb17+ and 2.9% into 133Cs20+.

  11. Above-threshold structure in {sup 244}Cm neutron-induced fission cross section

    Energy Technology Data Exchange (ETDEWEB)

    Maslov, V.M. [Radiation Physics and Chemistry Problems Inst., Minsk-Sosny (Belarus)

    1997-03-01

    The quasi-resonance structure appearing above the fission threshold in neutron-induced fission cross section of {sup 244}Cm(n,f) is interpreted. It is shown to be due to excitation of few-quasiparticle states in fissioning {sup 245}Cm and residual {sup 244}Cm nuclides. The estimate of quasiparticle excitation thresholds in fissioning nuclide {sup 245}Cm is consistent with pairing gap and fission barrier parameters. (author)

  12. Measurements and modeling of LLE and HE for (methanol + 2,4,4-trimethyl-1-pentene), and LLE for (water + methanol + 2,4,4-trimethyl-1-pentene)

    International Nuclear Information System (INIS)

    Highlights: • Simultaneous description of VLE, LLE and HE using NRTL model is investigated. • Measurement and modeling for LLE and HE of (methanol + 2,4,4-trimethyl-1-pentene). • Measurement and modeling for LLE of (water + methanol + 2,4,4-trimethyl-1-pentene). - Abstract: Excess enthalpy (HE) for the binary system of (methanol + 2,4,4-trimethyl-1-pentene) (TMP-1) is reported at T = 298.15 K and 101 kPa. (Liquid + liquid) equilibrium (LLE) for the same system is measured at atmospheric pressure (101 kPa). LLE for ternary system of (water + methanol + 2,4,4-trimethyl-1-pentene) is measured at T = (283 and 298) K. The parameters of Non-Random Two-Liquid (NRTL) model were regressed for the system of (methanol + TMP-1) using HE and LLE from this work combined with isobaric (101 kPa) and isothermal (T = 331 K) VLE data from literature. The NRTL parameters for the binary system of (water + TMP-1) were fitted to a binary LLE data set from literature. NRTL parameters for the binary system of (water + methanol) were taken from ASPEN PLUS. The LLE for the ternary system was modeled by the three binary NRTL interaction parameters systems. The binary and ternary models were compared against the measured data

  13. Ab initio full-potential study of mechanical properties and magnetic phase stability of californium monopnictides (CfN and CfP)

    Science.gov (United States)

    Amari, S.; Bouhafs, B.

    2016-09-01

    Based on the first-principles methods, the structural, elastic, electronic, properties and magnetic ordering of californium monopnictides CfX (X = P) have been studied using the full-potential augmented plane wave plus local orbitals (FP-L/APW + lo) method within the framework of density functional theory (DFT). The electronic exchange correlation energy is described by generalized gradient approximation GGA and GGA+U (U is the Hubbard correction). The GGA+U method is applied to the rare-earth 5f states. We have calculated the lattice parameters, bulk modulii and the first pressure derivatives of the bulk modulii. The elastic properties of the studied compounds are only investigated in the most stable calculated phase. In order to gain further information, we have calculated Young's modulus, shear modulus, anisotropy factor and Kleinman parameter by the aid of the calculated elastic constants. The results mainly show that californium monopnictides CfX (X = P) have an antiferromagnetic spin ordering. Density of states (DOS) and charge densities for both compounds are also computed in the NaCl (B1) structure.

  14. 胶态二氧化硅SYLOID244FP固化肉桂挥发油的研究%Study on solidifying volatile oil of cinnamon with colloidal silicon dioxide SYLOID244FP

    Institute of Scientific and Technical Information of China (English)

    蒋艳荣; 张振海; 胡绍英; 贾晓斌

    2013-01-01

    目的:评价胶态二氧化硅SYLOID244FP固化肉桂挥发油的特性.方法:采用SYLOID244FP固化肉桂挥发油,以桂皮醛收率为指标,优选SYLOID244FP用量;采用差示扫描量热法和扫描电镜法对固化粉末进行物相表征;考察SY-LOID244FP对肉桂挥发油中桂皮醛体外溶出和受热稳定性的影响.结果:SYLOID244FP与肉桂挥发油最佳固化比例1∶1,肉桂挥发油被固化之后,体外溶出速率加快,受热稳定性提高.结论:SYLOID244FP吸附固化中药挥发油值得进一步研究.%Objective:To evaluate the properties of solidifying volatile oil of cinnamon with colloidal silicon dioxide SYLOID244FP.Method:Volatile oil of cinnamon was solidified by SYLOID244FP.The amount of SYLOID244FP was optimized with the cinnamaldehyde yield as criteria.Curing powder was characterized by scanning electron microscopy (SEM) and differential scanning calorimetry (DSC).The effects of SYLOID244FP on dissolution in vitro and thermal stability of cinnamaldehyde were studied.Result:The optimum solidification ratio of SYLOID244FP to volatile oil of cinnamon was 1 ∶ 1.Dissolution rate of cinnamaldehyde increasesd and its thermal stability improved after volatile oil of cinnamon was solidified.Conclusion:Solidifying herbal volatile oil with SY-LOID244FP deserves studying further.

  15. Measurements of neutron cross section of the {sup 243}Am(n,{gamma}){sup 244}Am reaction

    Energy Technology Data Exchange (ETDEWEB)

    Hatsukawa, Yuichi; Shinohara, Nobuo; Hata, Kentaro [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment

    1998-03-01

    The effective thermal neutron cross section of {sup 243}Am(n,{gamma}){sup 244}Am reaction was measured by the activation method. Highly-purified {sup 243}Am target was irradiated in an aluminum capsule by using a research reactor JRR-3M. The tentative effective thermal neutron cross sections are 3.92 b, and 84.44 b for the production of {sup 244g}Am and {sup 244m}Am, respectively. (author)

  16. HAYNES 244 alloy – a new 760 ∘C capable low thermal expansion alloy

    Directory of Open Access Journals (Sweden)

    Fahrmann Michael G.

    2014-01-01

    Full Text Available HAYNES® 244TM alloy is a new 760∘C capable, high strength low thermal expansion (CTE alloy. Its nominal chemical composition in weight percent is Ni – 8 Cr – 22.5 Mo – 6 W. Recently, a first mill-scale heat of 244 alloy was melted by Haynes International, and processed to various product forms such as re-forge billet, plate, and sheet. This paper presents key attributes of this new alloy (CTE, strength, low-cycle fatigue performance, oxidation resistance, thermal stability as they pertain to the intended use in rings and seals of advanced gas turbines.

  17. The measurement of prompt neutron spectrum in spontaneous fission of {sup 244}Cm

    Energy Technology Data Exchange (ETDEWEB)

    Batenkov, O.I.; Boykov, G.S.; Drapchinsky, L.V.; Majorov, M.Ju.; Trenkin, V.A. [V.G. Khlopin Radium Inst., Saint Petersburg (Russian Federation)

    1997-03-01

    Under the Program of Measurements of Prompt Fission Neutron Spectra of Minor Actinides for Transmutation Purposes the integral neutron spectrum in spontaneous fission of {sup 244}Cm has been measured by the time-of-flight method in the energy range of 0.1-15 MeV relative to the standard neutron spectrum in {sup 252}Cf spontaneous fission. Essential attention was paid to revealing of possible systematic errors. It is shown, that the {sup 244}Cm spectrum shape may be well described by using Mannhart evaluation with appropriate parameter of Maxwell temperature T{sub M} = 1.37 MeV. (author)

  18. HAYNES 244 alloy – a new 760 ∘C capable low thermal expansion alloy

    OpenAIRE

    Fahrmann Michael G.; Srivastava S. Krishna; Pike Lee M.

    2014-01-01

    HAYNES® 244TM alloy is a new 760∘C capable, high strength low thermal expansion (CTE) alloy. Its nominal chemical composition in weight percent is Ni – 8 Cr – 22.5 Mo – 6 W. Recently, a first mill-scale heat of 244 alloy was melted by Haynes International, and processed to various product forms such as re-forge billet, plate, and sheet. This paper presents key attributes of this new alloy (CTE, strength, low-cycle fatigue performance, oxidation resistance, thermal stability) as they pertain t...

  19. Inhalation toxicology of repeated exposures to 244CmO2

    International Nuclear Information System (INIS)

    Rats have been exposed to inhaled 244CmO2 at 70 and 280 days of age (IAD, approx. 350 nCi) and at ten 3-week intervals (IAD, approx. 35 nCi per exposure). Autoradiographs are being examined for lung, liver and bone microdosimetry

  20. 48 CFR 1852.244-70 - Geographic participation in the aerospace program.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Geographic participation in... AERONAUTICS AND SPACE ADMINISTRATION CLAUSES AND FORMS SOLICITATION PROVISIONS AND CONTRACT CLAUSES Texts of Provisions and Clauses 1852.244-70 Geographic participation in the aerospace program. As prescribed in...

  1. 27 CFR 28.244a - Shipment to a customs bonded warehouse.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Shipment to a customs... Export Consignment § 28.244a Shipment to a customs bonded warehouse. Distilled spirits and wine withdrawn for shipment to a customs bonded warehouse shall be consigned in care of the customs officer in...

  2. Anatomy of a controversy: Application of the Langevin technique to the analysis of the Californium-252 Source-Driven Noise Analysis method for subcriticality determination

    International Nuclear Information System (INIS)

    The expressions for the power spectral density of the noise equivalent sources have been calculated explicitly for the (a) stochastic transport equation, (b) the one-speed transport equaton, (c) the one-speed P1 equations, (d) the one-speed diffusion equation and (e) the point kinetic equation. The stochastic nature of Fick's law in (d) has been emphasized. The Langevin technique has been applied at various levels of approximation to the interpretation of the Californium-252 Source-Driven Noise Analysis (CSDNA) experiment for determining the reactivity in subcritical media. The origin of the controversy surrounding this method has been explained. The foundations of the CSDNA method as a viable experimental technique to infer subcriticality from a measured ratio of power spectral densities of the outputs of two neutron detectors and a third external source detector has been examined by solving the one-speed stochastic diffusion equation for a point external Californium-252 source and two detectors in an infinite medium. The expression relating reactivity to the measured ratio of PSDs was found to depend implicitly on k itself. Through a numerical analysis fo this expression, the authors have demonstrated that for a colinear detector-source-detector configuration for neutron detectors far from the source, the expression for the subcritical multiplication factor becomes essentially insensitive to k, hence, demonstrating some possibility for the viability of this technique. However, under more realistic experimental conditions, i.e., for finite systems in which diffusion theroy is not applicable, the measurement of the subcritical multiplication factor from a single measured ratio of PSDs, without extensive transport calculations, remains doubtful

  3. Application of SCGE assay, classical cytogenetics and FISH for studying in vitro californium-252 neutrons irradiations and BSH pretreatment on human lymphocytes

    International Nuclear Information System (INIS)

    Recently, there has been observed a tendency to apply various energy neutrons for tumor therapy and particularly low energy neutrons from various sources, including californium-252 source, for cancer radiotherapy based on the neutron capture. In this study peripheral blood lymphocytes were used as a model for human cells and three methods were applied to assess the effectiveness of californium-252 neutrons irradiations in vitro in normal cells or pre-treated with compound enriched in B-10 ion. Human blood samples or isolated lymphocytes were irradiated with neutrons from isotopic 252Cf source at the Faculty of Nuclear Physics and Technics at University of Mining and Metallurgy (both neutron source and samples were placed in polyethylene block). Chemical pretreatment with BSH (Na210B12H11SH) was done to introduce boron-10 ion into cells in order to check any enhancement effect due to the process of boron neutron capture. Comet assay was done to investigate the DNA damage. Classical cytogenetics was applied to assess the frequencies of unstable aberrations (dicentrics and rings). Fluorescence in situ hybridization (FISH) with probes for chromosomes 1, 4 (14.3% of whole genome) and pancentromeric probe was performed to evaluate the frequencies of stable aberrations. Linear (or close to linear) increase of DNA damage and aberration frequency was observed with dose of radiation both for lymphocytes untreated or pre-treated with BSH. Very little differences (statistically insignificant) due to radiation dose and BSH pretreatment were observed in the frequencies of SCEs detected in the second mitosis. There is no significant difference between boron pre-treated and not treated cells, and even slightly higher effects were observed in case of the highest dose without BSH pretreatment. The level of translocations observed is comparable with the frequencies of dicentrics and rings. (author)

  4. Californium-252 neutron sources

    International Nuclear Information System (INIS)

    Major production programs for the Savannah River reactors and the High Flux Isotopes Reactor at Oak Ridge have made 252Cf one of the most available and, at the USAEC's sales price of $10/μg, one of the least-expensive isotopic neutron sources. Reactor production has totaled approximately 2 g, and, based on expected demand, an additional 10 g will be produced in the next decade. The approximately 800 mg chemically separated to date has been used to prepare over 600 neutron sources. Most, about 500, have been medical sources containing 1 to 5 μg of 252Cf plated in needles for experimental cancer therapy studies. The remainder have generally been point sources containing 10 μg to 12 mg of oxide for activation, well logging, or radiography uses. Bulk sources have also been supplied to the commercial encapsulators. The latest development has been the production of 252Cf cermet wire which can be cut into almost contamination-free lengths of the desired 252Cf content. Casks are available for transport of sources up to 50 mg. Subcritical assemblies have been developed to multiply the source neutrons by a factor of 10 to 40, and collimators and thermalizers have also been extensively developed to shape the neutron flux and energy distributions for special applications. (U.S.)

  5. Calculations of Nuclear Astrophysics and Californium Fission Neutron Spectrum Averaged Cross Section Uncertainties Using ENDF/B-VII.1, JEFF-3.1.2, JENDL-4.0 and Low-fidelity Covariances

    International Nuclear Information System (INIS)

    Nuclear astrophysics and californium fission neutron spectrum averaged cross sections and their uncertainties for ENDF materials have been calculated. Absolute values were deduced with Maxwellian and Mannhart spectra, while uncertainties are based on ENDF/B-VII.1, JEFF-3.1.2, JENDL-4.0 and Low-Fidelity covariances. These quantities are compared with available data, independent benchmarks, EXFOR library, and analyzed for a wide range of cases. Recommendations for neutron cross section covariances are given and implications are discussed

  6. Plutonium-244 fission xenon and primordial xenon in lunar samples and meteorites

    International Nuclear Information System (INIS)

    Xenon found in lunar samples is a binary mixture of 244Pu fission xenon and a trapped xenon, whose isotopic composition often shows a striking resemblance to that of TAKAOKA's primitive xenon. The decay product of 129I is conspicuously absent in lunar samples and this may be attributed to the facts that (a) the half-life of 129I is much shorter than that of 244Pu, and (b) the separation of xenon from plutonium may take place easily, since the former is a gaseous element, while the latter is a refractory element. The separation of xenon from iodine may not take place easily, however, since the former is a gaseous element, while the latter is a volatile element. The isotopic compositions of the trapped xenon released from ordinary chondrites and achondrites resemble that of TAKAOKA's primitive xenon, which has been mass-fractionated in such a manner that the heavier isotopes are systematically enriched relative to the lighter isotopes. (author)

  7. Alpha particle radiography of ants using a 244Cm alpha source

    International Nuclear Information System (INIS)

    Alpha particles emitted from a radioisotope 244Cm were used for the radiography of ants. Cellulose nitrate films, LR-115 from Kodak Pathe, were used as solid state nuclear track detectors to make the radiographs. Alpha particles of energies from 3.5 to 5.5 MeV were obtained by varying the air spacing between the 244Cm and the sample with stainless steel spacers of thickness from 2.4 to 0.5 cm to slow the 5.81 MeV alpha particles from the 244Cm by air. The resulting radiographs of the ants put on the LR-115 films and irradiated by alpha particles of different energies show that only the profiles of the ants were obtained when the ants were exposed to alpha particles of energies lower than 3.5 MeV, and almost all parts of the ant except a portion in the head were penetrated by alpha particles of energies higher than 5.0 MeV to register high density alpha tracks on the LR-115. The details of the internal organs of the ant can be shown clearly by radiography with alpha particles of energies between 4.0 and 5.0 MeV. (author)

  8. Oxidation-reduction properties of americium, curium, berkelium, californium, einsteinium and fermium, and thermodynamic consequences for the 5f series

    International Nuclear Information System (INIS)

    The amalgamation of 5f elements from Am to Fm has been studied by using 241Am, 244Cm, 249Bk, 249Cf, 252Cf, 253Es, 254Es, 252Fm and 255Fm with two electrochemical methods, radiocoulometry and radiopolarography, perfectly adapted to investigate extremely diluted solutions when the concentration of electroactive species is as low as 10-16M. The theory of radiocoulometry has been developed in the general cases of reversible and irreversible electrode process. It has been used to interpret the experimental data on the kinetic curves of amalgamation, and to estimate the standard rate constant of the electrode process in complexing medium (citric). On the other hand the radiopolarographic method has been applied to study the mechanism of reduction at the dropping mercury electrode of cations M3+ in aqueous medium to the metal M with formation of amalgam. The results are exploited into two directions: 1- Acquisition of some data concerning the oxidation-reduction properties of elements from Am to Fm. Therefore the standard electrode E0 [M(III-0)] potentials for Bk, Cf and Es, and the standard electrode E0 [M(II-0)] potential for Fm are estimated and the relative stability of each oxidation state (from II to VII) of 5f elements is discussed; 2- Acquisition of unknown thermodynamic data on transcalifornium elements. Correlations between 4f and 5f elements are precised and some divergences appear for the second half of 4f and 5f series (i.e. for 65<=Z<=71 and 97<=Z<=103)

  9. Effect of DTPA on concentration ratios of 237Np and 244Cm in vegetative parts of bush bean and barley

    International Nuclear Information System (INIS)

    Bush beans (Phaseolus vulgaris L.) and barley (Hordeum vulgare L.) were grown in two different soils (noncalcareous and calcareous) in containers in a glasshouse with 530 pCi/g 237Np or 15040 pCi/g 244Cm mixed into separate containers of the soil. The chelating agent DTPA at 100 μg/g soil was added to one half of the containers. The concentration ratio (C.R.) without DTPA was two orders of magnitude higher for 237Np than for 244Cm by two and three orders of magnitude but had little influence on 237Np. For the calcareous soil with DTPA, 244Cm C.R.'s were greater than those for 237Np. In bush beans both 237Np and 244Cm C.R.'s were higher in primary leaves than in trifoliate leaves which were higher than for stems

  10. Californium interrogation prompt neutron (CIPN) instrument for non-destructive assay of spent nuclear fuel-Design concept and experimental demonstration

    Science.gov (United States)

    Henzlova, D.; Menlove, H. O.; Rael, C. D.; Trellue, H. R.; Tobin, S. J.; Park, Se-Hwan; Oh, Jong-Myeong; Lee, Seung-Kyu; Ahn, Seong-Kyu; Kwon, In-Chan; Kim, Ho-Dong

    2016-01-01

    This paper presents results of the first experimental demonstration of the Californium Interrogation Prompt Neutron (CIPN) instrument developed within a multi-year effort launched by the Next Generation Safeguards Initiative Spent Fuel Project of the United States Department of Energy. The goals of this project focused on developing viable non-destructive assay techniques with capabilities to improve an independent verification of spent fuel assembly characteristics. For this purpose, the CIPN instrument combines active and passive neutron interrogation, along with passive gamma-ray measurements, to provide three independent observables. This paper describes the initial feasibility demonstration of the CIPN instrument, which involved measurements of four pressurized-water-reactor spent fuel assemblies with different levels of burnup and two initial enrichments. The measurements were performed at the Post-Irradiation Examination Facility at the Korea Atomic Energy Institute in the Republic of Korea. The key aim of the demonstration was to evaluate CIPN instrument performance under realistic deployment conditions, with the focus on a detailed assessment of systematic uncertainties that are best evaluated experimentally. The measurements revealed good positioning reproducibility, as well as a high degree of insensitivity of the CIPN instrument's response to irregularities in a radial burnup profile. Systematic uncertainty of individual CIPN instrument signals due to assembly rotation was found to be orientation in the instrument.

  11. Development of technology for high-purity 244Pu production by method of electromagnetic separation

    International Nuclear Information System (INIS)

    The IAEA needs plutonium isotopic reference materials and spikes certified to an accuracy of 0.05% or better for the verification of large throughputs and inventories of plutonium under IAEA safeguards and for the isotopic analysis of traces of plutonium in environmental samples taken to confirm state declarations. At the request of the IAEA the Russian Federal Nuclear Center (RFNC) has defined a plan to produce highly enriched plutonium isotopes necessary for the preparation of the required reference materials and spikes. The objective is to produce about 260 mg of 99.74% enriched 242Pu and up to 100 mg of 99.56% enriched 244Pu by electromagnetic separation starting from 5 g of a feed material of US origin containing about 16% of 244Pu. A second enrichment cycle is foreseen to produce about 1 mg of 99.99% enriched 244Pu. In view of the limited amount of feed material, RFNC will upgrade its technologies and procedures for the preparation of high-purity plutonium chloride, the processes of ionisation, the radiochemical recovery of the material deposited on the collectors of the mass separator or scattered in the machine and the regeneration of the latter, before proceeding with the production of the isotopes requested by the IAEA. To cover the cost of this development RFNC has applied to the International Science and Technology Center for a grant which is presently under evaluation. The project described in this paper is undertaken with the close support and collaboration of the IAEA, Los Alamos National Laboratory (LANL), New Brunswick Laboratory (NBL) and the Institute for Reference Materials and Measurements (IRMM)

  12. Software Verification and Validation Report for the 244-AR Vault Interim Stabilization Ventilation System

    International Nuclear Information System (INIS)

    This document reports on the analysis, testing and conclusions of the software verification and validation for the 244-AR Vault Interim Stabilization ventilation system. Automation control system will use the Allen-Bradley software tools for programming and programmable logic controller (PLC) configuration. The 244-AR Interim Stabilization Ventilation System will be used to control the release of radioactive particles to the environment in the containment tent, located inside the canyon of the 244-AR facility, and to assist the waste stabilization efforts. The HVAC equipment, ducts, instruments, PLC hardware, the ladder logic executable software (documented code), and message display terminal are considered part of the temporary ventilation system. The system consists of a supply air skid, temporary ductwork (to distribute airflow), and two skid-mounted, 500-cfm exhausters connected to the east filter building and the vessel vent system. The Interim Stabilization Ventilation System is a temporary, portable ventilation system consisting of supply side and exhaust side. Air is supplied to the containment tent from an air supply skid. This skid contains a constant speed fan, a pre-filter, an electric heating coil, a cooling coil, and a constant flow device (CFD). The CFD uses a passive component that allows a constant flow of air to pass through the device. Air is drawn out of the containment tent, cells, and tanks by two 500-cfm exhauster skids running in parallel. These skids are equipped with fans, filters, stack, stack monitoring instrumentation, and a PLC for control. The 500CFM exhaust skids were fabricated and tested previously for saltwell pumping activities. The objective of the temporary ventilation system is to maintain a higher pressure to the containment tent, relative to the canyon and cell areas, to prevent contaminants from reaching the containment tent

  13. Type B investigation report of curium-244 exposure at the ORNL TRU Facility, January 15, 1986

    Energy Technology Data Exchange (ETDEWEB)

    Love, G.L.; Butler, H.M.; Duncan, D.T.; Oakes, T.W.

    1986-04-01

    This Type B Investigative Report provides an evaluation of relevant events and activities that led to, were a part of, or resulted from the release of curium-244 in the Building 7920 facility at ORNL in January 1986. Impacts have been evaluated with respect to employee exposures and the costs and loss of productivity resulting from increased bioassay analyses and activities of investigative committees. Management systems evaluated include (1) training of employees performing lab analyses, (2) adherence to procedures, and (3) response to unusual circumstances.

  14. Type B investigation report of curium-244 exposure at the ORNL TRU Facility, January 15, 1986

    International Nuclear Information System (INIS)

    This Type B Investigative Report provides an evaluation of relevant events and activities that led to, were a part of, or resulted from the release of curium-244 in the Building 7920 facility at ORNL in January 1986. Impacts have been evaluated with respect to employee exposures and the costs and loss of productivity resulting from increased bioassay analyses and activities of investigative committees. Management systems evaluated include (1) training of employees performing lab analyses, (2) adherence to procedures, and (3) response to unusual circumstances

  15. Infrared Line Emission in the Interacting Region of Arp 244 (the Antennae) Colliding Molecular Cloud Complexes ?

    CERN Document Server

    Liang, M C; Lo, K Y; Kim, D C

    2001-01-01

    We report velocity-resolved spectroscopy of infrared hydrogen recombination lines in the interacting region of the Antennae galaxies (NGC 4038/4039). It generally has been assumed that the active star formation found there is due to the interaction of the disks of the two galaxies and \\citet{lee01} have observed two molecular cloud complexes, separated in velocity by $\\sim$100 km s$^{-1}$, in the southern part of this region. Our measurements imply that the two cloud complexes are moving away from each other. This result poses interesting questions about the physical mechanisms leading to starbursts in Arp 244 and other interacting galaxies.

  16. Kuluttajakäyttäytymisen hyödyntäminen verkkokaupan markkinoinnissa : Case: 244

    OpenAIRE

    Kylä-Kaila, Tero; Kylä-Kaila, Kaisa

    2013-01-01

    Opinnäytetyön toimeksiantajana oli kirjoittajien vuonna 2011 perustama yritys, 244. Yritys on vaatteita ja asusteita myyvä verkkokauppa. Opinnäytetyö tehtiin vauhdittamaan verkkokaupan myyntiä luomalla markkinointistrategia. Opinnäytetyöllä oli kaksi tavoitetta: ensimmäinen tavoite oli tutkia ja todistaa erityisesti sosiaalisten tekijöiden vaikutusta ihmisten verkkokauppakäyttäytymiseen muodin ostamisessa. Toinen tavoite oli löytää ja luoda keinoja markkinoida yritystä tutkimuksista saatujen ...

  17. New limit of $^{244}$Pu on Earth points to rarity of actinide nucleosynthesis

    CERN Document Server

    Wallner, A; Feige, J; Feldstein, C; Knie, K; Korschinek, G; Kutschera, W; Ofan, A; Paul, M; Quinto, F; Rugel, G; Steier, P

    2015-01-01

    Half of the heavy elements including all actinides are produced in r-process nucleosynthesis whose sites and history still remain a mystery. If continuously produced, the Interstellar Medium (ISM) is expected to build up a quasi-steady state of abundances of short-lived nuclides (with half-lives <100My), including actinides produced in r-process nucleosynthesis. Their existence in today's ISM would serve as a radioactive clock and would establish that their production was recent. In particular $^{244}$Pu, a radioactive actinide nuclide (81 My half-life), can place strong constraints on recent r-process frequency and production yield. Here we report on the detection of live interstellar $^{244}$Pu, archived in Earth's deep-sea floor during the last 25 My, at abundances lower by about two orders of magnitude than expected from continuous production in the Galaxy. This large discrepancy may signal a rarity of actinide r-process nucleosynthesis sites, compatible with neutron-star mergers or with a small subset...

  18. Isotopic yield in cold binary fission of even-even $^{244-258}$Cf isotopes

    CERN Document Server

    Santhosh, K P; Krishnan, Sreejith

    2016-01-01

    The cold binary fission of even-even 244-258Cf isotopes has been studied by taking the interacting barrier as the sum of Coulomb and proximity potential. The favorable fragment combinations are obtained from the cold valley plot (plot of driving potential vs. mass number of fragments) and by calculating the yield for charge minimized fragments. It is found that highest yield for 244,246,248Cf isotopes are for the fragments with isotope of Pb (Z=82) as one fragment, whereas for 250Cf and 252Cf isotopes the highest yield is for the fragments with isotope of Hg (Z=80) as one fragment. In the case of 254,256,258Cf isotopes the highest yield is for the fragments with Sn (Z=50) as one fragment. Thus, the fragment combinations with maximum yield reveal the role of doubly magic and near doubly magic nuclei in binary fission. It is found that asymmetric splitting is favoured for Cf isotopes with mass number A 252. In the case of Cf isotope with A=252, there is an equal probability for asymmetric and symmetric splitti...

  19. 244CmO2/nat.-UO2 hybrid blanket with flat fission power production

    International Nuclear Information System (INIS)

    In the present study, 244CmO2 is mixed with nat.-UO2 for the purpose of power flattening in a hybrid blanket with a reasonably high energy multiplication factor. Also, the temporal variations of the fission power density (FPD) are observed during an 18-month plant operation period. The main conclusion drawn from this work is that it became possible to keep a flat fission power profile (FPP) over a very long plant operation period of 18 months by simply omitting the beryllium multiplier in the blanket and keeping the neutron spectrum fairly unchanged throughout the fission zone. This reduced the efforts for fuel management to a minimum. A further observation focused on only minor variations of the integral neutronic data over longer plant operation periods. Among others, the fission power generation increase is also very modest. This results in an optimum investment for the nonnuclear island. The blanket burns up high-level nuclear waste 244Cm effectively, with efficient electricity production and breeding of a new type of nuclear fuel 245Cm with very superior nuclear properties. Finally, a warning should be issued for the careful international safeguarding of such a hybrid plant due to the extremely high quality of the bred plutonium fuel

  20. Isotopic yield in cold binary fission of even-even 244-258Cf isotopes

    Science.gov (United States)

    Santhosh, K. P.; Cyriac, Annu; Krishnan, Sreejith

    2016-05-01

    The cold binary fission of even-even 244-258Cf isotopes has been studied by taking the interacting barrier as the sum of Coulomb and proximity potential. The favorable fragment combinations are obtained from the cold valley plot (plot of driving potential vs. mass number of fragments) and by calculating the yield for charge minimized fragments. It is found that for 244,246,248Cf isotopes highest yield is for the fragments with isotope of Pb (Z = 82) as one fragment, whereas for 250Cf and 252Cf isotopes the highest yield is for the fragments with isotope of Hg (Z = 80) as one fragment. In the case of 254,256,258Cf isotopes the highest yield is for the fragments with Sn (Z = 50) as one fragment. Thus, the fragment combinations with maximum yield reveal the role of doubly magic and near doubly magic nuclei in binary fission. It is found that asymmetric splitting is favored for Cf isotopes with mass number A ≤ 250 and symmetric splitting is favored for Cf isotopes with A > 252. In the case of Cf isotope with A = 252, there is an equal probability for asymmetric and symmetric splitting. The individual yields obtained for the cold fission of 252Cf isotope are compared with the experimental data taken from the γ- γ- γ coincidences technique using Gammasphere.

  1. Stability of 244-260Fm isotopes against alpha and cluster radioactivity

    Indian Academy of Sciences (India)

    K P Santhosh; R K Biju; Sabina Sahadevan

    2009-12-01

    Taking Coulomb and proximity potentials as the interacting barrier we have studied the cold valley in the radioactive decay of 244-260Fm isotopes. It is found that in addition to alpha particle minima, other minima occur at S, Ar and Ca clusters. We have computed the half-lives and other characteristics of different clusters emitted from these parents treating parent, daughter and emitted cluster as spheres. Our study reveals that most of these parents are unstable against alpha and heavy cluster (46Ar, 48,50Ca) emissions and stable against light cluster emission, except 8Be from 244-248Fm isotopes. The most probable clusters from these parents are predicted to be 46Ar, 48,50Ca which indicate the role of doubly or near doubly magic clusters ( = 20, = 28) and also stress the role of doubly magic 208Pb daughter. The computed half-lives for alpha decay are in good agreement with the experimental data. It is found that the presence of neutron excess in the parent nuclei slows down the cluster decay process. The effect of quadrupole (2) and hexadecapole (4) deformations of parent and fragments on half-lives are also studied. It is found that inclusion of 2 and 4 reduces the height and shape of the barrier (increases barrier penetrability) and hence the half-life decreases.

  2. Biological Efficiency of Californium-252 Source Evaluated by Comet Assay, Classical Cytogenetics and FISH in Human Lymphocytes Irradiated without and with BSH Pretreatment

    International Nuclear Information System (INIS)

    Biological effectiveness of californium-252 source was evaluated after irradiations in vitro of normal or pre-treated with compound enriched in B-10 ion cells. Peripheral blood lymphocytes were used as a model for human cells. DNA and chromosomal damage were studied to compare biological effectiveness of irradiation. Human blood samples or isolated lymphocytes were irradiated with the isotopic source of 252Cf, at the Faculty of Physics and Nuclear Techniques at the University of Mining and Metallurgy (both neutron source and samples were placed in ''infinite'' polyethylene block). Chemical pretreatment with Na210B12H11SH (BSH) was performed to introduce boron-10 ion into cells in order to check any enhancement effect due to the process of boron neutron capture. Single cell gel electrophoresis also known as the Comet assay was done to investigate the DNA damage. Classical cytogenetic analysis was applied to assess the frequencies of unstable aberrations (dicentrics, rings and a centric fragments). To evaluate the frequencies of stable aberrations the fluorescence in situ hybridisation (FISH) with probes for chromosomes 1, 4 (14.3% of the whole genome) was performed. Linear (or close to linear) increase with radiation dose were observed for the DNA damage and aberration frequencies in lymphocytes both untreated or pre-treated with BSH. Levels of translocations evaluated for the whole genome were comparable with the frequencies of dicentrics and rings. No significant differences were detected due to radiation dose in the frequencies of sister chromatid exchanges (SCE) detected in the second mitosis. No statistically significant differences were observed in various biological end-points between normal or boron pre-treated cells. (author)

  3. Filaments and Ionized Gas in the Vicinity of 3C 244.1

    CERN Document Server

    Feinstein, C; Martel, A R; Sparks, W B; Feinstein, Carlos; Martel, Andre R.; Sparks, William B.

    2001-01-01

    We present results of Hubble Space Telescope observations of the radio galaxy 3C 244.1. The broadband F702W (R) and F555W (V) images (WFPC2/PC) show an elliptical galaxy and gaseous filaments and blobs surrounding it. In the narrow-band ramp filter, dominated by [OIII]lambda5007, these filaments are bright and have the same morphology as the broad band images. To the south, the filaments have a cone-shaped structure and the radio jet is located at the center of this cone. To the north of the galaxy, the structure is found near the nucleus of the galaxy within its elliptical profile. From the photometry, the two brighter structures seem to be extended narrow line emission regions (ENLRs). The comparison with diagnostic line ratios shows that the observed emission is consistent with interactions between the expanding radio-jet and the local denser medium.

  4. Deformation effects in the alpha accompanied cold ternary fission of even-even $^{244-260}$Cf isotopes

    OpenAIRE

    Santhosh, K P; Krishnan, Sreejith

    2016-01-01

    Within the Unified ternary fission model (UTFM), the alpha accompanied ternary fission of even-even $^{244-260}$Cf isotopes has been studied by taking the interacting barrier as the sum of Coulomb and proximity potential. For the alpha accompanied ternary fission of 244^Cf isotope, the highest yield is obtained for the fragment combination 108^Ru+4^He+132^Te, which contain near doubly magic nuclei 132^Te (N=80, Z=52). In the case of 246^Cf and 248^Cf isotopes, the highest yield is obtained fo...

  5. The emission probabilities of long range alpha particles from even-even 244-252Cm isotopes

    OpenAIRE

    Santhosh, K P; Krishnan, Sreejith; Priyanka, B.

    2014-01-01

    The alpha accompanied cold ternary fission of even-even 244Cm, 246Cm, 248Cm, 250Cm and 252Cm isotopes have been studied by taking the interacting barrier as the sum of Coulomb and proximity potential with the fragments in equatorial configuration. The favorable fragment combinations are obtained from the cold reaction valley plot and by calculating the relative yield for the charge minimized fragments. In the alpha accompanied ternary fission of 244Cm isotope, the highest yield is found for t...

  6. 5 CFR 531.244 - Adjusting a GM employee's rate at the time of an annual pay adjustment.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Adjusting a GM employee's rate at the... Rules for Gm Employees § 531.244 Adjusting a GM employee's rate at the time of an annual pay adjustment... agency must set the new GS rate for a GM employee as follows: (1) For a GM employee whose GS rate...

  7. 30 CFR 250.244 - What geological and geophysical (G&G) information must accompany the DPP or DOCD?

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false What geological and geophysical (G&G... Operations Coordination Documents (docd) § 250.244 What geological and geophysical (G&G) information must accompany the DPP or DOCD? The following G&G information must accompany your DPP or DOCD: (a)...

  8. 19 CFR 24.4 - Optional method for payment of estimated import taxes on alcoholic beverages upon entry, or...

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Optional method for payment of estimated import... THE TREASURY CUSTOMS FINANCIAL AND ACCOUNTING PROCEDURE § 24.4 Optional method for payment of... been given to me to use such procedure. (d) Use of deferred payment method. (1) The port director...

  9. Representation of perfectly reconstructed octave decomposition filter banks with set of decimators {2,4,4} via tree structure

    OpenAIRE

    Ling, Wing-Kuen; Tam, P K

    2003-01-01

    In this letter, we prove that a filter bank with set of decimators {2,4,4} achieves perfect reconstruction if and only if it can be represented via a tree structure and each branch of the tree structure achieves perfect reconstruction.

  10. The synthesis of superheavy nuclei in the 48Ca + 244Pu reaction

    International Nuclear Information System (INIS)

    In the bombardment of a 244Pu target with 48Ca ions, we observed a decay sequence consisting of an implanted heavy atom, three subsequent α-decays, and a spontaneous fission, all correlated in time and position. The measured α-energies and corresponding time intervals were: Eα = 9.71 MeV (Δt = 30.4 s), 8.67 MeV (Δt = 15.4 min) and 8.83 MeV (Δt = 1.6 min); for the spontaneous fission (Δt = 16.5 min) the total deposited energy was approximately 190 MeV. The large alpha-particle energies together with the long decay times and spontaneous fission terminating the chain offer evidence of the decay of nuclei with high atomic numbers. This decay chain is a good candidate for originating from the α-decay of the parent nucleus 289114, produced in the 3n-evaporation channel with a cross section of about 1 pb. The significant increase in the lifetimes of the new Z = 112 and 110 daughters of the Z = 114 nuclide (by a factor of ∼ 106) with respect to the known heaviest isotopes of elements 112 and 110 can be considered as a direct proof of the existence of the 'island of stability' of superheavy elements

  11. 243 244Cm studies in C57BL/Do mice

    International Nuclear Information System (INIS)

    Three groups of C57BL/Do mice were injected with different activities of 243244Cm so that the long-term biological effects could be evaluated. Effective skeletal retention equations were used to calculate the cumulative mean skeletal dose in rad at 140 days before death in each group of mice. The primary objective of this study was to determine the relative biological effectiveness (RBE) of 243244Cm compared to 226Ra, using bone sarcoma induction at the end point. Combined data for male and female mice permitted the RBE value +/- SD for 243244Cm to be calculated as 4.4 +/- 1.8 compared to 1.0 for 226Ra. A comparison of RBE values from a previous study in this mouse strain and the value for 243244Cm from this study suggest that the trivalent actinides 241Am, /sup 243,244/Cm, and 249Cf are about three times less effective for bone sarcoma induction than 239Pu

  12. Direct nuclear magnetic resonance observation of odorant binding to mouse odorant receptor MOR244-3.

    Science.gov (United States)

    Burger, Jessica L; Jeerage, Kavita M; Bruno, Thomas J

    2016-06-01

    Mammals are able to perceive and differentiate a great number of structurally diverse odorants through the odorant's interaction with odorant receptors (ORs), proteins found within the cell membrane of olfactory sensory neurons. The natural gas industry has used human olfactory sensitivity to sulfur compounds (thiols, sulfides, etc.) to increase the safety of fuel gas transport, storage, and use through the odorization of this product. In the United States, mixtures of sulfur compounds are used, but the major constituent of odorant packages is 2-methylpropane-2-thiol, also known as tert-butyl mercaptan. It has been fundamentally challenging to understand olfaction and odorization due to the low affinity of odorous ligands to the ORs and the difficulty in expressing a sufficient number of OR proteins. Here, we directly observed the binding of tert-butyl mercaptan and another odiferous compound, cis-cyclooctene, to mouse OR MOR244-3 on living cells by saturation transfer difference (STD) nuclear magnetic resonance (NMR) spectroscopy. This effort lays the groundwork for resolving molecular mechanisms responsible for ligand binding and resulting signaling, which in turn will lead to a clearer understanding of odorant recognition and competition. PMID:27019154

  13. The statistical model calculation of prompt neutron spectra from spontaneous fission of {sup 244}Cm and {sup 246}Cm

    Energy Technology Data Exchange (ETDEWEB)

    Gerasimenko, B.F. [V.G. Khlopin Radium Inst., Saint Peterburg (Russian Federation)

    1997-03-01

    The calculations of integral spectra of prompt neutrons of spontaneous fission of {sup 244}Cm and {sup 246}Cm were carried out. The calculations were done by the Statistical Computer Code Complex SCOFIN applying the Hauser-Feschbach method as applied to the description of the de-excitation of excited fission fragments by means of neutron emission. The emission of dipole gamma-quanta from these fragments was considered as a competing process. The average excitation energy of a fragment was calculated by two-spheroidal model of tangent fragments. The density of levels in an excited fragment was calculated by the Fermi-gas model. The quite satisfactory agreement was reached between theoretical and experimental results obtained in frames of Project measurements. The calculated values of average multiplicities of neutron number were 2,746 for {sup 244}Cm and 2,927 for {sup 246}Cm that was in a good accordance with published experimental figures. (author)

  14. MANTRA: An Integral Reactor Physics Experiment to Infer Actinide Capture Cross-sections from Thorium to Californium with Accelerator Mass Spectrometry

    Energy Technology Data Exchange (ETDEWEB)

    G. Youinou; C. McGrath; G. Imel; M. Paul; R. Pardo; F. Kondev; M. Salvatores; G. Palmiotti

    2011-08-01

    The principle of the proposed experiment is to irradiate very pure actinide samples in the Advanced Test Reactor at INL and, after a given time, determine the amount of the different transmutation products. The determination of the nuclide densities before and after neutron irradiation will allow inference of effective neutron capture cross-sections. This approach has been used in the past and the novelty of this experiment is that the atom densities of the different transmutation products will be determined using the Accelerator Mass Spectrometry technique at the ATLAS facility located at ANL. It is currently planned to irradiate the following isotopes: 232Th, 235U, 236U, 238U, 237Np, 238Pu, 239Pu, 240Pu, 241Pu, 242Pu, 241Am, 243Am, 244Cm and 248Cm.

  15. MANTRA: An Integral Reactor Physics Experiment to Infer Actinide Capture Cross-sections from Thorium to Californium with Accelerator Mass Spectrometry

    International Nuclear Information System (INIS)

    The principle of the proposed experiment is to irradiate very pure actinide samples in the Advanced Test Reactor at INL and, after a given time, determine the amount of the different transmutation products. The determination of the nuclide densities before and after neutron irradiation will allow inference of effective neutron capture cross-sections. This approach has been used in the past and the novelty of this experiment is that the atom densities of the different transmutation products will be determined using the Accelerator Mass Spectrometry technique at the ATLAS facility located at ANL. It is currently planned to irradiate the following isotopes: 232Th, 235U, 236U, 238U, 237Np, 238Pu, 239Pu, 240Pu, 241Pu, 242Pu, 241Am, 243Am, 244Cm and 248Cm.

  16. {\\alpha}-accompanied cold ternary fission of $^{238-244}$Pu isotopes in equatorial and collinear configuration

    OpenAIRE

    Santhosh, K P; Krishnan, Sreejith; Priyanka, B.

    2015-01-01

    The cold ternary fission of $^{238}$Pu, $^{240}$Pu, $^{242}$Pu and $^{244}$Pu isotopes, with $^{4}$He as light charged particle, in equatorial and collinear configuration has been studied within the Unified ternary fission model (UTFM). The fragment combination $^{100}$Zr+$^{4}$He+$^{134}$Te possessing the near doubly magic nuclei $^{134}$Te (N=82, Z=52) gives the highest yield in the alpha accompanied ternary fission of $^{238}$Pu. For the alpha accompanied ternary fission of $^{240}$Pu, $^{...

  17. Utilisation of micro-plant and reactive distillation for the production of 2-methoxy-2,4,4-trimethylpentane

    OpenAIRE

    Mustapha, Kehinde

    2014-01-01

    The micro-plant and reactive distillation concepts have been researched in this thesis. The aim of the project is to invent a technique for the production of pure 2-methoxy-2,4,4-trimethylpentane (TOME). After the production, physical property of interest of the chemical compound would be determined. The first phase of this project relates to the production of TOME with the micro-plant constructed by Aalto University chemical engineering research group. In the second section, TOME was man...

  18. Short-lived $^{244}$Pu Points to Compact Binary Mergers as Sites for Heavy r-process Nucleosynthesis

    CERN Document Server

    Hotokezaka, Kenta; Paul, Michael

    2015-01-01

    Measurements of the radioactive $^{244}$Pu abundances can break the degeneracy between high-rate/low-yield and low-rate/high-yield scenarios for the production of heavy $r$-process elements. The first corresponds to production by core collapse supernovae (cc-SNe) while the latter corresponds to production by e.g. compact binary mergers. The estimated $^{244}$Pu abundance in the current interstellar medium inferred from deep-sea measurements (Wallner et al. 2015) is significantly lower than that corresponding Early Solar System abundances (Turner et al 2007). We estimate the expected median value of the $^{244}$Pu abundances and fluctuations around this value in both models. We show that while the current and Early Solar System abundances are naturally explained within the low-rate/high-yield (e.g. merger) scenario, they are incompatible with the high-rate/low-yield (cc-SNe) model. The inferred event rate remarkably agrees with compact binary merger rates estimated from Galactic neutron star binaries and from ...

  19. {\\alpha}-accompanied cold ternary fission of $^{238-244}$Pu isotopes in equatorial and collinear configuration

    CERN Document Server

    Santhosh, K P; Priyanka, B

    2015-01-01

    The cold ternary fission of $^{238}$Pu, $^{240}$Pu, $^{242}$Pu and $^{244}$Pu isotopes, with $^{4}$He as light charged particle, in equatorial and collinear configuration has been studied within the Unified ternary fission model (UTFM). The fragment combination $^{100}$Zr+$^{4}$He+$^{134}$Te possessing the near doubly magic nuclei $^{134}$Te (N=82, Z=52) gives the highest yield in the alpha accompanied ternary fission of $^{238}$Pu. For the alpha accompanied ternary fission of $^{240}$Pu, $^{242}$Pu and $^{244}$Pu isotopes, the highest yield was found for the fragment combination with doubly magic nuclei $^{132}$Sn (N=82, Z=50) as the heavier fragment. The deformation and orientation of fragments have also been taken into account for the alpha accompanied ternary fission of $^{238-244}$Pu isotopes, and it has been found that in addition to closed shell effect, ground state deformation also plays an important role in determining the isotopic yield in the ternary fission process. The emission probability and ki...

  20. The emission probabilities of long range alpha particles from even-even 244-252Cm isotopes

    CERN Document Server

    Santhosh, K P; Priyanka, B

    2014-01-01

    The alpha accompanied cold ternary fission of even-even 244Cm, 246Cm, 248Cm, 250Cm and 252Cm isotopes have been studied by taking the interacting barrier as the sum of Coulomb and proximity potential with the fragments in equatorial configuration. The favorable fragment combinations are obtained from the cold reaction valley plot and by calculating the relative yield for the charge minimized fragments. In the alpha accompanied ternary fission of 244Cm isotope, the highest yield is found for the fragment combination 110Ru+4He+130Sn, which possess near doubly magic nuclei 130Sn. For the ternary fission of 246Cm, 248Cm, 250Cm and 252Cm isotopes with 4He as light charged particle, the highest yield is obtained for the fragment combination with doubly magic nuclei 132Sn as the heavier fragment. The emission probabilities and kinetic energies of long range alpha particle have been computed for the 242,244,246,248Cm isotopes and are found to be in good agreement with the experimental data. The relative yields for th...

  1. Californium Recovery from Palladium Wire

    Energy Technology Data Exchange (ETDEWEB)

    Burns, Jon D. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States)

    2014-08-01

    The recovery of 252Cf from palladium-252Cf cermet wires was investigated to determine the feasibility of implementing it into the cermet wire production operation at Oak Ridge National Laboratory’s Radiochemical Engineering Development Center. The dissolution of Pd wire in 8 M HNO3 and trace amounts of HCl was studied at both ambient and elevated temperatures. These studies showed that it took days to dissolve the wire at ambient temperature and only 2 hours at 60°C. Adjusting the ratio of the volume of solvent to the mass of the wire segment showed little change in the kinetics of dissolution, which ranged from 0.176 mL/mg down to 0.019 mL/mg. A successful chromatographic separation of 153Gd, a surrogate for 252Cf, from Pd was demonstrated using AG 50x8 cation exchange resin with a bed volume of 0.5 mL and an internal diameter of 0.8 cm.

  2. [Italian national register of low etiological fraction occupational cancer pursuant to art. 244 of legislative decree n. 81/2008].

    Science.gov (United States)

    Massari, S; Ippoliti, M; Menegozzo, S; Forastiere, F; Crosignani, P

    2011-01-01

    Legislative decree No. 81/2008 in the article n. 244 states that ISPESL, now INAIL, realizes a register of occupational cancers with low etiological fraction by means of a data collection method based exclusively on voluntary reports by GPs, healthcare and social security agencies (ReNaLOC) and a surveillance cancer monitoring system (OCCAM) based on linkage of routinely available data (cancer registries, hospital discharge records, Italian Social Security archives). ReNaLOC has produced a partial picture of the situation, it includes 1.584 cases as of June 2011. With OCCAM many situations of known risks were identified and others are worthy to be deepen. PMID:23393807

  3. Absolute L X-ray intensities in the decays of 230Th, 234U, 238Pu and 244Cm

    International Nuclear Information System (INIS)

    The absolute L X-ray emission rates of 230Th, 234U, 238Pu and 244Cm have been measured. The rates were obtained by an alpha-particle gated photon spectrometry technique involving the use of a highly calibrated Ge(HP) detector in coincidence with a SiSB detector. The directional correlation between L X-rays and alpha-particles has been accounted for. The present results are compared with previous experimental values and theoretical estimates. Agreement with theoretical estimates is good, however few of the previous experimental values agree with the present work. Differences with previous work partly seem to lie with the detector calibration. (orig.)

  4. A multi-channel 24.4 ps bin size Time-to-Digital Converter for HEP applications

    CERN Document Server

    Mester, C; Morira, P

    2008-01-01

    A multi-channel time-tagging Time-to-Digital Converter (TDC) ASIC with a resolution of 24.4 ps (bin size) has been implemented and fabricated in a 130 nm CMOS technology. An on-chip PLL is used to generate an internal timing reference from an external 40 MHz clock source. The circuit is based on a 32 element Delay Locked Loop (DLL) which performs the time interpolation. The 32 channel architecture of the TDC is suitable for both triggered and non-triggered applications. The prototype contains test structures such as a substrate noise generator. The paper describes the circuit architecture and its principles of operation.

  5. When the non-contrast-enhanced phase is unnecessary in abdominal computed tomography scans? A retrospective analysis of 244 cases

    Energy Technology Data Exchange (ETDEWEB)

    Costa, Danilo Manuel Cerqueira; Salvadori, Priscila Silveira; Monjardim, Rodrigo da Fonseca; Bretas, Elisa Almeida Sathler; Torres, Lucas Rios; Caldana, Rogerio Pedreschi; Shigueoka, David Carlos; Medeiros, Regina Bitelli; D' ippolito, Giuseppe, E-mail: giuseppe_dr@uol.com.br [Universidade Federal de Sao Paulo (EPM/UNIFESP), Sao Paulo, SP (Brazil). Escola Paulista de Medicina. Departamento de Diagnostico por Imagem

    2013-06-15

    Objective: to evaluate the necessity of the non contrast-enhanced phase in abdominal computed tomography scans. Materials and Methods: A retrospective, cross-sectional, observational study was developed, evaluating 244 consecutive abdominal computed tomography scans both with and without contrast injection. Initially, the contrast-enhanced images were analyzed (first analysis). Subsequently, the observers had access to the non-contrast-enhanced images for a second analysis. The primary and secondary diagnoses were established as a function of the clinical indications for each study (such as tumor staging, acute abdomen, investigation for abdominal collection and hepatocellular carcinoma, among others). Finally, the changes in the diagnoses resulting from the addition of the non-contrast-enhanced phase were evaluated. Results: Only one (0.4%; p > 0.999; non-statistically significant) out of the 244 reviewed cases had the diagnosis changed after the reading of non-contrast-enhanced images. As the secondary diagnoses are considered, 35 (14%) cases presented changes after the second analysis, as follows: nephrolithiasis (10%), steatosis (3%), adrenal nodule (0.7%) and cholelithiasis (0.3%). Conclusion: For the clinical indications of tumor staging, acute abdomen, investigation of abdominal collections and hepatocellular carcinoma, the non-contrast-enhanced phase can be excluded from abdominal computed tomography studies with no significant impact on the diagnosis. (author)

  6. When the non-contrast-enhanced phase is unnecessary in abdominal computed tomography scans? A retrospective analysis of 244 cases

    International Nuclear Information System (INIS)

    Objective: to evaluate the necessity of the non contrast-enhanced phase in abdominal computed tomography scans. Materials and Methods: A retrospective, cross-sectional, observational study was developed, evaluating 244 consecutive abdominal computed tomography scans both with and without contrast injection. Initially, the contrast-enhanced images were analyzed (first analysis). Subsequently, the observers had access to the non-contrast-enhanced images for a second analysis. The primary and secondary diagnoses were established as a function of the clinical indications for each study (such as tumor staging, acute abdomen, investigation for abdominal collection and hepatocellular carcinoma, among others). Finally, the changes in the diagnoses resulting from the addition of the non-contrast-enhanced phase were evaluated. Results: Only one (0.4%; p > 0.999; non-statistically significant) out of the 244 reviewed cases had the diagnosis changed after the reading of non-contrast-enhanced images. As the secondary diagnoses are considered, 35 (14%) cases presented changes after the second analysis, as follows: nephrolithiasis (10%), steatosis (3%), adrenal nodule (0.7%) and cholelithiasis (0.3%). Conclusion: For the clinical indications of tumor staging, acute abdomen, investigation of abdominal collections and hepatocellular carcinoma, the non-contrast-enhanced phase can be excluded from abdominal computed tomography studies with no significant impact on the diagnosis. (author)

  7. Deformation effects in the alpha accompanied cold ternary fission of even-even 244-260Cf isotopes

    Science.gov (United States)

    Santhosh, K. P.; Krishnan, Sreejith

    2016-04-01

    Within the unified ternary fission model (UTFM), the alpha accompanied ternary fission of even-even 244-260Cf isotopes has been studied by taking the interacting barrier as the sum of Coulomb and proximity potential. For the alpha accompanied ternary fission of the 244Cf isotope, the highest yield is obtained for the fragment combination 108Ru + 4He + 132Te, which contains the near doubly magic nucleus 132Te ( N = 80, Z = 52). In the case of 246Cf and 248Cf isotopes, the highest yield is obtained for the fragment combinations with the near doubly magic nucleus 134Te ( N = 82, Z = 52) as the heaviest fragment. The highest yield obtained for 250Cf, 252Cf, 254Cf, 256Cf, 258Cf and 260Cf isotopes is for the fragment combination with the doubly magic nucleus 132Sn ( N = 82), Z = 50 as the heaviest fragment. We have included the effect of deformation and orientation of fragments and this has revealed that in addition to the closed shell effect, ground-state deformation also plays an important role in the calculation of the relative yield of favorable fragment combinations. The computed isotopic yields for the alpha accompanied ternary fission of the 252Cf isotope are found to be in agreement with the experimental data. The emission probability and kinetic energy of the long-range alpha particle is calculated for the various isotopes of Cf and are found to be in good agreement with the experimental data.

  8. Deformation effects in the alpha accompanied cold ternary fission of even-even $^{244-260}$Cf isotopes

    CERN Document Server

    Santhosh, K P

    2016-01-01

    Within the Unified ternary fission model (UTFM), the alpha accompanied ternary fission of even-even $^{244-260}$Cf isotopes has been studied by taking the interacting barrier as the sum of Coulomb and proximity potential. For the alpha accompanied ternary fission of 244^Cf isotope, the highest yield is obtained for the fragment combination 108^Ru+4^He+132^Te, which contain near doubly magic nuclei 132^Te (N=80, Z=52). In the case of 246^Cf and 248^Cf isotopes, the highest yield is obtained for the fragment combinations with near doubly magic nuclei 134^Te (N=82, Z=52) as the heavier fragment. The highest yield obtained for 250^Cf, 252^Cf, 254^Cf, 256^Cf, 258^Cf and 260^Cf isotopes is for the fragment combination with doubly magic nuclei 132^Sn (N=82, Z=50) as the heavier fragment. We have included the effect of deformation and orientation of fragments and this has revealed that in addition to closed shell effect, ground state deformation also plays an important role in the calculation of relative yield of fav...

  9. When the non-contrast-enhanced phase is unnecessary in abdominal computed tomography scans? A retrospective analysis of 244 cases

    Directory of Open Access Journals (Sweden)

    Danilo Manuel Cerqueira Costa

    2013-07-01

    Full Text Available Objective: To evaluate the necessity of the non contrast-enhanced phase in abdominal computed tomography scans. Materials and Methods: A retrospective, cross-sectional, observational study was developed, evaluating 244 consecutive abdominal computed tomography scans both with and without contrast injection. Initially, the contrast-enhanced images were analyzed (first analysis. Subsequently, the observers had access to the non-contrast-enhanced images for a second analysis. The primary and secondary diagnoses were established as a function of the clinical indications for each study (such as tumor staging, acute abdomen, investigation for abdominal collection and hepatocellular carcinoma, among others. Finally, the changes in the diagnoses resulting from the addition of the non-contrast-enhanced phase were evaluated. Results: Only one (0.4%; p > 0.999; non-statistically significant out of the 244 reviewed cases had the diagnosis changed after the reading of non-contrast-enhanced images. As the secondary diagnoses are considered, 35 (14% cases presented changes after the second analysis, as follows: nephrolithiasis (10%, steatosis (3%, adrenal nodule (0.7% and cholelithiasis (0.3%. Conclusion: For the clinical indications of tumor staging, acute abdomen, investigation of abdominal collections and hepatocellular carcinoma, the non-contrast-enhanced phase can be excluded from abdominal computed tomography studies with no significant impact on the diagnosis.

  10. Radioactive air emissions notice of construction use of a portable exhauster at 244-AR vault. Revision 2

    International Nuclear Information System (INIS)

    This document serves as a notice of construction (NOC), pursuant to the requirements of Washington Administrative Code (WAC) 246-247-060, and as a request for approval to construct, pursuant to 40 Code of Federal Regulations (CFR) 61.96, a portable exhauster at the 244-AR Vault. The exhauster would be used during air jetting of accumulated liquids from the cell sumps into the tanks and to make transfers among the tanks within the vault when needed. The 244-AR Vault is considered to be a double-contained receiver tank (OCRT) based on its functional characteristics, although it is not listed as one of the five designated DCRTs in the 200 Area Tank Farm systems. Process operations at the vault have been inactive since 1978 and the vault's two stacks have not operated since 1993. Since cessation of vault operations an extremely large amount of rain water and snow melt have accumulated in the cell sumps. The water level in the sumps is substantially above their respective operating levels and there is concern for leakage to the environment through containment failure due to corrosion from backed-up sump liquid. Active ventilation is required to provide contamination control during air jetting operations within the vault. It has been determined that it would not be cost effective to repair the existing exhaust systems to an operational condition; thus, a portable exhauster will be used to support the intermittent operations

  11. Design of a homogeneous subcritical nuclear reactor based on thorium with a source of californium 252; Diseno de un reactor nuclear subcritico homogeneo a base de Torio con una fuente de Californio 252

    Energy Technology Data Exchange (ETDEWEB)

    Delgado H, C. E.; Vega C, H. R. [Universidad Autonoma de Zacatecas, Unidad Academica de Estudios Nucleares, Cipres No. 10, Fracc. La Penuela, 98068 Zacatecas, Zac. (Mexico); Sajo B, L., E-mail: ce_delgado89@hotmail.com [Universidad Simon Bolivar, Laboratorio de Fisica Nuclear, Apdo. 89000, 1080A Caracas (Venezuela, Bolivarian Republic of)

    2015-10-15

    Full text: One of the energy alternatives to fossil fuels which do not produce greenhouse gases is the nuclear energy. One of the drawbacks of this alternative is the generation of radioactive wastes of long half-life and its relation to the generation of nuclear materials to produce weapons of mass destruction. An option to these drawbacks of nuclear energy is to use Thorium as part of the nuclear fuel which it becomes in U{sup 233} when capturing neutrons, that is a fissile material. In this paper Monte Carlo methods were used to design a homogeneous subcritical reactor based on thorium. As neutron reflector graphite was used. The reactor core is homogeneous and is formed of 70% light water as moderator, 12% of enriched uranium UO{sub 2}(NO{sub 3}){sub 4} and 18% of thorium Th(NO{sub 3}){sub 4} as fuel. To start the nuclear fission chain reaction an isotopic source of californium 252 was used with an intensity of 4.6 x 10{sup 7} s{sup -1}. In the design the value of the effective multiplication factor, whose value turned out k{sub eff} <1 was calculated. Also, the neutron spectra at different distances from the source and the total fluence were calculated, as well as the values of the ambient dose equivalent in the periphery of the reactor. (Author)

  12. Manganese determination om minerals by activation analysis, using the californium-252 as a neutron source; Determinacao de manganes em minerios, por analise por ativacao, usando californio-252 como fonte de neutrons

    Energy Technology Data Exchange (ETDEWEB)

    Cardoso, Antonio

    1976-07-01

    Neutron Activation Analysis, using a Californium-252 neutron source, has been applied for the determination of manganese in ores such as pyrolusite, rodonite (manganese silicate)' and blending used in dry-batteries The favorable nuclear properties of manganese, such as high thermal neutron cross-section for the reaction {sup 55}Mn (n.gamma){sup 56} Mn, high concentration of manganese in the matrix and short half - life of {sup 56}Mn, are an ideal combination for non-destructive analysis of manganese in ores. Samples and standards of manganese dioxide were irradiated for about 20 minutes, followed by a 4 to 15 minutes decay and counted in a single channel pulse-height discrimination using a NaI(Tl) scintillation detector. Counting time was equal to 10 minutes. The interference of nuclear reactions {sup 56}Fe(n,p){sup 56}Mn and {sup 59} Co (n, {alpha}){sup 56} were studied, as well as problems in connection with neutron shadowing during irradiation, gamma-rays attenuation during counting and influence of granulometry of samples. One sample,was also analysed by wet-chemical method (sodium bismuthate) in order to compare results. As a whole, i t was shown that the analytical method of neutron activation for manganese in ores and blending, is a method simple, rapid and with good precision and accuracy. (author)

  13. Petrogenesis of silicic magmatism related to the ˜ 2.44 Ga rifting of Archean crust in Koillismaa, eastern Finland

    Science.gov (United States)

    Lauri, L. S.; Rämö, O. T.; Huhma, H.; Mänttäri, I.; Räsänen, J.

    2006-01-01

    Early Paleoproterozoic extension in the Archean craton of the Fennoscandian shield led to the emplacement of several 2.44 Ga layered gabbroic intrusive complexes in northern Finland and adjacent Russia. Closely associated with them are felsic rocks of similar age: (1) the Sirniö Group volcanic rocks on top of the Koillismaa layered complex; (2) a quartz alkali feldspar syenite at Kynsijärvi near the Koillismaa complex; and (3) an aluminous A-type granite at Nuorunen near the Oulanka layered complex. In the Koillismaa area, the ruptured Archean crust consists of ortho- and paragneisses that were intruded and migmatized by somewhat younger granites. U-Pb zircon data indicate that the gneisses are at least ˜2.8 Ga old and that the granites were crystallized at ˜2.7 Ga. Both rock types show a common monazite age of 2695 Ma that registers the peak of granulite facies metamorphism and, possibly, the intrusion of the granites. The local Neoarchean crust has ɛNd(at 2440 Ma) values between - 5 and - 8.5. The mafic rocks of the Koillismaa complex show initial ɛNd(at 2440 Ma) values around - 1.5 and those of the Oulanka complex range from - 2.1 to 0. The ɛNd value (- 4.8) and TDM model age (2.9-3.0 Ga) of the Kynsijärvi quartz alkali feldspar syenite are within the limits of the evolution path of the local Archean crust. The corresponding values for the Nuorunen granite are - 2.0 and 2.76 Ga and are thus closer to those of the mafic rocks. The volcanic rocks of the Sirniö Group show more scatter with initial ɛNd(at 2440 Ma) values of - 1.1 to - 5.3; the lowest ɛNd values probably reflect later disturbance-magmatic values cluster around - 2. Major and trace element modeling shows that fractional crystallization of the Koillismaa complex parental magma or partial melting of the Archean crust cannot account for the ˜ 2.44 Ga silicic rocks of Koillismaa. The geochemical and Nd isotope characteristics of the volcanic rocks and the Kynsijärvi quartz alkali feldspar

  14. Shu-mei Shih, Visuality and Identity. Sinophone Articulation across the Pacific, Berkeley, University Press of California, 2007, 244 p.

    OpenAIRE

    Lincot, Emmanuel

    2008-01-01

    Professeur de littérature comparée à l’université de Californie de Los Angeles (UCLA), spécialiste des « gender studies », Shu-mei Shih aborde d’une manière originale, dans ce nouvel ouvrage, la question de l’identité dans le monde sinophone actuel. Long de 244 pages, Visuality and Identity. Sinophone Articulations across the Pacific, est composé d’une introduction et de six parties : la première porte sur la globalisation et ses effets sur les minorités, la deuxième sur le cas, plus précis, ...

  15. Hazards assessment document for receiving basin for offsite fuel (244-H) and resin regeneration facility (245-H) (RBOF/RRF)

    International Nuclear Information System (INIS)

    The Hazard Assessment Document (HAD) for the Receiving Basin for Offsite Fuels (RBOF), Building 244-H, and the Resin Regeneration Facility (RRF), Building 245-H, was prepared in accordance with Department of Energy (DOE) Order 5480.23, DOE-STD-1 027-92, and WSRC-MS-92-206. The HAD provides hazards categorizations based on the radiological and chemical hazards associated with the facility. The hazard category is used to provide the input data for a graded approach to the development of the facility Safety Analysis Report (SAR) in accordance with DOE Order 5480.23. The RBOF/RRF was assumed to be a one segment facility. The accident consequences are calculated without consideration for any mitigative systems or administrative controls This facility is categorized as Hazard Category 2 as a result of the analysis of the radiological inventory conducted in accordance with Reference 2 and the chemical inventory in accordance with Reference 3

  16. Production of new superheavy Z=108-114 nuclei with $^{238}$U, $^{244}$Pu and $^{248,250}$Cm targets

    CERN Document Server

    Feng, Zhao-Qing; Li, Jun-Qing

    2009-01-01

    Within the framework of the dinuclear system (DNS) model, production cross sections of new superheavy nuclei with charged numbers Z=108-114 are analyzed systematically. Possible combinations based on the actinide nuclides $^{238}$U, $^{244}$Pu and $^{248,250}$Cm with the optimal excitation energies and evaporation channels are pointed out to synthesize new isotopes which lie between the nuclides produced in the cold fusion and the $^{48}$Ca induced fusion reactions experimentally, which are feasible to be constructed experimentally. It is found that the production cross sections of superheavy nuclei decrease drastically with the charged numbers of compound nuclei. Larger mass asymmetries of the entrance channels enhance the cross sections in 2n-5n channels.

  17. Statistical evaluation of lung, bone, and liver tumors in rats exposed to aerosols of 238PuO2, 239PuO2, and 244CmO2

    International Nuclear Information System (INIS)

    The Mantel--Haenszel procedure was applied to the evaluation of tumor data from exposures to aerosols of 238PuO2, 239PuO2, and 244CmO2. Significance was evident for lung tumors for all three transuranics, for osteosarcomas in animals exposed to 244CmO2, and was suggested for liver tumors in animals exposed to 244CmO2

  18. Drospirenone/ethinylestradiol 3mg/20microg (24/4 day regimen): a review of its use in contraception, premenstrual dysphoric disorder and moderate acne vulgaris.

    Science.gov (United States)

    Fenton, Caroline; Wellington, Keri; Moen, Marit D; Robinson, Dean M

    2007-01-01

    Drospirenone 3mg with ethinylestradiol 20microg (Yaz) is a low-dose combined oral contraceptive (COC) administered in a regimen of 24 days of active tablets followed by a short hormone-free interval (4 days; 24/4 regimen). Drospirenone, unlike other synthetic progestogens used in COCs, is a 17alpha-spirolactone derivative and a 17alpha-spironolactone analogue with antimineralocorticoid and antiandrogenic properties. Drospirenone/ethinylestradiol 3mg/20microg (24/4) is approved in the US for the prevention of pregnancy in women, for the treatment of the symptoms of premenstrual dysphoric disorder (PMDD) and for the treatment of moderate acne vulgaris in women who wish to use an oral contraceptive for contraception.Drospirenone/ethinylestradiol 3mg/20microg (24/4) provided 99% contraceptive protection over 1 year of treatment in two large studies. The same treatment regimen over three treatment cycles also significantly improved the emotional and physical symptoms associated with PMDD, and improved moderate acne vulgaris over six treatment cycles in double-blind trials. It was generally well tolerated, with adverse events generally typical of those experienced with other COCs and which were most likely to occur in the first few cycles. Clinical trials indicate that drospirenone/ethinylestradiol 3mg/20microg (24/4) is a good long-term contraceptive option, and additionally offers relief of symptoms that characterise PMDD and has a favourable effect on moderate acne vulgaris. PMID:17683173

  19. Primary hyperoxaluria type 1 in the Canary Islands: a conformational disease due to I244T mutation in the P11L-containing alanine:glyoxylate aminotransferase.

    Science.gov (United States)

    Santana, A; Salido, E; Torres, A; Shapiro, L J

    2003-06-10

    Primary hyperoxaluria type 1 (PH1) is an inborn error of metabolism resulting from a deficiency of alanine:glyoxylate aminotransferase (AGXT; EC 2.6.1.44). Most of the PH1 alleles detected in the Canary Islands carry the Ile-244 --> Thr (I244T) mutation in the AGXT gene, with 14 of 16 patients homozygous for this mutation. Four polymorphisms within AGXT and regional microsatellites also were shared in their haplotypes (AGXT*LTM), consistent with a founder effect. The consequences of these amino acid changes were investigated. Although I244T alone did not affect AGXT activity or subcellular localization, when present in the same protein molecule as Leu-11 --> Pro (L11P), it resulted in loss of enzymatic activity in soluble cell extracts. Like its normal counterpart, the AGXT*LTM protein was present in the peroxisomes but it was insoluble in detergent-free buffers. The polymorphism L11P behaved as an intragenic modifier of the I244T mutation, with the resulting protein undergoing stable interaction with molecular chaperones and aggregation. This aggregation was temperature-sensitive. AGXT*LTM expressed in Escherichia coli, as a GST-fusion protein, and in insect cells could be purified and retained enzymatic activity. Among various chemical chaperones tested in cell culture, betaine substantially improved the solubility of the mutant protein and the enzymatic activity in cell lysates. In summary, I244T, the second most common mutation responsible for PH1, is a protein conformational disease that may benefit from new therapies with pharmacological chaperones or small molecules to minimize protein aggregation. PMID:12777626

  20. Fragmentation of 200 and 244 MeV/u carbon beams in thick tissue-like absorbers

    International Nuclear Information System (INIS)

    Stacks consisting of thin CR-39 sheets sandwiched between thick lucite and water absorbers were perpendicularly bombarded by 12C ions at 200 and 244 MeV/u. Track radius distributions representing the charge composition of the fragmented beams were automatically measured by a particle track analysis system. After analysis of the nuclear charge distributions, the total charge removal cross-sections and elemental production cross-sections of fragments with atomic numbers from 5 to 3, were obtained down to the lower energies (∼50 and 100 MeV/u, respectively). It has been found that the measured total charge removal cross-section agrees with theoretical predictions within ∼10% and very well with previous experiments in corresponding energy regions. Two model calculations for production of B fragment are in good agreement with our measured data while a third model overestimates it by ∼12%. Theoretical cross-sections for Be and Li fragments differ strongly among the different models and from measured values

  1. In vivo characterization of radioiodinated (+)-2-[4-(4-iodophenyl) piperidino] cyclohexanol as a potential {sigma}-1 receptor imaging agent

    Energy Technology Data Exchange (ETDEWEB)

    Akhter, Nasima [Department of Biotracer Medicine, Kanazawa University, Kanazawa 920-8640 (Japan); Shiba, Kazuhiro [Division of Tracer Kinetics, Advanced Science Research Center, Kanazawa University, Kanazawa 920-8640 (Japan)], E-mail: shiba@med.kanazawa-u.ac.jp; Ogawa, Kazuma [Division of Tracer Kinetics, Advanced Science Research Center, Kanazawa University, Kanazawa 920-8640 (Japan); Kinuya, Seigo; Nakajima, Kenichi [Department of Biotracer Medicine, Kanazawa University, Kanazawa 920-8640 (Japan); Mori, Hirofumi [Division of Tracer Kinetics, Advanced Science Research Center, Kanazawa University, Kanazawa 920-8640 (Japan)

    2007-08-15

    In this study, the (+)-enantiomer of radioiodinated 2-[4-(4-iodophenyl)piperidino]cyclohexanol [(+)-[{sup 125}I]-p-iodovesamicol] [(+)-[{sup 125}I]pIV], which is reported to bind with high affinity to {sigma}-1 receptors in vitro, was tested for its usefulness in imaging {sigma}-1 receptors in the central nervous system (CNS) in vivo. In biodistribution studies, significant amounts (approximately 3% of the injected dose) of (+)-[{sup 125}I]pIV accumulated in rat brain, and its retention was prolonged. In blocking studies, the accumulation of (+)-[{sup 125}I]pIV in the rat brain was significantly reduced by the coadministration of {sigma}-ligands such as pentazocine (5.0 {mu}mol), haloperidol (0.5 {mu}mol) or SA4503 (0.5 {mu}mol). The blocking effect of pentazocine (selective {sigma}-1 ligand) was similar to the blocking effects of SA4503 and haloperidol [nonselective {sigma} ({sigma}-1 and {sigma}-2) ligands]. Ex vivo autoradiography of the rat brain at 45 min following intravenous injection of (+)-[{sup 125}I]pIV showed high localization in brain areas rich in {sigma}-1 receptors. Thus, the distribution of (+)-[{sup 125}I]pIV was thought to bind to {sigma}-1 receptors in the CNS in vivo. These results indicate that radioiodinated (+)-pIV may have the potential to image {sigma}-1 receptors in vivo.

  2. In vivo characterization of radioiodinated (+)-2-[4-(4-iodophenyl) piperidino] cyclohexanol as a potential σ-1 receptor imaging agent

    International Nuclear Information System (INIS)

    In this study, the (+)-enantiomer of radioiodinated 2-[4-(4-iodophenyl)piperidino]cyclohexanol [(+)-[125I]-p-iodovesamicol] [(+)-[125I]pIV], which is reported to bind with high affinity to σ-1 receptors in vitro, was tested for its usefulness in imaging σ-1 receptors in the central nervous system (CNS) in vivo. In biodistribution studies, significant amounts (approximately 3% of the injected dose) of (+)-[125I]pIV accumulated in rat brain, and its retention was prolonged. In blocking studies, the accumulation of (+)-[125I]pIV in the rat brain was significantly reduced by the coadministration of σ-ligands such as pentazocine (5.0 μmol), haloperidol (0.5 μmol) or SA4503 (0.5 μmol). The blocking effect of pentazocine (selective σ-1 ligand) was similar to the blocking effects of SA4503 and haloperidol [nonselective σ (σ-1 and σ-2) ligands]. Ex vivo autoradiography of the rat brain at 45 min following intravenous injection of (+)-[125I]pIV showed high localization in brain areas rich in σ-1 receptors. Thus, the distribution of (+)-[125I]pIV was thought to bind to σ-1 receptors in the CNS in vivo. These results indicate that radioiodinated (+)-pIV may have the potential to image σ-1 receptors in vivo

  3. Resíduos de glifosato e ácido aminometilfosfônico e teores de isoflavonas em soja BRS 244 RR e BRS 154 Residues of glyphosate and aminomethylphosphonic acid and levels of isoflavones in BRS 244 RR and BRS 154 soybean

    Directory of Open Access Journals (Sweden)

    Giani Mariza Bärwald Bohm

    2008-12-01

    Full Text Available A principal forma de controle das plantas daninhas durante o cultivo de soja geneticamente modificada (GM RR BRS 244 RR é o uso de glifosato. Porém, existem dúvidas quanto à segurança desse herbicida, à qualidade dos grãos e do solo da soja GM RR cultivada em Planossolo. Resíduos da molécula do glifosato e do metabólito ácido aminometilfosfônico (AMPA podem estar presentes nos grãos, bem como, podem afetar a concentração de isoflavonas. Por isso, avaliaram-se as sojas BRS 244 RR e BRS 154 cultivadas nos seguintes tratamentos: T1 - soja BRS 244 RR, sem aplicação de herbicida, com capina manual aos 28 dias após o plantio (dap; T2 - soja BRS 154 sem aplicação de herbicida, com capina manual também aos 28 dap; T3 - soja BRS 244 RR com uma aplicação de glifosato a 960 g ia ha-1 aos 28 dap; T4 - soja BRS 244 RR com duas aplicações de glifosato a 960 g ia ha-1 aos 28 e 56 dap; T5 - soja BRS 244 RR com uma aplicação de herbicida imazetapir a 100 g ia ha-1 aos 28 dap; T6 - soja BRS 154 com uma aplicação de herbicida imazetapir a 100 g ia ha-1 aos 28 dap. Verificou-se que a aplicação de glifosato no controle de plantas daninhas resultou em teores elevados de glifosato e ácido aminometilfosfônico no solo. Nos grãos, o teor de isoflavonas não parece ser significativamente afetado pela aplicação de glifosato, mas os resíduos desse herbicida foram superiores ao permitido pela legislação vigente, que é de 10 mg.kg-1.The use of Glyphosate is the best way to control weed growing when cultivating genetically modified soybean (GMRR BRS 244 RR. However, there have been doubts about the safety of this herbicide use concerning its effects on the quality of grains and on the soil of Albaqualf cultivated GMRR soybean. Glyphosate and the metabolite aminomethylphosphonic acid (AMPA residues can be present in the grains and affect the isoflavones concentration. Therefore, BRS 244 RR and BRS 154 soybeans with the following

  4. Studying of distribution of 137Cs, 90Sr, 239+240Pu, 241Am and 244Cm according to the organic acids fractions of the alienation zone soils

    International Nuclear Information System (INIS)

    The paper deals with data of research on the distribution of the radionuclides 137Cs, 90Sr, 239+240Pu, 241Am and 244Cm of ''the Chornobyl rains'' by the fractions of the organic matters of derno-podzolic sandy, derno-meadow and peat soils sampled in the alienation zone of the Chornobyl NPP. Functioning of organic matters was carried according to Tyurin's method. It is stressed that, independently on soil type, 137Cs is connected with the mineral contituent by 80-95%. It is found out that, independently on the soil type, 50-70% 137Sr and 15-45% 241Am are associated with fulvic acid fractions. The 241Am and 244Cm distribution according to organic acids taking into account deviations while carrying out determinations is unambiguous. It is found out that in all the soils tested the main quality of 239+24Pu is connected with humic acids

  5. A Study of Personality and Family- and School Environment and Possible Interactional Effects in 244 Swedish Children—A Multiple Regression Analysis

    OpenAIRE

    Persson, Bertil

    2014-01-01

    The aim of the study was to examine relationships between psychosocial family- and school environment and personality as assessed by the Junior Eysenck Personality Questionnaire (EPQ-J) and possible personality interactional effects. The study was based on 244 Swedish girls and boys, 10-19 years old, who filled in the Family- and School Psychosocial Environment (FSPE) questionnaire and the EPQ-J. A multiple regression analysis showed that the FSPE-factor Family conflicts and school discipline...

  6. Comparison of theoretical and experimental anisotropy between α-particles and L X-rays in the decays of 238Pu and 244Cm

    International Nuclear Information System (INIS)

    Recent measurements of the anisotropic directional correlation between α-particles and L X-rays in the decays of 238Pu and 244Cm are compared with theoretical estimates. The comparison shows reasonable agreement for the major L X-ray groups Lα and Lβ, however the experimental value for Ll is considerably lower than the theoretical prediction. A greater M2 admixture in the Ll transition than predicted by Scofield could explain the difference. (orig.)

  7. The effect of occupational stress on depression symptoms among 244 policemen in a city%某市244名警察职业紧张对抑郁症状发生的影响

    Institute of Scientific and Technical Information of China (English)

    谷桂珍; 余善法; 吴辉; 周文慧

    2015-01-01

    目的 探讨职业紧张相关因素对警察抑郁症状发生的影响.方法 采取整群抽样方法,于2011年5月抽取某市公安局287名警察进行职业问卷调查,剔除人口学特征调查表变量缺失者以及职业紧张相关因素调查表3个条目以上应答缺失者问卷后,最终244名警察的资料纳入本研究.采用抑郁自评问卷中文译本、工作内容问卷、付出-回报失衡问卷中文译本、工作危险量表、职业紧张量表测试调查对象的抑郁症状及职业紧张相关因素.应用Spearman相关分析和多元回归分析探讨抑郁症状评分与职业紧张相关变量之间的关系.结果 全部调查对象抑郁症状评分中位数(P25~P75)为16.50(11.00~25.00)分.无抑郁症状警察144名,有抑郁症状警察100名.警龄<10、10~19、20~29、≥30年的抑郁症状评分中位数(P25~P75)分别为17.00(8.00~26.00)、16.00(11.00~24.50)、19.00(12.00~27.00)、12.00(6.25~15.00)分(χ2=9.52,P=0.023),差异有统计学意义.有抑郁症状组的心理需求、睡眠障碍、每日紧张感和负性情感评分中位数(P25~P75)分别为25.00(23.00~28.00)、12.50(9.00~18.00)、9.50(8.00~12.00)、3.00(2.00~4.00)分,均高于无抑郁症状组[24.00(22.00~25.00)、8.00(5.00~13.00)、8.00(6.00~10.00)、1.00(0~2.75)分](Z值分别为3.82、5.39、5.15、6.41,P值均<0.001),差异有统计学意义.Spearman相关分析显示,抑郁症状评分与睡眠障碍、内在投入、付出、心理需求、每日紧张感、负性情感和工作危险性呈正相关,相关系数分别为0.44、0.28、0.28、0.33、0.38、0.44、0.38(P均<0.001).多元线性回归分析结果表明,自尊感、每日紧张感和负性情感状态对抑郁症状评分的贡献较大,标准回归系数分别是-0.46、0.19和0.13(P值分别为<0.001、0.001、0.030).结论 睡眠障碍、内在投入、付出、心理需求、每日紧张感、负性情感和工作危险性是警察抑郁症状的诱因,减少负性情感、

  8. Biological, chemical and other data collected aboard the THOMAS G. THOMPSON during cruise TN244 in the Coastal Waters of SE Alaska from 2009-12-05 to 2009-12-08 (NODC Accession 0117395)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NODC accession 0117395 includes biological, chemical, optical and physical data collected aboard the THOMAS G. THOMPSON during cruise TN244 in the Coastal Waters of...

  9. Liquid-Liquid Extraction and Separation of Co (II) and Ni(II) from Chloride Medium by bis (2,4,4-trimethylpentyl) dithio phosphinic acid in Kerosene

    International Nuclear Information System (INIS)

    The extraction of Co(II) and Ni(II) from chloride solutions using bis (2,4,4-trimethylpentyl) dithio phosphinic acid (CYANEX 301) in kerosene has been investigated. The various factors affecting the extraction process of Co(II) and Ni(II) by the investigated extractant such as contact time, ph, extractant and metal ion concentration as well as temperature, are separately investigated. The stripping of the extracted metal ions from loaded organic solutions is also carried out using different stripping reagents. The results were used to assess the conditions for maximum Co(II)/Ni(II) separation from chloride medium using CYANEX 301

  10. Magnetic thermal hysteresis due to paramagnetic-antiferromagnetic transition in Fe-24.4Mn-5.9Si-5.1Cr alloy

    Directory of Open Access Journals (Sweden)

    L. Wang

    2013-08-01

    Full Text Available Magnetic thermal hysteresis (MTH associated with a paramagnetic (PM-antiferromagnetic (AFM phase transition was found in an Fe-24.4Mn-5.9Si-5.1Cr shape-memory alloy. Aside from the magnetic field (H, the driving rate (v can also tune the critical temperature of the magnetic transition and cause an increase in MTH. The magnetic phase diagram obtained is discussed. The equation for MTH was deduced based on the Landau model for a PM-AFM transition that includes H and v dependence, which gives a reasonable account of the experimental results.

  11. Uptake of curium (244Cm) by five benthic marine species (Arenicola marina, Cerastoderma edule, Corophium volutator, Nereis diversicolor and Scrobicularia plana): comparison with americium and plutonium

    International Nuclear Information System (INIS)

    Curium (244Cm) uptake from contaminated sea water was studied in five benthic marine species: two bivalve molluscs (Scrobicularia plana and Cerastoderma edule), two polychaete annelids (Arenicola marina and Nereis diversicolor) and one amphidpod crustacean (Corophium volutator). The concentrations in the whole organisms relative to the concentration in the sea water (concentration factors) were: 700 for the amphipods (after 11 d of accumulation), 140 for the cockles (after 28 d), 80 for the scrobicularia (after 23d) and approx. 30 for the two annelids (after > 20 d). All species except S. plana accumulated americium and curium similarly; S. plana accumulated similar amounts of curium and plutonium. (author)

  12. Uptake of curium (/sup 244/Cm) by five benthic marine species (Arenicola marina, Cerastoderma edule, Corophium volutator, Nereis diversicolor and Scrobicularia plana): comparison with americium and plutonium

    Energy Technology Data Exchange (ETDEWEB)

    Miramand, P.; Germain, P.; Arzur, J.C.

    1987-01-01

    Curium (/sup 244/Cm) uptake from contaminated sea water was studied in five benthic marine species: two bivalve molluscs (Scrobicularia plana and Cerastoderma edule), two polychaete annelids (Arenicola marina and Nereis diversicolor) and one amphidpod crustacean (Corophium volutator). The concentrations in the whole organisms relative to the concentration in the sea water (concentration factors) were: 700 for the amphipods (after 11 d of accumulation), 140 for the cockles (after 28 d), 80 for the scrobicularia (after 23d) and approx. 30 for the two annelids (after > 20 d). All species except S. plana accumulated americium and curium similarly; S. plana accumulated similar amounts of curium and plutonium.

  13. 60-day waste compatibility safety issue and final results for 244-TX DCRT, grab samples TX-95-1, TX-95-2, and TX-95-3

    International Nuclear Information System (INIS)

    Three grab samples (TX-95-1, TX-95-2, and TX-95-3) were taken from tank 241- TX-244 riser 8 on November 7, 1995 and received by the 222-S Laboratory on that same day. Samples TX-95-1 and TX-95-2 were designated as supernate liquids, and sample TX-95-3 was designated as a supernate/sludge. These samples were analyzed to support the waste compatibility safety program. Accuracy and precision criteria were met for all analyses. No notifications were required based on sample results. This document provides the analysis to support the waste compatibility safety program

  14. A 233U/236U/242Pu/244Pu spike for isotopic and isotope dilution analysis by mass spectrometry with internal calibration

    International Nuclear Information System (INIS)

    The Khlopin Radium Institute prepared on behalf of the IAEA a synthetic mixture of 233U, 236U, 242Pu and 244Pu isotopes. The isotopic composition and elemental concentration of uranium and plutonium were certified on the basis of analyses done by four laboratories of the IAEA Network, using mass spectrometry with internal standardization. The certified values for 233U/236U ratio and the 236U chemical concentration have a coefficient of variation of 0.05%. The latter is fixed by the uncertainty in the 235U/238U ratio of NBS500 used as internal standard. The coefficients of variation of the 244Pu/242Pu ratio and the 242Pu chemical concentration are respectively 0.10% and 0.16% and limited by the uncertainty in the 240Pu/239Pu ratio of NBS947. This four isotope mixture was used as an internal standard as well as a spike, to analyze 30 batches of LWR spent fuel solutions. The repeatability of the mass spectrometric measurements have a coefficient of variation of 0.025% for the uranium concentration, and of 0.039% for the plutonium concentration. The spiking and treatment errors had a coefficient of variation of 0.048%. (author). Refs, figs and tabs

  15. Analysis of linear energy transfers and quality factors of charged particles produced by spontaneous fission neutrons from 252Cf and 244Pu in the human body

    International Nuclear Information System (INIS)

    Absorbed doses, linear energy transfers (LETs) and quality factors of secondary charged particles in organs and tissues, generated via the interactions of the spontaneous fission neutrons from. 252Cf and. 244Pu within the human body, were studied using the Particle and Heavy Ion Transport Code System (PHITS) coupled with the ICRP Reference Phantom. Both the absorbed doses and the quality factors in target organs generally decrease with increasing distance from the source organ. The analysis of LET distributions of secondary charged particles led to the identification of the relationship between LET spectra and target-source organ locations. A comparison between human body-averaged mean quality factors and fluence-averaged radiation weighting factors showed that the current numerical conventions for the radiation weighting factors of neutrons, updated in ICRP103, and the quality factors for internal exposure are valid. (authors)

  16. Separation and activity determination of 239+240Pu, 241Am and Curium (242and244Cm) in evaporator concentrate by Alpha Spectrometry

    International Nuclear Information System (INIS)

    Alpha spectrometry analysis was used for activity determinations of Pu, Am and Cm isotopes in evaporator concentrate samples from nuclear power plants. Using a sequential procedure the first step was Pu isolation by an anion exchange column followed by an Am and Cm separation of U and Fe by a co-precipitation with oxalic acid. The precipitate was used for americium and curium separation of strontium by using a TRU resin extraction chromatography column. Due to their chemical similarities and energy difference it was seen that the simultaneous determination of 241Am, 242Cm and 243,244Cm isotopes is possible using the 243Am as tracer, once they have peaks in different region of interest (ROI) in the alpha spectrum. In this work it was used tracers, 238Pu, 243Am, 244Cm and 232U, for determination and quantification of theirs isotopes, respectively. The standard deviations for replicate analysis were calculated and for 241Am it was (1,040 ± 160 mBqKg-1), relative standard deviation 15.38%, and for 239+240Pu it was (551 +- 44 mBqKg-1), relative standard deviation 7.98%. In addition, for the 242Cm isotope the standard deviation for determinations was(75 ± 23 mBqKg-1), with the relative standard deviation 30.67% higher than for 241Am and 239+240Pu. The radiometric yields ranged from 90% to 105% and the lower limit of detection was estimated as being 2.05 mBqKg-1. (author)

  17. Role of static deformation and compact orientation of target nucleus in measured fusion, fusion-fission and capture cross-sections of 244Pu+48Ca reaction

    International Nuclear Information System (INIS)

    The dynamical cluster-decay model (DCM), with deformations and orientation degrees of freedom of the incoming nuclei and of outgoing fragments included, is used to study the excitation functions of the "equatorial" compact hot fusion reaction 244Pu+48Ca→292114* (compact orientation angle θc=90° for 244Pu). Considering the higher multipole deformations up to hexadecapole deformation β4 and configurations with "compact" orientation θc, the model is shown to give a good description of the measured individual light-particle decay channels σxn, here x=3, 4 and 5, and other decay channels, the fusion-fission σff and quasi-fission σqf (equivalently, capture σcap) with in one parameter fitting, the neck length ΔR. The quasi-fission is also considered as a cold process with an elongated "polar" configuration. The xn-channel cross-sections for collisions between nuclei with static deformations at their respective compact orientations are shown to be much more than for the case of the nuclei taken to be spherical, signifying the increase in fusion threshold for an intermediate hot fusion reaction to be associated with the static deformation of the target nucleus and its orientation at the point of collision in its path toward the (spherical) compound nucleus. The shell effects in both the potential and kinetic energy (the mass parameters) terms of the Hamiltonian are shown to be important. The free parameter ΔR of the model is shown to depend strongly on limiting angular momentum, which in turn depends on the use of sticking or non-sticking moment of inertia for angular momentum effects. For the sticking moment of inertia, the evaporation residue (neutron emission) is shown to occur almost promptly (largest ΔR), followed by the competing (hot/cold) quasi-fission and ending finally with fusion-fission of hot compound nucleus. Different ΔR's (equivalently, relative separations) for the three processes means to predict that the processes ER, ff and qf happen

  18. Synthesis and Crystal Structure of Cobalt(II) Complex [Co(H2O)2(bpe)(OAc)2](4,4'-dpdo

    Institute of Scientific and Technical Information of China (English)

    赵琦华; 李惠琼; 方瑞斌

    2004-01-01

    The reaction of Co(OAc)2 with bpe and 4,4'-dpdo in an aqueous-alcohol solution affords the formation of red crystals of [Co(H2O)2(bpe)(OAc)2](4,4'-dpdo (bpe = trans-1,2-bis(4- pyridyl)ethylene, 4,4'-dpdo = 4,4'-dipyridyl N,N'-oxide). The molecular and crystal structures were determined by single-crystal X-ray diffraction. The crystal is of triclinic, space group P with a = 7.6146(9), b = 8.6691(11), c = 10.344011 A, α = 88.311(3), β = 76.992(3), γ = 75.809(3)°, V = 644.7613 A3, Z = 1, C26H28CoN4O8, Mr = 583.45, Dc = 1.503 g/cm3, μ = 0.724 mm-1, F(000) = 303, T = 223(2) K, the final R = 0.0477 and wR = 0.1177 for 3199 observed reflections with I > 2σ(I). In the crystal the cobalt atom is six-coordinated by oxygen atoms from two carboxylic molecules, two nitrogen atoms from the bpe ligands and two water molecules, completing an octahedral geometry. The structure of the title complex consists of neutral chains containing cobalt(II) ions bridged by mutually trans bpe molecules. The adjacent chains are connected through weak hydrogen bonds to form a two-dimensional structure.

  19. Measurements of prompt neutron multiplicity distributions in correlation with mass-energy distribution of fission fragments in spontaneous fission of 252Cf, 244Cm and 248Cm

    International Nuclear Information System (INIS)

    The number of prompt neutrons emitted in the fission event have been measured separately for each complementary fragment in coincidence with fragment mass and kinetic energies in spontaneous fission of 252Cf, 244Cm and 248Cm. Two high efficient Gd-loaded liquid scintillator tanks were used for the neutron registration. Approximately 3x106 fission events coincident with prompt neutron emission have been accumulated for each isotope. The mean neutron multiplicity, the dispersion and the covariance of the multiplicity distributions have been obtained as a function of fission fragment mass and kinetic energy. The neutron multiplicity data have been corrected for neutron registration efficiency, background and pile-up. Dependencies of the moments of the multiplicity distributions on the fragment mass and total kinetic energy for different mass bins, as well as mass and total kinetic energy distributions of the fission fragments are presented, discussed and compared for the different isotopes investigated. The results showed a different behavior of the moments of the multiplicity distribution depending on the fragment mass asymmetry that reflects changes in the dynamical effects for different fission modes. (author)

  20. Routine radiochemical method for the determination of 90Sr, 238Pu, 239+240Pu, 241Am and 244Cm in environmental samples

    International Nuclear Information System (INIS)

    Routine analytical procedures have been developed for the reliable simultaneous determination of 90Sr, 238Pu, 239+240Pu, 241Am and 242-244Cm, Chernobyl derived radioisotopes and fallout after nuclear weapon tests in a wide range of environmental samples: soil (100-200 g), sediments, aerosols, water and vegetation. This procedure has been applied to thousands of soil and sediment samples and hundreds of biological and water samples taken in the exclusive zone of Chernobyl NPP and different regions of Ukraine from 1989 to the present. After the sample has been properly prepared and isotopic tracers added, plutonium, americium and curium are precipitated with calcium oxalate and then lanthanum fluoride. Plutonium is separated from americium and curium by anion-exchange. Americium and curium are separated from rare earths by cation-exchange with gradient elute α-hydroxy-iso-butyric acid. During projects by AQCS IAEA 'Evaluation of Methods for 90Sr in a Mineral Matrix' and 'Proficiency Test for 239Pu, 241Pu and 241Am Measurement in a Mineral Matrix' accuracy and precision for 90Sr, 239Pu and 241Am by present procedure was evaluated. Advantages, difficulties and limitations of the method are discussed. (author)

  1. Synthesis and Crystal Structure of {Cu2(pdc)2(4,4′-bipy)(H2O)·(3H2O}2

    Institute of Scientific and Technical Information of China (English)

    温一航; 张健; 覃业燕; 李兆基; 康遥; 陈玉标; 程建开; 姚元根

    2004-01-01

    The title compound {Cu2(pdc)2(4,4′-bipy)(H2O)(3H2O}2 1 (H2pdc = pyridine-2,6- dicarboxylic acid, also known as dipicolinic acid; 4,4′-bipy = 4,4′-bipyridine) has been synthesized by the hydrothermal reaction and its structure was determined by single-crystal X-ray diffraction. The crystal is of triclinic, space group Pī with a = 7.2278(3), b = 10.6259(4), c = 17.7614(6)A, α= 79.5990(10), β = 83.6300(10), γ = 71.8280(10)o, V = 1272.60(8)A3, C48H44Cu4N8O24, Mr = 1371.07, Z = 1, Dc = 1.789 g/cm3, μ = 1.747 mm-1, F(000) = 696, R = 0.0397 and wR = 0.1137 for 3938 observed reflections (I > 2σ(I)). There are two kinds of Cu coordination environments, and each central copper(II) atom is five-coordinated in a distorted square-based pyramidal coordination geo- metry. Four copper(II) atoms are linked by four pdc and two 4,4′-bipy ligands to form an annular rectangle structure. Extensive hydrogen-bonding interactions involving carboxylate O atoms as well as coordinated and free water molecules lead to the formation of a three-dimensional network struc- ture.

  2. Synergistic extraction of gadolinium from nitrate media by mixtures of bis (2,4,4-trimethylpentyl) dithiophosphinic acid and di-(2-ethylhexyl) phosphoric acid

    International Nuclear Information System (INIS)

    Highlights: • The effect of operating parameters on the gadolinium extraction was investigated. • The mixture of extractants had the synergistic effects on the gadolinium extraction. • Mixture system obtained better stripping in comparison with D2EHPA system. - Abstract: The extraction of gadolinium (III) from aqueous nitrate solution with bis (2,4,4-trimethylpentyl) dithiophosphinic acid (Cyanex301), di-(2-ethylhexyl) phosphoric acid (D2EHPA) and the mixtures of extractants was investigated. Various parameters affecting the extraction process including the pH of aqueous phase, nitrate ion, extractant concentration, temperature, and stripping agents were studied. The stoichiometric coefficients of reactive extraction, thermodynamic and equilibrium parameters were obtained for two extractants and their mixtures. The results showed that the extraction ability of Cyanex301 was lower than that of D2EHPA extractant. As a result, the extraction of Gd3+ at low concentration of Cyanex301 was investigated by the addition of D2EHPA to the extraction system. The reactive extraction in the mixture system was spontaneous in nature as referred to the negative sign of ΔG while it was not favorable in case of single Cyanex301 system as indicated by the positive sign of ΔG. The experimental results showed that the mixture of extractants provided better extraction efficiency and effective stripping performance in comparison with single D2EHPA or Cyanex301 system

  3. 2B4 (CD244) signaling via chimeric receptors costimulates tumor-antigen specific proliferation and in vitro expansion of human T cells.

    Science.gov (United States)

    Altvater, Bianca; Landmeier, Silke; Pscherer, Sibylle; Temme, Jaane; Juergens, Heribert; Pule, Martin; Rossig, Claudia

    2009-12-01

    Regulatory NK cell receptors can contribute to antigen-specific adaptive immune responses by modulating T cell receptor (TCR)-induced T cell activation. We investigated the potential of the NK cell receptor 2B4 (CD244) to enhance tumor antigen-induced activation of human T cells. 2B4 is a member of the CD2 receptor subfamily with both activating and inhibitory functions in NK cells. In T cells, its expression is positively associated with the acquisition of a cytolytic effector memory phenotype. Recombinant chimeric receptors that link extracellular single-chain Fv fragments specific for the tumor-associated surface antigens CD19 and G(D2) to the signaling domains of human 2B4 and/or TCRzeta were expressed in non-specifically activated peripheral blood T cells by retroviral gene transfer. While 2B4 signaling alone failed to induce T cell effector functions or proliferation, it significantly augmented the antigen-specific activation responses induced by TCRzeta. 2B4 costimulation did not affect the predominant effector memory phenotype of expanding T cells, nor did it increase the proportion of T cells with regulatory phenotype (CD4+CD25(hi)FoxP3+). These data support a costimulatory role for 2B4 in human T cell subpopulations. As an amplifier of TCR-mediated signals, 2B4 may provide a powerful new tool for immunotherapy of cancer, promoting sustained activation and proliferation of gene-modified antitumor T cells. PMID:19360406

  4. Experimental study of the formation of super-heavy compound nuclei in the reaction 58Fe + 244Pu → 302 120

    International Nuclear Information System (INIS)

    This work deals with the nuclear mechanisms that take place in the collision of an incident Fe58 nucleus with a Pu244 nucleus for an energy that nears that of the Coulomb barrier. The compound nucleus is Z = 120, A 302. We have studied the specificities of the main reaction products and we have taken into account the information conveyed away by the neutrons released in the collision. Measurements have been performed at the U-400 accelerator in Dubna (Russia). 2 detecting systems have been necessary to detect fission fragments and neutrons: the Corset system is made up of 2 telescopes measuring the time of flight of the nuclear fragments and the Demon multi-detector able to draw the energy spectrum of the neutrons detected in coincidence with the fragments. We know that mass asymmetry is no longer a point of difference between fusion-fission and quasi-fission. It seems that fusion-fission fragments have more kinetic energy than quasi-fission fragments. We have made various analysis concerning the neutron emission in order to find the values of temperatures and multiplicities at pre- and post-scission stages with a view to tell fusion-fission events from quasi-fission events. We have deduced that the contribution of fusion-fission events to symmetric partitioning is about 10%. (A.C.)

  5. 社区卫生服务中心门诊腹痛患者244例诊治情况分析%Analysis of diagnosis and treatment of 244 cases of patients with abdominal pain in outpatient services of community health service center

    Institute of Scientific and Technical Information of China (English)

    胡勇军

    2014-01-01

    目的:分析某社区卫生服务中心门诊腹痛患者伴随症状及病因,探索门诊腹痛诊治过程中的注意事项及腹痛诊断思维。方法:2013年1-12月收治腹痛患者244例,回顾性分析其临床资料。结果:244例腹痛患者中,102例伴恶心呕吐,86例伴腹泻,28例伴反跳痛,5例伴牵涉痛,19例有发热。腹痛病因最后确诊为急性胃肠炎等18种疾病,病例数及百分比排在前5位的疾病有急性胃肠炎92例(38.70%)、胆囊炎及胆结石34例(13.92%)、急性阑尾炎17例(6.97%)、泌尿系结石及感染12例(4.92%)、急性盆腔炎11例(4.51%)。另有腹痛患者诊断为心肌梗死、心肌炎和癫痫等。结论:腹痛病因较为复杂,社区门诊医师应完善自己的知识结构,打破固有的思维定势,进一步扩大腹痛病因诊断方面的知识面,以减少误诊和漏诊。%Objective:To analyze the associated symptoms and etiology of patients with abdominal pain in outpatient services of community health service center,to explore the matters needing attention in the course of diagnosis and treatment of abdominal pain and abdominal pain diagnosis thinking.Methods:244 patients with abdominal pain were selected from January to December 2013.The clinical data were retrospectively analyzed.Results:In 244 cases of patients with abdominal pain,102 cases accompanied with nausea and vomiting;86 cases had diarrhea;28 cases had rebound pain;5 cases had referred pain;19 cases had fever.The cause of abdominal pain finally diagnosed as acute gastroenteritis and other 18 kinds of diseases.The case number and percentage of the top five diseases were acute gastroenteritis in 92 cases(38.70% ),cholecystitis and gallstones in 34 cases(13.92% ),17 cases(6.97%) of acute appendicitis,urinary calculi and infection in 12 cases(4.92%),11 cases(4.51%) of acute pelvic inflammatory disease.In addition,some abdominal pain were diagnosed with myocardial infarction

  6. Safe handling of kilogram amounts of fuel-grade plutonium and of gram amounts of plutonium-238, americium-241 and curium-244

    International Nuclear Information System (INIS)

    During the past 10 years about 600 glove-boxes have been installed at the Institute for Transuranium Elements at Karlsruhe. About 80% of these glove-boxes have been designed and equipped for handling 100-g to 1-kg amounts of 239Pu containing 8-12% 240Pu (low-exposure plutonium). A small proportion of the glove-boxes is equipped with additional shielding in the form of lead sheet or lead glass for work with recycled plutonium. In these glove-boxes gram-amounts of 241Am have also been handled for preparation of Al-Am targets using tongs and additional shielding inside the glove-boxes themselves. Water- and lead-shielded glove-boxes equipped with telemanipulators have been installed for routine work with gram-amounts of 241Am, 243Am and 244Cm. A prediction of the expected radiation dose for the personnel is difficult and only valid for a preparation procedure with well-defined preparation steps, owing to the fact that gamma dose-rates depend strongly upon proximity and source seize. Gamma radiation dose measurements during non-routine work for 241Am target preparation showed that handling of gram amounts leads to a rather high irradiation dose for the personnel, despite lead or steel glove-box shielding and shielding within the glove-boxes. A direct glove-hand to americium contact must be avoided. For all glove-handling of materials with gamma radiation an irradiation control of the forearms of the personnel by, for example, thermoluminescence dosimeters is necessary. Routine handling of americium and curium should be executed with master-slave equipment behind neutron and gamma shielding. (author)

  7. Soil washing in combination with homogeneous Fenton-like oxidation for the removal of 2,4,4'-trichlorodiphenyl from soil contaminated with capacitor oil.

    Science.gov (United States)

    Ma, Xiao-Hong; Zhao, Ling; Lin, Zhi-Rong; Dong, Yuan-Hua

    2016-04-01

    Detoxification by chemical oxidation of polychlorinated biphenyls (PCBs) in contaminated soils is very difficult and inefficient because PCBs typically associate with the solid phase or exist as non-aqueous-phase liquids due to their low solubility and slow desorption rates, and thus, they are difficult to remove from soils by using traditional, water-based elution techniques. Surfactant can enhance washing efficiency of PCBs from contaminated soils. This study used Brij 58, Brij 30, Tween 80, and 2-hydroxypropyl-β-cyclodextrin (HPCD) to solubilize 2,4,4'-trichlorodiphenyl (PCB28) from soil contaminated with capacitor oil into solution. The feasibility of PCB28 oxidation in soil washing wastewater through a Fe(3+)-catalyzed Fenton-like reaction was subsequently examined. Washing with 10 g L(-1) Brij 58 solution showed the highest extraction efficiency (up to 61.5 %) compared with that of the three other surfactants. The total concentration of PCB28 in contaminated soil at 25 °C after 48-h extraction was 286 mg L(-1). In contrast to conditions in which no washing agent was added, addition of the four washing agents decreased the efficiency of PCB28 degradation by the Fenton-like reaction, with the decrease due to addition of 10 g L(-1) Brij 58 solution being the smallest. The optimal concentration of H2O2 for preventing its useless decomposition was found to be 50 mM. The efficiency of PCB28 removal was lower when the initial concentration of PCB28 treated in the Fenton-like reaction was higher. The degradation efficiencies of PCB28 at initial concentrations of 0.1, 10, and 176 mg L(-1) in 10 g L(-1) Brij 58 solution at 25 °C and pH 3.0 and 9 h of reaction using 50 mM H2O2 were 64.1, 42.0, and 34.6 %, respectively. This result indicates that soil washing combined with Fenton-like oxidation may be a practical approach for the remediation of PCB-contaminated soil. PMID:26762933

  8. CHLOROPHYLL A, growth rate and graze rate (or grazing rate) site samples data collected in the Gulf of Alaska on the ALPHA HELIX cruises HX242, HX244 and others as part of the NEP project from 2001-04-18 to 2003-08-10 (NODC Accession 0114241)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NODC Accession 0114241 includes site samples and biological data collected aboard the ALPHA HELIX during cruises HX242, HX244, HX247, HX271 and HX275 in the Gulf of...

  9. SILICATE, WATER TEMPERATURE, FLUORESCENCE, PHOTOSYNTHETIC ACTIVE RADIATION (PAR) and other profile and discrete sample data collected in the Gulf of Alaska on the ALPHA HELIX cruises HX242, HX244 and others as part of the NEP project from 2001-04-18 to 2003-08-11 (NODC Accession 0113348)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NODC Accession 0113348 includes profile, discrete sample, biological, chemical and physical data collected aboard the ALPHA HELIX during cruises HX242, HX244,...

  10. SALINITY, WATER TEMPERATURE, FLUORESCENCE, PHOTOSYNTHETIC ACTIVE RADIATION (PAR) and other profile data collected in the Gulf of Alaska on the ALPHA HELIX cruises HX242, HX244 and others as part of the NEP project from 2001-04-18 to 2003-08-11 (NODC Accession 0115255)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NODC Accession 0115255 includes profile, biological and physical data collected aboard the ALPHA HELIX during cruises HX242, HX244, HX247, HX271 and HX275 in the...

  11. AG Turbo, Turbotech II, project 1.244. Experimental investigations of rotary instabilities in axial compressors and their effects in terms of compressor stability. Final report; AG Turbo, Turbotech II, Vorhaben 1.244. Experimentelle Untersuchungen rotierender Instabilitaeten in Axialverdichtern und ihr Einfluss auf die Verdichterstabilitaet. Abschlussbericht

    Energy Technology Data Exchange (ETDEWEB)

    Holste, F.; Haukap, C.; Kameier, F.

    2000-07-10

    The physical phenomena of rotary instabilities in industrial compressors and high-pressure aircraft compressors were investigated, which may be a cause of compressor blade fracture. The investigations were carried out by Duesseldorf Technical University on behalf of Rolls-Royce Deutschland GmbH at the new four-stage low-pressure compressor test stand of TU Dresden University. Extensive measurements were made both in the rotary and stationary system in the third compressor stage. Rotary instabilities could be detected by increasing the clearance between the blade tip and compressor wall. Modal analyses yielded a rate of about 30 for 63 blades, i.e. a characteristic wavelength of about twice the length of a blade. So far, an accurate description of the physical mechanism was impossible. Investigations using a Snubber model showed no significant influence on the rotary instabilities. [German] Im Turbotech II Forschungsvorhaben 1.244 wurden die physikalischen Vorgaenge der rotierenden Instabilitaet untersucht, die sowohl in industriellen Verdichtern als auch in Hochdruckverdichtern von Flugtriebwerken auftreten koennen. Diese Instabilitaeten stellen eine zusaetzliche Belastung fuer die Verdichterblaetter dar und koennen damit die Ursache fuer Blattbrueche sein. Im Auftrag von Rolls-Royce Deutschland wurden die Untersuchungen von der Faachhochschule Duesseldorf durchgefuehrt. Testobjekt war der neu aufgebaute vier stufige Niedergeschwindigkeitsverdichter der TU Dresden. In enger Kooperation mit den Vorhaben 1.243 und 1.246 wurden umfangreiche Messungen sowohl im rotierenden als auch im festen System an der dritten Stufe des Verdichters durchgefuehrt. Durch Vergroesserung des Spaltes zwischen Schaufelspitze und Verdichterwandung konnten rotierenden Instabilitaeten nachgewiesen werden. Modenanalysen ergaben Umfangsordnungen von ungefaehr 30 bei einer Blattzahl von 63, wodurch die charakteristische Wellenlaenge etwa zwei Schaufelwellenlaengen entspricht. Eine exakte

  12. Facile synthesis of new nano sorbent for magnetic solid-phase extraction by self assembling of bis-(2,4,4-trimethyl pentyl)-dithiophosphinic acid on Fe3O4-Ag core-shell nanoparticles: Characterization and application

    International Nuclear Information System (INIS)

    Graphical abstract: Self assembling of bis-(2,4,4-trimethylpentyl)-dithiophosphinic acid on Fe3O4-Ag core-shell nanoparticles and application of it for solid phase extraction of PAHs. Highlights: ► A novel sorbent for magnetic solid-phase extraction of PAHs was introduced. ► Silver was coated on Fe3O4 nanoparticles (MNPs) by reduction of AgNO3 with NaBH4. ► Bis-(2,4,4-trimethylpentyl)-dithiophosphinic acid self-assembled on silver coated MNPs. ► Size, morphology, composition and properties of the nanoparticles were characterized. ► Extraction efficiency of the sorbent was investigated by extraction of five PAHs. - Abstract: A novel sorbent for magnetic solid-phase extraction by self-assembling of organosulfur compound, (bis-(2,4,4-trimethylpentyl)-dithiophosphinic acid), onto the silver-coated Fe3O4 nanoparticles was introduced. Due to the formation of covalent bond of S-Ag, the new coating on the silver surface was very stable and showed high thermal stability (up to 320 °C). The size, morphology, composition, and properties of the prepared nanoparticles have also been characterized and determined using scanning electron microscopy (SEM), energy-dispersive X-ray analyzer (EDX), dynamic light scattering (DLS), Fourier transform-infrared (FT-IR) spectroscopy, and thermal gravimetric analysis (TGA). Extraction efficiency of the new sorbent was investigated by extraction of five polycyclic aromatic hydrocarbons (PAHs) as model compounds. The optimum extraction conditions for PAHs were obtained as of extraction time, 20 min; 50 mg sorbent from 100 mL of the sample solution, and elution with 100 μL of 1-propanol under fierce vortex for 2 min. Under the optimal conditions, the calibration curves were obtained in the range of 0.05–100 μg L−1 (R2 > 0.9980) and the LODs (S/N = 3) were obtained in the range of 0.02–0.10 μg L−1. Relative standard deviations (RSDs) for intra- and inter-day precision were 2.6–4.2% and 3.6–8.3%, respectively. In

  13. Extraction mechanism of Sc(III) and separation from Th(IV), Fe(III) and Lu(III) with bis(2,4,4-trimethylpentyl)phosphinic acid in n-hexane from sulphuric acid solutions

    International Nuclear Information System (INIS)

    The extraction equilibrium data of sulphuric acid and scandium(III) with bis(2,4,4-trimethylpentyl)phosphinic acid (H[BTMPP]) from sulphuric acid solutions have been obtained. There are two extraction mechanisms of scandium(III) with H[BTMPP] at different ranges of aqueous acidity. The extraction of Sc(III) proceeds according to a cation exchange reaction at lower aqueous acidity and to a solvating reaction at higher acidity. The practicability of separating Sc(III) from Th(IV),Fe(III) and Lu(III) by controlling the aqueous acidity was discussed. The effect of temperature on extraction of Sc(III) was observed and thermodynamic functions were calculated. IR and NMR spectra were made for organic extracts. The extraction characteristics of H[BTMPP] and di(2-ethylhexyl)phosphinic acid (H[DEHP]) were contrasted to obtain more information about extraction with H[BTMPP]. 12 refs., 6 figs., 1 tab

  14. Adsorption of gases and vapors on nanoporous Ni2(4,4'-Bipyridine)3(NO3)4 metal-organic framework materials templated with methanol and ethanol: structural effects in adsorption kinetics.

    Science.gov (United States)

    Fletcher, Ashleigh J; Cussen, Edmund J; Bradshaw, Darren; Rosseinsky, Matthew J; Thomas, K Mark

    2004-08-11

    Desolvation of Ni(2)(4,4'-bipyridine)(3)(NO(3))(4).2CH(3)OH and Ni(2)(4,4'-bipyridine)(3)(NO(3))(4).2C(2)H(5)OH give flexible metal-organic porous structures M and E, respectively, which have the same stoichiometry, but subtly different structures. This study combines measurements of the thermodynamics and kinetics of carbon dioxide, methanol, and ethanol sorption on adsorbents M and E over a range of temperatures with adsorbent structural characterization at different adsorbate (guest) loadings. The adsorption kinetics for methanol and ethanol adsorption on porous structure E obey a linear driving force (LDF) mass transfer model for adsorption at low surface coverage. The corresponding adsorption kinetics for porous structure M follow a double exponential (DE) model, which is consistent with two different barriers for diffusion through the windows and along the pores in the structure. The former is a high-energy barrier due to the opening of the windows in the structure, required to allow adsorption to occur, while the latter is a lower-energy barrier for diffusion in the pore cavities. X-ray diffraction studies at various methanol and ethanol loadings showed that the host porous structures E and M underwent different scissoring motions, leading to an increase in unit cell volume with the space group remaining unchanged during adsorption. The results are discussed in terms of reversible adsorbate/adsorbent (host/guest) structural changes and the adsorption mechanism involving hydrogen-bonding interactions with specific surface sites for methanol and ethanol adsorption in relation to pore size and extent of filling. This paper contains the first evidence for individual kinetic barriers to diffusion through windows and pore cavities in flexible porous coordination polymer frameworks. PMID:15291578

  15. Survey of potential markets for devices using Californium-252

    International Nuclear Information System (INIS)

    Potential applications for devices or systems containing 252Cf in the years from 1975 to 1980 are estimated. The estimated number of devices and associated business value were derived from a survey of 46 industrial, educational and governmental organizations conducted from Jan. to May, 1975. Applications for devices and systems based on 252Cf are expected to increase by a factor of 7 in the 6-y period from 1975 to 1980. The annual business value of 252Cf devices should increase from 1.5 million dollars in 1975 to 10.8 million dollars in 1980. The potential European market should be several times as large as the US market, based on actual sales of 252Cf, which have been two to four times greater in Europe than in the US

  16. The protective cell petrus for the production of californium 252

    International Nuclear Information System (INIS)

    The alpha, beta, gamma, neutron cell which is described in the present paper is devoted to the transplutonium element production and study. It is located at the CEN in Fontenay-aux-Roses (France). The 4 feet ordinary concrete shielding made of stacked blocs allows the manipulation of radioactive sources as high as 1000 curies of 1 MeV gamma rays and with a fast neutrons flux of 109 n.cm-2.s-1. The airtight alpha containment box is equipped with two transfer systems, one consists of a parallelepiped shaped airtight box located in a turntable, the other uses standard cylindrical containers made of polyethylene. The general equipment and the main setting up are also described. (authors)

  17. Californium-252 neutron activation facility at the Savannah River Laboratory

    International Nuclear Information System (INIS)

    A neutron irradiation facility has been established to develop new analytical methods and for the support of research programs. A major component of this facility is a 252Cf source which provides both fission spectrum and thermal neutrons. (U.S.)

  18. Californium-252 brachytherapy for anal and ano-rectal carcinoma

    International Nuclear Information System (INIS)

    Surgery has historically been the standard treatment for anal, ano-rectal and rectal carcinoma but is prone to local or regional failure. Over the past 15 years there has been increasing interest in and success with radiation therapy and combined chemoradiotherapy for treatment of anal and ano-rectal cancers. Cf-252 brachytherapy combined with external beam teletherapy has been investigated for anal and ano-rectal lesions at the Univ. of Kentucky with encouraging results

  19. Mobile equipment for neutron radiography using a californium-252 source

    International Nuclear Information System (INIS)

    The basic requirements for successful neutron radiography are first summarised and the use of 252Cf is placed in perspective by comparing its properties with those of sources based on the Be (γ, n) and Be (α, n) reactions which have a broadly similar range of applications. The more essential design features of mobile neutron radiography equipment are next examined in some detail, to show how the often conflicting requirements of optimum beam production and adequate shielding may be reconciled. An assembly with a maximum dimension around 1 m with a source of 1 mg is used as an example. The design data used are reproduced in graphical form to permit designs to be scaled to suit the source available and the requirements. The selection of suitable image recorders for 252Cf radiography is discussed with the conclusion that the gadolinium foil-film combinations are likely to remain the normal choice. Demonstration radiographs are presented with particular reference to the location of residual casting sand in gas-cooled turbine blades. Finally, it is suggested that other applications for mobile 252Cf-based neutron radiography equipment will be found in the ordnance, aero-space, chemical and nuclear fuel manufacturing industries. (author)

  20. Automated absolute activation analysis with californium-252 sources

    Energy Technology Data Exchange (ETDEWEB)

    MacMurdo, K.W.; Bowman, W.W.

    1978-09-01

    A 100-mg /sup 252/Cf neutron activation analysis facility is used routinely at the Savannah River Laboratory for multielement analysis of many solid and liquid samples. An absolute analysis technique converts counting data directly to elemental concentration without the use of classical comparative standards and flux monitors. With the totally automated pneumatic sample transfer system, cyclic irradiation-decay-count regimes can be pre-selected for up to 40 samples, and samples can be analyzed with the facility unattended. An automatic data control system starts and stops a high-resolution gamma-ray spectrometer and/or a delayed-neutron detector; the system also stores data and controls output modes. Gamma ray data are reduced by three main programs in the IBM 360/195 computer: the 4096-channel spectrum and pertinent experimental timing, counting, and sample data are stored on magnetic tape; the spectrum is then reduced to a list of significant photopeak energies, integrated areas, and their associated statistical errors; and the third program assigns gamma ray photopeaks to the appropriate neutron activation product(s) by comparing photopeak energies to tabulated gamma ray energies. Photopeak areas are then converted to elemental concentration by using experimental timing and sample data, calculated elemental neutron capture rates, absolute detector efficiencies, and absolute spectroscopic decay data. Calculational procedures have been developed so that fissile material can be analyzed by cyclic neutron activation and delayed-neutron counting procedures. These calculations are based on a 6 half-life group model of delayed neutron emission; calculations include corrections for delayed neutron interference from /sup 17/O. Detection sensitivities of < or = 400 ppB for natural uranium and 8 ppB (< or = 0.5 (nCi/g)) for /sup 239/Pu were demonstrated with 15-g samples at a throughput of up to 140 per day. Over 40 elements can be detected at the sub-ppM level.

  1. Californium-based neutron radiography for corrosion detection in aircraft

    International Nuclear Information System (INIS)

    In support of an overall program aimed at minimizing disassembly and reducing inspection time during aircraft maintenance, a series of projects has been carried out to determine the feasibility of applying neutron radiographic techniques to the nondestructive (NDT) inspection of aircraft and aircraft components. These investigations have clearly demonstrated the superiority of neutron radiography over all other NDT techniques in its ability to detect surface and subsurface corrosion in aircraft structure. This capability is particularly significant where the corrosion is hidden behind thick metallic structural members. The neutron radiographic technique has been applied successfully to detect corrosion in the wing tank of E-2C, C-130, and DC-9 aircraft; rear stabilators of F-4 and F-111 aircraft; aft spar, starboard and port wing, and rudder of the F-8; fuselage skin of the 727; rotary blades of AH-1 and SH-3 helicopters; rotary tail flaps of the UH-2 helicopter; and nose landing gear of A-7 aircraft

  2. Automated absolute activation analysis with californium-252 sources

    International Nuclear Information System (INIS)

    A 100-mg 252Cf neutron activation analysis facility is used routinely at the Savannah River Laboratory for multielement analysis of many solid and liquid samples. An absolute analysis technique converts counting data directly to elemental concentration without the use of classical comparative standards and flux monitors. With the totally automated pneumatic sample transfer system, cyclic irradiation-decay-count regimes can be pre-selected for up to 40 samples, and samples can be analyzed with the facility unattended. An automatic data control system starts and stops a high-resolution gamma-ray spectrometer and/or a delayed-neutron detector; the system also stores data and controls output modes. Gamma ray data are reduced by three main programs in the IBM 360/195 computer: the 4096-channel spectrum and pertinent experimental timing, counting, and sample data are stored on magnetic tape; the spectrum is then reduced to a list of significant photopeak energies, integrated areas, and their associated statistical errors; and the third program assigns gamma ray photopeaks to the appropriate neutron activation product(s) by comparing photopeak energies to tabulated gamma ray energies. Photopeak areas are then converted to elemental concentration by using experimental timing and sample data, calculated elemental neutron capture rates, absolute detector efficiencies, and absolute spectroscopic decay data. Calculational procedures have been developed so that fissile material can be analyzed by cyclic neutron activation and delayed-neutron counting procedures. These calculations are based on a 6 half-life group model of delayed neutron emission; calculations include corrections for delayed neutron interference from 17O. Detection sensitivities of 239Pu were demonstrated with 15-g samples at a throughput of up to 140 per day. Over 40 elements can be detected at the sub-ppM level

  3. Adsorption dynamics of gases and vapors on the nanoporous metal organic framework material Ni2(4,4'-bipyridine)3(NO3)4: guest modification of host sorption behavior.

    Science.gov (United States)

    Fletcher, A J; Cussen, E J; Prior, T J; Rosseinsky, M J; Kepert, C J; Thomas, K M

    2001-10-17

    This study combines measurements of the thermodynamics and kinetics of guest sorption with powder X-ray diffraction measurements of the nanoporous metal organic framework adsorbent (host) at different adsorptive (guest) loadings. The adsorption characteristics of nitrogen, argon, carbon dioxide, nitrous oxide and ethanol and methanol vapors on Ni2(4,4'-bipyridine)3(NO3)4 were studied over a range of temperatures as a function of pressure. Isotherm steps were observed for both carbon dioxide and nitrous oxide adsorption at approximately 10-20% of the total pore volume and at approximately 70% of total pore volume for methanol adsorption. The adsorption kinetics obey a linear driving force (LDF) mass transfer model for adsorption at low surface coverage. At high surface coverage, both methanol and ethanol adsorption follow a combined barrier resistance/diffusion model. The rates of adsorption in the region of both the carbon dioxide and methanol isotherm steps were significantly slower than those observed either before or after the step. X-ray diffraction studies at various methanol loadings showed that the host structure disordered initially but underwent a structural change in the region of the isotherm step. These isotherm steps are ascribed to discrete structural changes in the host adsorbent that are induced by adsorption on different sites. Isotherm steps were not observed for ethanol adsorption, which followed a Langmuir isotherm. Previous X-ray crystallography studies have shown that all the sites are equivalent for ethanol adsorption on Ni2(4,4'-bipyridine)3(NO3)4, with the host structure undergoing a scissoring motion and the space group remaining unchanged during adsorption. The activation energies and preexponential factors for methanol and ethanol adsorption were calculated for each pressure increment at which the linear driving force model was obeyed. There was a good correlation between activation energy and ln(preexponential factor), indicating a

  4. Psychological Empowerment of Contract Nurses and Its Influencing Factors%244名合同制护士心理授权及其影响因素分析

    Institute of Scientific and Technical Information of China (English)

    郭青; 覃巍; 何红燕; 程嘉莉; 胡华琼; 张小虹

    2012-01-01

    Objective To understand the status quo and the potential influencing factors of psychological empowerment of contract nurses and to provide reference for nursing managers to take psychological empowerment and improve contract nurses ' psychological empowerment. Methods Psychological Empowerment Scale (PES) was used to survey 244 contract nurses. Results The score of PES of contract nurses was (40.70±4.96), and there was no statistically significant difference in terms of different ages, marriages, work length, educational background, professional titles and departments. However, statistically significant difference was found in the factor of different working purposes (P<0.01). Conclusion Psychological empowerment of contract nurses needs to be improved. The recognition of importance of psychological empowerment, and the devotion to nursing will contribute to the improvement of psychological empowerment of contract nurses.%目的 了解合同制护士心理授权状况,探讨潜在的影响因素,为护理管理者实施心理授权提供依据,以有效提高合同制护士心理授权水平.方法 采用中文版心理授权量表对湖北省襄阳市3 所三级甲等综合性医院的244 名合同制护士进行调查.结果 合同制护士心理授权问卷总分(40.70±4.96)分,不同年龄、婚姻状态、护龄、学历、职称、科室的合同制护士心理授权总分差异无统计学意义,而工作目的 不同的合同制护士心理授权总分差异有统计学意义(P<0.01).结论 合同制护士的心理授权水平有待提高,认识合同制护士心理授权的重要性,培养合同制护士热爱护理专业有助于提高合同制护士心理授权水平.

  5. Formation of W/O microemulsions in the extraction of Nd(iii) by bis(2,4,4-trimethylpentyl)dithiophosphinic acid and its effects on Nd(iii) coordination.

    Science.gov (United States)

    Sun, Taoxiang; Xu, Chao; Chen, Jing

    2016-01-21

    The formation of water-in-oil (W/O) microemulsions during the extraction of Nd(iii) by bis(2,4,4-trimethylpentyl)dithiophosphinic acid (also known as purified Cyanex 301, denoted as HC301) was studied. Results from the measurement of the concentration of Nd(iii), Na(+) and NO3(-) in the organic phase, IR spectroscopy, and dynamic light scattering (DLS) all indicated that W/O microemulsions could form as the ratio of the neutralized ligand to Nd(iii) in the aqueous phase is over 3 : 1. The coordination environment of Nd(iii) in the extracted complexes was monitored by absorption spectroscopy and extended X-ray absorption fine structure (EXAFS) and was found to vary significantly with the formation of W/O microemulsions. When only 10% of HC301 was neutralized, with no formation of W/O microemulsions, the inner coordination shell of Nd(iii) in the organic phase was occupied dominantly by sulfur atoms from HC301. As HC301 was further neutralized, the coordinated sulfur atoms around Nd(iii) were replaced gradually by the oxygen atoms from water. This work provides further insights into the extraction mechanism in the extraction system using purified Cyanex 301 as an extractant. PMID:26660060

  6. 15 CFR 24.4 - Applicability.

    Science.gov (United States)

    2010-01-01

    ... Commerce and Foreign Trade Office of the Secretary of Commerce UNIFORM ADMINISTRATIVE REQUIREMENTS FOR... National School Lunch Act: (i) School Lunch (section 4 of the Act), (ii) Commodity Assistance (section 6 of...), and (ii) School Breakfast (section 4 of the Act). (6) Entitlement grants for State...

  7. 48 CFR 1652.244-70 - Subcontracts.

    Science.gov (United States)

    2010-10-01

    ... under FAR 52.215-2 “Audit and Records—Negotiations” if based on cost analysis or 48 CFR 1646.301 and... all FEHB Program contracts based on cost analysis (experience-rated): Subcontracts (JUL 2005) (a) The... price analysis; (5) The subcontractor's current, complete, and accurate cost or pricing data and...

  8. 8 CFR 244.9 - Evidence.

    Science.gov (United States)

    2010-01-01

    ... consist of: (i) Passport; (ii) Birth certificate accompanied by photo identification; and/or (iii) Any national identity document from the alien's country of origin bearing photo and/or fingerprint. (2) Proof... with whom he or she has done business. In all of the above, the name of the alien and the name of...

  9. 49 CFR 244.9 - Definitions.

    Science.gov (United States)

    2010-10-01

    ... rules at 49 CFR part 1105. Merger means the acquisition of one Class I railroad or Class II railroad... regulations of the Surface Transportation Board (49 CFR part 1201; General Instructions 1-1), as those... environmental documentation and analyses. Transaction means a consolidation, merger, or acquisition of...

  10. 50 CFR 216.244 - Mitigation.

    Science.gov (United States)

    2010-10-01

    ... habitat (as designated in 50 CFR Part 226) shall implement the following measures. (A) All torpedo-firing... right whale critical habitat (as designated in 50 CFR part 226) from November 15-April 15. (E) Object... accomplishment of primary operational duties. (xviii) Aircraft with deployed sonobuoys shall use only the...

  11. 17 CFR 244.101 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... applicable to the registrant. (b) GAAP. GAAP refers to generally accepted accounting principles in the United... prepared in accordance with non-U.S. generally accepted accounting principles, GAAP refers to the... with U.S. generally accepted accounting principles, GAAP refers to U.S. generally accepted...

  12. Efficacy and safety of an oral contraceptive containing ethinylestradiol 20 µg/drospirenone 3 mg (24/4 regimen in three indications in the People's Republic of China: a comparison with international studies

    Directory of Open Access Journals (Sweden)

    Marr J

    2015-07-01

    Full Text Available Joachim Marr,1 Zirong Huang,2 Baoxi Wang,3 Hongyan Zhang,4 Katrin Roth1 1Bayer Pharma AG, Berlin, Germany; 2Obstetrics and Gynecology Hospital of Fudan University, Shanghai, 3Institute of Dermatology, Chinese Academy of Medical Sciences, Nanjing, Jiangsu, 4Peking University Sixth Hospital, Peking University Institute of Mental Health, Ministry of Health (Peking University, Beijing, People's Republic of China Abstract: While combined oral contraceptives are a popular choice in developed Western countries, they are used by only 1% of women who are married or in a relationship in the People's Republic of China. The purpose of this review is to describe the efficacy and safety of the combined oral contraceptive containing ethinylestradiol (EE 20 µg/drospirenone 3 mg taken in a 24/4 regimen (YAZ®; Bayer HealthCare Pharmaceuticals, Berlin, Germany by Chinese women and to compare these results with those in women assessed in the international studies. Studies of EE 20 µg/drospirenone 3 mg in three different indications (contraception, acne, and premenstrual dysphoric disorder [PMDD] have been conducted in Chinese women. The results of these three studies indicate that the EE 20 µg/drospirenone 3 mg combined oral contraceptive is a good long-term contraceptive option in Chinese women, providing 99% contraceptive protection over the observed 1-year treatment period, and additionally had a favorable effect on moderate acne vulgaris and relieved the symptoms of PMDD. The contraceptive efficacy, improvement in acne, and relief from PMDD symptoms observed in these studies did not differ from the effects observed in other international studies of EE 20 µg/drospirenone 3 mg, indicating that EE 20 µg/drospirenone 3 mg is as effective in Chinese women as in other ethnicities. Further, EE 20 µg/drospirenone 3 mg demonstrated a similar safety and tolerability profile in women enrolled in the Chinese and international trials, with no unexpected adverse

  13. Facile synthesis of new nano sorbent for magnetic solid-phase extraction by self assembling of bis-(2,4,4-trimethyl pentyl)-dithiophosphinic acid on Fe{sub 3}O{sub 4}-Ag core-shell nanoparticles: Characterization and application

    Energy Technology Data Exchange (ETDEWEB)

    Tahmasebi, Elham [Department of Chemistry, Tarbiat Modares University, P.O. Box 14115-175, Tehran (Iran, Islamic Republic of); Yamini, Yadollah, E-mail: yyamini@modares.ac.ir [Department of Chemistry, Tarbiat Modares University, P.O. Box 14115-175, Tehran (Iran, Islamic Republic of)

    2012-12-05

    Graphical abstract: Self assembling of bis-(2,4,4-trimethylpentyl)-dithiophosphinic acid on Fe{sub 3}O{sub 4}-Ag core-shell nanoparticles and application of it for solid phase extraction of PAHs. Highlights: Black-Right-Pointing-Pointer A novel sorbent for magnetic solid-phase extraction of PAHs was introduced. Black-Right-Pointing-Pointer Silver was coated on Fe{sub 3}O{sub 4} nanoparticles (MNPs) by reduction of AgNO{sub 3} with NaBH{sub 4}. Black-Right-Pointing-Pointer Bis-(2,4,4-trimethylpentyl)-dithiophosphinic acid self-assembled on silver coated MNPs. Black-Right-Pointing-Pointer Size, morphology, composition and properties of the nanoparticles were characterized. Black-Right-Pointing-Pointer Extraction efficiency of the sorbent was investigated by extraction of five PAHs. - Abstract: A novel sorbent for magnetic solid-phase extraction by self-assembling of organosulfur compound, (bis-(2,4,4-trimethylpentyl)-dithiophosphinic acid), onto the silver-coated Fe{sub 3}O{sub 4} nanoparticles was introduced. Due to the formation of covalent bond of S-Ag, the new coating on the silver surface was very stable and showed high thermal stability (up to 320 Degree-Sign C). The size, morphology, composition, and properties of the prepared nanoparticles have also been characterized and determined using scanning electron microscopy (SEM), energy-dispersive X-ray analyzer (EDX), dynamic light scattering (DLS), Fourier transform-infrared (FT-IR) spectroscopy, and thermal gravimetric analysis (TGA). Extraction efficiency of the new sorbent was investigated by extraction of five polycyclic aromatic hydrocarbons (PAHs) as model compounds. The optimum extraction conditions for PAHs were obtained as of extraction time, 20 min; 50 mg sorbent from 100 mL of the sample solution, and elution with 100 {mu}L of 1-propanol under fierce vortex for 2 min. Under the optimal conditions, the calibration curves were obtained in the range of 0.05-100 {mu}g L{sup -1} (R{sup 2} > 0.9980) and the

  14. Capture cross section measurement analysis in the Californium-252 spectrum with the Monte Carlo method

    International Nuclear Information System (INIS)

    Absolute average capture cross sections of gold, thorium, tantalum, molybdenum, copper and strontium in 252Cf spontaneous fission neutron spectrum were simulated for two types of experiment setups preformed by Z. Dezso and J. Csikai and by L. Green. The experiments were simulated with MCNP5 using cross section data from the ENDF/B-VII.0 library. The determination of neutron backscattering was calculated with the use of neutron flagging. Correction factors to experimentally measured values were determined to obtain average cross sections in a pure 252Cf spontaneous fission spectrum. Influence of concrete wall thickness, air moisture and room size on the average cross section was analyzed. Correction factors amounted to about 30%. Corrected values corresponding to average cross sections in a pure 252Cf spectrum were calculated for 197Au, 232Th, 181Ta, 98Mo, 65Cu and 84Sr. Average cross sections were also calculated with the RR-UNC software using IRDFF-v.1.05 and ENDF/B-VII.0 libraries. The revised average radiative capture cross sections are 75.5±0.1 mb for 197Au, 87.0±1.6 mb for 232Th , 98.0±4.5 mb for 181Ta, 21.2±0.5 mb for 98Mo, 10.3±0.3 mb for 63Cu, and 34.9±6.5 mb for 84Sr. - Highlights: • Average capture cross sections in 252Cf spontaneous fission spectrum were simulated. • Calculations were done using MCNP5 code and ENDF/B-VII.0 library. • Correction factors for self-shielding and room return effects were taken into account. • The revised average radiative capture cross sections for different materials are published

  15. Multi-element neutron activation analysis of sediment using a californium-252 source

    International Nuclear Information System (INIS)

    The application of a 252Cf source to the neutron activation analysis of several elements in small (approximately 1.5 in. in dia) cores was studied using high-resolution gamma ray spectroscopy and manual data reduction. (U.S.)

  16. OER of californium-252 at low dose rate for growth inhibition in Vicia faba

    International Nuclear Information System (INIS)

    OER of 252Cf, at low dose rate, has been determined for growth inhibition in Vicia faba roots. A new strain ''BelB'' was used; it was found to be more resistant to prolonged anoxia. Two sets of linear 252Cf sources were used (linear activity 0.31 and 0.47 (μg.cm-1)) in somewhat different geometrical arrangements. The (n+γ) 252Cf dose rates at the level of the root tips were 0.11 and 0.13 Gy.h-1 respectively. The relative contribution of the γ component Dsub(γ) to the total absorbed dose Dsub(n+γ) at the level of the root tips was evaluated Dsub(γ)/Dsub(n+γ)=0.35 for the first source-geometry and 0.42 for the second source-geometry. The reference radiation was the γ emission of 192Ir, used in the same geometrical conditions and for similar irradiation times. Irradiations performed in aerobic and anoxic conditions were alternated. OER values of 1.4 +- 0.1 and 1.5 +- 0.1 were observed for the 252Cf emission with the first and second source-geometry respectively. The corresponding OER values for 192Ir were 2.3 +- 0.2 and 2.6 +- 0.1; the derived oxygen gain factors were then equal to 1.6 and 1.7 repectively

  17. 19 CFR 10.244 - Certificate of Origin.

    Science.gov (United States)

    2010-04-01

    ... Group: Group Each Description Below Is Only a Summary of the Cited CFR Provision. 19 CFR A Apparel... preference group which applies to the article according to the description contained in the CFR provision... llama, alpaca or vicuña fabrics, fabric components, or knit-to-shape components, from Andean yarns...

  18. Dicty_cDB: CHS244 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available d:none) Homo sapiens mRNA for mannosidase,... 121 4e-26 AY099704_1( AY099704 |pid:none) Arabidopsis thaliana alpha-man... sequence. 74 9e-13 2 BW354577 |BW354577.1 Ciona intestinalis cDNA, clone:cima804e24, 5'end, single read. 66...dqicqlhlqvfnilwiqplpvywqiqkeslfmlklhfskdggmnkvqqckill rvwlkvvnwn--- ---hhgi*pwfnqpvvim...M82822.1 Dictyostelium discoideum alpha-mannosidase (manA) gene, complete cds. 1302 0.0 1 CK149800 |CK149800...( P34098 ) RecName: Full=Lysosomal alpha-mannosidase; Sho... 387 e-106 M82822_1(

  19. 1935 15' Quad #244 Aerial Photo Mosaic Index

    Data.gov (United States)

    Earth Data Analysis Center, University of New Mexico — Aerial Photo Reference Mosaics contain aerial photographs that are retrievable on a frame by frame basis. The inventory contains imagery from various sources that...

  20. Fuzzy Itand#244; Integral Driven by a Fuzzy Brownian Motion

    OpenAIRE

    Didier Kumwimba Seya; Rostin Mabela Makengo; Marcel Rémon; Walo Omana Rebecca

    2015-01-01

    In this paper we take into account the fuzzy stochastic integral driven by fuzzy Brownian motion. To define the metric between two fuzzy numbers and to take into account the limit of a sequence of fuzzy numbers, we invoke the Hausdorff metric. First this fuzzy stochastic integral is constructed for fuzzy simple stochastic functions, then the construction is done for fuzzy stochastic integrable functions.

  1. Determination of 241Am and 244Cm in environmental samples

    International Nuclear Information System (INIS)

    The present technique describes a method to separate, purify and measure low levels of americium and curium in different environmental samples such as sediments, soils, water, vegetables, and air filters. The determination of radionuclides in theses environmental matrices have analytical problems, since a simple method doesn't exist for the purification, which is indispensable for its later measuring alpha spectrometry. The developed technique consist on taking an aliquot of the sample to analyze, to add tracer as americium 243 and curium 242, and to dissolve the matrix in a such way to have a clear solution. For the isolation of the americium and curium of the other actinides ar used as separation techniques: precipitation with Fe3+, anionic and cationic exchange, and extraction with a appropriate organic solvent. The purification of the americium and curium is followed by the electrodeposition habitually used. The measurement is carried out by alpha spectrometry with a detector of implanted ion. The detection limit for this techniques is of 0,002 Bq/l or 0,2 mBq in the case of filters. (author)

  2. Dicty_cDB: AHA244 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CP000094 |pid:none) Pseudomonas fluorescens Pf0-1, ... 35 8.3 AY338732_1( AY338732 |pid:none) Avian infec...tious bronchitis virus ... 35 8.3 DQ278233_1( DQ278233 |pid:none) Uncultured microo

  3. Dicty_cDB: VFH244 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available resident chaperone calreticulin mRNA, complete cds. 56 6e-04 1 CB937139 |CB937139.1 IpCGJ...x13_12_E07_23 IpCGJx13 Ictalurus punctatus cDNA clone IpCGJx13_12_E07 5', mRNA sequence. 56 6e-04 1

  4. Dicty_cDB: CHE244 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ing in prelim test: 0 Number of HSP's gapped (non-prelim): 0 length of query: 176 length of database: 80,480,566 effective... HSP length: 17 effective length of query: 159 effective length of database: 78,821,179 effe...ctive search space: 12532567461 effective search space used: 12532567461 T: 0 A: 0 ... of query: 176 length of database: Z,811,932,929 effective HSP length: 22 effective length of query: 154 effective... length of database: Y,960,467,611 effective search space: 6461912012094 effective

  5. Poweo 2006 consolidated revenue at euro 244 million, up 121%

    International Nuclear Information System (INIS)

    POWEO, the leading independent energy operator in France, presents in this document its key business indicators for the 4. quarter of 2006 and the full year: POWEO records again a strong rise of its annual revenue, exceeding its euro 220 million target. This progression relates to all the business components. The particularly soft climatic conditions recorded in France at the end of the year did not result in a significant fall of revenue compared to initial forecasts. The number of customer sites amounts to 80.300 at December 31, 2006, in progression of 23% compared to the end of 2005. The customer base remained overall stable during the second half of 2006, POWEO limiting voluntarily the acquisition of customers in electricity during the preparation of the opening to competition of the residential market due to take place on July 1, 2007. The gas customer base for its part more than doubled compared to end June 2006, with more than 5.000 customer sites transferred as at December 31, 2006. The Energy Management net margin, realised or un-realised, amounted to euro 49.7 million in 2006, recognised as revenue under IFRS standards. This includes the euro 22 million exceptional capital gain mentioned in previous financial releases in 2006, as well as a euro 7.9 million un-realised capital gain resulting from the transfer of some contracts into the Energy Management portfolio further to the capacity swap agreement with EDF announced publicly on January 3, 2007. The services provided by POWEO to its customers enjoy a high level of acceptance and represented revenue of euro 2.9 million in 2006. As from 2007, the revenue realised through these services will be presented separately from other components of revenue in order to better reflect its expected growth. The services offering will be indeed a key element of the marketing strategy of POWEO in the years to come, with a potentially significant impact on the results taking into account their level of gross margin which is structurally high. POWEO announced on January 3, 2007 to have concluded with EDF a long-term industrial agreement relating to a power generation capacity exchange, which will allow POWEO to have access from 2007 to 2021 to base-load electricity generated by EDF nuclear power plants. POWEO actively prepares the launch of its offering to residential customers, with in particular a communication campaign planned from next March to June in order to increase its notoriety and to create the conditions necessary to its commercial success on this segment. In parallel POWEO will dedicate specific sales resources to the acquisition of large accounts in industry and services. The public opinion poll carried out in the 4. quarter 2006 by BVA at the request of the Commission of Regulation of the Energy (CRE), and whose results have been just published, indicates that POWEO is already enjoying a global notoriety of 24% near companies only consuming electricity and 37% near companies consuming both electricity and gas. In addition, according to a TNS Sofres study ordered by POWEO, the assisted notoriety of the company near the specific segment of residential customers targeted by POWEO amounts to 13%. These results make POWEO feel confident in its ability to grow significantly its customer base in 2007

  6. Reasons for Exclusion from School. Research Brief No. 244.

    Science.gov (United States)

    Osler, Audrey; Watling, Rob; Busher, Hugh; Cole, Ted; White, Andy

    This study examined the reasons behind exclusion from school, emphasizing the exclusion of students with special needs, ethnic minority children, and children looked after by local authorities. Data collection included interviews with local education authority (LEA) officers; interviews with teachers and administrators; and documents from the…

  7. Transuranium element production. II. Chemical processing of targets

    International Nuclear Information System (INIS)

    The chemical processing described concerns small experimental targets irradiated in OSIRIS or EL-III and industrial targets irradiated in the CELESTIN reactors. In view of the difficulties encountered when processing highly irradiated targets (760MWd.kg-1) by liquid-liquid extraction (interface sludges leading to stable emulsion) the new processes developed are based on inverse phase chromatography. This technique applied to targets of americium 241, plutonium 239 and a plutonium mixture rich in isotope 242 has given tens of milligrams of curium 242, grams of americium 243 and curium 244 and micrograms of californium 252

  8. Radiation protection data sheet. Radiation protection data sheets for the use of radionuclides in unsealed sources

    International Nuclear Information System (INIS)

    These radiation protection data sheet are devoted to responsible persons and employees of various laboratories or medical, pharmaceutical, university and industrial departments where radionuclides are handled as well as all the persons who attend to satisfy in this field. They contain the essential radiation protection data for the use of unsealed sources: physical characteristics, risk assessment, administrative procedures, recommendations, regulations and bibliography. This new series includes the following radionuclides: californium 252, curium 244, gallium 67, indium 113m, plutonium 238, plutonium 239, polonium 210, potassium 42, radium 226, thorium 232, uranium 238 and zinc 65. (O.M.)

  9. The determination of americium, curium and californium in biological samples by combined solvent extraction-liquid scintillation counting

    International Nuclear Information System (INIS)

    A method has been developed to extract Am, Cm and Cf from ashed biological samples dissolved in 8 M LiN03-10-2 M HN03 into a liquid/scintillation cocktail. This new method reduces tissue and instrument background and allows use of a larger sample for analysis than when using a commercial gelling cocktail. The extractant cocktail is 20% N,N,N-trioctyl-N-methylammonium chloride dissolved in toluene containing the scintillators p-terphenyl and 1,4-bis-2-(5-phenyl-oxazolyl)-benzene. Several different types of biological samples were analyzed and radionuclide recoveries greater than 90% were obtained in all cases. (author)

  10. Raman and absorption spectrophotometric studies of selected lanthanide, californium-doped lanthanide, and actinide trihalides in the solid state

    International Nuclear Information System (INIS)

    The solid-state absorption spectra of Cf(III) ions as a dopant in lanthanide trihalide hosts (LnCl3: Ln = Ce, Sm, and Y; LnBr3: Ln = Ce, Sm, Tb, and Y; LnI3: Ln = Ce and Y) have been recorded. The spectra of Cf(III) have been correlated with the various crystal structures. The phonon Raman spectra and solid-state absorption spectra of PmF3, PmCl3, PmBr3, and two crystal modifications of PmI3 have been recorded. Symmetry assignments have been made for the Raman-active bands for these trihalides and also the sesquioxide. The room-temperature absorption spectra have been correlated to crystal field effects. The symmetry assignments of the Raman-active phonon modes have been made based on polarized Raman spectra from single crystals of YF3-type orthorhombic TbF3 and PuBr3-type orthorhombic NdBr3. Raman spectra of other isostructural lanthanide compounds have been recorded and compared. Symmetry assignments for these compounds have been made by analogy to the single-crystal assignments. Raman spectra have been obtained and catalogued for a number of actinide compounds. Symmetry assignments have been made for the observed Raman-active phonon bands in this work based on the assignments made for isostructural lanthanide compounds. 29 figs., 22 tabs

  11. Optical Transitions in Highly Charged Californium Ions with High Sensitivity to Variation of the Fine-Structure Constant

    Science.gov (United States)

    Berengut, J. C.; Dzuba, V. A.; Flambaum, V. V.; Ong, A.

    2012-08-01

    We study electronic transitions in highly charged Cf ions that are within the frequency range of optical lasers and have very high sensitivity to potential variations in the fine-structure constant, α. The transitions are in the optical range despite the large ionization energies because they lie on the level crossing of the 5f and 6p valence orbitals in the thallium isoelectronic sequence. Cf16+ is a particularly rich ion, having several narrow lines with properties that minimize certain systematic effects. Cf16+ has very large nuclear charge and large ionization energy, resulting in the largest α sensitivity seen in atomic systems. The lines include positive and negative shifters.

  12. Optical transitions in highly-charged californium ions with high sensitivity to variation of the fine-structure constant

    CERN Document Server

    Berengut, J C; Flambaum, V V; Ong, A

    2012-01-01

    We study electronic transitions in highly-charged Cf ions that are within the frequency range of optical lasers and have very high sensitivity to potential variations in the fine-structure constant, alpha. The transitions are in the optical despite the large ionisation energies because they lie on the level-crossing of the 5f and 6p valence orbitals in the thallium isoelectronic sequence. Cf16+ is a particularly rich ion, having several narrow lines with properties that minimize certain systematic effects. Cf16+ has very large nuclear charge and large ionisation energy, resulting in the largest alpha-sensitivity seen in atomic systems. The lines include positive and negative shifters.

  13. AN INTEGRAL REACTOR PHYSICS EXPERIMENT TO INFER ACTINIDE CAPTURE CROSS-SECTIONS FROM THORIUM TO CALIFORNIUM WITH ACCELERATOR MASS SPECTROMETRY

    International Nuclear Information System (INIS)

    The principle of the proposed experiment is to irradiate very pure actinide samples in the Advanced Test Reactor (ATR) at INL and, after a given time, determine the amount of the different transmutation products. The determination of the nuclide densities before and after neutron irradiation will allow inference of effective neutron capture cross-sections. This approach has been used in the past and the novelty of this experiment is that the atom densities of the different transmutation products will be determined using the Accelerator Mass Spectroscopy (AMS) technique at the ATLAS facility located at ANL. It is currently planned to irradiate the following isotopes: 232Th, 235U, 236U, 238U, 237Np, 238Pu, 239Pu, 240Pu, 241Pu, 242Pu, 241Am, 243Am and 248Cm.

  14. Integral range, energy, residual range, and linear energy transfer distributions for Californium fission fragments in microelectronics materials

    International Nuclear Information System (INIS)

    This report discusses the advantages and limitations of using Cf-252 radiation sources for single event testing of microelectronics for space environments. Integral distributions for the range, energy, residual range, and linear energy transfer of Cf-252 fission fragments in absorber and microelectronic materials have been calculated. Techniques are suggested for determining when single event testing using Cf-252 is appropriate; also, techniques are given for estimating the saturation cross section and thresh old linear energy transfer from test data. 10 refs., 25 figs., 2 tabs

  15. Research and experimental work at Groote Schuur Hospital and the University of Cape Town using californium-252 sources

    International Nuclear Information System (INIS)

    Experiments have been undertaken to determine the high-LET and low-LET components of the absorbed dose from neutron beams. This is achieved by measuring the fluxes of the high-LET and low-LET radiations in a tissue-equivalent phantom individually and simultaneously using a scintillation probe fitted with a pulse shape discriminator. This system was successfully used with a 22 MeV neutron beam from the T(d,n) reaction and has been employed with 252Cf sources. Results obtained in the low-energy ranges (up to 3 MeV) indicate that the electron counts exceed the high-LET counts by a factor of 2 to 3. These results are related to the absorbed dose. Calculations have also been undertaken to establish whether the Paterson-Parker system could be used for the design of 252Cf treatments and the optimum needle activities to yield the desired dose. Experiments are under way to determine the variation of RBE and OER for 252Cf radiations around the source. The inhibition of root growth in Vicia Faba is being used to determine any such effects. Dose rates comparable to that employed in interstitial radiotherapy are being aimed at. A study of dose fractionation effects is also being undertaken. (author)

  16. Poweo 2006 consolidated revenue at euro 244 million, up 121%; Poweo chiffre d'affaires 2006 de 244 millions euro, en hausse de 121%

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2007-01-15

    POWEO, the leading independent energy operator in France, presents in this document its key business indicators for the 4. quarter of 2006 and the full year: POWEO records again a strong rise of its annual revenue, exceeding its euro 220 million target. This progression relates to all the business components. The particularly soft climatic conditions recorded in France at the end of the year did not result in a significant fall of revenue compared to initial forecasts. The number of customer sites amounts to 80.300 at December 31, 2006, in progression of 23% compared to the end of 2005. The customer base remained overall stable during the second half of 2006, POWEO limiting voluntarily the acquisition of customers in electricity during the preparation of the opening to competition of the residential market due to take place on July 1, 2007. The gas customer base for its part more than doubled compared to end June 2006, with more than 5.000 customer sites transferred as at December 31, 2006. The Energy Management net margin, realised or un-realised, amounted to euro 49.7 million in 2006, recognised as revenue under IFRS standards. This includes the euro 22 million exceptional capital gain mentioned in previous financial releases in 2006, as well as a euro 7.9 million un-realised capital gain resulting from the transfer of some contracts into the Energy Management portfolio further to the capacity swap agreement with EDF announced publicly on January 3, 2007. The services provided by POWEO to its customers enjoy a high level of acceptance and represented revenue of euro 2.9 million in 2006. As from 2007, the revenue realised through these services will be presented separately from other components of revenue in order to better reflect its expected growth. The services offering will be indeed a key element of the marketing strategy of POWEO in the years to come, with a potentially significant impact on the results taking into account their level of gross margin which is structurally high. POWEO announced on January 3, 2007 to have concluded with EDF a long-term industrial agreement relating to a power generation capacity exchange, which will allow POWEO to have access from 2007 to 2021 to base-load electricity generated by EDF nuclear power plants. POWEO actively prepares the launch of its offering to residential customers, with in particular a communication campaign planned from next March to June in order to increase its notoriety and to create the conditions necessary to its commercial success on this segment. In parallel POWEO will dedicate specific sales resources to the acquisition of large accounts in industry and services. The public opinion poll carried out in the 4. quarter 2006 by BVA at the request of the Commission of Regulation of the Energy (CRE), and whose results have been just published, indicates that POWEO is already enjoying a global notoriety of 24% near companies only consuming electricity and 37% near companies consuming both electricity and gas. In addition, according to a TNS Sofres study ordered by POWEO, the assisted notoriety of the company near the specific segment of residential customers targeted by POWEO amounts to 13%. These results make POWEO feel confident in its ability to grow significantly its customer base in 2007.

  17. Measurements of the neutron capture cross sections and incineration potentials of minor-actinides in high thermal neutron fluxes: Impact on the transmutation of nuclear wastes

    International Nuclear Information System (INIS)

    This thesis comes within the framework of minor-actinide nuclear transmutation studies. First of all, we have evaluated the impact of minor actinide nuclear data uncertainties within the cases of 241Am and 237Np incineration in three different reactor spectra: EFR (fast), GT-MHR (epithermal) and HI-HWR (thermal). The nuclear parameters which give the highest uncertainties were thus highlighted. As a result of fact, we have tried to reduce data uncertainties, in the thermal energy region, for one part of them through experimental campaigns in the moderated high intensity neutron fluxes of ILL reactor (Grenoble). These measurements were focused onto the incineration and transmutation of the americium-241, the curium-244 and the californium-249 isotopes. Finally, the values of 12 different cross sections and the 241Am isomeric branching ratio were precisely measured at thermal energy point. (author)

  18. Measurements of the neutron capture cross sections and incineration potentials of minor-actinides in high thermal neutron fluxes: Impact on the transmutation of nuclear wastes; Mesures des sections efficaces de capture et potentiels d'incineration des actinides mineurs dans les hauts flux de neutrons: Impact sur la transmutation des dechets

    Energy Technology Data Exchange (ETDEWEB)

    Bringer, O

    2007-10-15

    This thesis comes within the framework of minor-actinide nuclear transmutation studies. First of all, we have evaluated the impact of minor actinide nuclear data uncertainties within the cases of {sup 241}Am and {sup 237}Np incineration in three different reactor spectra: EFR (fast), GT-MHR (epithermal) and HI-HWR (thermal). The nuclear parameters which give the highest uncertainties were thus highlighted. As a result of fact, we have tried to reduce data uncertainties, in the thermal energy region, for one part of them through experimental campaigns in the moderated high intensity neutron fluxes of ILL reactor (Grenoble). These measurements were focused onto the incineration and transmutation of the americium-241, the curium-244 and the californium-249 isotopes. Finally, the values of 12 different cross sections and the {sup 241}Am isomeric branching ratio were precisely measured at thermal energy point. (author)

  19. Prompt Neutron Emission from Fragments in Spontaneous Fission of 244, 248Cm and 252Cf

    Science.gov (United States)

    Vorobyev, A. S.; Dushin, V. N.; Hambsch, F.-J.; Jakovlev, V. A.; Kalinin, V. A.; Laptev, A. B.; Petrov, B. F.; Shcherbakov, O. A.

    2005-11-01

    Neutrons emitted in fission were measured separately for each complementary fragment in correlation with fission fragment energies. Two high efficient Gd-loaded liquid scintillator tanks were used for neutron registration. Fission fragment energies were measured using a twin Frisch gridded ionization chamber with a pin-hole collimator. The neutron multiplicity distributions were obtained for each value of the fission fragment mass and energy and corrected for neutron registration efficiency, background and pile-up. The dependencies of these distributions on fragment mass and energy for different energy and mass bins, as well as the mass and energy distribution of the fission fragments are presented and discussed.

  20. Poly[bis(μ2-4,4′-bipyridinebis(3-nitrobenzoatocobalt(II

    Directory of Open Access Journals (Sweden)

    Pei-Hsuan Chiang

    2009-11-01

    Full Text Available The hydrothermal reaction of cobalt nitrate with 4,4′-bipyridine and 3-nitrobenzoic acid lead to the formation of the title complex, [Co(C7H4NO42(C10H8N22]n. In the crystal structure, the CoII atoms are coordinated by two terminal carboxylate anions and four 4,4′-bipyridine ligands within slightly distorted octahedra. The CoII atom and one of the two independent 4,4′-bipyridine ligands are located on a twofold rotation axis, while the second independent 4,4′-bipyridine molecule is located on a centre of inversion. One of the two rings of one 4,4′-bipyridine ligand is disordered over two orientations and was refined using a split model [occupancy ratio 0.68 (2:0.32 (2]. The CoII atoms are connected by the 4,4′-bipyridine ligands into layers, which are located parallel to the ab plane.

  1. Options in Education. Technology in College, Parts One and Two, Program Nos. 244-245.

    Science.gov (United States)

    George Washington Univ., Washington, DC. Inst. for Educational Leadership.

    Scripts of public radio programs on the subject of technology in college are presented. The scripts are as follows: "Dental Videotape;""A Geography Student Talks About Learning by Computers;""Linda Harris Talks About Fear of Computers;""Charles Van Loan, Who Teaches Computer Science at Cornell University;""Students Who Learn Through…

  2. 7 CFR 2.44 - Administrator, Risk Management Agency and Manager, Federal Crop Insurance Corporation.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 1 2010-01-01 2010-01-01 false Administrator, Risk Management Agency and Manager... Secretary for Farm and Foreign Agricultural Services to the Administrator, Risk Management Agency, and... for the transaction of the business of the Federal Crop Insurance Corporation and the Risk...

  3. PETROCHINA PLACED US$2.44 B IN NEW H SHARES

    Institute of Scientific and Technical Information of China (English)

    Qu Lan

    2005-01-01

    @@ Following a request made by PetroChina, China's largest oil and gas producer, Hong Kong-listed, to the Stock Exchange of Hong Kong Limited, trading in the Company's H shares had been suspended with effect from 9:30 a.m. on 31 August 2005. The Company issued a formal announcement concerning about a placing of H shares under the general mandate granted to the Board of Directors at the annual general meeting of the Company on 26 May 2005 to issue up to 20% of the aggregate nominal amount of the Company's H shares in issue on that date, being not exceeding 3,516,483,600 H shares.

  4. Effect of benthic invertebrates on the desorption of Am-241 and Cm-244 from freshwater sediments

    International Nuclear Information System (INIS)

    Americium and curium are transuranic elements that bind strongly to particulate matter in freshwater environments. This research was conducted to determine if benthic amphipods (Hyalella sp.) or oligochaete worms (Tubifex spp.) alter sediment/water partitioning. Laboratory experiments were conducted in buffered water from Lake Washington (Seattle, WA) with radionuclide tracers added either to the water or to a selected particulate phase - quartz sand, organic detritus, or NBS (National Bureau of Standards) standard river sediment. Samples were collected during a five day exposure period and radioactivity was measured in the water, particulates and organisms. The presence of organisms increased soluble concentrations of Am and Cm. Desorption from particulate phases occurred more readily for Am than for Cm and each isotope was bound most tightly by NBS sediment and least strongly by quartz sand. (author)

  5. 40 CFR 98.244 - Monitoring and QA/QC requirements.

    Science.gov (United States)

    2010-07-01

    ... Measurement of Fluid Flow by Means of Coriolis Mass Flowmeters (incorporated by reference, see § 98.7). (viii... the minimum frequency specified by the manufacturer. (2) Operate and maintain all flow meters for gas... procedures specified by the flow meter manufacturer or § 98.3(i). Recalibrate each flow meter...

  6. Accurate determination of Curium and Californium isotopic ratios by inductively coupled plasma quadrupole mass spectrometry (ICP-QMS) in 248Cm samples for transmutation studies

    International Nuclear Information System (INIS)

    The French Atomic Energy Commission has carried out several experiments including the mini-INCA (INcineration of Actinides) project for the study of minor-actinide transmutation processes in high intensity thermal neutron fluxes, in view of proposing solutions to reduce the radiotoxicity of long-lived nuclear wastes. In this context, a Cm sample enriched in 248Cm (∼97 %) was irradiated in thermal neutron flux at the High Flux Reactor (HFR) of the Laue-Langevin Institute (ILL). This work describes a quadrupole ICP-MS (ICP-QMS) analytical procedure for precise and accurate isotopic composition determination of Cm before sample irradiation and of Cm and Cf after sample irradiation. The factors that affect the accuracy and reproducibility of isotopic ratio measurements by ICP-QMS, such as peak centre correction, detector dead time, mass bias, abundance sensitivity and hydrides formation, instrumental background, and memory blank were carefully evaluated and corrected. Uncertainties of the isotopic ratios, taking into account internal precision of isotope ratio measurements, peak tailing, and hydrides formations ranged from 0.3% to 1.3%. This uncertainties range is quite acceptable for the nuclear data to be used in transmutation studies.

  7. Radiological Characterization Technical Report on Californium-252 Sealed Source Transuranic Debris Waste for the Off-Site Source Recovery Project at Los Alamos National Laboratory

    Energy Technology Data Exchange (ETDEWEB)

    Feldman, Alexander [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2014-04-24

    This document describes the development and approach for the radiological characterization of Cf-252 sealed sources for shipment to the Waste Isolation Pilot Plant. The report combines information on the nuclear material content of each individual source (mass or activity and date of manufacture) with information and data on the radionuclide distributions within the originating nuclear material. This approach allows for complete and accurate characterization of the waste container without the need to take additional measurements. The radionuclide uncertainties, developed from acceptable knowledge (AK) information regarding the source material, are applied to the summed activities in the drum. The AK information used in the characterization of Cf-252 sealed sources has been qualified by the peer review process, which has been reviewed and accepted by the Environmental Protection Agency.

  8. The development and medical applications of a simple facility for partial body in vivo neutron activation analysis using californium-252 sources

    International Nuclear Information System (INIS)

    A simple and cheap facility for partial body neutron activation analysis has been designed, based on the use of two 100 μg 252Cf neutron sources. The results reported show that calcium can be measured in parts of the body such as the tibia with a precision as good as +- 1.6 % for a radiation dose of 2 rem. The uniformity of the thermal neutron flux density is better than +- 3 % over 10 cm. Some applications of this irradiation facility for studies of trace elements, in particular cadmium in liver and aluminium in liver or brain, have also been explored. However, the sensitivity attainable is not yet sufficient for the study of normal levels, but could be of interest in toxicological investigations

  9. Accurate determination of Curium and Californium isotopic ratios by inductively coupled plasma quadrupole mass spectrometry (ICP-QMS) in Cm-248 samples for transmutation studies

    International Nuclear Information System (INIS)

    The French Atomic Energy Commission has carried out several experiments including the mini-INCA (Incineration of Actinides) project for the study of minor-actinide transmutation processes in high intensity thermal neutron fluxes, in view of proposing solutions to reduce the radiotoxicity of long-lived nuclear wastes. In this context, a Cm sample enriched in 248Cm (similar to 97%) was irradiated in thermal neutron flux at the High Flux Reactor (HFR) of the Laue-Langevin Institute (ILL). This work describes a quadrupole ICP-MS (ICP-QMS) analytical procedure for precise and accurate isotopic composition determination of Cm before sample irradiation and of Cm and Cf after sample irradiation. The factors that affect the accuracy and reproducibility of isotopic ratio measurements by ICP-QMS, such as peak centre correction, detector dead time, mass bias, abundance sensitivity and hydrides formation, instrumental background, and memory blank were carefully evaluated and corrected. Uncertainties of the isotopic ratios, taking into account internal precision of isotope ratio measurements, peak tailing, and hydrides' formations ranged from 0. 3% to 1. 3%. This uncertainties' range is quite acceptable for the nuclear data to be used in transmutation studies. (authors)

  10. Investigation of equilibria in solutions of metal(2) ion complexes with heptane-2,4,4-trione

    International Nuclear Information System (INIS)

    Using the method of pH potentiometric titration in water - ethanol solutions, the interaction of bivalent metal ions with heptane-2, 4, 6-trione is investigated. It is shown that in case of Mg, Ca, Sr, Ba protonated and normal mononuclear complexes are formed. At 22 deg C and ionic strength μ = 0.1 equilibrium constants of the complex mononuclear forms are determined

  11. Distribution of Prompt Neutron Emission Probability for Fission Fragments in Spontaneous Fission of 252Cf and 244,248Cm

    Science.gov (United States)

    Vorobyev, A. S.; Dushin, V. N.; Hambsch, F.-J.; Jakovlev, V. A.; Kalinin, V. A.; Laptev, A. B.; Petrov, B. F.; Shcherbakov, O. A.

    2005-05-01

    Neutrons emitted in fission events were measured separately for each complementary fragment in correlation with fission fragment energies. Two high-efficiency Gd-loaded liquid scintillator tanks were used for neutron registration. Fission fragment energies were measured using a twin Frisch gridded ionization chamber with a pinhole collimator. The neutron multiplicity distributions were obtained for each value of the fission fragment mass and energy and corrected for neutron registration efficiency, background, and pile-up. The dependency of these distributions on fragment mass and energy for different energy and mass bins as well as mass and energy distribution of fission fragments are presented and discussed.

  12. Changing convention in combination oral contraceptives: estradiol and nomegestrol acetate in a monophasic 24/4 regimen.

    Science.gov (United States)

    Shulman, Lee P

    2013-07-01

    Initial oral contraceptive regimens were characterised by high doses of ethinylestradiol (EE) and a progestogen in a 21-day regimen that either included seven additional hormone-free tablets or simply the 21 days of combination hormonal tablets. These regimens were developed to ensure high contraceptive effectiveness, regular and predictable withdrawal bleeding episodes to mimic a menstrual cycle, and minimal unscheduled vaginal bleeding. However, these regimens were associated with adverse tolerability and safety issues resulting from the dose and characteristics of their hormonal components. Attempts to ameliorate these adverse issues included the development of lower-dose EE regimens, the incorporation of new progestogens, multiphasic regimens, and reduced hormone-free interval regimens. However, the EE component has remained a constant until the recent approval of combination oral contraceptives with an estrogen component other than EE. The development and introduction of an estradiol-based oral contraceptive regimen is presented in this review. PMID:23709606

  13. NA22 Model Cities Project - LL244T An Intelligent Transportation System-Based Radiation Alert and Detection System

    Energy Technology Data Exchange (ETDEWEB)

    Peglow, S

    2004-02-24

    The purpose of this project was twofold: first, provide an understanding of the technical foundation and planning required for deployment of Intelligent Transportation System (ITS)-based system architectures for the protection of New York City from a terrorist attack using a vehicle-deployed nuclear device; second, work with stakeholders to develop mutual understanding of the technologies and tactics required for threat detection/identification and establish guidelines for designing operational systems and procedures. During the course of this project we interviewed and coordinated analysis with people from the New Jersey State Attorney General's office, the New Jersey State Police, the Port Authority of New York/New Jersey, the Counterterrorism Division of the New York City Police Department, the New Jersey Transit Authority, the State of New Jersey Department of Transportation, TRANSCOM and a number of contractors involved with state and federal intelligent transportation development and implementation. The basic system architecture is shown in the figure below. In an actual system deployment, radiation sensors would be co-located with existing ITS elements and the data will be sent to the Traffic Operations Center. A key element of successful system operation is the integration of vehicle data, such as license plate, EZ pass ID, vehicle type/color and radiation signature. A threat data base can also be implemented and utilized in cases where there is a suspect vehicle identified from other intelligence sources or a mobile detector system. Another key aspect of an operational architecture is the procedures used to verify the threat and plan interdiction. This was a major focus of our work and discussed later in detail. In support of the operational analysis, we developed a detailed traffic simulation model that is described extensively in the body of the report.

  14. Plutonium-244 dating: Initial ratios of plutonium to uranium in the Apollo 11 and 14 lunar fines and breccias

    International Nuclear Information System (INIS)

    More than 550 mass-spectrometric analyses of xenon released from bulk samples and temperature fractions of the lunar fines, breccias and rocks have been carried out in various laboratories in the world including the Soviet Union, since Apollo 11 astronauts made the first successful landing on the moon on 20 July 1969. Re-examination of all the known xenon isotope data for the lunar samples reveals that the moon started to retain her xenon at about the same time as the carbonaceous chondrites, when the initial ratio of Pu to U within the solar system was about 1 to 10 (atom/atom) more than 4,800 million years ago

  15. Notice of construction work in tank farm waste transfer pit 244-TX double contained receiver-tank

    International Nuclear Information System (INIS)

    The following description and any attachments and references are provided to the Washington State Department of Health (WDOH), Division of Radiation Protection, Air Emissions and Defense Waste Section as a notice of construction (NOC) in accordance with Washington Administrative Code (WAC) 246-247, Radiation Protection - Air Emissions. WAC 246-247-060, ''Applications, registration, and licensing'', states ''This section describes the information requirements for approval to construct, modify, and operate an emission unit. Any NOC requires the submittal of information listed in Appendix A,'' Appendix A (WAC 246-247-1 10) lists the requirements that must be addressed. Additionally, the following description, attachments, and references are provided to the U.S. Environmental Protection Agency (EPA) as an NOC, in accordance with Title 40 Code of Federal Regulations (CFR), Part 61, ''National Emission Standards for Hazardous Air Pollutants.'' The information required for submittal to the EPA is specified in 40 CFR 61.07. The potential emissions from this activity are estimated to provide less than 0.1 millired year total effective dose equivalent to the hypothetical offsite maximally exposed individual, and commencement is needed within a short time. Therefore, this application also is intended to provide notification of the anticipated date of initial startup in accordance with the requirement listed in 40 CFR 61.09(a)(1), and it is requested that approval of this application also will constitute EPA acceptance of this initial startup notification. Written notification of the actual date of initial startup, in accordance with the requirement listed in 40 CFR 61.09(a)(2), will be provided later. The activities described in this NOC are estimated to provide a potential offsite (unabated) total effective dose equivalent (TEDE) to the hypothetical maximally exposed individual (MEI) of 2.36 E-02 millirem per year

  16. Investigation of the soil-to-plant transfer of Np-237, Pu-238, Am-241 and Cm-244

    International Nuclear Information System (INIS)

    Inside a greenhouse for radioecological studies the root uptake of Np, Pu, Am, and Cm from 5 different soils into 19 crop plants have been measured. The soils have been artificially contaminated with the 4 nuclides in range from 1-20 Bq/g dry soil. Within 7 vegetation periods about 380 transfer measurements have been performed. The obtained results show that the soil-to-plant transfer is mainly influenced by the following parameters: physical and chemical properties of the different radionuclides, plant species and variety, soil type, time of soil utilization and soil management. The transfer factors measured are compared with those data which are proposed for the calculation of the long term radiation burden of the population by ingestion of contaminated food inside the Federal Republic of Germany. The experiments have been performed from the beginning of 1983 to the end of 1986. The results summarized within this report have already been published in annual reports or as contributions to scientific meetings. (orig.)

  17. Metabolites of 2,4,4'-tribrominated diphenyl ether (BDE-28) in pumpkin after in vivo and in vitro exposure.

    Science.gov (United States)

    Yu, Miao; Liu, Jiyan; Wang, Thanh; Sun, Jianteng; Liu, Runzeng; Jiang, Guibin

    2013-01-01

    There is currently limited knowledge on PBDE metabolism in plants although they could play an important role in the environmental transformation of these persistent organic pollutants. In this study, pumpkin (Cucurbita maxima × C. moschata) was chosen as the model to understand the fate of BDE-28 in plants. MeO-tri-BDEs, OH-tri-BDEs, and OH-tri-BDEs were found as metabolites in plant samples of both in vivo hydroponic and in vitro tissue culture exposure. Three MeO-tri-BDEs were further identified as para-substituted metabolites. MeO-BDEs and OH-BDEs, respectively, accounted for about 1.6% and 1.5% (recovery corrected) of initial amount of BDE-28 according to the semiquantitative results. Other PBDEs, especially less brominated PBDEs as impurities in the standard of BDE-28, were also detected. The impurities and evaporation of the standard must be considered when trace metabolites are studied in exposure experiments. PMID:24191731

  18. Accumulation of Am-241 and Cm-244 from water and sediments by Hyalella sp. and Tubifex spp

    International Nuclear Information System (INIS)

    This paper reports on the bioaccumulation of americium and curium by freshwater invertebrates in laboratory experiments. Uptake by benthic invertebrates will affect both the biogeochemical cycling of these elements and the potential exposure of man through accumulation in aquatic food chains. Am and Cm isotopes are produced by nuclear reactions in commercial reactors and are major components of high level wastes. Both elements bind strongly to sediments which may be the principal source for uptake by benthic organisms in freshwater and marine environments. The principal objectives of this research were: (1) to determine the extent of bioaccumulation of Am and Cm for freshwater species; (2) to compare bioaccumulation from water with bioaccumulation from various types of sediment particles; and (3) to evaluate the similarities and differences in the behavior of Am and Cm

  19. Accumulation of Am-241 and Cm-244 from water and sediments by Hyalella sp. and Tubifex spp

    Energy Technology Data Exchange (ETDEWEB)

    Sibley, T.H.; Stohr, J.S. (Univ. of Washington, Seattle (USA))

    1990-01-01

    This paper reports on the bioaccumulation of americium and curium by freshwater invertebrates in laboratory experiments. Uptake by benthic invertebrates will affect both the biogeochemical cycling of these elements and the potential exposure of man through accumulation in aquatic food chains. Am and Cm isotopes are produced by nuclear reactions in commercial reactors and are major components of high level wastes. Both elements bind strongly to sediments which may be the principal source for uptake by benthic organisms in freshwater and marine environments. The principal objectives of this research were: (1) to determine the extent of bioaccumulation of Am and Cm for freshwater species; (2) to compare bioaccumulation from water with bioaccumulation from various types of sediment particles; and (3) to evaluate the similarities and differences in the behavior of Am and Cm.

  20. Oscar H. Aelo, El peronismo en la provincia de Buenos Aires (1946-1955), Caseros, Eduntref, 2012, 244 p.

    OpenAIRE

    Hémeury, Lucie

    2013-01-01

    Fenómeno fundamental en la historia de la Argentina del siglo XX, el peronismo sigue siendo un tema central de la historiografía argentina. Como suele ocurrir en el caso de movimientos de tal amplitud, caracterizados tanto por su longevidad como por la importancia de ciertas transformaciones en el campo político, social, cultural y económico, la bibliografía enfoca algunos de estos aspectos en perjuicio de otros. En su libro El peronismo en la provincia de Buenos Aires, fruto de una tesis de ...

  1. Comparison of photosensitivity in germanium doped silica fibers using 244 nm and 266 nm continuous wave lasers

    DEFF Research Database (Denmark)

    Jensen, Jesper Bo; Varming, Poul; Liu, B.;

    2001-01-01

    Diode pumped continuous-wave UV lasers offer an interesting alternative to frequency doubled argon-ion lasers. We report the first photosensitivity comparison using these lasers on deuterium loaded standard telecommunication fibers and unloaded experimental fibers.......Diode pumped continuous-wave UV lasers offer an interesting alternative to frequency doubled argon-ion lasers. We report the first photosensitivity comparison using these lasers on deuterium loaded standard telecommunication fibers and unloaded experimental fibers....

  2. Freeze drying method for preparing radiation source material

    International Nuclear Information System (INIS)

    Fabrication of a neutron source is specifically claimed. A palladium/californium solution is freeze dried to form a powder which, through conventional powder metallurgy, is shaped into a source containing the californium evenly distributed through a palladium metal matrix. (E.C.B.)

  3. Review of RBE and OER values for Cf-neutrons

    International Nuclear Information System (INIS)

    Californium-252, an isotope emitting neutrons, gamma photons and alpha particles, is being investigated for its practical use in intracavitary and interstitial brachytherapy. A review of published RBE and OER values for californium neutrons as a function of dose rate for a variety of biological endpoints is given. (Auth.)

  4. 8 CFR 1240.21 - Suspension of deportation and adjustment of status under section 244(a) of the Act (as in effect...

    Science.gov (United States)

    2010-01-01

    ... cancellation of removal as provided in 8 CFR 240.21 (as in effect prior to September 30, 1998). (b) Conditional... of removal is pending on appeal before the Board as of September 30, 1998 or, if the right to appeal... unfavorable exercise of discretion, a finding of no good moral character on a ground not specifically noted...

  5. 8 CFR 240.21 - Suspension of deportation and adjustment of status under section 244(a) of the Act (as in effect...

    Science.gov (United States)

    2010-01-01

    ... provided in 8 CFR 240.21 (as in effect prior to September 30, 1998). (b) Conditional grants of suspension... before the Board as of September 30, 1998 or, if the right to appeal to the Board has not been waived... moral character on a ground not specifically noted in section 101(f) of the Act, a failure to...

  6. Integrated plant safety assessment systematic evaluation program. R.E. Ginna Nuclear Power Plant, Rochester Gas and Electric Corporation, Docket No. 50-244

    International Nuclear Information System (INIS)

    The Systematic Evaluation Program was initiated in February 1978 by the US Nuclear Regulatory Commission to review the designs of older operating nuclear reactor plants to reconfirm and document their safety. The review provides (1) an assessment of how these plants compare with current licensing safety requirements relating to selected issues, (2) a basis for deciding on how these differences should be resolved in an integrated plant review, and (3) a documented evaluation of plant safety. This report documents the review of the R.E. Ginna Nuclear Power Plant (located in Wayne County near Rochester, NY), one of ten plants reviewed under Phase II of this program, and indicates how 137 topics selected for review under Phase I of the program were addressed. Equipment and procedural changes have been identified as a result of the review. It is expected that this report will be one of the bases in considering the issuance of a full-term operating license in place of the existing provisional operating license

  7. 77 FR 27082 - StarTek USA, Inc., 244 Dundee Avenue, Greeley, CO; StarTek USA, Inc., 1250 H Street, Greeley, CO...

    Science.gov (United States)

    2012-05-08

    ... Department's notice of determination was published in the Federal Register on January 14, 2011 (76 FR 2717...., 1250 H Street, Greeley, CO; Amended Certification Regarding Eligibility To Apply for Worker Adjustment... ``north'' center at 1250 H Street); both facilities supply business processes services and operate...

  8. Fission barrier determinations and fragment angular correlations for the 244Pu, 242Pu, 240U, 238U, 234Th, and 232Th compound nuclei from (t, pf) reactions

    International Nuclear Information System (INIS)

    Fission probabilities and the angular distribution of the fission fragments have been measured for six even-even compound nuclear systems using the (t, pf) reaction. Angular correlations of fission fragments obtained in these experiments provide information about the low-lying collective excitations or transition states at the fission barrier. The (t, p) reaction in particular leads to neutron-rich residual nuclei unobtainable by other methods. The absence of spin coupling for (t, p) reactions on even-even targets provides angular distributions with well defined structure in the region of the fission barrier. The experimental data were obtained using an 18-MeV triton beam on targets of 242Pu, 240Pu, 238U, 236U, 232Th and 230Th at Los Alamos Van-de-Graaff accelerator facility. Outgoing protons were detected at 140 deg relative to the incident triton beam. Excitation energies ranging from 3.0 to 9.0 MeV were obtained in these experiments. Fission fragment angular distributions were measured at 24 angles from 0 deg to 140 deg relative to the kinematic recoil angle. The data were fitted to a series of even Legendre polynomials W(θ) = A0 [1 + ΣL gL PL (cos θ)] and the coefficients g2 through g12 and A0 were determined as a function of excitation energy. The fission probability Pf was obtained from the ratio of A0 to the (t, p) cross-section for the target nucleus. The results exhibit well defined structure in the angular coefficients which correlates with structure in the fission probability for most of the nuclei studied. In an attempt to interpret this observed structure the experimentally determined fitting parameters Pf and g are compared with calculated results of a microscopic model. This model takes into consideration the penetrability and angular dependence of fission through each member of the various transition bands at the saddle point and appropriately sums the results for comparison with the data. The effects of barrier penetration through a two-peaked deformation potential are explored in this analysis. This survey of the fission properties of several nuclei indicates some general trends relating the saddle point deformation to the character of the transition level structure. (author)

  9. SU-E-J-244: Development and Validation of a Knowledge Based Planning Model for External Beam Radiation Therapy of Locally Advanced Non-Small Cell Lung Cancer

    International Nuclear Information System (INIS)

    Purpose: The study aims to develop and validate a knowledge based planning (KBP) model for external beam radiation therapy of locally advanced non-small cell lung cancer (LA-NSCLC). Methods: RapidPlan™ technology was used to develop a lung KBP model. Plans from 65 patients with LA-NSCLC were used to train the model. 25 patients were treated with VMAT, and the other patients were treated with IMRT. Organs-at-risk (OARs) included right lung, left lung, heart, esophagus, and spinal cord. DVH and geometric distribution DVH were extracted from the treated plans. The model was trained using principal component analysis and step-wise multiple regression. Box plot and regression plot tools were used to identify geometric outliers and dosimetry outliers and help fine-tune the model. The validation was performed by (a) comparing predicted DVH boundaries to actual DVHs of 63 patients and (b) using an independent set of treatment planning data. Results: 63 out of 65 plans were included in the final KBP model with PTV volume ranging from 102.5cc to 1450.2cc. Total treatment dose prescription varied from 50Gy to 70Gy based on institutional guidelines. One patient was excluded due to geometric outlier where 2.18cc of spinal cord was included in PTV. The other patient was excluded due to dosimetric outlier where the dose sparing to spinal cord was heavily enforced in the clinical plan. Target volume, OAR volume, OAR overlap volume percentage to target, and OAR out-of-field volume were included in the trained model. Lungs and heart had two principal component scores of GEDVH, whereas spinal cord and esophagus had three in the final model. Predicted DVH band (mean ±1 standard deviation) represented 66.2±3.6% of all DVHs. Conclusion: A KBP model was developed and validated for radiotherapy of LA-NSCLC in a commercial treatment planning system. The clinical implementation may improve the consistency of IMRT/VMAT planning

  10. Large-Scale Wind Turbine Testing in the NASA 24.4m (80) by 36.6m(120) Wind Tunnel

    Science.gov (United States)

    Zell, Peter T.; Imprexia, Cliff (Technical Monitor)

    2000-01-01

    The 80- by 120-Foot Wind Tunnel at NASA Ames Research Center in California provides a unique capability to test large-scale wind turbines under controlled conditions. This special capability is now available for domestic and foreign entities wishing to test large-scale wind turbines. The presentation will focus on facility capabilities to perform wind turbine tests and typical research objectives for this type of testing.

  11. SU-E-J-244: Development and Validation of a Knowledge Based Planning Model for External Beam Radiation Therapy of Locally Advanced Non-Small Cell Lung Cancer

    Energy Technology Data Exchange (ETDEWEB)

    Liu, Z; Kennedy, A [Sarah Cannon, Nashville, TN (United States); Larsen, E; Hayes, C; Grow, A [North Florida Cancer Center, Gainesville, FL (United States); Bahamondes, S.; Zheng, Y; Wu, X [JFK Comprehensive Cancer Institute, Lake Worth, FL (United States); Choi, M; Pai, S [Good Samaritan Hospital, Los Gatos, CA (United States); Li, J [Doctors Hospital of Augusta, Augusta, GA (United States); Cranford, K [Trident Medical Center, Charleston, SC (United States)

    2015-06-15

    Purpose: The study aims to develop and validate a knowledge based planning (KBP) model for external beam radiation therapy of locally advanced non-small cell lung cancer (LA-NSCLC). Methods: RapidPlan™ technology was used to develop a lung KBP model. Plans from 65 patients with LA-NSCLC were used to train the model. 25 patients were treated with VMAT, and the other patients were treated with IMRT. Organs-at-risk (OARs) included right lung, left lung, heart, esophagus, and spinal cord. DVH and geometric distribution DVH were extracted from the treated plans. The model was trained using principal component analysis and step-wise multiple regression. Box plot and regression plot tools were used to identify geometric outliers and dosimetry outliers and help fine-tune the model. The validation was performed by (a) comparing predicted DVH boundaries to actual DVHs of 63 patients and (b) using an independent set of treatment planning data. Results: 63 out of 65 plans were included in the final KBP model with PTV volume ranging from 102.5cc to 1450.2cc. Total treatment dose prescription varied from 50Gy to 70Gy based on institutional guidelines. One patient was excluded due to geometric outlier where 2.18cc of spinal cord was included in PTV. The other patient was excluded due to dosimetric outlier where the dose sparing to spinal cord was heavily enforced in the clinical plan. Target volume, OAR volume, OAR overlap volume percentage to target, and OAR out-of-field volume were included in the trained model. Lungs and heart had two principal component scores of GEDVH, whereas spinal cord and esophagus had three in the final model. Predicted DVH band (mean ±1 standard deviation) represented 66.2±3.6% of all DVHs. Conclusion: A KBP model was developed and validated for radiotherapy of LA-NSCLC in a commercial treatment planning system. The clinical implementation may improve the consistency of IMRT/VMAT planning.

  12. El control territorial de la administración ugarítica: el ‘catastro’ TU 4.244

    OpenAIRE

    Zamora, José-Ángel

    2003-01-01

    Estudio ugarítico, y de aspectos de la administración ugarítica que de él se deducen, haciendo uso de los instrumentos informáticos que el homenajeado, Jesús-Luis Cunchillos, proporcionó a la especialidad.

  13. Takotsubo cardiomyopathy associated with sepsis due to Pseudomonas aeruginosa pneumoniadoi: 10.12662/2317-3076jhbs.v3i4.169.p242-244.2015

    Directory of Open Access Journals (Sweden)

    Márcio da Silva Pereira

    2015-12-01

    Full Text Available The authors describe a case report of a 71 year-old female patient admitted at the emergency service due to severe precordial chest pain associated with dyspnea and sweating. The electrocardiogram performed on admission showed ST elevation on V2 and V3 leads and the ventriculography revealed left ventricular apical ballooning, denoting the diagnosis of Takotsubo Cardiomyopathy. At the eighth day of hospitalization, although the heart function was recovered, the patient died due the clinical complications of a septic shock.

  14. Distribution of sup 137 Cs, sup 90 Sr, sup 238 Pu, sup 239 Pu, sup 241 Am and sup 244 Cm in Pond B, Savannah River Site

    Energy Technology Data Exchange (ETDEWEB)

    Whicker, F.W. (Colorado State Univ., Fort Collins, CO (USA)); Pinder, J.E. III; Bowling, J.W. (Savannah River Ecology Lab., Aiken, SC (USA)); Alberts, J.J. (Georgia Univ., Sapelo Island, GA (USA). Marine Inst.); Brisbin, I.L. Jr. (Savannah River Ecology Lab., Aiken, SC (USA))

    1989-05-01

    The gradual senescence of present-day operating nuclear facilities, and resultant contamination of aquatic and terrestrial ecosystems, emphasize the importance of understanding the behavior of radionuclides in the environment. Observations and deductions concerning mechanisms of radionuclide transport can contribute significantly to knowledge of fundamental ecological processes. This study emphasized the ecosystem-level distribution of several long-lived radionuclides in an abandoned reactor cooling impoundment after a twenty year period of chemical and biological equilibration. 90 refs., 14 figs., 5 tabs.

  15. Phenotype and 244k array-CGH characterization of chromosome 13q deletions: an update of the phenotypic map of 13q21.1-qter

    DEFF Research Database (Denmark)

    Kirchhoff, Maria; Bisgaard, Anne-Marie; Stoeva, Radka;

    2009-01-01

    breakpoints in 14 patients with partial deletions of this region. Subsequently, we linked the genotype to the patient's phenotype. Using this approach, we were able to refine the smallest deletion region linked to short stature (13q31.3: 89.5-91.6 Mb), microcephaly (13q33.3-q34), cortical development...

  16. Radionuclides and radiation protection. Practical guide for radioactive substance handling in laboratories of low and intermediate level radioactivity

    International Nuclear Information System (INIS)

    This book is a practical guide, intended for radionuclide users, working in Industry, Research and Nuclear Medicine, in low and intermediate laboratories. About a hundred data cards about the main radionuclides used in these laboratories are presented (nuclear characteristics, radiotoxicity, external and internal exposure, external contamination of skin, protections from beta, gamma and X radiations, detection and contamination limits and maximum handling activity): TRITIUM, CARBON 11, CARBON 14, FLUORINE 18, SODIUM 22, SODIUM 24, PHOSPHORUS 32, PHOSPHORUS 33, SULFUR 35, CHLORINE 36, POTASSIUM 40, POTASSIUM 42, POTASSIUM 43, CALCIUM 45, SCANDIUM 47, CALCIUM 47, SCANDIUM 46, CHROMIUM 51, MANGANESE 52, MANGANESE 54, MANGANESE 56, IRON 52, IRON 55, IRON 59, COBALT 56, COBALT 57, COBALT 58, COBALT 60, NICKEL 63, NICKEL 65, COPPER 64, COPPER 67, ZINC 65, GALLIUM 66, GALLIUM 67, GALLIUM 68, ARSENIC 76, SELENIUM 75, BROMINE 77, BROMINE 82, KRYPTON 85, RUBIDIUM 86, STRONTIUM 85, STRONTIUM 89, STRONTIUM 90, YTTRIUM 90, ZIRCONIUM 95, MOLYBDENUM 99, TECHNETIUM 99, RUTHENIUM 103, RUTHENIUM 106, RHODIUM 103, RHODIUM 106, SILVER 110, SILVER 111, CADMIUM 109, INDIUM 111, INDIUM 115, TIN 125, ANTIMONY 122, ANTIMONY 124, ANTIMONY 126, TELLURIUM 123, TELLURIUM 132, IODINE 123, IODINE 12,; IODINE 131, CESIUM 131, CESIUM 134, XENON 133, BARIUM 137, BARIUM 140, CESIUM 137, LANTHANUM 140, CERIUM 139, CERIUM 141, CERIUM 143, PRASEODYMIUM 144, PRASEODYMIUM 143, PROMETHIUM 147, SAMARIUM 153, EUROPIUM 152, EUROPIUM 154, EUROPIUM 156, ERBIUM 169, YTTERBIUM 169, RHENIUM 186, RHENIUM 188, IRIDIUM 192, GOLD 198, MERCURY 197, MERCURY 203, THALLIUM 201, THALLIUM 204, LEAD 210, RADIUM 226, URANIUM 235, URANIUM 238, PLUTONIUM 239, AMERICIUM 241, CURIUM 244, CALIFORNIUM 252

  17. Sonochemical synthesis and characterization of a nano-sized Manganese (II) coordination polymer, [{Mn(NCS)2(4,4´-bipy)(H2O)2}(4,4´-bipy)]n; with 4,4'-Bipyridine (4,4'-bipy) ligand

    OpenAIRE

    N. Mosallanejad

    2014-01-01

    A novel nano – sized  manganese (II) coordination polymer, [{Mn(NCS)2(L)(H2O)2}(L)]n  , (1) (L- = 4,4'-Bipyridine), have been synthesized by a sonochemical process and characterized by scanning electron microscopy (SEM), X-ray diffraction (XRD), IR spectroscopy and elemental analysis.  Direct calcination of the single crystals and nano-sized compound 1 at 400 0C under air atmosphere yields mixture of K2Mn2 (SO4)3, MnOS and Mn3O4 nanoparticles. Results show that the size and morphology of the ...

  18. Sonochemical synthesis and characterization of a nano-sized Manganese (II coordination polymer, [{Mn(NCS2(4,4´-bipy(H2O2}(4,4´-bipy]n; with 4,4'-Bipyridine (4,4'-bipy ligand

    Directory of Open Access Journals (Sweden)

    N. Mosallanejad

    2014-05-01

    Full Text Available A novel nano – sized  manganese (II coordination polymer, [{Mn(NCS2(L(H2O2}(L]n  , (1 (L- = 4,4'-Bipyridine, have been synthesized by a sonochemical process and characterized by scanning electron microscopy (SEM, X-ray diffraction (XRD, IR spectroscopy and elemental analysis.  Direct calcination of the single crystals and nano-sized compound 1 at 400 0C under air atmosphere yields mixture of K2Mn2 (SO43, MnOS and Mn3O4 nanoparticles. Results show that the size and morphology of the K2Mn2 (SO43, MnOS, Mn3O4 nanoparticles depend on the particles size of compound 1. Decrease in the particles size of compound 1 leads to decrease in the particles size of the K2Mn2 (SO43, MnOS and Mn3O4.

  19. Multibeam collection for TN244: Multibeam data collected aboard Thomas G. Thompson from 2009-12-05 to 2009-12-08, departing from Seattle, WA and returning to Seattle, WA

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set is part of a larger set of data called the Multibeam Bathymetry Database (MBBDB) where other similar data can be found at...

  20. Evaluation of the TWRS S/RID for Additional Requirements Resulting from W-420 Stack Monitoring System Upgrades [for 241C and 244A and BX and CF and S and TX

    International Nuclear Information System (INIS)

    This document answers the question: ''Do Project W-420 Activities introduce the need to add new requirements to the TWRS S/RID?'' and documents that basis for the answer. It concludes that no additional S/RID requirements are necessary

  1. SU-E-J-244: Validation of a 6D-Robotic-Couch and Image Guidance Radiation Therapy (IGRT) System for Localization in World's First Single-Room Proton Therapy System

    International Nuclear Information System (INIS)

    Purpose: The Mevion S250 proton therapy unit is equipped with a 6D-robotic couch and IGRT system (Verity). The patient alignment process allows corrections in six degrees of freedom: translation (x,y,z), pitch, roll, and yaw (θ,ϑ,ψ). Geometric accuracy of couch corrections and imaging vs. radiation isocenter coincidence were quantified before clinical implementation. Methods: A commercial phantom with sixteen 2mm tungsten BBs was rigidly couch-mounted and imaged with CT. Seventeen rigid translations/rotations of known magnitude were digitally applied to the original CT image using commercial software, validated with Varian OBI system. For each altered image, phantom was mounted on robotic couch in original position, then Verity 2D:2D match (PA-LLAT) was performed using DRRs from altered images. Corrections were recorded and applied, phantom was imaged a second time and residual corrections recorded. Physical measurements verified that applied couch corrections coincided with both physical couch shifts/rotations and known CT image translations/rotations. Additionally, image vs. radiation isocenter coicidence was quantified over couch treatment angles (±90° from setup position) using radiochromic film and an image-guided couch star-shot. Posterior-anterior and left-lateral kV radiographs were taken before each beam was delivered to verify imaging/radiation isocentricity. Results: Verity suggested couch corrections and known CT shifts/rotations agreed within ±1mm (average: Δ lat=0.5mm; Δ vert=0.4mm; Δ long=0.3mm) and ± 0.4° (average: Δ pitch=0.24° Δ roll=0.01°; Δ yaw=0.10°). Physical couch measurements and Verity applied corrections agreed within ± 1mm (average: Δlat=0.5mm; Δvert=0.4mm; Δlong=0.2mm) and ±0.2° (average: Δpitch=0.03°; Δ roll=0.04°; Δ yaw=0.04°). The directionality of all translations and rotations were qualitatively verified. The image vs. radiation isocenter coincidence was <1mm and radiation-isocenter precision was <1mm over the 180° of couch motion, as indicated by film analysis. Conclusion: The Verity IGRT software and 6D-couch combination on the Mevion S250 was verified as accurate within 1mm and 0.5°. This complies with the TG-142 standards for a stereotactic radiotherapy IGRT system. Rob Cessac is employed as Product Manager for Mevion Medical Systems

  2. Beneficios no anticonceptivos de 0,02 mg de etinilestradiol/2 mg de acetato de clormadinona administrados en un régimen de 24+4 días

    Directory of Open Access Journals (Sweden)

    Hans Peter Zahradnik

    2011-01-01

    Full Text Available Objetivo: Demostrar la influencia sobre las molestias emocionales y físicas (beneficios no anticonceptivos experimentadas durante el primer año de uso de un anticonceptivo oral combinado (AOC que contiene 0,02 mg de etinilestradiol (EE y 2 mg de acetato de clormadinona (ACM administrado en un régimen de 24 + 4 días de placebo. Diseño del estudio: Análisis adicional de las sensaciones subjetivas registradas en los diarios de 1665 participantes de un estudio de Fase III multicéntrico, no controlado, de administración múltiple, después de 13 ciclos de EE/ACM en un régimen de administración de 24 + 4 días, publicado previamente. Resultados: Se informó de menor frecuencia de molestias emocionales y físicas en el ciclo de medicación 13 en comparación con los datos en la admisión y en el ciclo 1. La incidencia de ánimo depresivo se redujo en 84,5% y 72,2% respectivamente, y la irritabilidad en 87,3% y 66,0%. Las cefaleas se redujeron en 75,5% y 74,7%, las molestias mamarias en 77,1% y 66,1%, y la dismenorrea preexistente en 77,9% y 67,6% respectivamente. El abandono prematuro del estudio a causa de las molestias fue marginal, y el perfil del sangrado fue aceptable. Conclusiones: Un AOC de baja dosis que contiene 0,02 mg de EE + 2 mg de ACM, administrado en un régimen de 24 + 4 días, reduce significativamente la mayor parte de las molestias emocionales y físicas que se presentan durante los ciclos espontáneos de las mujeres, y se combina con un adecuado perfil de sangrado.Objective: To demonstrate the influence on physical and psychological complaints during the first year of intake of the combined oral contraceptive (COC 0.02 mg ethinylestradiol (EE/2 mg chlormadinone acetate (CMA, administered in a regimen of 24 days of CMA/EE intake followed by 4 days of placebo intake. Study design: The subjective feelings of non-contraceptive benefits registered in women's diaries of 1,665 subjects participating in a multicentre, uncontrolled, multiadministration, Phase III trial, published elsewhere, were analyzed post-hoc after 13 cycles intake of EE/CMA in a 24 +4 days intake regimen. Results: Emotional complaints were reported less frequently at medication cycle 13 compared with admission and cycle 1. Depressive mood was reduced by 84.5% and 72.2%, irritability by 87.3% and 66.0%; physical complaints were also reduced: headaches by 75.5% and 74.7%, breast discomfort by 77.1% and 66.1%; pre-existing dysmenorrhea by 77.9% and 67.6%. Premature termination due to complaints was only marginal, the bleeding profile was accepted. Conclusions: The low-dose COC, 0.02 mg EE/2 mg CMA, administered in a 24 +4 day regimen, reduces significantly most of the emotional and physical complaints occurring during spontaneous cycles of women, combined with an adequate bleeding profile.

  3. A change of in vivo characteristics depending on specific activity of radioiodinated (+)-2-[4-(4-iodophenyl)piperidino]cyclohexanol [(+)-pIV] as a ligand for sigma receptor imaging

    Energy Technology Data Exchange (ETDEWEB)

    Akhter, Nasima [Department of Biotracer Medicine, Kanazawa University, Kanazawa 920-8640, Ishikawa (Japan); Shiba, Kazuhiro [Division of Tracer Kinetics, Advanced Science Research Center, Kanazawa University, Kanazawa 920-8640, Ishikawa (Japan)], E-mail: shiba@med.kanazawa-u.ac.jp; Ogawa, Kazuma [Division of Tracer Kinetics, Advanced Science Research Center, Kanazawa University, Kanazawa 920-8640, Ishikawa (Japan); Tsuji, Shiro [School of Health Sciences, Kanazawa University, Kanazawa 920-8640, Ishikawa (Japan); Kinuya, Seigo; Nakajima, Kenichi [Department of Biotracer Medicine, Kanazawa University, Kanazawa 920-8640, Ishikawa (Japan); Mori, Hirofumi [Division of Tracer Kinetics, Advanced Science Research Center, Kanazawa University, Kanazawa 920-8640, Ishikawa (Japan)

    2008-01-15

    The radioiodinated (+)-p-iodovesamicol [(+)-pIV], which shows a high binding affinity for sigma-1 ({sigma}-1) receptors, is prepared by an exchange reaction. The specific activity (SA) is fairly low and therefore is insufficient for clinical use. In this study, we prepared (+)-[{sup 125}I]pIV with a high SA from tributylstannyl precursor and compared the in vivo characteristics between high and low SA by imaging {sigma}-1 receptors in the central nervous system. In the biodistribution study, a difference in brain accumulation was observed between the two methods. At 30 min postinjection, the brain accumulation (1.58%ID/g) of low SA [0.6-1.1 TBq/mmol (16-30 Ci/mmol)] (+)-[{sup 125}I]pIV was higher than that (1.34%ID/g) of high SA [>88.8 TBq/mmol (>2400 Ci/mmol)] (+)-[{sup 125}I]pIV. In the blocking study, the brain uptake of high SA (+)-[{sup 125}I]pIV was reduced more significantly by the coadministration of sigma ligands such as pentazocine, haloperidol or SA4503 than that of low SA (+)-[{sup 125}I]pIV. These results showed that nonspecific binding of high SA (+)-[{sup 125}I]pIV in the brain was lower than that of low SA (+)-[{sup 125}I]pIV, and high SA (+)-[{sup 125}I]pIV bound more specifically to {sigma}-1 receptors in the brain than low SA (+)-[{sup 125}I]pIV. In contrast, in the blood-binding study, high SA (+)-[{sup 125}I]pIV (58.4%) bound to blood cells with higher affinity than low SA (+)-[{sup 125}I]pIV (46.0%). In metabolite studies, blood metabolites of high SA (+)-[{sup 125}I]pIV (57.3{+-}3.5%) were higher than those of low SA (+)-[{sup 125}I]pIV (45.5{+-}4.1%) at 30 min postinjection. Higher SA may be apt to bind to blood cells with higher affinity and to be metabolized faster.

  4. Poly[[aqua(μ2-4,4′-bipyridine-κ2N:N′[μ3-3-bromo-2-(carboxylatomethylbenzoato-κ3O1:O1′:O2]cadmium] monohydrate

    Directory of Open Access Journals (Sweden)

    Yangmei Liu

    2012-08-01

    Full Text Available In the title compound, {[Cd(C9H5BrO4(C10H8N2(H2O]·H2O}n, the CdII atom has a distorted octahedral coordination geometry. Two N atoms from two 4,4′-bipyridine (bipy ligands occupy the axial positions, while the equatorial positions are furnished by three carboxylate O atoms from three 3-bromo-2-(carboxylatomethylbenzoate (bcb ligands and one O atom from a water molecule. The bipy and bcb ligands link the CdII atoms into a three-dimensional network. O—H...O hydrogen bonds and π–π interactions between the pyridine and benzene rings [centroid–centroid distance = 3.736 (4 Å] are present in the crystal.

  5. A new shipping container for an intense neutron emitter

    International Nuclear Information System (INIS)

    Californium-252 is an intense neutron emitter (2.34 x 1012 n/s·g) used in medicine, research, and industry. The western world's sole source of this rare radioisotope is the Californium Facility at Oak Ridge National Laboratory's Radiochemical Engineering Development Center (REDC). A project has been initiated at the REDC to design a new Type B Californium Shipping Container. This effort is essential for future transportation of californium to meet the needs of users all over the world. The shipping container must meet all requirements for transport by motor freight, air, vessel, and rail, both domestic and foreign. There are unique problems in the design, fabrication, and licensing of a new Type B shipping container that will accommodate up to 60 milligrams of californium-252. One of the first challenges in the design phase of the project is the selection of a material to shield the high neutron flux. The more stringent safety precautions of today's world impel us to consider more exotic materials for such a purpose. The candidate materials must be examined not just for their neutron shielding properties, but also in conjunction with other properties such as thermal and structural requirements to withstand the hypothetical accident conditions. The design and building of such a container is a formidable task requiring much planning. The licensing process, with the complex, interactive federal codes, is a special challenge and may be the biggest on the project in terms of time and money

  6. Application of Cf for the quantitative measurement of nuclear reactor fuel materials

    International Nuclear Information System (INIS)

    Sensitive and rapid measurements of the quantity and geometric distribution of nuclear reactor fuel materials can be made using neutrons from californium. The neutron-induced fission rate in these materials may be measured by detection of either prompt radiations from fission or delayed radiations from radioactive fission products. A number of californium-based instruments are presently in use by the nuclear industry for purposes of process control, quality control, nuclear materials safeguards, and environmentl assessment. An Automated Fuel Rod Scanner (AFRS) is used for high-speed measurement of the uniformity of loading and total fissile content of reactor fuel rods. The fuel rods are moved first through an irradiator containing about 1 mg of californium, and subsequently through high-efficiency detectors for the measurement of fission-product gamma-rays. Multiple detectors on each of two irradiation channels are used to reduce the californium source strength requirement. The fuel loading of each 15-mm-long pellet is tested to +-10% on 100% of the plant throughput. By summing the response over length, the total fissile material content of the fuel rod is measured to better than 0.5%. An on-line computer for data processing allows the instrument to measure about 150 rods per hour with a single operator. The same activation concept is used with a 25-μg californium source in a Small Sample Assay System (SSAS) which measures the fissile content of fuel pellet sized samples with a precision of 0.5%

  7. Application of PGNAA to preincineration assay of combustible waste for chlorine

    Energy Technology Data Exchange (ETDEWEB)

    Gehrke, R.J.; Pawelko, R.J.; Greenwood, R.C. [Idaho National Engineering Lab., Idaho Falls, ID (United States)

    1995-12-31

    A prompt gamma neutron activation analysis method is being developed for on-stream pre-incineration assay of low level radioactive combustible waste for it`s chlorine content. The assay system consists of three californium 252 sources and a germanium or scintillation gamma-ray spectrometer.

  8. Magnetic measurements of the transuranium elements. Progress report, January 1, 1984-December 31, 1984

    International Nuclear Information System (INIS)

    Measurements of the magnetic properties of dhcp californium-249 metal indicated the presence of three regions of differing magnetic character. Additional measurements are also reported. Magnetic moments and valence states of terbium in TbF3, BaTbO3, and TbO18 are discussed. Progress on high-field operation of the micro-magnetic susceptometer is reported

  9. Source storage and transfer cask: Users Guide

    International Nuclear Information System (INIS)

    The storage and shield cask for the dual californium source is designed to shield and transport up to 3.7 mg (2 Ci) of 252Cf. the cask meets Department of Transportation (DOT) license requirements for Type A materials (DOT-7A). The cask is designed to transfer sources to and from the Flourinel and Fuel Storage (FAST) facility delayed-neutron interrogator. Californium sources placed in the cask must be encapsulated in the SR-CF-100 package and attached to Teleflex cables. The cask contains two source locations. Each location contains a gear box that allows a Teleflex cable to be remotely moved by a hand crank into and out of the cask. This transfer procedure permits sources to be easily removed and inserted into the delayed-neutron interrogator and reduces personnel radiation exposure during transfer. The radiation dose rate with the maximum allowable quantity of californium (3.7 mg) in the cask is 30 mR/h at the surface and less than 2 mR/h 1 m from the cask surface. This manual contains information about the cask, californium sources, describes the method to ship the cask, and how to insert and remove sources from the cask. 28 figs

  10. Discovery of Isotopes of the Transuranium Elements with 93 <= Z <= 98

    OpenAIRE

    Fry, C; Thoennessen, M

    2012-01-01

    One hundred and five isotopes of the transuranium elements neptunium, plutonium, americium, curium, berkelium and californium have so far been observed; the discovery of these isotopes is discussed. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  11. Poly[(μ2-4,4′-bipyridine-κ2N:N′(μ2-2,2-dimethylcyclopentane-1,3-dicarboxylato-κ4O1,O1′:O3,O3′cadmium

    Directory of Open Access Journals (Sweden)

    Xian-Fa Zhang

    2011-11-01

    Full Text Available In the title polymeric compound, [Cd(C9H12O4(C10H8N2]n, the CdII atom is located on a twofold rotation axis and is coordinated by two 4,4′-bipyridine ligands and two 2,2-dimethylcyclopentane-1,3-dicarboxylate ions. The carboxylate ion and the N-heterocycle both function as bridges to link adjacent CdII atoms to result in the formation of a layer structure parallel to (010. The mid-point of the central C—C bond of the 4,4′-bipyridine ligand is located on an inversion center. In the crystal, the carboxylate ion is disordered over a twofold rotation axis in respect of its methyl group and the cyclopentane ring.

  12. Dicty_cDB: Contig-U10474-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available t = 1e-83 Identities = 244/244 (100%) Strand = Plus / Plus Query: 17 ctttcncatggggatatngnagctaaagntanaaaanatttatccna...|||| Sbjct: 17 ctttcncatggggatatngnagctaaagntanaaaanatttatccnatggnaaaaatnaa 76 Query: 77 aacccacntgcnnaacata...aattattnccccccatcnttagnctatccctaggnccnaaa 136 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| S...bjct: 77 aacccacntgcnnaacataaattattnccccccatcnttagnctatccctaggnccnaaa 136 Query: ...ngnagctaaagntanaaaanatttatccnatggnaaaaatnaa 76 ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||

  13. Oxidation of microquantities of transplutonium elements to tetravalent state in mineral acid solutions and their stability

    International Nuclear Information System (INIS)

    Kinetics of americium(3) microquantity oxidation and stability of forming americium(4), as well as possibility of curium and californium oxidation to tetravalent state in solutions of sulfuric and nitric acids depending on the concentration of mineral acid, potassium tungstophosphate and ammonium persulfate are studied by the extraction method. It is shown that curium(3) and californium(3) in solutions of 0.05-2.5 mol/l H2SO4 and HNO3 containing 10-3 mol/l potassium tungstophosphate is not practically oxidized by the mixture of silver nitrate and ammonium persulfate. Americium(3) is oxidized to the utmost to Am(4) for 2-3 min at room temperature, but stability of Am(4) depends on the concentration of sulfuric acid and potassium tungstophosphate

  14. Characterization of berkelium(III) dipicolinate and borate compounds in solution and the solid state.

    Science.gov (United States)

    Silver, Mark A; Cary, Samantha K; Johnson, Jason A; Baumbach, Ryan E; Arico, Alexandra A; Luckey, Morgan; Urban, Matthew; Wang, Jamie C; Polinski, Matthew J; Chemey, Alexander; Liu, Guokui; Chen, Kuan-Wen; Van Cleve, Shelley M; Marsh, Matthew L; Eaton, Teresa M; van de Burgt, Lambertus J; Gray, Ashley L; Hobart, David E; Hanson, Kenneth; Maron, Laurent; Gendron, Frédéric; Autschbach, Jochen; Speldrich, Manfred; Kögerler, Paul; Yang, Ping; Braley, Jenifer; Albrecht-Schmitt, Thomas E

    2016-08-26

    Berkelium is positioned at a crucial location in the actinide series between the inherently stable half-filled 5f(7) configuration of curium and the abrupt transition in chemical behavior created by the onset of a metastable divalent state that starts at californium. However, the mere 320-day half-life of berkelium's only available isotope, (249)Bk, has hindered in-depth studies of the element's coordination chemistry. Herein, we report the synthesis and detailed solid-state and solution-phase characterization of a berkelium coordination complex, Bk(III)tris(dipicolinate), as well as a chemically distinct Bk(III) borate material for comparison. We demonstrate that berkelium's complexation is analogous to that of californium. However, from a range of spectroscopic techniques and quantum mechanical calculations, it is clear that spin-orbit coupling contributes significantly to berkelium's multiconfigurational ground state. PMID:27563098

  15. Neutron activation determination of gold in technogenic raw materials with different mineral composition

    OpenAIRE

    Yudakov Aleksandr A.; Ivannikov Sergey I.; Zheleznov Veniamin V.; Taskin Andrei V.; Tsybulskaya Oksana N.

    2015-01-01

    The methods used to determine the gold content in the technogenic objects of gold mining were analyzed regarding their non-homogeneity and complexity of chemical and mineral compositions. A possible application of the neutron activation analysis with the use of the californium source of neutrons for determining the content of fine-grained and extra-fine-grained gold in the technogenic objects, including the bottom-ash waste of energy providers, is considere...

  16. Jak bylo objeveno spontánní štěpení

    Czech Academy of Sciences Publication Activity Database

    Vobecký, Miloslav

    Praha: Spektroskopická společnost J.M. Marci, 2010 - (Vobecký, M.), s. 5-10 ISBN 978-80-904539-0-6. [Seminář Radioanalytické metody IAA 10. Praha (CZ), 30.06.2010-01.07.2010] Institutional research plan: CEZ:AV0Z40310501 Keywords : spontaneous fission * fission -track dating method * californium 252 neutron source Subject RIV: CB - Analytical Chemistry, Separation

  17. Study of heavy particle decay from superheavy elements by SK model

    International Nuclear Information System (INIS)

    Heavy nuclei usually decay by alpha decay or spontaneous fission. These two decay modes are generally the most probable competing processes. Another less probable decay process is cluster radioactivity in which nuclei from carbon to silicon are emitted from Radium to Californium leading to the most stable daughter nucleus, lead. This work reports such a study using the cubic plus Yukawa plus exponential model of Shanmugam and Kamalaharan (SK)

  18. Measurement of the energy spectra of fission fragments using nuclear track detectors and digital image processing

    International Nuclear Information System (INIS)

    Energy spectra of fission fragments were determined using a Nuclear Track Methodology (NTM) supported by digital image analysis and numerical data processing using a standard personal computer. The analysis of a californium (252Cf) spectrum with this approach shows improvement compared with the values reported previously using the standard procedure, in terms of resolution and accuracy. This new method adds full automation to the technical advantages and cost effectiveness of an NTM.

  19. Heavy ion tests on programmable VLSI

    International Nuclear Information System (INIS)

    The radiation from space environment induces operation damages in onboard computers systems. The definition of a strategy, for the Very Large Scale Integrated Circuitry (VLSI) qualification and choice, is needed. The 'upset' phenomena is known to be the most critical integrated circuit radiation effect. The strategies for testing integrated circuits are reviewed. A method and a test device were developed and applied to space applications candidate circuits. Cyclotron, synchrotron and Californium source experiments were carried out

  20. Properties of neutron sources

    International Nuclear Information System (INIS)

    The Conference presentations were divided into sessions devoted to the following topics: white neutron sources, primarily pulsed (6 papers); fast neutron fields (5 papers); Californium-252 prompt fission neutron spectra (14 papers); monoenergetic sources and filtered beams (11 papers); 14 MeV neutron sources (10 papers); selected special application (one paper); and a general interest session (4 papers). Individual abstracts were prepared separately for the papers

  1. Neutron multiplicities for the transplutonium nuclides

    International Nuclear Information System (INIS)

    This paper continues, with respect to the transplutonium nuclides, earlier efforts to collate and evaluate data from the scientific literature on the prompt neutron multiplicity distribution from fission and its first moment = ΣnuPnu. The isotopes considered here for which P/sub nu/ and or data (or both) were found in the literature are of americium (Am), curium (Cm), berkelium (Bk), californium (Cf), einsteinium (Es), fermium (Fm), and nobelium (No)

  2. Dependence of metal partition coefficients in D2EHPA capacity on extraction from acid solutions

    International Nuclear Information System (INIS)

    In devising solvent-extraction schemes for extracting the transplutonium elements (TPE), one usually employs the partition coefficients K/sub p/ for trace amounts; when the results are transferred to weighable amounts of the elements, there are difficulties because one lacks capacity characteristics for the extractants under the conditions used. They have determined the capacity of D2EHPA over a wide range in acidity (0.001-2 mole/liter) in relation to dysprosium (the analog of californium) in the system formed by D2EHPA with nitric acid by saturating a set volume of the extractant with dysprosium in nitric acid containing the necessary amount of free acid

  3. TOWARD AN IMPROVED UNDERSTANDING OF STRUCTURE AND MAGNETISM IN NEPTUNIUM AND PLUTONIUM PHOSPHONATES AND SULFONATES

    Energy Technology Data Exchange (ETDEWEB)

    Albrecht-Schmitt, Thomas

    2012-03-01

    This grant supported the exploratory synthesis of new actinide materials with all of the actinides from thorium to californium with the exceptions of protactinium and berkelium. We developed detailed structure-property relationships that allowed for the identification of novel materials with selective ion-exchange, selective oxidation, and long-range magnetic ordering. We found novel bonding motifs and identified periodic trends across the actinide series. We identified structural building units that would lead to desired structural features and novel topologies. We also characterized many different spectroscopic trends across the actinide series. The grant support the preparation of approximately 1200 new compounds all of which were structurally characterized.

  4. NONDESTRUCTIVE IDENTIFICATION OF CHEMICAL WARFARE AGENTS AND EXPLOSIVES BY NEUTRON GENERATOR-DRIVEN PGNAA

    International Nuclear Information System (INIS)

    Prompt gamma-ray neutron activation analysis (PGNAA) is now a proven method for the identification of chemical warfare agents and explosives in military projectiles and storage containers. Idaho National Laboratory is developing a next-generation PGNAA instrument based on the new Ortec Detective mechanically-cooled HPGe detector and a neutron generator. In this paper we review PGNAA analysis of suspect chemical warfare munitions, and we discuss the advantages and disadvantages of replacing the californium-252 radioisotopic neutron source with a compact accelerator neutron generator

  5. NONDESTRUCTIVE IDENTIFICATION OF CHEMICAL WARFARE AGENTS AND EXPLOSIVES BY NEUTRON GENERATOR-DRIVEN PGNAA

    Energy Technology Data Exchange (ETDEWEB)

    T. R. Twomey; A. J. Caffrey; D. L. Chichester

    2007-02-01

    Prompt gamma-ray neutron activation analysis (PGNAA) is now a proven method for the identification of chemical warfare agents and explosives in military projectiles and storage containers. Idaho National Laboratory is developing a next-generation PGNAA instrument based on the new Ortec Detective mechanically-cooled HPGe detector and a neutron generator. In this paper we review PGNAA analysis of suspect chemical warfare munitions, and we discuss the advantages and disadvantages of replacing the californium-252 radioisotopic neutron source with a compact accelerator neutron generator.

  6. Composition containing transuranic elements for use in the homeopathic treatment of aids

    International Nuclear Information System (INIS)

    A homeopathic remedy consisting of a composition containing one or more transuranic elements, particularly plutonium, for preventing and treating acquired immunodeficiency syndrome (AIDS) in humans, as well as seropositivity for human immunodeficiency virus (HIV). Said composition is characterized in that it uses any chemical or isotopic form of one or more transuranic elements (neptunium, plutonium, americium, curium, berkelium, californium or einsteinium), particularly plutonium, said form being diluted and dynamized according to conventional homeopathic methods, particularly the so-called Hahnemann and Korsakov methods, and provided preferably but not exclusively in the form of lactose and/or saccharose globules or granules impregnated with the active principle of said composition. (author)

  7. Neutron nondestructive essay of the plutonium metal parts

    International Nuclear Information System (INIS)

    Based on the principle of neutron multiplicity and data unfolding mathematics, this paper developed the software which can execute the neutron multiplicity analysis, neutron attenuation analysis, parameter calibration, Pu mass solution with the neutron pulse sequence acquisition method. The measurement system consisted of detector,nuclear electronic apparatus, pulsed sequence acquisition and analysis software was tested and calibrated by californium source. Three mental plutonium components with different mass were used for experimental assay and validation, which showed that the assay bias was within 15% against the nominal value of the samples. (authors)

  8. Physical-chemical studies of transuranium elements. Progress report, April 1, 1982-March 31, 1983

    International Nuclear Information System (INIS)

    Progress is reported on the following topics: electrochemical and spectroscopic studies of less-stable higher oxidation states of transuranium elements in complexing aqueous media; spectroscopic and electrochemical studies of selected lanthanides and actinides in molten dimethyl sulfone; spectroelectronchemical studies of the Ce(IV)/Ce(III) couple in aqueous carbonate solutions; characterization of actinide orthophosphates by Raman and absorption spectrophotometries and by x-ray diffraction; relativistic multiple scattering calculations on transuranium element compounds; Raman spectroscopic studies of natural minerals containing the uranyl ion; and solution calorimetry of californium metal

  9. Detection of rare earth elements in Powder River Basin sub-bituminous coal ash using laser-induced breakdown spectroscopy (LIBS)

    Energy Technology Data Exchange (ETDEWEB)

    Tran, Phuoc [National Energy Technology Lab. (NETL), Pittsburgh, PA, (United State; Mcintyre, Dustin [National Energy Technology Lab. (NETL), Pittsburgh, PA, (United State

    2015-10-01

    We reported our preliminary results on the use of laser-induced breakdown spectroscopy to analyze the rare earth elements contained in ash samples from Powder River Basin sub-bituminous coal (PRB-coal). We have identified many elements in the lanthanide series (cerium, europium, holmium, lanthanum, lutetium, praseodymium, promethium, samarium, terbium, ytterbium) and some elements in the actinide series (actinium, thorium, uranium, plutonium, berkelium, californium) in the ash samples. In addition, various metals were also seen to present in the ash samples

  10. Study by thermochromatography of fluorides of transuranium elements

    International Nuclear Information System (INIS)

    Thermochromatography was made suitable for fluoride study. So, an investigation of actinide tetrafluorides was accomplished from uranium to californium. Pentavalent and hexavalent fluorospecies of uranium, neptunium, plutonium and ruthenium were studied. Some new compounds have been identified in gaseous phase, whose: PuF5, PuOF3 and PaOF3. Furthermore, some presomptions as for the existence in gaseous phase of EsF4 and of an heptavalent fluorospecies of plutonium have been established. An important analogy between plutonium and ruthenium behaviour with fluorine have been shown, these results could explain the difficulties encountered in the fluoride-volatility processes

  11. PROCEEDINGS OF THE SYMPOSIUM COMMEMORATING THE 25th ANNIVERSARY OF ELEMENTS 97 and 98 HELD ON JAN. 20, 1975

    Energy Technology Data Exchange (ETDEWEB)

    Seaborg, Glenn T.; Street Jr., Kenneth; Thompson, Stanley G.; Ghiorso, Albert

    1976-07-01

    This volume includes the talks given on January 20, 1975, at a symposium in Berkeley on the occasion of the celebration of the 25th anniversary of the discovery of berkelium and californium. Talks were given at this symposium by the four people involved in the discovery of these elements and by a number of people who have made significant contributions in the intervening years to the investigation of their nuclear and chemical properties. The papers are being published here, without editing, in the form in which they were submitted by the authors in the months following the anniversary symposium, and they reflect rather faithfully the remarks made on that occasion.

  12. Method for measuring multiple scattering corrections between liquid scintillators

    Science.gov (United States)

    Verbeke, J. M.; Glenn, A. M.; Keefer, G. J.; Wurtz, R. E.

    2016-07-01

    A time-of-flight method is proposed to experimentally quantify the fractions of neutrons scattering between scintillators. An array of scintillators is characterized in terms of crosstalk with this method by measuring a californium source, for different neutron energy thresholds. The spectral information recorded by the scintillators can be used to estimate the fractions of neutrons multiple scattering. With the help of a correction to Feynman's point model theory to account for multiple scattering, these fractions can in turn improve the mass reconstruction of fissile materials under investigation.

  13. Surface fission tracks in diamond

    International Nuclear Information System (INIS)

    Scanning Probe Microscope (SPM) images reveal important fingerprint features of latent tracks induced in diamond by fission fragments from a californium source. Collimated fission fragments with a binary distribution of the predominant energies of 79.4 and 103.8 MeV, are assumed. Cavities, reticular formations around these cavities, and black spots of graphite were found. A brief discussion on the possible track formation mechanism is given on the basis of the explosion spike theory; an attempt to determine latent track core and halo parameters is included

  14. Use of trioctylphosphine oxide for transplutonium element extraction and purification

    International Nuclear Information System (INIS)

    Investigated was extraction of tri-valent curium, berkelium, californium, einsteinium as well as cerium and europium with trioctylphosphin oxide from lactic acid solutions, containing DTPA and aluminium nitrate depending on the aluminium nitrate and TOPO concentrations and nitric acid solutions of variable concentration as well. Under optimum conditions of extraction chromatography of berkelium studied was the distribution of cobalt, nickel, chromium, iron, aluminium, titanium, zirconium and niobium ions, and the coefficients of berkelium purification from cations investigated were determined. The effect of weight quantities of cation impurities on extraction chromatographic yield of berkelium has been investigated. Examples of practice application of the extraction chromatography with the use of TOPO are given

  15. Drug: D01888 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D01888 Drug Safrazine hydrochloride (JAN) C11H16N2O2. HCl 244.0979 244.7179 D01888.gif Antidepressant withdr...awal drug monoamine oxidase (MAO) inhibitor [HSA:4128 4129] [KO:K00274] hsa00260(41

  16. Applications of Text Analysis Tools for Spoken Response Grading

    Science.gov (United States)

    Crossley, Scott; McNamara, Danielle

    2013-01-01

    This study explores the potential for automated indices related to speech delivery, language use, and topic development to model human judgments of TOEFL speaking proficiency in second language (L2) speech samples. For this study, 244 transcribed TOEFL speech samples taken from 244 L2 learners were analyzed using automated indices taken from…

  17. Unigene BLAST: CBRC-CELE-05-0630 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CELE-05-0630 gnl|UG|Cel#S5720508 Caenorhabditis elegans Serpentine Receptor, c...lass H family member (srh-244) (srh-244) mRNA, complete cds /cds=p(1,1011) /gb=NM_072471 /gi=17557561 /ug=Cel.25680 /len=1011 8e-48 34% ...

  18. ARL Academic Health Sciences Library Statistics 2006-2007

    Science.gov (United States)

    Kyrillidou, Martha, Comp.; Bland, Les, Comp.

    2008-01-01

    This document presents data that describe collections, expenditures, personnel, and services in 65 medical libraries at Association of Research Libraries (ARL) member institutions throughout North America. In 2006-2007, the reporting health sciences libraries held a median of 244,188 volumes, spent a total of $244,188,020, and employed 2,395 FTE…

  19. 76 FR 4823 - Hazardous Waste Management System; Identifying and Listing Hazardous Waste Exclusion

    Science.gov (United States)

    2011-01-27

    ...), in Owosso, Michigan to exclude (or ``delist'') up to 244 cubic yards of wastewater treatment sludge... petitioned EPA to exclude an annual volume of 244 cubic yards of F006 wastewater treatment sludges generated....31. OGAI generates this wastewater treatment sludge from spent solutions that were used for...

  20. Pediatric Palliative Care: A Personal Story

    Medline Plus

    Full Text Available ... 4,244,244 views 1:09:38 Phoebe's Cancer Story - Duration: 7:46. Family A-Fair 621, ... 3:02 Pediatric Palliative Care: helping children with cancer survive and thrive - Duration: 3:29. American Cancer ...

  1. The Road to Market Society

    DEFF Research Database (Denmark)

    Christiansen, Christian O.; Cockburn, Patrick Joseph

    2014-01-01

    Book review of Michael J. Sandel, What Money Can't Buy: The Moral Limits of Markets. London: Penguin Group, 2012, 244 pp., $16.46. ISBN 9781846144714 (hbk).......Book review of Michael J. Sandel, What Money Can't Buy: The Moral Limits of Markets. London: Penguin Group, 2012, 244 pp., $16.46. ISBN 9781846144714 (hbk)....

  2. Monte Carlo aided enhanced design of an neutron scatterometer

    International Nuclear Information System (INIS)

    This paper will present a particular example for the use of the Monte Carlo Method to enhance the performance of a neutron scatterometer, currently employed to detect the void fraction in fast-transient high-pressure water-vapour flow in a rod-bundle channel. The scatterometer relies on measuring the slowing-down of californium-252 neutrons by the hydrogen in the water to determine the liquid, hence vapour (void) content. However, californium-252 is a relatively fast-decaying source and alternative isotopic sources are typically too energetic to provide sufficient moderation given the small amount of liquid in the channel. Monte Carlo simulation were utilized to examine various design enhancement possibilities, including: filtering out unthermalized fast neutrons, amplifying by a fissionable material the amount of detected thermal neutrons, adding a dissolvable contrast material to the liquid phase, or relying on the scattering of fast neutrons by oxygen in water. In addition, methods to determine the distribution of the pattern of liquid-vapour phase in the channel are devised

  3. Transformation of Triclosan by Trametes versicolor and Pycnoporus cinnabarinus

    OpenAIRE

    Hundt, Kai; Martin, Dierk; Hammer, Elke; Jonas, Ulrike; Kindermann, Markus Karl; Schauer, Frieder

    2000-01-01

    We investigated the ability of Trametes versicolor and Pycnoporous cinnabarinus to metabolize triclosan. T. versicolor produced three metabolites, 2-O-(2,4,4′-trichlorodiphenyl ether)-β-d-xylopyranoside, 2-O-(2,4,4′-trichlorodiphenyl ether)-β-d-glucopyranoside, and 2,4-dichlorophenol. P. cinnabarinus converted triclosan to 2,4,4′-trichloro-2′-methoxydiphenyl ether and the glucoside conjugate known from T. versicolor. The conjugates showed a distinctly lower cytotoxic and microbicidal activity...

  4. Komisjoni kiuste avaldas Holland valimistulemuse / Arko Olesk

    Index Scriptorium Estoniae

    Olesk, Arko, 1981-

    2004-01-01

    Euroopa Komisjoni keelule ja karistusähvardusele vaatamata avaldasid Hollandi võimud europarlamendi valimiste tulemused, mille kohaselt said valitsevad kristlikud demokraadid 24,4 protsenti ja opositsioonilised sotsiaaldemokraadid 23,6 protsenti häältest

  5. AcEST: DK946138 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU02A01NGRL0011_J16 568 Adiantum capillus-veneris mRNA. clone: YMU02A01NGRL0011_J16. 5' end seq ... NVFIRKVKILKAPKFDIGKLMEVHGDYSEDVGVKL 243 Query: 543 ERP ... 551 +RP Sbjct: 244 DRP 246 >sp|Q42262|RS3A2_ARATH ... VFIRKVKILKAPKFDLGKLMEVHGDYTAEDVGVK 243 Query: 540 VERP ... 551 V+RP Sbjct: 244 VDRP 247 >sp|P33444|RS3A_CATRO ... NVFIRKVKILKAPKFDLGKLMEVHGDYNEDIGTKL 243 Query: 543 ERP ... 551 +RP Sbjct: 244 DRP 246 >sp|Q9CAV0|RS3A1_ARATH ... VFIRKVKILKAPKFDLGKLMDVHGDYSAEDVGVK 243 Query: 540 VERP ... 551 V+RP Sbjct: 244 VDRP 247 >sp|P49397|RS3A_ORYSJ ...

  6. Dicty_cDB: Contig-U00892-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 124 ggattattttaaagaattaaagagatatatatatttncttcatctcttttcaaccaataa 183 Query: 184 attgncaaatgaaaatgtgttaccna...|||||||||||||||| Sbjct: 184 attgncaaatgaaaatgtgttaccnataactcaaaactaaataataatattcnactttgc 243 Query: 244 naaa...aacc 303 Query: 304 cnattttaatggctgncctcccnagcttcnaactantgcttgatattatttananataaa 363 |||||||||||||||||||||||...||||||||||||||||||||||||||||||||||||| Sbjct: 304 cnattttaatggctgncctcccnagcttcnaactantgcttgatattatttananataa...Query: 184 attgncaaatgaaaatgtgttaccnataactcaaaactaaataataatattcnactttgc 243 ||||||||||||||||||||||||||||||||

  7. Characterization of a Novel Radiation-Induced Sarcoma Cell Line

    Czech Academy of Sciences Publication Activity Database

    Lang, J.; Zhu, W.Z.; Nokes, B.; Sheth, S.G.; Novák, Petr; Fuchs, L.; Watts, G.; Futscher, B. W.; Mineyev, N.; Ring, A.

    2015-01-01

    Roč. 111, č. 6 (2015), s. 669-682. ISSN 0022-4790 Institutional support: RVO:60077344 Keywords : Sarcoma * radiation-induced * breast * cancer Subject RIV: FD - Oncology ; Hematology Impact factor: 3.244, year: 2014

  8. Crystallization and preliminary X-ray diffraction studies of infectious bronchitis virus nonstructural protein 9

    OpenAIRE

    Ma, Yanlin; Chen, Cheng; Wei, Lei; Yang, Qingzhu; Liao, Ming; Li, Xuemei

    2010-01-01

    The gene segment encoding avian infectious bronchitis virus nonstructural protein 9 has been cloned and expressed in Escherichia coli. The protein has been crystallized and the crystals diffracted X-rays to 2.44 Å resolution.

  9. Zwischen Gewalt und Toleranz. Die unsichere Existenz der Brüderunität im spätmittelalterlichen Böhmen

    Czech Academy of Sciences Publication Activity Database

    Hlaváček, Petr

    Leipzig: Evangelische Verlagsanstalt, 2014 - (Plasger, G.; Stobbe, H.), s. 237-244 ISBN 978-3-374-03923-4 Institutional support: RVO:67985955 Keywords : Middle Ages * Bohemia * tolerance * violence Subject RIV: AB - History

  10. Structure of filamin A immunoglobulin-like repeat 10 from Homo sapiens

    OpenAIRE

    Page, Richard C; Clark, Jeffrey G.; Misra, Saurav

    2011-01-01

    The structure of immunoglobulin-like repeat 10 from human filamin A solved at 2.44 Å resolution suggests the potential effects of mutations correlated with otopalatodigital syndrome spectrum disorders.

  11. Cestopisné črty v časopisu Poutník

    Czech Academy of Sciences Publication Activity Database

    Vítová, Andrea

    Olomouc: Univerzita Palackého v Olomouci, 2015 - (Hrabal, J.), s. 79-89 ISBN 978-80-244-4876-3 Institutional support: RVO:68378068 Keywords : Czech literature * Travelogue Subject RIV: AJ - Letters, Mass-media, Audiovision

  12. Uranium hydrothermal deposits

    Czech Academy of Sciences Publication Activity Database

    René, Miloš

    New York : Nova Science Publishers, 2012 - (Vasiliev, A.; Sidorov, M.), s. 211-244 ISBN 978-1-62081-207-5 Institutional research plan: CEZ:AV0Z30460519 Keywords : uranium * hydrothermal deposits * uraninite Subject RIV: DB - Geology ; Mineralogy

  13. František Lýsek a lidová píseň

    Czech Academy of Sciences Publication Activity Database

    Toncrová, Marta

    Olomouc: Univerzita Palackého, 2003, s. 47-53. ISBN 80-244-0773-6 Institutional research plan: CEZ:AV0Z9058907 Keywords : folk song * collector * Moravia Subject RIV: AC - Archeology, Anthropology, Ethnology

  14. Německý Mácha, Óda na radost a krize evropské vize

    Czech Academy of Sciences Publication Activity Database

    Pokorný, Martin Z.

    2013-01-01

    Roč. 31, 97-98 (2013), s. 244-251. ISSN 0862-7045 Institutional support: RVO:67985955 Keywords : K. H. Mácha * F. Schiller * A. Mozart * Enlightenment * romanticism Subject RIV: AA - Philosophy ; Religion

  15. Partial genetic characterization of Sedlec virus (Orthobunyavirus, Bunyaviridae)

    Czech Academy of Sciences Publication Activity Database

    Bakonyi, T.; Kolodziejek, J.; Rudolf, Ivo; Berčič, R.; Nowotny, N.; Hubálek, Zdeněk

    2013-01-01

    Roč. 19, October (2013), s. 244-249. ISSN 1567-1348 Institutional support: RVO:68081766 Keywords : Sedlec virus * Leanyer virus * Simbu group * Orthobunyavirus * Acrocephalus Subject RIV: EE - Microbiology, Virology Impact factor: 3.264, year: 2013

  16. K pojmu psychospirituální krize

    Czech Academy of Sciences Publication Activity Database

    Říčan, Pavel

    2012-01-01

    Roč. 56, č. 2 (2012), s. 194-196. ISSN 0009-062X Institutional support: RVO:68081740 Keywords : psychospiritual crisis * spirituality * transpersonal psychology Subject RIV: AN - Psychology Impact factor: 0.244, year: 2012

  17. Miroslav Masák

    Czech Academy of Sciences Publication Activity Database

    Švácha, Rostislav

    [Řevnice]: Arbor vitae, 2012 - (Švácha, R.), s. 244-247 ISBN 978-80-87164-87-7 Institutional support: RVO:68378033 Keywords : architecture * postwar architecture * Liberec Subject RIV: AL - Art, Architecture, Cultural Heritage

  18. Application of Cappilary and Free-Flow Zone Electrophoresis and Isotachophoresis to Analytical and Preparative Separations of Synthetic Peptides

    Czech Academy of Sciences Publication Activity Database

    Kašička, Václav; Prusík, Zdeněk; Barth, Tomislav; Weber, G.; Wagner, H.

    Hamburg : Gesselschaft Deutscher Chemiker (Arbeitskreis Chromatographie), 1993, s. 244. [International Symposium on Column Liquid Chromatography /17./. Hamburg (DB), 09.05.1993-14.05.1993] R&D Projects: GA AV ČR IA45511

  19. Yersinia outer proteins E, H, P, and T differentially target the cytoskeleton and inhibit phagocytic capacity of dendritic cells

    Czech Academy of Sciences Publication Activity Database

    Adkins, Irena; Köberle, M.; Gröbner, S.; Bohn, E.; Autenrieth, I. B.; Borgmann, S.

    2007-01-01

    Roč. 297, - (2007), s. 235-244. ISSN 1438-4221 Institutional research plan: CEZ:AV0Z50200510 Keywords : yersinia * yops * dendritic cells Subject RIV: EC - Immunology Impact factor: 2.524, year: 2007

  20. 40 CFR Appendix D to Part 132 - Great Lakes Water Quality Initiative Methodology for the Development of Wildlife Criteria

    Science.gov (United States)

    2010-07-01

    ... substance which, if not exceeded, should better protect the taxon in question. E. “Tier I wildlife criterion.... American Journal of Physiology. 244:601-606. C. Nagy, K.A. 1987. Field Metabolic Rate and Food...

  1. QTL Information Table: 1009 [Q-TARO

    Lifescience Database Archive (English)

    Full Text Available onomic importance in a recombinant inbred population derived from a subspecific rice cross. TAG Theoretical and Applied Genetics 92, 230-244. http://dx.doi.org/10.1007/s001220050118 ...

  2. Výzkumy zaměřené na cizince v České republice po roce 1989

    Czech Academy of Sciences Publication Activity Database

    Vojtková, Michaela

    2010-01-01

    Roč. 52, č. 4 (2010), s. 230-244. ISSN 0011-8265 Institutional research plan: CEZ:AV0Z70280505 Keywords : Foreigners in the Czech Republic * sociological surveys * international migration Subject RIV: AO - Sociology, Demography

  3. Czech Codifications in the High Middle Ages

    Czech Academy of Sciences Publication Activity Database

    Krafl, Pavel

    Firenze : Firenze University Press, 2014 - (Maffei, P.; Varanini, G.), s. 237-244 ISBN 978-88-6655-632-9 Institutional support: RVO:67985963 Keywords : Bohemia * legal history * codification * High Middle Ages Subject RIV: AB - History

  4. Politische und kirchliche Kontexte der Entstehung des päpstlichen Kollegiums Nepomucenum im Jahre 1929

    Czech Academy of Sciences Publication Activity Database

    Šebek, Jaroslav

    Olomouc : Univerzita Palackého v Olomouci, 2011, s. 107-125 ISBN 978-80-244-2644-0 Institutional support: RVO:67985963 Keywords : religious situation * history * College Nepomucenum Subject RIV: AB - History

  5. K narativnímu pojetí autobiografické paměti: výzkumné možnosti metody čáry života

    Czech Academy of Sciences Publication Activity Database

    Vlčková, Irena; Blatný, Marek

    Olomouc: Univerzita Palackého v Olomouci, 2005, s. 183-199. ISBN 80-244-1159-8 Institutional research plan: CEZ:AV0Z70250504 Keywords : Autobiographical memory * narrative psychology Subject RIV: AN - Psychology

  6. 76 FR 68221 - Notice of Intent To Award-Grant Awards for the Provision of Civil Legal Services to Eligible Low...

    Science.gov (United States)

    2011-11-03

    ... of funding availability on March 30, 2011 (76 FR 17711), and Grant Renewal applications due beginning... Assistance, Inc. Delaware DE-1 Legal Services 686,244 Corporation of Delaware, Inc. MDE Legal Aid Bureau,...

  7. Leaf trace element spectrum in woody plants in south Spain.

    OpenAIRE

    Marañón, Teodoro; Domínguez, María Teresa; Aponte, Cristina; Murillo Carpio, José Manuel; Luis V. García; Villar Montero, Rafael

    2009-01-01

    Poster presentation nº 244. 6th International Symposium on Ecosystem Behaviour BIOGEOMON 2009, 29 June-3 July 2009. The University of Helsinki, Finland. Session 9: Trace element biogeochemistry and ecosystem impact.

  8. Literatura cestopisu zbavená

    Czech Academy of Sciences Publication Activity Database

    Šidák, Pavel

    Olomouc : Univerzita Palackého v Olomouci, 2015 - (Hrabal, J.), s. 29-39 ISBN 978-80-244-4876-3 Institutional support: RVO:68378068 Keywords : Czech literature * Travelogue Subject RIV: AJ - Letters, Mass-media, Audiovision

  9. Drug: D08088 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D08088 Drug Isoaminile (INN); Peracon (TN) C16H24N2 244.1939 244.3752 D08088.gif Antitussive ATC ... assification [BR:br08303] R RESPIRATORY SYSTEM R05 COUGH ... AND COLD PREPARATIONS R05D COUGH ... SUPPRESSANTS, EXC ... L. COMBINATIONS WITH EXPECTORANTS R05DB Other cough ... suppressants R05DB04 Isoaminile D08088 Isoaminile ...

  10. AcEST: BP911471 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000005_D01 583 Adiantum capillus-veneris mRNA. clone: YMU001_000005_D01. BP911471 CL520Co ... GLAVGRSSTDDYLLGKPVEEKKGDDDVTKAAGA-------PGALFVEEKPQSAND TWRK 244 G + D+YLLG+P+++ + K AG PG++F S D K Sbjct: ... GLAVGRSSTDDYLLGKPVEEKKGDDDVTKAAGA-------PGALFVEEKPQSAND TWRK 244 G + D+YLLG+P+++ + + AG PG++F S D K Sbjct: ...

  11. Neutron radiography for nondestructive testing

    International Nuclear Information System (INIS)

    Neutron radiography is similar to X-ray inspection in that both depend upon use of radiation that penetrates some materials and is absorbed by others to provide a contrast image of conditions not readily available for visual inspection. X-rays are absorbed by dense materials, such as metals, whereas neutrons readily penetrate metals, but are absorbed by materials containing hydrogen. The neutron radiography has been successfully applied to a number of inspection situations. These include the inspection of explosives, advanced composites, adhesively bonded structures and a number of aircraft engine components. With the availability of Californium-252, it has become feasible to construct mobile neutron radiography systems suitable for field use. Such systems have been used for in-situ inspection of flight line aircraft, particularly to locate and measure hidden corrosion

  12. Preparation of actinide targets by electrodeposition

    Science.gov (United States)

    Trautmann, N.; Folger, H.

    1989-10-01

    Actinide targets with varying thicknesses on different substrates have been prepared by electrodeposition either from aqueous solutions or from solutions of their nitrates in isopropyl alcohol. With these techniques the actinides can be deposited almost quantitatively on various backing materials within 15 to 30 min. Targets of thorium, uranium, neptunium, plutonium, americium, curium and californium with areal densities from almost carrier-free up to 1.4 mg/cm 2 on thin beryllium, carbon, titanium, tantalum and platinum foils have been prepared. In most cases, prior to the deposition, the actinides had to be purified chemically and for some of them, due to the limited amount of material available, recycling procedures were required. Applications of actinide targets in heavy-ion reactions are briefly discussed.

  13. An atomic beam source for actinide elements: concept and realization

    International Nuclear Information System (INIS)

    For ultratrace analysis of actinide elements and studies of their atomic properties with resonance ionization mass spectroscopy (RIMS), efficient and stable sources of actinide atomic beams are required. The thermodynamics and kinetics of the evaporation of actinide elements and oxides from a variety of metals were considered, including diffusion, desorption, and associative desorption. On this basis various sandwich-type filaments were studied. The most promising system was found to consist of tantalum as the backing material, an electrolytically deposited actinide hydroxide as the source of the element, and a titanium covering layer for its reduction to the metal. Such sandwich sources were experimentally proven to be well suited for the production of atomic beams of plutonium, curium, berkelium and californium at relatively low operating temperatures and with high and reproducible yields. (orig.)

  14. Environmental assessment of the thermal neutron activation explosive detection system for concourse use at US airports

    International Nuclear Information System (INIS)

    This document is an environmental assessment of a system designed to detect the presence of explosives in checked airline baggage or cargo. The system is meant to be installed at the concourse or lobby ticketing areas of US commercial airports and uses a sealed radioactive source of californium-252 to irradiate baggage items. The major impact of the use of this system arises from direct exposure of the public to scattered or leakage radiation from the source and to induced radioactivity in baggage items. Under normal operation and the most likely accident scenarios, the environmental impacts that would be created by the proposed licensing action would not be significant. 44 refs., 19 figs., 18 tabs

  15. A comparative study of bulk etch rate measurement methods in polycarbonate detectors

    International Nuclear Information System (INIS)

    The response of a plastic detector to an incoming charged particle is given by the ratio of track etch rate vt to bulk etch rate vg along its path. Although the accurate determination of vt offers no difficulty as cone length can be comfortably measured, there seems to be a certain ambiguity as how to measure vg. Several LEXAN and TUFFAK polycarbonate plates have been exposed to normally incident Californium-252 fission fragments, etched in a stirred aqueous NaOH solution saturated with etch products and with a 0.05% of Dowfax surfactant, for different etching times, concentrations and temperatures. We have used three methods to measure vg and we obtain consistent results in agreement with those published in the literature. Surface quality and, consequently, ellipses neatness, are far superior in TUFFAK than in LEXAN. (author)

  16. A Novel Approach to β-delayed Neutron Spectroscopy Using the Beta-decay Paul Trap

    International Nuclear Information System (INIS)

    A new approach to β-delayed neutron spectroscopy has been demonstrated that circumvents the many limitations associated with neutron detection by instead inferring the decay branching ratios and energy spectra of the emitted neutrons by studying the nuclear recoil. Using the Beta-decay Paul Trap, fission-product ions were trapped and confined to within a 1-mm3 volume under vacuum using only electric fields. Results from recent measurements of 137I+ and plans for development of a dedicated ion trap for future experiments using the intense fission fragment beams from the Californium Rare Isotope Breeder Upgrade (CARIBU) facility at Argonne National Laboratory are summarized. The improved nuclear data that can be collected is needed in many fields of basic and applied science such as nuclear energy, nuclear astrophysics, and stockpile stewardship

  17. Devices for rapid protein determination in grain products and mixed feeds by the neutron method

    International Nuclear Information System (INIS)

    Protein determination should be carried out using rapid techniques so that each truckful of grain can be checked for protein while mixed feeds can be checked for protein directly in the product flow lines with automatic correction of their work. The existing methods of protein determination do not meet the above requirements. In this connection, the Azot analyzer has beem developed based on the reaction of capture of thermal neutrons by the nuclei of the nitrogen present in the analyzed product and the registration of the resulting gamma-quanta emission of 10.8 Mev. Readings of the nitrogen will be converted to those of protein with the help of standard conversion coefficients. Alongside with protein content, the Azot can measure the test weight of the grain by absorbing californium 252 neutrons

  18. Probe for the exploration of deposits

    International Nuclear Information System (INIS)

    The exploration probes work by means of a prompt (n,γ) analysis, activation analysis or X-ray fluorescence analysis. The neutrons or gamma radiation are provided by a californium-252 source or a cobalt-57 source which are placed in the probe. The probe is in the form of a pipe consisting of single modules. Each module contains a part of the whole radiation producing, shielding, detector, detector cooling and detector electronic system. They can be screwed onto one another and can be exchanged for other parts. A melt cryostatat or a compressor is used as cooling device, a germanium-(Li) detector as detector, and bismuth and heavy water as shielding. All measuring process can thus be carried out in situ in a relatively short measuring time. (DG)

  19. Robotics and remote systems applications

    International Nuclear Information System (INIS)

    This article is a review of numerous remote inspection techniques in use at the Savannah River (and other) facilities. These include: (1) reactor tank inspection robot, (2) californium waste removal robot, (3) fuel rod lubrication robot, (4) cesium source manipulation robot, (5) tank 13 survey and decontamination robots, (6) hot gang valve corridor decontamination and junction box removal robots, (7) lead removal from deionizer vessels robot, (8) HB line cleanup robot, (9) remote operation of a front end loader at WIPP, (10) remote overhead video extendible robot, (11) semi-intelligent mobile observing navigator, (12) remote camera systems in the SRS canyons, (13) cameras and borescope for the DWPF, (14) Hanford waste tank camera system, (15) in-tank precipitation camera system, (16) F-area retention basin pipe crawler, (17) waste tank wall crawler and annulus camera, (18) duct inspection, and (19) deionizer resin sampling

  20. Utilization of radiation facilities at TNRC for shielding researches and related topics

    International Nuclear Information System (INIS)

    This paper presents the running shielding research activities at Tajura Nuclear research center. The main area of researches are concentrated on the investigation of different types of concrete made from local materials such as conventional concrete, Magnetite-Limonite concrete, and heat resistant concrete. The measuring techniques used were neutron-gamma spectrometry, and activation foils. The measurements were performed using collimated beam of reactor neutrons emitted from one of the horizontal channels, as well as from californium-252 neutron source. The transmitted neutron spectra through concrete barriers of different thicknesses were measured by a scintillation spectrometer with NE-213 liquid organic scintillator. A non-destructive testing of some reactor materials were also carried out using neutron and gamma ray computerized tomography technique (CT). Some experiments were also carried out related to measurements of neutron depth dose distributions inside tissue equivalent materials. 10 figs

  1. Nuclear fission and the transuranium elements

    International Nuclear Information System (INIS)

    Many of the transuranium elements are produced and isolated in large quantities through the use of neutrons furnished by nuclear fission reactions: plutonium (atomic number 94) in ton quantities; neptunium (93), americium (95), and curium (96) in kilogram quantities; berkelium (97) in 100 milligram quantities; californium (98) in gram quantities; and einsteinium (99) in milligram quantities. Transuranium isotopes have found many practical applications---as nuclear fuel for the large-scale generation of electricity, as compact, long-lived power sources for use in space exploration, as means for diagnosis and treatment in the medical area, and as tools in numerous industrial processes. Of particular interest is the unusual chemistry and impact of these heaviest elements on the periodic table. This account will feature these aspects. 9 refs., 5 figs

  2. Potential nuclear safeguards applications for neutron generators

    International Nuclear Information System (INIS)

    Many nuclear safeguards inspection instruments use neutron sources to interrogate the fissile material (commonly 235U and 239Pu) to be measured. The neutron sources currently used in these instruments are isotopics such as Californium-252, Americium-Lithium, etc. It is becoming increasingly more difficult to transport isotopic sources from one measurement location to another. This represents a significant problem for the International Atomic Energy Agency (IAEA) safeguards inspectors because they must take their safeguards instruments with them to each nuclear installation to make an independent measurement. Purpose of this paper is to review the possibility of replacing isotopic neutron sources now used in IAEA safeguards instruments with electric neutron sources such as deuterium-tritium (D-T, 14-MeV neutrons) or deuterium-deuterium (D-D, 2-MeV neutrons). The potential for neutron generators to interrogate spent-light water reactor fuel assemblies in storage pools is also reviewed

  3. Reliability of semiconductor and gas-filled diodes for over-voltage protection exposed to ionizing radiation

    Directory of Open Access Journals (Sweden)

    Stanković Koviljka

    2009-01-01

    Full Text Available The wide-spread use of semiconductor and gas-filled diodes for non-linear over-voltage protection results in a variety of possible working conditions. It is therefore essential to have a thorough insight into their reliability in exploitation environments which imply exposure to ionizing radiation. The aim of this paper is to investigate the influence of irradiation on over-voltage diode characteristics by exposing the diodes to californium-252 combined neutron/gamma radiation field. The irradiation of semiconductor over-voltage diodes causes severe degradation of their protection characteristics. On the other hand, gas-filled over-voltage diodes exhibit a temporal improvement of performance. The results are presented with the accompanying theoretical interpretations of the observed changes in over-voltage diode behaviour, based on the interaction of radiation with materials constituting the diodes.

  4. Multi-purpose neutron radiography system

    International Nuclear Information System (INIS)

    A conceptual design is given for a low cost, multipurpose radiography system suited for the needs of the Los Alamos National Laboratory (LANL). The proposed neutron source is californium-252. One purpose is to provide an in-house capability for occasional, reactor quality, neutron radiography thus replacing the recently closed Omega-West Reactor. A second purpose is to provide a highly reliable standby transportable neutron radiography system. A third purpose is to provide for transportable neutron probe gamma spectroscopy techniques. The cost is minimized by shared use of an existing x-ray facility, and by use of an existing transport cask. The achievable neutron radiography and radioscopy performance characteristics have been verified. The demonstrated image qualities range from high resolution gadolinium - SR film, with L:D = 100:1, to radioscopy using a LIXI image with L:D = 30:1 and neutron fluence 3.4 x 105 n/cm2

  5. Triton and alpha-particle contribution from LiF converter for neutron dosimeter

    CERN Document Server

    Camacho, M E; Balcazar, M

    1999-01-01

    A personnel neutron dosimeter prototype based on chemical and electrochemical etched CR-39 detector, combined with LiF converter, has been calibrated using an ICRP-like phantom, under a heavy-water moderated Californium source neutron spectra; A conversion factor of 1.052+-126 spots cm sup - sup 2 mSv sup - sup 1 was obtained. The sealing properties of the detector holder showed a ten-fold reduction in radon background when it was tested in a high radon atmosphere. A convenient mechanical shock resistance was achieved in LiF converters by sintering to 11 tons pressure LiF powder at 650 deg. C, during one hour.

  6. Nuclear fission and the transuranium elements

    Energy Technology Data Exchange (ETDEWEB)

    Seaborg, G.T.

    1989-02-01

    Many of the transuranium elements are produced and isolated in large quantities through the use of neutrons furnished by nuclear fission reactions: plutonium (atomic number 94) in ton quantities; neptunium (93), americium (95), and curium (96) in kilogram quantities; berkelium (97) in 100 milligram quantities; californium (98) in gram quantities; and einsteinium (99) in milligram quantities. Transuranium isotopes have found many practical applications---as nuclear fuel for the large-scale generation of electricity, as compact, long-lived power sources for use in space exploration, as means for diagnosis and treatment in the medical area, and as tools in numerous industrial processes. Of particular interest is the unusual chemistry and impact of these heaviest elements on the periodic table. This account will feature these aspects. 9 refs., 5 figs.

  7. General purpose nuclear irradiation chamber

    International Nuclear Information System (INIS)

    Nuclear technology has found a great need for use in medicine, industry, and research. Smoke detectors in our homes, medical treatments and new varieties of plants by irradiating its seeds are just a few examples of the benefits of nuclear technology. Portable neutron source such as Californium-252, available at Industrial Technology Division (BTI/ PAT), Malaysian Nuclear Agency, has a 2.645 year half-life. However, 252Cf is known to emit gamma radiation from the source. Thus, this chamber aims to provide a proper gamma shielding for samples to distinguish the use of mixed neutron with gamma-rays or pure neutron radiation. The chamber is compatible to be used with other portable neutron sources such as 241Am-Be as well as the reactor TRIGA PUSPATI for higher neutron dose. This chamber was designed through a collaborative effort of Kulliyyah Engineering, IIUM with the Industrial Technology Division (BTI) team, Malaysian Nuclear Agency. (Author)

  8. Experimental survey of the potential energy surfaces associated with fission

    International Nuclear Information System (INIS)

    Progress in the experimental determination of the properties of the potential energy surface associated with fission is reviewed. The importance of nuclear symmetry effects on the calculation of fission widths is demonstrated. Evidence is presented for the fragmentation of the mass-asymmetric second barrier in the thorium region and the axial asymmetric first barrier in the californium region. Detailed analyses of experimental data suggest the presence of two parallel second barriers; the normal mass-asymmetric, axial-symmetric barrier and a slightly higher mass-symmetric, axial-asymmetric barrier. Experimental barrier parameters are determined systematically and compared with calculations from various theoretical models. Techniques for expanding fission probability measurements to higher energies are discussed. (author)

  9. Separation of 248Cm (III) from 252Cf (III) and its use in time resolved fluorescence spectroscopic (TRFS) studies

    International Nuclear Information System (INIS)

    The present report gives a description of the methodology for the separation of 248Cm(III) from decayed 252Cf (III) waste solution. The waste solution was first assayed for 252Cf content by neutron counting using a neutron well coincidence counter. The sample was subjected to the chemical separation of 248Cm (III) from 252Cf (III) following anion and cation exchange chromatography. The alpha spectrum of the separated curium fraction showed peaks due to 246Cm and 248Cm while the corresponding alpha spectrum of californium fraction showed 249,250,251,252Cf. The gamma ray abundances of 249Cf were determined with respect to its gamma rays of 387 keV and the data agreed well with that in literature. Separated Cm(III) was further characterized by recording its time resolved fluorescence spectrum (TRFS) in aqueous medium. (author)

  10. Effects of 252Cf neutrons, transmitted through an iron block on human lymphocyte chromosome

    International Nuclear Information System (INIS)

    Chromosome aberration of human peripheral blood lymphocytes exposed to californium-252 (252Cf) neutrons transmitted through a 15 cm thick iron block was analysed. The spectrum of the filtered neutrons ranged from 0.1 to 2MeV with a peak at 0.7 MeV, simulating the Hiroshima atomic bomb neutron spectrum as shown in the Dosimetry System 1986 (DS86). Chromosome aberration frequencies after exposure to filtered and unfiltered 252Cf radiation were compared. Acentric ring chromosomes were significantly increased (p 0.1). The relative biological effectiveness (RBE) of the neutrons with respect to the formation of dicentrics and centric rings was 10.9 and 12.3 in the filtered and unfiltered conditions respectively, but the difference was not statistically significant. These results provide useful information for the re-evaluation of the biological effect of the Hiroshima atomic bomb radiations. (Author)

  11. Test and evaluation results of the 252Cf shuffler at the Savannah River Plant

    International Nuclear Information System (INIS)

    The 252Cf Shuffler, a nondestructive assay instrument employing californium neutron source irradiation and delayed-neutron counting, was developed for measuring 235U content of scrap and waste items generated at the Savannah River Plant (SRP) reactor fuel fabrication facility. The scrap and waste items include high-purity uranium-aluminum alloy ingots as well as pieces of castings, saw and lathe chips from machining operations, low-purity items such as oxides of uranium or uranium intermixed with flux materials found in recovery operations, and materials not recoverable at SRP such as floor sweepings or residues from the uranium scrap recovery operation. The uranium contains about 60% 235U with the remaining isotopes being 236U, 238U, and 234U in descending order. The test and evaluation at SRP concluded that the accuracy, safety, reliability, and ease of use made the 252Cf Shuffler a suitable instrument for routine use in an industrial, production-oriented plant

  12. Highly charged ions for atomic clocks and search for variation of the fine structure constant

    CERN Document Server

    Dzuba, V A

    2015-01-01

    We review a number of highly charged ions which have optical transitions suitable for building extremely accurate atomic clocks. This includes ions from Hf$^{12+}$ to U$^{34+}$, which have the $4f^{12}$ configuration of valence electrons, the Ir$^{17+}$ ion, which has a hole in almost filled $4f$ subshell, the Ho$^{14+}$, Cf$^{15+}$, Es$^{17+}$ and Es$^{16+}$ ions. Clock transitions in most of these ions are sensitive to variation of the fine structure constant, $\\alpha$ ($\\alpha = e^2/\\hbar c$). E.g., californium and einsteinium ions have largest known sensitivity to $\\alpha$-variation while holmium ion looks as the most suitable ion for experimental study. We study the spectra of the ions and their features relevant to the use as frequency standards.

  13. The CARIBU EBIS control and synchronization system

    Science.gov (United States)

    Dickerson, Clayton; Peters, Christopher

    2015-01-01

    The Californium Rare Isotope Breeder Upgrade (CARIBU) Electron Beam Ion Source (EBIS) charge breeder has been built and tested. The bases of the CARIBU EBIS electrical system are four voltage platforms on which both DC and pulsed high voltage outputs are controlled. The high voltage output pulses are created with either a combination of a function generator and a high voltage amplifier, or two high voltage DC power supplies and a high voltage solid state switch. Proper synchronization of the pulsed voltages, fundamental to optimizing the charge breeding performance, is achieved with triggering from a digital delay pulse generator. The control system is based on National Instruments realtime controllers and LabVIEW software implementing Functional Global Variables (FGV) to store and access instrument parameters. Fiber optic converters enable network communication and triggering across the platforms.

  14. Neutrons in cancer therapy

    Science.gov (United States)

    Allen, Barry J.

    1995-03-01

    The role of neutrons in the management of cancer has a long history. However, it is only in recent years that neutrons are beginning to find an accepted place as an efficacious radiation modality. Fast neutron therapy is already well established for the treatment of certain cancers, and clinical trials are ongoing. Californium neutron sources are being used in brachytherapy. Boron neutron capture therapy has been well tested with thermal neutrons and epithermal neutron dose escalation studies are about to commence in the USA and Europe. Possibilities of neutron induced auger electron therapy are also discussed. With respect to chemotherapy, prompt neutron capture analysis is being used to study the dose optimization of chemotherapy in the management of breast cancer. The rationales behind these applications of neutrons in the management of cancer are examined.

  15. Study of reproducibility of measurements with the spectrometer of Bonner multispheres

    Energy Technology Data Exchange (ETDEWEB)

    Azevedo, G.A.; Pereira, W.W.; Patrao, K.C.S.; Fonseca, E.S., E-mail: geisadeazevedo@gmail.com, E-mail: walsan@ird.gov.br, E-mail: karla@ird.gov.br, E-mail: evaldo@ird.gov.br [Instituto de Radionprotecao e Dosimetria (IRD/CNEN-RJ), Rio de Janeiro, RJ (Brazil)

    2013-07-01

    This work aims to study the metrological behavior of the Bonner Multisphere Spectrometer (BMS) of the LN / LNMRI / IRD - Laboratorio Metrologia de Neutrons / Laboratorio Nacional de Metrologia e Radiacao Ionizante / Instituto de Radioprotecao e Dosimetria, for measurements in repeatability and reproducibility conditions. Initially, a simulation was done by applying the Monte Carlo method, using the MCNP code and respecting the ISO 8529-1 (2001), using the sources of Californium ({sup 252} Cf), Americium-Beryllium ({sup 241} AmBe) and californium in heavy water (Cf + D{sub 2}O), all located at a distance of 100 cm from the neutron detector ({sup 6}Li (Eu) - crystal scintillator). In this program, the counting of neutrons that are captured by the detector was made. The source is located in the center of a sphere of radius 300 cm. Analyzes the impact of these neutrons in a point of the sphere wall, which in this case acted as a neutron detector and from there, it is estimated the number of neutrons that collide in the whole sphere. The purpose is to obtain the neutron count for different energy bands in a solid field of neutrons, since they have a spectrum ranging from a low to a high energy that can also vary within a particular environment. Wishes to obtain new fields with different sources and moderators materials to be used as new reference fields. Measurements are being conducted for these fields, with the aim of analyzing the variability conditions of the measurement (repeatability and reproducibility) in LEN - Laboratorio de Espectrometria de Neutrons of the LN/LMNRI/IRD. Thus, the spectrometer will be used to improve both the knowledge of the spectrum as the standard of neutrons of the lab, proving that a spectrometry is essential for correct measurement.

  16. The pH-sensitive structure of the C-terminal domain of voltage-gated proton channel and the thermodynamic characteristics of Zn2+ binding to this domain

    International Nuclear Information System (INIS)

    Highlights: • The α-helical content of the C-terminus is decreased with a pH increase. • The thermostability of the C-terminus is decreased with a pH increase. • Zn2+ binds to His244 and His266 residues within the C-terminal domain. • The binding of Zn2+ to His244 residue is an endothermic heat reaction. • The binding of Zn2+ to His266 residue is an exothermic heat reaction. - Abstract: The voltage-gated proton channel Hv1 is strongly sensitive to Zn2+. The H+ conduction is decreased at a high concentration of Zn2+ and Hv1 channel closing is slowed by the internal application of Zn2+. Although the recent studies demonstrated that Zn2+ interacts with the intracellular C-terminal domain, the binding sites and details of the interaction remain unknown. Here, we studied the pH-dependent structural stability of the intracellular C-terminal domain of human Hv1 and showed that Zn2+ binds to His244 and His266 residues. The thermodynamics signature of Zn2+ binding to the two sites was investigated by isothermal titration calorimetry. The binding of Zn2+ to His244 (mutant H266A) and His266 (mutant H244A) were an endothermic heat reaction and an exothermic heat reaction, respectively

  17. Chelation of curium in the adult baboon using Ca- and Zn-DTPA

    International Nuclear Information System (INIS)

    The effectiveness of Ca-DTPA in removing internally deposited Cm-243, 244 was tested in the baboon at 1.5 and 8-month intervals between injection of Cm-243, 244 and treatment. Four young adult female baboons were injected IV with the radionuclides in citrate form. Ca-DTPA was administered three times in five days on alternate days beginning at 1.5 months in one baboon and at 8 months in another. The two remaining control baboons were administered physiological saline only. In vivo counting was performed to determine the total body, skeletal, and liver retention before, during and after chelation therapy. All urine and feces were collected and the Cm-243, 244 content of each was determined daily. A comparison of the efficacy of chelate therapy with Cm-243, 244 and Am-241 when treatment was delayed for 1.5 months after Am-241 injection showed that Ca-DTPA is more effective in enhancing the excretion of established burdens of Cm-243, 244 than that of Am-241 by approximately 34 percent in the urine and 87 percent in the feces during the first seven days after initiation of therapy

  18. 粘结型粉末氯丁橡胶的制备方法%Preparation of bonding powdered chloroprene rubber

    Institute of Scientific and Technical Information of China (English)

    赵志超; 马朋高; 郑聚成; 李波; 胡育林; 秦传高

    2011-01-01

    采用直接凝聚法制备了粉末氯丁橡胶PCR244,并讨论了凝聚剂种类和用量、隔离剂种类和用量、凝聚温度以及凝聚体系的pH值对PCR244粉末化效果的影响.研究表明,在低温条件下凝聚所得粉末氯丁橡胶的成粉率高,溶解速率快,且粘结强度高.%Powdered chloroprene rubber PCR244 was prepared by direct coagulation process,and the effects of kind and amount of coagulating agent, kind and amount of separating agent,coagulation temperature and pH value of coagulating system on powdered ratio of chloroprene rubber PCR244 were studied. The results showed that powdered ratio and bond strength of powdered chloroprene rubber PCR244 obtained under low temperature were higher,and dissolution rate of that was faster.

  19. Solvent Extraction of Zr(IV) from Nitric Acid Solutions using CYANEX 272, CYANEX 301 and CYANEX 302

    International Nuclear Information System (INIS)

    The extraction of Zr(IV) from nitric acid solutions using CYANEX 272 (bis(2,4,4-trimethylpentyl) phosphinic acid), bis (2,4,4-trimethylpentyl) dithio phosphinic acid (CYANEX 301) or (bis(2,4,4-trimethylpentyl) mono phosphinic acid (CYANEX 302) in kerosene has been investigated. The various factors affecting the extraction process of Zr(IV) by each of the investigated extractants such as contact time, loading capacity, extractant, metal ion and nitric acid concentration as well as temperature, are separately investigated. The stripping of the extracted zirconium from loaded organic solutions is also carried out using different stripping reagents. The results are compared and the potential advantages of each extractant over the others are exploited in terms of higher loading capacity and selectivity, less nitric acid extraction, equilibration period and reagent concentration

  20. Extraction and stripping of rare earths using mixtures of acidic phosphorusbased reagents

    Institute of Scientific and Technical Information of China (English)

    WANG Xianglan; LI Wei; LI Deqian

    2011-01-01

    Studies were carried out on the extraction characters of trivalent rare earths from chloride solutions using organophosphorus acids 2-ethylhexylphosphonic acid mono-(2-ethylhexyl) ester (HEHEHP) combined with [di-(2-ethylhexyl)-phosphoric acid (HDEHP), isopropylphosphonic acid l-hexyl-4-ethyloctyl ester (HHEOIPP), bis(2,4,4-trimethylpentyl)-phosphinic acid (Cyanex 272), bis(2,4,4-trimethypen-tyl)-monothiophosphinic acid (Cyanex 302) or bis(2,4,4-trimethypentyl)-dithiophosphinic acid (Cyanex 301)] as extractants. The effect of the equilibrium aqueous acidity on the extraction was studied. According to the corresponding separation factors for adjacent pairs of rare earths,it could be concluded that HEHEHP and Cyanex 272 could be employed for the separation of Tm(Ⅲ), Yb(Ⅲ), Lu(Ⅲ) from the other rare earths. Taking Yb(Ⅲ) as an example, based on the different stripping acid, the potential of the stripping was estimated.

  1. Golden Eagle mortality at a utility-scale wind energy facility near Palm Springs, California

    Science.gov (United States)

    Lovich, Jeffrey E.

    2015-01-01

    Golden Eagle (Aquila chrysaetos) mortality associated with wind energy turbines and infrastructure is under-reported and weakly substantiated in the published literature. I report two cases of mortality at a utility-scale renewable energy facility near Palm Springs, California. The facility has been in operation since 1984 and included 460 65KW turbines mounted on 24.4 m or 42.7 m lattice-style towers with 8 m rotor diameters. One mortality event involved a juvenile eagle that was struck and killed by a spinning turbine blade on 31 August, 1995. The tower was 24.4 m high. The other involved an immature female that was struck by a spinning blade on another 24.4 m tower on 17 April, 1997 and was later euthanized due to the extent of internal injuries. Other raptor mortalities incidentally observed at the site, and likely attributable to turbines, included three Red-tailed Hawks (Buteo jamaicensis) found near turbines.

  2. Combined influence of teichoic acids from Staphylococcus aureus and heterometallik Cu/Cd ethylenediamine complex on peritoneal macrophages and tumor cells.

    Science.gov (United States)

    Nikulina, V V; Garmanchuk, L V; Senchylo, N V; Nikolaenko, T V; Dzhus, O I; Ostapchenko, L I; Khranovska, N M

    2014-01-01

    We investigated the effects of teichoic acid (TA) from Staphylococcus aureus Wood 46 on tumor growth and metastasis of the experimental Lewis lung carcinoma (LLC) in mice. Intranasal administration of TA alone aggravated both tumor growth and metastasis, whereas combined administration of TA with a synthetic bimetallic (copper : cadmium) ethylene diamine complex PO244 resulted in pronounced antitumor and antimetastatic effects. The group of animals subjected to the combined treatment with TA and PO244 manifested the highest degree of lymphocyte infiltration into the tumor tissue, compared to the control group and those exposed to TA or PO244 alone. Moreover, the combined treatment negatively affected the adhesive properties of peritoneal macrophages in the LLC bearing mice. Co-cultivation of the isolated macrophages with primary LLC cultures revealed significant (p < 0.05) cytotoxic and cytostatic effects, detected as an increased level of apoptosis and a reduced fraction of replicating cells. PMID:25536823

  3. Sm-Nd-Pu timepieces in the Angra dos Reis meteorite

    International Nuclear Information System (INIS)

    Sm-Nd systematics in pyroxene and phosphate mineral separates of Angra dos Reis have been studied. A pyroxene-phosphate internal isochron age of T2=4.55+-0.04 AE is obtained, in excellent agreement with reported Pb-Pb ages. 142Nd/144Nd ratios in pyroxene samples are systematically larger than those in phosphates by 6 parts in 105. This variation is tentatively assigned to a radiogenic contribution from extinct 146Sm. Fission xenon components in pyroxene and phosphate separates are characterized by discrete ratios of fission/spallation and evidence is presented for a third ratio in celsian. It is shown that this characteristic is due to a close association of 244Pu with the light REE. Computed ratios 244Pu/Nd are the same in pyroxene and phosphate separates, but 244Pu/238U and 244Pu/232Th ratios are not. Taking the fission xenon retention age to be 4.55 AE, an abundance ratio 244Pu/Nd=1.5x10-4 (or an atomic ratio 244Pu/150Nd=1.6x10-3) is obtained at this time and in the region of the solar system where the Angra dos Reis parent body formed. The exposure age of Angra dos Reis, as obtained by the 81Kr-83Kr method is 55.5+-1.2 m.y. Neutron capture during the 55.5-m.y. exposure to cosmic rays increased the ratio 150Sm/149Sm in Angra dos Reis by 6 parts in 104. (Auth.)

  4. New data on transuranium elements in the ecosystem of the Yenisei river floodplain

    Energy Technology Data Exchange (ETDEWEB)

    Bolsunovsky, A. [Russian Academy of Sciences, Siberian Branch, Krasnoyarsk (Russian Federation). Inst. of Biophysics; Ermakov, A.; Sobolev, A. [SIA ' RADON' , Moscow (Russian Federation)

    2007-07-01

    The aim of the study is to investigate levels of transuranium elements in the ecosystem of the Yenisei river floodplain in the vicinity of the Mining-and-Chemical Combine of Rosatom. For the first time, the transuranium isotopes {sup 243,244}Cm have been detected in sediment, floodplain soil, and a berry shrub (Ribes nigrum - the blackcurrant) in the floodplain of the Yenisei river. The highest level of curium isotopes registered in the sediment of the Yenisei river is 21.4Bq/kg (dry), which is more than twice higher than maximum curium levels reported for soils sampled not far from the Chernobyl Nuclear Plant. Blackcurrant plants growing on radioactively contaminated soils contain the same transuranium elements as the soil (plutonium isotopes, americium, and curium). The highest activity concentrations of all transuranic elements have been found in ashed roots of the blackcurrant plants: {sup 239,240}Pu - 9.3Bq/kg, {sup 241}Am - 6.9Bq/kg, and {sup 243,244}Cm - 1.8Bq/kg. The highest soil-plant transfer factor (TF) for {sup 243,244}Cm is determined for roots - 0.073; the TF of {sup 243,244}Cm in berries is 0.027. The TF for {sup 239,240}Pu in berries is 0.006, which is several times lower than the TF for {sup 243,244}Cm. Analysis of our results and the literature data suggests that TFs for {sup 243,244}Cm are higher than those for {sup 239,240}Pu and {sup 241}Am. (orig.)

  5. Cloned defective interfering influenza virus protects ferrets from pandemic 2009 influenza A virus and allows protective immunity to be established.

    Directory of Open Access Journals (Sweden)

    Nigel J Dimmock

    Full Text Available Influenza A viruses are a major cause of morbidity and mortality in the human population, causing epidemics in the winter, and occasional worldwide pandemics. In addition there are periodic outbreaks in domestic poultry, horses, pigs, dogs, and cats. Infections of domestic birds can be fatal for the birds and their human contacts. Control in man operates through vaccines and antivirals, but both have their limitations. In the search for an alternative treatment we have focussed on defective interfering (DI influenza A virus. Such a DI virus is superficially indistinguishable from a normal virus but has a large deletion in one of the eight RNAs that make up the viral genome. Antiviral activity resides in the deleted RNA. We have cloned one such highly active DI RNA derived from segment 1 (244 DI virus and shown earlier that intranasal administration protects mice from lethal disease caused by a number of different influenza A viruses. A more cogent model of human influenza is the ferret. Here we found that intranasal treatment with a single dose of 2 or 0.2 µg 244 RNA delivered as A/PR/8/34 virus particles protected ferrets from disease caused by pandemic virus A/California/04/09 (A/Cal; H1N1. Specifically, 244 DI virus significantly reduced fever, weight loss, respiratory symptoms, and infectious load. 244 DI RNA, the active principle, was amplified in nasal washes following infection with A/Cal, consistent with its amelioration of clinical disease. Animals that were treated with 244 DI RNA cleared infectious and DI viruses without delay. Despite the attenuation of infection and disease by DI virus, ferrets formed high levels of A/Cal-specific serum haemagglutination-inhibiting antibodies and were solidly immune to rechallenge with A/Cal. Together with earlier data from mouse studies, we conclude that 244 DI virus is a highly effective antiviral with activity potentially against all influenza A subtypes.

  6. Dicty_cDB: CFE467 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFE467 (Link to dictyBase) - G21752 DDB0187369 Contig-U11569-1 CFE467P (Lin ... 5e-63 BC114556_1( BC114556 |pid:none) Homo sapiens thyroid ... hormone recep... 244 5e-63 BC113891_1( BC113891 |p ... id:none) Homo sapiens thyroid ... hormone recep... 244 5e-63 BC105889_1( BC105889 |p ... id:none) Rattus norvegicus thyroid ... hormone ... 243 9e-63 BC100624_1( BC100624 |pid:no ... ne) Rattus norvegicus thyroid ... hormone ... 243 9e-63 BC088304_1( BC088304 |pid:no ...

  7. Distinctiveness in chromosomal behaviour in interspecific hybrid genotypes of cotton

    OpenAIRE

    A.W. More and U.G. Kulkarni

    2010-01-01

    Cytological studies in interspecific hybrid derivatives of cotton viz., IS-244/4/1 and IS-181/7/1 obtained in BC1F8generation of trispecies cross of [ (G. hirsutum x G. barbadanse )x G. arboreum] was carried out to find out thechromosome behaviour. During the meiosis variation in chromosome no. from 26 to 31 in IS-181/7/1 and 19 to 49 inIS244/4/1 was observed against the normal choromosomal behaviour of G. arboretum (2n == 26)and G. hirsutum (2n=4x=52).Chromosome pairing revealed the presence...

  8. EST Table: FS918452 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available FS918452 E_FL_fufe_44G17_F_0 10/09/28 46 %/244 aa ref|XP_975194.1| PREDICTED: similar to something...l|GB19080-PA 10/09/10 46 %/244 aa gi|91081571|ref|XP_975194.1| PREDICTED: similar to something about silencing protein 10 [Tribolium castaneum] FS937283 fufe ... ... about silencing protein 10 [Tribolium castaneum] gb|EFA01562.1| hypothetical protein TcasGA2...93 aa AGAP002960-PA Protein|2R:30130647:30132122:-1|gene:AGAP002960 10/09/10 40 %/253 aa gnl|Ame

  9. Fabrication and stability of fiber bragg gratings for WDM applications using a 266 nm cw-laser

    DEFF Research Database (Denmark)

    Deyerl, Hans-Jürgen; Sørensen, Henrik Rokkjær; Jensen, Jesper Bo Damm;

    2003-01-01

    Diode pumped continuous wave all solid state UV-lasers operating at 266 nm offer an interesting alternative to frequency doubled argon ion lasers. We compare photosensitivity, UV-writing of Bragg gratings and thermal decay at 244, 257 and 266 nm.......Diode pumped continuous wave all solid state UV-lasers operating at 266 nm offer an interesting alternative to frequency doubled argon ion lasers. We compare photosensitivity, UV-writing of Bragg gratings and thermal decay at 244, 257 and 266 nm....

  10. Preparation of powdered adhesiVe type chloroprene rubber

    Institute of Scientific and Technical Information of China (English)

    朱家顺; 王炼石; 梁启浩

    2003-01-01

    研究了包覆剂对黏接型氯丁胶乳(CR 244)包覆性能的影响,并通过扫描电子显微镜研究了所得粉末橡胶的微观结构.结果表明,包覆剂用量大于15份(质量)时,粒径不大于0.9 mm的试样质量分数大于99%.粉末CR 244中存在许多孔洞,使得试样易于干燥和溶解.

  11. Independent Verification of Element 114 Production in the 48Ca+242Pu Reaction

    International Nuclear Information System (INIS)

    Independent verification of the production of element 114 in the reaction of 244-MeV 48Ca with 242Pu is presented. Two chains of time- and position-correlated decays have been assigned to 286114 and 287114. The observed decay modes, half-lives, and decay energies agree with published results. The measured cross sections at a center-of-target energy of 244 MeV for the 242Pu(48Ca,3-4n)287,286114 reactions were 1.4-1.2+3.2 pb each, which are lower than the reported values.

  12. On the Consistency of an Estimator for Hierarchical Archimedean Copulas

    Czech Academy of Sciences Publication Activity Database

    Górecki, J.; Hofert, M.; Holeňa, Martin

    Olomouc : Palacký University, 2014 - (Talašová, J.; Stoklasa, J.; Talášek, T.), s. 239-244 ISBN 978-80-244-4209-9. [MME 2014. International Conference Mathematical Methods in Economics /32./. Olomouc (CZ), 10.09.2014-12.09.2014] R&D Projects: GA ČR GA13-17187S Grant ostatní: Slezská univerzita v Opavě(CZ) SGS/21/2014 Institutional support: RVO:67985807 Keywords : hierarchical Archimedean copula * Kendall distribution function * parameter estimation * structure determination * consistency Subject RIV: IN - Informatics, Computer Science

  13. 氯霉素类三甲基硅衍生物的质谱特征及其残留监测

    Institute of Scientific and Technical Information of China (English)

    贺利民; 曾振灵; 刘雅红; 陈建新; 黄显会

    2004-01-01

    Mass characteristics of TMS derivative of chloramphenicol, florfenicol,and thiamphenicol were interpreted manually, respectively. Then SIM mode was performed at m/z 225, m/z 242, m/z 244, m/z 361 for CAP, m/z 178, m/z 257, m/z 259, m/z 394 for FF,and m/z 242, m/z 244, m/z 257, m/z 330 for TAP. A sensitive, reproducible gas chromatographic-mass spectrometric method was developed for simultaneous monitoring residues of fenicols in pork and tissues.

  14. Comparison of fission and capture cross sections of minor actinides

    CERN Document Server

    Nakagawa, T

    2003-01-01

    The fission and capture cross sections of minor actinides given in JENDL-3.3 are compared with other evaluated data and experimental data. The comparison was made for 32 nuclides of Th-227, 228, 229, 230, 233, 234, Pa-231, 232, 233, U-232, 234, 236, 237, Np-236, 237, 238, Pu-236, 237, 238, 242, 244, Am-241, 242, 242m, 243, Cm-242, 243, 244, 245, 246, 247 and 248. Given in the present report are figures of these cross sections and tables of cross sections at 0.0253 eV and resonance integrals.

  15. Drug: D00029 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available utic category of drugs in Japan [BR:br08301] 3 Agents affecting metabolism 31 Vitamins 319 Miscellaneous vitamins... 3190 Miscellaneous vitamins D00029 Biotin (JP16/USP/INN) Anatomical Therapeutic Chemi...AIN VITAMIN PREPARATIONS A11HA Other plain vitamin preparations A11HA05 Biotin D00029 Biotin (JP16/USP/INN) ...D00029 Drug Biotin (JP16/USP/INN); Bioepiderm (TN) C10H16N2O3S 244.0882 244.3106 D00029.gif Vitamin Sam...e as: C00120 Therapeutic category: 3190 ATC code: A11HA05 Vitamin B7 (Vitamin H) Therape

  16. Comparison of fission and capture cross sections of minor actinides

    International Nuclear Information System (INIS)

    The fission and capture cross sections of minor actinides given in JENDL-3.3 are compared with other evaluated data and experimental data. The comparison was made for 32 nuclides of Th-227, 228, 229, 230, 233, 234, Pa-231, 232, 233, U-232, 234, 236, 237, Np-236, 237, 238, Pu-236, 237, 238, 242, 244, Am-241, 242, 242m, 243, Cm-242, 243, 244, 245, 246, 247 and 248. Given in the present report are figures of these cross sections and tables of cross sections at 0.0253 eV and resonance integrals. (author)

  17. Prompt neutron multiplicities for the transplutonium nuclides

    International Nuclear Information System (INIS)

    The direct determination of the average prompt neutron emission values is reviewed, and a method of comparing different sites of neutron emission multiplicity distribution values is described. Measured and recommended values are tabulated for these nuclides: 241Am, 242Am, 242Cm, 243Cm, 244Cm, 246Cm, 247Cm, 248Cm, 250Cm, 245Cm, 249Bk, 246Cf, 249Cf, 250Cf, 252Cf, 254Cf, 251Cf, 253Es, 254Es, 244Fm, 246Fm, 255Fm, 252No, 254Fm, 256Fm, 257Fm. 59 refs., 24 tabs

  18. A new type-B cask design for transporting 252Cf

    International Nuclear Information System (INIS)

    A project to design, certify, and build a new US Department of Energy (DOE) Type B container for transporting >5 mg of 252Cf is more than halfway to completion. This project was necessitated by the fact that the existing Oak Ridge National Laboratory (ORNL) Type B containers were designed and built many years ago and thus do not have the records and supporting data that current regulations require. Once the new cask is available, it will replace the existing Type B containers. The cask design is driven by the unique properties of 252Cf, which is a very intense spontaneous fission neutron source and necessitates a large amount of neutron shielding. The cask is designed to contain up to 60 mg of 252Cf in the form of californium oxide or californium oxysulfate, in pellet, wire, or sintered material forms that are sealed inside small special-form capsules. The new cask will be capable of all modes of transport (land, sea, and air). The ORNL team, composed of technical and purchasing personnel and using rigorous selection criteria, chose NAC, International (NAC), as the subcontractor for the project. In January 1997, NAC started work on developing the conceptual design and performing the analyses. The original design concept was for a tungsten alloy gamma shield surrounded by two concentric shells of NS-4-FR neutron shield material. A visit to US Nuclear Regulatory Commission (NRC) regulators in November 1997 to present the conceptual design for their comments resulted in a design modification when the question of potential straight-line cracking in the NS-4-FR neutron shield material arose. NAC's modified design includes offset, wedgelike segments of the neutron shield material. The new geometry eliminates concerns about straight-line cracking but increases the weight of the packaging and makes the fabrication more complex. NAC has now completed the cask design and performed the analyses (shielding, structural, thermal, etc.) necessary to certify the cask. The cask

  19. The Development of Neutron Radiography and Tomography on a SLOWPOKE-2 Reactor

    Science.gov (United States)

    Bennett, L. G. I.; Lewis, W. J.; Hungler, P. C.

    Development of neutron radiography at the Royal Military College of Canada (RMC) started by trying to interest the Royal Canadian Air Force (RCAF) in this new non-destructive testing (NDT) technique. A Californium-252 based device was ordered and then installed at RMC for development of applicable techniques for aircraft by the first author. A second and transportable device was then designed, modified and used in trials at RCAF Bases and other locations for one year. This activity was the only foreign loan of the U.S. Californium Loan Program. Around this time, SLOWPOKE-2 reactors were being installed at four Canadian universities, while a new science and engineering building was being built at RMC. A reactor pool was incorporated and efforts to procure a reactor succeeded a decade later with a SLOWPOKE-2 reactor being installed at RMC. The only modification by the vendor for RMC was a thermal column replacing an irradiation site inside the reactor container for a later installation of a neutron beam tube (NBT). Development of a working NBT took several years, starting with the second author. A demonstration of the actual worth of neutron radiography took place with a CF-18 Hornet aircraft being neutron and X-radiographed at McClellan Air Force Base, Sacramento, CA. This inspection was followed by one of the rudders that had indications of water ingress being radiographed successfully at RMC just after the NBT became functional. The next step was to develop a neutron radioscopy system (NRS), initially employing film and then digital imaging, and is in use today for all flight control surfaces (FCS). With the third author, a technique capable of removing water from affected FCS was developed at RMC. Heating equipment and a vacuum system were utilized to carefully remove the water. This technique was proven using a sequence of near real time neutron images obtained during the drying process. The results of the drying process were correlated with a relative humidity

  20. Čeština „dlouhého 16. století“: zdroje spisovné normy

    Czech Academy of Sciences Publication Activity Database

    Vykypělová, Taťána

    Olomouc : Univerzita Palackého v Olomouci, 2013 - (Dittmann, R.; Uličný, O.), s. 41-63 ISBN 978-80-244-3549-7 Institutional support: RVO:68378092 Keywords : Czech language * Czech Grammar Subject RIV: AI - Linguistics

  1. Svět v perspektivě logocentrismu

    Czech Academy of Sciences Publication Activity Database

    Parusniková, Zuzana

    Olomouc: Univerzita Palackého v Olomouci. Cyrilometodějská teologická fakulta, 2009 - (Nejeschleba, T.; Floss, P.; Michalík, J.; Stehura, E.), s. 109-129 ISBN 978-80-244-2438-5 Institutional research plan: CEZ:AV0Z90090514 Keywords : logocentrism * postmodernism * philosophy Subject RIV: AA - Philosophy ; Religion

  2. Gclust Server: 87214 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available 87214 SCE_YDR364C=CDC40 Cluster Sequences Related Sequences(244) 455 Pre-mRNA splicing factor, important...quence length 455 Representative annotation Pre-mRNA splicing factor, important for catalytic step II of pre

  3. Natural Formation and Degradation of Chloroacetic Acids and Volatile Organochlorines in Forest Soil

    Czech Academy of Sciences Publication Activity Database

    Laturnus, F.; Fahimi, I.; Gryndler, Milan; Hartmann, A.; Heal, M. R.; Matucha, M.; Schöler, H. F.; Schroll, R.; Svensson, T.

    2005-01-01

    Roč. 12, č. 4 (2005), s. 233-244. ISSN 0944-1344 Institutional research plan: CEZ:AV0Z50200510 Keywords : chloroacetic acids * degradation * fores decline Subject RIV: EE - Microbiology, Virology Impact factor: 1.518, year: 2005

  4. Immunochemical detection of the crustacean cardioactive peptide in the cephalic ganglia cockroaches (Blattodea: Blattidae)

    Czech Academy of Sciences Publication Activity Database

    Gladysz, M.; Guzik, J.; Sehadová, Hana; Baran, B.; Bembenek, J.; Dolezych, B.

    2015-01-01

    Roč. 112, č. 2 (2015), s. 235-244. ISSN 1210-5759 Institutional support: RVO:60077344 Keywords : Blattodea * Periplaneta americana * Gromphadorhina portentosa Subject RIV: ED - Physiology Impact factor: 0.975, year: 2014 http://www.eje.cz/corproof.php?tartkey=eje-000000-0111#.VRVB0PmG8mM

  5. TDI Is in Short Supply

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    @@ Market price rise in 2006 The apparent consumption of TDI (toluene diisocyanate) in China was around 377 thousand tons in 2006, an increase of only 2.44% over 2005-a big reduction in growth. The outputof TDI was 132 thousand tons in 2006 and the self-sufficiency rate was only 35%.

  6. SAH Gene Variants Revisited in the European Project on Genes in Hypertension

    Czech Academy of Sciences Publication Activity Database

    Tikhonoff, V.; Staessen, J.A.; Kuznetsova, T.; Thijs, L.; Hasenkamp, S.; Stolarz, K.; Seidlerová, J.; Filipovský, J.; Nikitin, Y.; Peleška, Jan; Kawecka-Jaszcz, K.; Casiglia, E.; Brand-Herrmann, S.M.; Brand, E.

    2008-01-01

    Roč. 26, č. 2 (2008), s. 244-250. ISSN 0263-6352 Institutional research plan: CEZ:AV0Z10300504 Keywords : body mass index * hypertension * population study * SAH gene * serum lipids Subject RIV: FA - Cardiovascular Diseases incl. Cardiotharic Surgery Impact factor: 5.132, year: 2008

  7. Lokální hudby v globální vesnici. Etnomuzikologie mezi voskovým válečkem a internetem

    Czech Academy of Sciences Publication Activity Database

    Kratochvíl, Matěj

    Olomouc: Univerzita Palackého v Olomouci, 2007 - (Poledňák, I.), s. 127-138 ISBN 978-80-244-1809-4 Institutional research plan: CEZ:AV0Z90580513 Keywords : traditional music * technology * internet * recording * ethnomusicology Subject RIV: AC - Archeology, Anthropology, Ethnology

  8. Hlučná samota jako obraz světa

    Czech Academy of Sciences Publication Activity Database

    Zumr, Josef

    Praha: Filosofia, 2006 - (Cosentino, A.; Jankovič, M.; Zumr, J.), s. 79-85 ISBN 80-7007-244-X. [Kolem Bohumila Hrabala. Udine (IT), 27.10.2005-29.10.2005] Institutional research plan: CEZ:AV0Z90090514 Keywords : Hrabal Bohumil * Too noisy loneliness * philosophical signification Subject RIV: AA - Philosophy ; Religion

  9. Avantgarda v situaci moderny a "po" moderně

    Czech Academy of Sciences Publication Activity Database

    Kanda, Roman

    Olomouc: Univerzita Palackého v Olomouci, 2013 - (Kubíček, T.; Wiendl, J.), s. 330-337 ISBN 978-80-244-3418-6 Institutional support: RVO:68378068 Keywords : literature * avant-garde * modernism Subject RIV: AJ - Letters, Mass-media, Audiovision

  10. Multihorizontální analýza kritických momentů a pracovním životě herců

    Czech Academy of Sciences Publication Activity Database

    Lindénová, J.; Čermák, Ivo

    Olomouc: Univerzita Palackého v Olomouci, 2005, s. 47-55. ISBN 80-244-1159-8 R&D Projects: GA AV ČR IAA7025402 Institutional research plan: CEZ:AV0Z70250504 Keywords : Diary-in Group method * hermeneutic inquiry Subject RIV: AN - Psychology

  11. Reaching the superlinear convergence phase of the CG method

    Czech Academy of Sciences Publication Activity Database

    Axelsson, Owe; Karátson, J.

    2014-01-01

    Roč. 260, č. 260 (2014), s. 244-257. ISSN 0377-0427 R&D Projects: GA MŠk ED1.1.00/02.0070 Institutional support: RVO:68145535 Keywords : superlinear convergence * conjugate gradient method * eigenvalues Subject RIV: BA - General Mathematics Impact factor: 1.266, year: 2014 http://www.sciencedirect.com/science/article/pii/S0377042713005451

  12. Can voltammetry distinguish glycan isomers?

    Czech Academy of Sciences Publication Activity Database

    Trefulka, Mojmír; Paleček, Emil

    2015-01-01

    Roč. 69, č. 1 (2015), s. 241-244. ISSN 0366-6352 R&D Projects: GA ČR(CZ) GAP301/11/2055 Institutional support: RVO:68081707 Keywords : oligosaccharide isomers * Os(VI) complexes * chemical modification Subject RIV: BO - Biophysics Impact factor: 1.468, year: 2014

  13. Immunity

    Institute of Scientific and Technical Information of China (English)

    1997-01-01

    970239 The effect of interleukin 6 against cytopeniaand suppressed phagocytosis of macrophage caused bychemotherapy. ZHANG Lichao(张利朝), et al.Tangdu Hosp, 4th Milit Med Univ, Xian, 710038. ChinJ Clin Oncol 1997; 24(4): 252-255. Objective: To explore The effect of interleukin 6against cytopenia and suppressed phagocytosis ofmacrophage caused by chemotherapy. Methods:Inter-

  14. Romantika jako epistemologická alternativa otevřená Kantovou Kritikou soudnosti

    Czech Academy of Sciences Publication Activity Database

    Ďurďovič, Martin

    2014-01-01

    Roč. 36, č. 3 (2014), s. 259-281. ISSN 1210-0250 Institutional support: RVO:68378025 Keywords : epistemology * German romanticism * philosophy of arts * teleology * aesthetics Subject RIV: AA - Philosophy ; Religion http://teorievedy.flu.cas.cz/index.php/tv/article/view/244/281

  15. Formation of the reverse micelles of cetyl trimethylammonium bromide in chloroform and their behavior at subzero temperatures

    Czech Academy of Sciences Publication Activity Database

    Klíčová, L.; Šebej, P.; Štacko, P.; Filippov, Sergey K.; Klán, P.

    Philadelphia : American Chemical Society, 2012. s.103-COLL 217. [American Chemical Society National Meeting /244./ & Exposition - Materials for Health & Medicine. 19.08.2012-23.08.2012, Philadelphia] R&D Projects: GA ČR GAP108/12/0640 Institutional support: RVO:61389013 Keywords : aggregation * reverse micelles Subject RIV: CD - Macromolecular Chemistry

  16. Analýza motivace na základě použití TAT u dvou skupin adolescentů

    Czech Academy of Sciences Publication Activity Database

    Urbánek, Tomáš; Czekóová, Kristína; Čermák, Ivo; Fikarová, Táňa; Pokorná, Zuzana

    2012-01-01

    Roč. 56, č. 5 (2012), s. 393-408. ISSN 0009-062X R&D Projects: GA ČR GA406/09/2089 Institutional research plan: CEZ:AV0Z70250504 Keywords : thematic apperception test * thematic content analysis * motivation * adolescents Subject RIV: AN - Psychology Impact factor: 0.244, year: 2012

  17. Jakobson’s Ruse: Artifice in the Context of Functional Aesthetics and the Theory of Sign

    Czech Academy of Sciences Publication Activity Database

    Müller, Richard; Šidák, Pavel

    Olomouc : Palacký University, 2014 - (Kubíček, T.; Lass, A.), s. 155-169 ISBN 978-80-244-4386-7 Institutional support: RVO:68378068 Keywords : sign * semiotics * artifice * icon * index * symbol * parallelism * aesthetic function * Saussure, F. de * Peirce, S. Subject RIV: AJ - Letters, Mass-media, Audiovision

  18. Analýza deníků Sylvie Plathové pomocí HAL

    Czech Academy of Sciences Publication Activity Database

    Kodrlová, Ida; Kaufman, Allison Beth; Kaufman, James Corey; Čermák, Ivo; Burgess, Curt

    Olomouc : Univerzita Palackého v Olomouci, 2005, s. 305-313. ISBN 80-244-1159-8 R&D Projects: GA AV ČR IAA7025402 Keywords : Sylvia Plath * Hyperspace Analog to Language (HAL) Subject RIV: AN - Psychology

  19. Domain-General and Domain-Specific Creative-Thinking Tests: Effects of Gender and Item Content on Test Performance

    Science.gov (United States)

    Hong, Eunsook; Peng, Yun; O'Neil, Harold F., Jr.; Wu, Junbin

    2013-01-01

    The study examined the effects of gender and item content of domain-general and domain-specific creative-thinking tests on four subscale scores of creative-thinking (fluency, flexibility, originality, and elaboration). Chinese tenth-grade students (234 males and 244 females) participated in the study. Domain-general creative thinking was measured…

  20. Powdery Mildew Resistance in 268 Entries of Hordeum vulgare

    DEFF Research Database (Denmark)

    Jiang, W.M.; Jørgensen, Jørgen Helms; Torp, J

    1984-01-01

    A collection of 24 'Spontaneum' barley [H. vulgare ssp. spontaneum] entries and one comprising 244 Ethiopian barleys [H. vulgare ssp. vulgare] were tested for resistance to 4 powdery mildew [used by Erysiphe graminis f. sp. hordei] cultures that carried genes for virulence corresponding to most of...

  1. Expozice komunitnímu násilí a školní šikana a jejich vztah k antisociálnímu chování v rané adolescenci

    Czech Academy of Sciences Publication Activity Database

    Sobotková, Veronika; Osecká, Terezie; Jelínek, Martin; Blatný, Marek; Hrdlička, M.

    2012-01-01

    Roč. 56, č. 5 (2012), s. 409-419. ISSN 0009-062X Institutional research plan: CEZ:AV0Z7025918 Keywords : antisocial behavior * exposure to violence * school bullying Subject RIV: AN - Psychology Impact factor: 0.244, year: 2012

  2. On the Increasing Fragility of Human Teeth with Age: ADeep-Ultraviolet Resonance Raman Study

    Energy Technology Data Exchange (ETDEWEB)

    Ager III, J.W.; Nalla, R.K.; Balooch, G.; Kim, G.; Pugach, M.; Habelitz, S.; Marshall, G.W.; Kinney, J.H.; Ritchie, R.O.

    2006-07-14

    Ultraviolet resonance Raman spectroscopy (UVRRS) using 244nm excitation was used to investigate the impact of aging on humandentin. The intensity of a spectroscopic feature from the peptide bondsin the collagen increases with tissue age, similar to a finding reportedpreviously for human cortical bone.

  3. Počáteční růstová stádia amfipor a archeocyátů – srovnání

    Czech Academy of Sciences Publication Activity Database

    Hladil, Jindřich

    Olomouc : Univerzita Palackého, 2005 - (Lehotský, T.), s. 26-28 ISBN 80-244-1111-3. [Paleontologický seminář /6./. Olomouc (CZ), 14.09.2005-15.09.2005] Institutional research plan: CEZ:AV0Z30130516 Keywords : amphiporids * archaeocyaths * earliest growth stages Subject RIV: DB - Geology ; Mineralogy

  4. How Well Can the Theory of Planned Behavior Account for Occupational Intentions?

    Science.gov (United States)

    Arnold, John; Loan-Clarke, John; Coombs, Crispin; Wilkinson, Adrian; Park, Jennifer; Preston, Diane

    2006-01-01

    We tested the capacity of an extended version of the theory of planned behavior (TPB) to account for intentions to work for the UK's National Health Service (NHS) as a nurse, physiotherapist or radiographer amongst three groups: professionally unqualified (N=507), in professional training (N=244), and professionally qualified (N=227). We found…

  5. The Phaeodactylum genome reveals the evolutionary history of diatom genomes

    Czech Academy of Sciences Publication Activity Database

    Bowler, Ch.; Allen, A. E.; Badger, J. H.; Grimwood, J.; Jabbari, K.; Kuo, A.; Maheswari, U.; Martens, C.; Maumus, F.; Otillar, R. P.; Rayko, E.; Salamov, A.; Vandepoele, K.; Beszteri, B.; Gruber, A.; Heijde, M.; Katinka, M.; Mock, T.; Valentin, K.; Verret, F.; Berges, J. A.; Brownlee, C.; Cadoret, J.-P.; Chiovitti, A.; Choi, Ch. J.; Coesel, S.; De Martino, A.; Detter, J. Ch.; Durkin, C.; Falciatore, A.; Fournet, J.; Haruta, M.; Huysman, M. J. J.; Jenkins, B. D.; Jiroutová, Kateřina; Jorgensen, R. E.; Joubert, Y.; Kaplan, A.; Kröger, N.; Kroth, P. G.; La Roche, J.; Lindquist, E.; Lommer, M.; Martin–Jézéquel, V.; Lopez, P. J.; Lucas, S.; Mangogna, M.; McGinnis, K.; Medlin, L. K.; Montsant, A.; Oudot–Le Secq, M.-P.; Napoli, C.; Oborník, Miroslav; Schnitzler Parker, M.; Petit, J.-L.; Porcel, B. M.; Poulsen, N.; Robison, M.; Rychlewski, L.; Rynearson, T. A.; Schmutz, J.; Shapiro, H.; Siaut, M.; Stanley, M.; Sussman, M. R.; Taylor, A. R.; Vardi, A.; von Dassow, P.; Vyverman, W.; Willis, A.; Wyrwicz, L. S.; Rokhsar, D. S.; Weissenbach, J.; Armbrust, E. V.; Green, B. R.; Van de Peer, Y.; Grigoriev, I. V.

    2008-01-01

    Roč. 456, 13-11-2008 (2008), s. 239-244. ISSN 0028-0836 Institutional research plan: CEZ:AV0Z60220518 Keywords : Phaeodactylum * genome * evolution * diatom Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 31.434, year: 2008

  6. Patterns of Parenting during Adolescence: Perceptions of Adolescents and Parents.

    Science.gov (United States)

    Paulson, Sharon E.; Sputa, Cheryl L.

    1996-01-01

    Explores differences in maternal and paternal parenting styles and involvement, the differences between parents' and adolescents' perceptions of parenting style and involvement, and changes in parenting style and involvement between the adolescents' 9th and 12th grade years. Subjects were 244 ninth graders from the Southeast and Midwest. Discusses…

  7. The change of microtubule lenght caused by endogebous AC fields in cell

    Czech Academy of Sciences Publication Activity Database

    Sataric, M. V.; Žakula, R.B.; Zekovic, S.; Pokorný, Jiří; Fiala, J.

    1996-01-01

    Roč. 39, č. 2 (1996), s. 127-133. ISSN 0303-2647 R&D Projects: GA ČR GA202/94/1055 Grant ostatní: MŠk(CZ) OC 244 Keywords : self -adjusting systems * biophysics * cellular biophysics Impact factor: 0.648, year: 1996

  8. Moiré deflectometry used for refractive index measurements

    Czech Academy of Sciences Publication Activity Database

    Keprt, Jiří; Bartoněk, L.

    1. Olomouc : Univerzita Palackého v Olomouci, 2006 - (Křepelka, J.), s. 133-137 ISBN 80-244-1544-5 R&D Projects: GA MŠk(CZ) 1M06002 Institutional research plan: CEZ:AV0Z10100522 Keywords : Moiré deflectometry Subject RIV: BH - Optics, Masers, Lasers

  9. Případová studie: Pastva ovcí a koz na xerotermních trávnících

    Czech Academy of Sciences Publication Activity Database

    Dostálek, J.; Frantík, Tomáš

    Vol. 2. Olomouc: Univerzita Palackého, 2012 - (Machar, I.; Drobilová, L.), s. 87-95 ISBN 978-80-244-3041-6 Institutional research plan: CEZ:AV0Z60050516 Institutional support: RVO:67985939 Keywords : grazing * dry grasslands * diversity Subject RIV: EF - Botanics http://envirup.profimap.cz/download/ochranaprirody/Pripadove_studie_digitalne.pdf

  10. Rovnica smrti a života. Problematika šoa a rezistencie československých Židov v rokoch 1938-1945

    Czech Academy of Sciences Publication Activity Database

    Zudová-Lešková, Zlatica

    Praha : Historický ústav, 2010 - (Prokš, P.), s. 223-244 ISBN 978-80-7286-165-1. - (Práce Historického ústavu AV ČR, v. v. i. Řada C. Miscellanea. 23) Institutional research plan: CEZ:AV0Z80150510 Keywords : Shoah * Holocaust * Czechoslovak Jews Subject RIV: AB - History

  11. Expression and Signal Transduction Pathways of Melatonin Receptors in the Pituitary

    Czech Academy of Sciences Publication Activity Database

    Zemková, Hana; Balík, Aleš; Stojilkovič, S.S.

    Georgetown: Eurekah.com, 2006 - (Pandi-Perumal, S.; Cardinali, D.), s. 88-104 ISBN 1-58706-244-5 R&D Projects: GA AV ČR IAA5011105; GA AV ČR IAA5011103 Institutional research plan: CEZ:AV0Z50110509 Keywords : melatonin * gonadotropin-releasing hormone * anterior pituitary Subject RIV: ED - Physiology

  12. On additive preservers of semi-Browder operators

    Czech Academy of Sciences Publication Activity Database

    Mbekhta, M.; Müller, Vladimír; Oudghiri, M.

    2014-01-01

    Roč. 59, č. 2 (2014), s. 237-244. ISSN 0035-3965 R&D Projects: GA ČR GA201/09/0473; GA AV ČR IAA100190903 Institutional support: RVO:67985840 Keywords : additive preservers * semi-Browder operators Subject RIV: BA - General Mathematics http://imar.ro/journals/Revue_Mathematique/pdfs/2014/2/6.pdf

  13. Attitudes of Undergraduate Students to the Uses of Animals.

    Science.gov (United States)

    Stanisstreet, Martin; And Others

    1993-01-01

    A survey of 244 British university undergraduates in biology, computer science, and English investigated attitudes about various uses of animals, including killing animals to make luxury clothing, killing of animals for food, general and medical research using animals, and captivity. Response differences by discipline, gender, and age were also…

  14. Catalog of thermal waters in New Mexico. Hydrologic report 4

    Energy Technology Data Exchange (ETDEWEB)

    Summers, W.K.

    1976-01-01

    Waters at 67 locations in New Mexico discharge at anomalous temperatures. Details on these thermal water resources such as the location, temperature, discharge rate, field pH, and specific conductance are presented in 29 tables and 47 figures. Included also are 244 chemical analyses of water from 38 areas.

  15. Fuel selection for radioisotope thermoelectric generators

    International Nuclear Information System (INIS)

    The availability of Radioisotope Thermoeletric Generator fuels is evaluated based on the amount of fuel discharged from selected power reactors. In general, the best alternatives are either to use Plutonium-238 produced by irradiation of Neptunium-237 generated in typical thermal reactors or to use Curium-244 directly separated from the discharged fuels of fast or thermal reactors. (author)

  16. Magnetostratigraphy of the Jurassic/Cretaceouis boundary

    Czech Academy of Sciences Publication Activity Database

    Schnabl, Petr; Grabowski, J.; Oloriz, F.; Pruner, Petr; Čížková, Kristýna; Sobien, K.; Wimbledon, W. A. P.

    Olomouc: Palacký University, 2014 - (Bábek, O.; Matys Grygar, T.; Uličný, D.). s. 87-87 ISBN 978-80-244-4098-9. [Central European Meeting of Sedimentary Geology : an international conference. 09.06.2014-13.06.2014, Olomouc] Institutional support: RVO:67985831 Keywords : magnetostratigraphy * palaeomagnetism Subject RIV: DE - Earth Magnetism, Geodesy, Geography

  17. CW frequency doubling of 1029 nm radiation using single pass bulk and waveguide PPLN crystals

    Czech Academy of Sciences Publication Activity Database

    Chiodo, N.; Du Burck, F.; Hrabina, Jan; Candela, Y.; Wallerand, J. P.; Acef, O.

    2013-01-01

    Roč. 311, 15 January (2013), s. 239-244. ISSN 0030-4018 R&D Projects: GA ČR GPP102/11/P820 Institutional support: RVO:68081731 Keywords : IR laser * second harmonic generation * waveguide and bulk crystals * periodically poled lithium niobate * 1029 nm wavelength Subject RIV: BH - Optics, Masers, Lasers Impact factor: 1.542, year: 2013

  18. Identification of the aeroelastic profile based on optical measurement

    Czech Academy of Sciences Publication Activity Database

    Chládek, Štěpán; Zolotarev, Igor

    Brno: Brno University of Technology , 2014 - (Fuis, V.), s. 244-247 ISBN 978-80-214-4871-1. ISSN 1805-8248. [Engineering Mechanics 2014 /20./. Svratka (CZ), 12.05.2014-15.05.2014] R&D Projects: GA ČR GA13-10527S Institutional support: RVO:61388998 Keywords : system identification * aeroelastic profile * optical measurement Subject RIV: BI - Acoustics

  19. GenBank blastx search result: AK107592 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK107592 002-131-A07 AL158826.23 Human DNA sequence from clone RP11-244N20 on chromosome 9 Conta ... sin type) with thrombospondin type 1 motif 13, the SURF1 ... gene for surfeit 1, the SURF2 gene for surfeit 2, ...

  20. GenBank blastx search result: AK061725 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK061725 001-038-B03 AL158826.23 Human DNA sequence from clone RP11-244N20 on chromosome 9 Conta ... sin type) with thrombospondin type 1 motif 13, the SURF1 ... gene for surfeit 1, the SURF2 gene for surfeit 2, ...

  1. GenBank blastx search result: AK062210 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK062210 001-047-A04 AL158826.23 Human DNA sequence from clone RP11-244N20 on chromosome 9 Conta ... sin type) with thrombospondin type 1 motif 13, the SURF1 ... gene for surfeit 1, the SURF2 gene for surfeit 2, ...

  2. GenBank blastx search result: AK105467 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK105467 001-126-A05 AL158826.23 Human DNA sequence from clone RP11-244N20 on chromosome 9 Conta ... sin type) with thrombospondin type 1 motif 13, the SURF1 ... gene for surfeit 1, the SURF2 gene for surfeit 2, ...

  3. GenBank blastx search result: AK108838 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK108838 002-151-H01 AL158826.23 Human DNA sequence from clone RP11-244N20 on chromosome 9 Conta ... sin type) with thrombospondin type 1 motif 13, the SURF1 ... gene for surfeit 1, the SURF2 gene for surfeit 2, ...

  4. GenBank blastx search result: AK241630 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK241630 J065187N12 AL158826.23 AL158826 Human DNA sequence from clone RP11-244N20 on chromosome ... sin type) with thrombospondin type 1 motif 13, the SURF1 ... gene for surfeit 1, the SURF2 gene for surfeit 2, ...

  5. Mirrors for pion spectrometer DIRAC

    Czech Academy of Sciences Publication Activity Database

    Pech, Miroslav; Schovánek, Petr; Hrabovský, Miroslav; Řídký, Jan; Mandát, Dušan; Nožka, Libor; Palatka, Miroslav

    1. Olomouc : Univerzita Palackého v Olomouci, 2006 - (Křepelka, J.), s. 109-110 ISBN 80-244-1544-5 R&D Projects: GA MŠk(CZ) 1M06002 Institutional research plan: CEZ:AV0Z10100522 Keywords : mirrors * pion spectrometer DIRAC Subject RIV: BH - Optics, Masers, Lasers

  6. The Genus Arsenophonus

    Czech Academy of Sciences Publication Activity Database

    Wilkes, T. E.; Duron, O.; Darby, A. C.; Hypša, Václav; Nováková, Eva; Hurst, G. D. D.

    Florida : CRC Press, Taylor and Francis Group, 2011 - (Zchori-Fein, E.; Bourtzis, K.), s. 225-244 ISBN 9781439827499. - (Frontiers in Microbiology) Institutional research plan: CEZ:AV0Z60220518 Keywords : phenotypes * symbiosis * inherited symbionts of arthropods Subject RIV: EE - Microbiology, Virology

  7. Coordination of auxin and ethylene biosynthesis by the aminotransferase VAS1

    Czech Academy of Sciences Publication Activity Database

    Zheng, Z.Y.; Guo, Y.X.; Novák, Ondřej; Dai, X.H.; Zhao, Y.D.; Ljung, K.; Noel, J.P.; Chory, J.

    2013-01-01

    Roč. 9, č. 4 (2013), s. 244-246. ISSN 1552-4450 R&D Projects: GA AV ČR KAN200380801 Institutional research plan: CEZ:AV0Z50380511 Keywords : PLANT DEVELOPMENT * SHADE AVOIDANCE * ARABIDOPSIS Subject RIV: EC - Immunology Impact factor: 13.217, year: 2013

  8. Data získaná z komparativních politologických šetření

    Czech Academy of Sciences Publication Activity Database

    Lyons, Pat

    Praha : SLON, 2012 - (Krejčí, J.; Leontiyeva, Y.), s. 244-267 ISBN 978-80-7419-111-4; ISBN 978-80-7330-204-7 R&D Projects : GA MŠk LA09010 Institutional support: RVO:68378025 Keywords : political attitudes * voting behaviour * comparative survey research Subject RIV: AO - Sociology, Demography

  9. Identification of the double-bond position in fatty acid methyl esters by liquid chromatography/atmospheric pressure chemical ionisation mass spectrometry

    Czech Academy of Sciences Publication Activity Database

    Vrkoslav, Vladimír; Cvačka, Josef

    2012-01-01

    Roč. 1259, 12 Oct (2012), s. 244-250. ISSN 0021-9673 R&D Projects: GA ČR GA203/09/0139 Institutional research plan: CEZ:AV0Z40550506 Keywords : APCI * double-bond localisation * fatty acids Subject RIV: CC - Organic Chemistry Impact factor: 4.612, year: 2012

  10. Dairy Products, Dietary Calcium, and Risk of Inflammatory Bowel Disease

    DEFF Research Database (Denmark)

    Opstelten, Jorrit L; Leenders, Max; Dik, Vincent K;

    2016-01-01

    , yogurt, and cheese) and dietary calcium was measured using validated food frequency questionnaires. Cases developing incident CD (n = 110) or UC (n = 244) during follow-up were matched with 4 controls. Conditional logistic regression analyses were used to calculate odds ratios (ORs) with 95% confidence...

  11. Microhabitats of Collembola (Insecta: Entognatha) in beech and spruce forests and their influence on biodiversity

    Czech Academy of Sciences Publication Activity Database

    Rusek, Josef

    2001-01-01

    Roč. 37, - (2001), s. 237-244. ISSN 1164-5563 R&D Projects: GA AV ČR IAA6066702; GA ČR GA206/99/1416 Institutional research plan: CEZ:AV0Z6066911 Keywords : Collembola communities * biodiversity Subject RIV: EH - Ecology, Behaviour Impact factor: 0.317, year: 2001

  12. Serologic Evidence of Dengue Infection before Onset of Epidemic, Bangladesh

    OpenAIRE

    Hossain, M Anowar; Khatun, Mahmuda; Arjumand, Farzana; Nisaluk, Ananda; Breiman, Robert F.

    2003-01-01

    Dengue fever emerged in Bangladesh in 2000. We tested 225 serum and plasma samples from febrile patients and 184 blood donors in 1996 and 1997 for dengue antibodies; 55 (24.4%) febrile patients had dengue antibodies (65.5% with secondary infection pattern), compared with one (0.54%) donor (p < 0.001), suggesting that dengue transmission was ongoing well before 1996.

  13. On the Conditioning of Factors in the SR Decomposition

    Czech Academy of Sciences Publication Activity Database

    Fassbender, H.; Rozložník, Miroslav

    2016-01-01

    Roč. 505, 15 September (2016), s. 224-244. ISSN 0024-3795 R&D Projects: GA ČR GA13-06684S Institutional support: RVO:67985807 Keywords : SR decomposition * symplectic matrices * skew-symmetric bilinear forms * orthogonalization * condition number Subject RIV: BA - General Mathematics Impact factor: 0.939, year: 2014

  14. Perceptions of the Utility of Professional Education Topics.

    Science.gov (United States)

    Young, Robert B.; Coldwell, LuAnn Linson

    1993-01-01

    Student affairs professionals (n=244) rater utility of 10 professional developmental competencies, skills, and attributes. Their assessments differed significantly according to their current and projected work responsibilities. Cultural diversity and values/ethics/philosophy were rated very highly, suggesting that student affairs has…

  15. 78 FR 65690 - Extension of the Designation of Somalia for Temporary Protected Status

    Science.gov (United States)

    2013-11-01

    ... not need to pay the fee for the Application for Temporary Protected Status (Form I-821). See 8 CFR 244... Service Center at 800-375-5283 (TTY 800-767-1833). Service is available in English and Spanish. Further... conditions resulting from armed conflict. See 56 FR 46804 (Sept. 16, 1991). The initial designation...

  16. 78 FR 20123 - Extension of the Designation of Honduras for Temporary Protected Status

    Science.gov (United States)

    2013-04-03

    ... an application for re-registration, you do not need to pay the fee for the Application for Temporary...). Service is available in English and Spanish. Further information will also be available at local USCIS..., specifically the devastation resulting from Hurricane Mitch. See 64 FR 524; section 244(b)(1)(B) of the INA,...

  17. 78 FR 20128 - Extension of the Designation of Nicaragua for Temporary Protected Status

    Science.gov (United States)

    2013-04-03

    ... do not need to pay the fee for the Application for Temporary Protected Status (Form I-821). See 8 CFR...). Service is available in English and Spanish. Further information will also be available at local USCIS... FR 526; section 244(b)(1)(B) of the INA, 8 U.S.C. 1254a(b)(1)(B). The Secretary last extended...

  18. Influence of the morphology of organic heterojunction on the photovoltaic cell performance

    Czech Academy of Sciences Publication Activity Database

    Podhájecká, Klára; Pfleger, Jiří

    2006-01-01

    Roč. 36, č. 3 (2006), s. 241-244. ISSN 1286-0042 R&D Projects: GA ČR GP203/06/P226; GA AV ČR IAA4050406 Institutional research plan: CEZ:AV0Z40500505 Keywords : photovoltaic cell * heterojunction * morphology Subject RIV: CD - Macromolecular Chemistry Impact factor: 0.938, year: 2006

  19. AcEST: DK963216 [AcEST

    Lifescience Database Archive (English)

    Full Text Available EU2_CAVPO Vasopressin-neurophysin 2-copeptin OS=Cavia... 32 2.2 sp|Q869S5|DOKA_DICDI Hybrid signal transduct...STSSA 233 Query: 290 ---DADPPSSP 313 D P+ P Sbjct: 234 YSTDQQKPNQP 244 >sp|P10769|NEU2_CAVPO Vasopressin-neurophysin 2-copeptin

  20. A new species of Bathycreadium Kabata, 1961 (Digenea: Opecoelidae) from Phycis blennoides (Brünnich) (Gadiformes: Phycidae) in the western Mediterranean

    Czech Academy of Sciences Publication Activity Database

    Pérez-del-Olmo, A.; Dallarés, S.; Carrasson, M.; Kostadinova, Aneta

    2014-01-01

    Roč. 88, č. 3 (2014), s. 233-244. ISSN 0165-5752 R&D Projects: GA ČR GBP505/12/G112 Institutional support: RVO:60077344 Keywords : Digenea * Mediterranean * fish Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.336, year: 2014

  1. Wessen Lehrlinginn? Marie Anna Sager (1719-1805) und der Kulturtransfer im Sozialsystem Literatur

    Czech Academy of Sciences Publication Activity Database

    Wögerbauer, Michael

    Olomouc : Univerzita Palackého, 2011 - (Todorow, A.; Weinberg, M.), s. 47-65 ISBN 978-80-244-2752-2. - (Beiträge zur deutschmährischen Literatur. 16) Institutional research plan: CEZ:AV0Z90560517 Keywords : Czech literature * German literature * Sager, Maria Anna Subject RIV: AJ - Letters, Mass-media, Audiovision

  2. Ti, kteří milují umění jako Anna Grigorjevna, aneb kritika „estetické obhajoby umění“ v kontextu kulturního materialismu

    Czech Academy of Sciences Publication Activity Database

    Müller, Richard

    Olomouc : Univerzita Palackého v Olomouci, 2014 - (Hrabal, J.), s. 9-25 ISBN 978-80-244-4389-8 R&D Projects: GA ČR GAP406/10/2127 Institutional support: RVO:68378068 Keywords : censorship * literature Subject RIV: AJ - Letters, Mass-media, Audiovision

  3. Jaroslav Vrchlický a strategie obhajoby před tiskovým soudem

    Czech Academy of Sciences Publication Activity Database

    Charypar, Michal

    Olomouc : Univerzita Palackého v Olomouci, 2014 - (Hrabal, J.), s. 39-50 ISBN 978-80-244-4389-8 R&D Projects: GA ČR GAP406/10/2127 Institutional support: RVO:68378068 Keywords : censorship * literature * 19th century * Vrchlický, Jaroslav * institutions Subject RIV: AJ - Letters, Mass-media, Audiovision

  4. Geometry of finite deformations and time-incremental analysis

    Czech Academy of Sciences Publication Activity Database

    Fiala, Zdeněk

    2016-01-01

    Roč. 81, May (2016), s. 230-244. ISSN 0020-7462 Institutional support: RVO:68378297 Keywords : solid mechanics * finite deformations * time-incremental analysis * Lagrangian system * evolution equation of Lie type Subject RIV: BE - Theoretical Physics Impact factor: 1.977, year: 2014 http://www.sciencedirect.com/science/article/pii/S0020746216000330

  5. Preparation and characterization of ZnS nanoparticles deposited on montmorillonite

    Czech Academy of Sciences Publication Activity Database

    Kozák, O.; Praus, P.; Kočí, K.; Klementová, Mariana

    2010-01-01

    Roč. 352, č. 2 (2010), s. 244-251. ISSN 0021-9797 Institutional research plan: CEZ:AV0Z40320502 Keywords : ZnS nanoparticles * montmorillonite * photoluminescence * photocatalysis * carbon dioxide Subject RIV: CA - Inorganic Chemistry Impact factor: 3.068, year: 2010

  6. Mutations in MFSD8, encoding a lysosomal membrane protein, are associated with nonsyndromic autosomal recessive macular dystrophy

    NARCIS (Netherlands)

    Roosing, S.; Born, L.I. van den; Sangermano, R.; Banfi, S.; Koenekoop, R.K.; Zonneveld-Vrieling, M.N.; Klaver, C.C.; Lith-Verhoeven, J.J. van; Cremers, F.P.M.; Hollander, A.I. den; Hoyng, C.B.

    2015-01-01

    PURPOSE: This study aimed to identify the genetic defects in 2 families with autosomal recessive macular dystrophy with central cone involvement. DESIGN: Case series. PARTICIPANTS: Two families and a cohort of 244 individuals with various inherited maculopathies and cone disorders. METHODS: Genome-w

  7. A Seat at the Table: K-12 and Higher Ed Collaboration to Align Evaluation Instruments for School Librarians and Teachers

    Science.gov (United States)

    Grigsby, Susan K. S.; Helfrich, Jennifer; Deissler, Christa Harrelson

    2015-01-01

    This article describes how school librarians in Gwinnett County Public Schools (GCPS) in Georgia addressed a concern regarding the performance evaluation tool that stemmed from the passing of House Bill (HB) 244, which was passed in response to the state's Race to the Top (RT3) application requirements. The bill became law on July 1, 2014, and the…

  8. Phospholipase Dζ2 Drives Vesicular Secretion of Auxin for Its Polar Cell-Cell Transport in the Transition Zone of the Root Apex

    Czech Academy of Sciences Publication Activity Database

    Mancuso, S.; Marras, A.M.; Mugnai, S.; Schlicht, M.; Žárský, Viktor; Li, G.; Song, L.; Xue, H.W.; Baluška, F.

    2007-01-01

    Roč. 2, č. 4 (2007), s. 240-244. ISSN 1559-2316 Institutional research plan: CEZ:AV0Z50380511 Keywords : auxin * Brefeldin A * plant synapse * phospholipase D Subject RIV: EB - Genetics ; Molecular Biology www.landesbioscience.com/journals/psb/abstract.php?id=4566

  9. HUBUNGAN SISTEM PEMBELAJARAN, LINGKUNGAN BELAJAR, KONSEP DIRI DAN PENGEMBANGAN EMPLOYABILITY SKILLS MAHASISWA

    OpenAIRE

    I Made Suarta

    2013-01-01

    Tujuan penelitian adalah memperoleh model struktural pengembangan employability skills mahasiswa. Penelitian bersifat ex-post facto, menggunakan pendekatan kuantitatif non-eksperimen. Populasi penelitian adalah lulusan Politeknik Negeri Bali tahun 2009 dan mahasiswa tingkat akhir tahun akademik 2009/2010 yang sedang melakukan praktik kerja lapangan di industri. Ukuran sampel sebanyak 244, dipilih secara proportional random sampling. Pengumpulan data dilakukan menggunakan kuesioner dengan skal...

  10. Children's Moral Self-Concept: The Role of Aggression and Parent-Child Relationships

    Science.gov (United States)

    Sengsavang, Sonia; Krettenauer, Tobias

    2015-01-01

    This study examined the role of aggressiveness and parenting in the development of children's moral self-concept. Participants were 198 elementary school children and their parents (M = 8.65 years, SD = 2.44). Participants completed a structured moral self puppet interview and a questionnaire about their relationship to parents. Parents completed…

  11. Magnetohydrodynamic pumps for molten salts in cooling loops of high-temperature nuclear reactors

    Czech Academy of Sciences Publication Activity Database

    Doležel, Ivo; Kotlan, V.; Ulrych, B.

    2011-01-01

    Roč. 87, č. 5 (2011), s. 28-33. ISSN 0033-2097 Grant ostatní: GA MŠk(CZ) MEB051041 Institutional research plan: CEZ:AV0Z20570509 Keywords : magnetohydrodynamic pump * molten salt * electric field Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering Impact factor: 0.244, year: 2011 http://pe.org.pl/

  12. Examining Holland's Person-Environment Fit, Workplace Aggression, Interpersonal Conflict, and Job Satisfaction

    Science.gov (United States)

    Pseekos, A. Chantelle; Bullock-Yowell, Emily; Dahlen, Eric R.

    2011-01-01

    The researchers examined the impact of person-environment (P-E) fit, as defined by Holland's (1997) theory, on interpersonal conflict at work (ICAW) and workplace aggression. In addition, previous relationships found in the job satisfaction literature were examined in the present sample of 244 United States employees. Internet-based surveys were…

  13. Changing School Board Governance in Primary Education through School Inspections

    Science.gov (United States)

    Ehren, Melanie C. M.; Honingh, M. E.; Hooge, E. H.; O'Hara, J.

    2016-01-01

    This paper addresses if, and to what extent, the current working methods of the Dutch Inspectorate of Education affect the governance of school boards in schools for primary education. A key facet of the working method is the inspection meeting with the school board. Drawing upon a large quantitative study (n = 244) we are able to identify some…

  14. A Study of Methods for Estimating Distributions of Test Scores.

    Science.gov (United States)

    Cope, Ronald T.; Kolen, Michael J.

    This study compared five density estimation techniques applied to samples from a population of 272,244 examinees' ACT English Usage and Mathematics Usage raw scores. Unsmoothed frequencies, kernel method, negative hypergeometric, four-parameter beta compound binomial, and Cureton-Tukey methods were applied to 500 replications of random samples of…

  15. Text-analytic Measurement of Effectuation and Causation Orientations among Small and Global Business Managers

    DEFF Research Database (Denmark)

    Mattsson, Jan; Helmersson, Helge

    2012-01-01

    reasons behind company growth. Using Ward’s clustering method (J Am Stat Assoc 58:236–244, 1963) on a binary matrix for connections between textual components, we suggest using the ESS value from clustering to calculate AFFI as an overall measure of quality. By further splitting the AFFI into three sub...

  16. Application of sum rule to the dispersion model of hydrogenated amorphous silicon

    Czech Academy of Sciences Publication Activity Database

    Franta, D.; Nečas, D.; Zajíčková, L.; Ohlídal, I.; Stuchlík, Jiří; Chvostová, Dagmar

    2013-01-01

    Roč. 539, JUL (2013), s. 233-244. ISSN 0040-6090 Institutional support: RVO:68378271 Keywords : optical constants * ellipsometry * spectrophotometry * a-Si:H * Urbach tail * localized states * sum rule Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.867, year: 2013

  17. Chinese Adolescents' Social Status Goals: Associations with Behaviors and Attributions for Relational Aggression

    Science.gov (United States)

    Wright, Michelle F.; Li, Yan; Shi, Junqi

    2014-01-01

    This study examined two social status goals in relation to aggressive and prosocial behaviors as well as attributions for relational aggression among 477 (244 girls) Chinese early adolescents. Findings indicate that, after controlling for each other, the social preference goal was negatively related to self-reported overt aggression, and…

  18. Konfigurace zkušenosti: figury a zápletky které žijeme

    Czech Academy of Sciences Publication Activity Database

    Chrz, Vladimír

    1. vyd. Olomouc : Universita Palackého, 2005 - (Miovský, M.; Čermák, I.; Chrz, V.), s. 129-139 ISBN 80-244-1159-8 Institutional research plan: CEZ:AV0Z70250504 Keywords : narrative research * configuration * experience * figure * plot Subject RIV: AN - Psychology

  19. Zrcadlový systém pro atmosférický LIDAR

    Czech Academy of Sciences Publication Activity Database

    Pech, Miroslav; Schovánek, Petr; Hrabovský, Miroslav; Řídký, Jan; Mandát, Dušan; Nožka, Libor; Palatka, Miroslav

    1. Olomouc : Univerzita Palackého v Olomouci, 2006 - (Křepelka, J.), s. 106-108 ISBN 80-244-1544-5 R&D Projects: GA MŠk(CZ) 1M06002 Institutional research plan: CEZ:AV0Z10100522 Keywords : mirror system LIDAR * LIDAR Subject RIV: BH - Optics, Masers, Lasers

  20. Superkritická fluidní chromatografie

    Czech Academy of Sciences Publication Activity Database

    Planeta, Josef

    Praha : Lucie Nováková, Michal Douša, 2013, s. 244-250 ISBN 978-80-260-4243-3 Institutional support: RVO:68081715 Keywords : supercritical fluid chromatography * overview Subject RIV: CB - Analytical Chemistry, Separation http://hdl.handle.net/11104/0222563

  1. Facial Symmetry in Robust Anthropometrics

    Czech Academy of Sciences Publication Activity Database

    Kalina, Jan

    2012-01-01

    Roč. 57, č. 3 (2012), s. 691-698. ISSN 0022-1198 R&D Projects: GA MŠk(CZ) 1M06014 Institutional research plan: CEZ:AV0Z10300504 Keywords : forensic science * anthropology * robust image analysis * correlation analysis * multivariate data * classification Subject RIV: BB - Applied Statistics, Operational Research Impact factor: 1.244, year: 2012

  2. Unigene BLAST: CBRC-MMUS-09-0209 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MMUS-09-0209 gnl|UG|Mm#S10844081 Mus musculus adult male hypothalamus cDNA, RIKEN full-leng ... LONE SKMUS2001129, WEAKLY SIMILAR TO NAD-DEPENDENT METHANOL ... DEHYDROGENASE (EC 1.1.1.244) homolog [Homo sapiens ...

  3. Teleskop s velkou elevací - HEAT

    Czech Academy of Sciences Publication Activity Database

    Mandát, Dušan; Hrabovský, Miroslav; Schovánek, Petr; Palatka, Miroslav; Pech, Miroslav; Nožka, Libor; Halenka, Viktor; Marek, Milan

    Olomouc : Univerzita Palackého v Olomouci, 2007 - (Křepelka, J.), s. 123-127 ISBN 978-80-244-1844-5 R&D Projects: GA MŠk(CZ) 1M06002 Institutional research plan: CEZ:AV0Z10100522 Keywords : Pierre Auger * HEAT * fluorescence light * FD detect Subject RIV: BH - Optics, Masers, Lasers

  4. Chinese Teachers' Attributions and Coping Strategies for Student Classroom Misbehaviour

    Science.gov (United States)

    Ding, Meixia; Li, Yeping; Li, Xiaobao; Kulm, Gerald

    2010-01-01

    In this study, we investigated Chinese teachers' attributions and coping strategies for classroom misbehaviour across grade levels. A total of 244 teachers (Grades 1-12) from the Chinese mainland participated in this survey. Results indicated that Chinese teachers first attributed misbehaviour to student characteristics, such as being "lazy, not…

  5. Variation in Raven's Progressive Matrices Scores across Time and Place

    Science.gov (United States)

    Brouwers, Symen A.; Van de Vijver, Fons J. R.; Van Hemert, Dianne A.

    2009-01-01

    The paper describes a cross-cultural and historical meta-analysis of Raven's Progressive Matrices. Data were analyzed of 798 samples from 45 countries (N = 244,316), which were published between 1944 and 2003. Country-level indicators of educational permeation (which involves a broad set of interrelated educational input and output factors that…

  6. Risk and Urban School Transition in Early Adolescence

    Science.gov (United States)

    Ward, Sharon; Sylva, Judith; Gresham, Frank M.; Wantz-Sutton, Jacqueline L.

    2007-01-01

    This is a comparison study of 244 early adolescents attending sixth grade at either an urban elementary school or an urban middle school. Utilizing four data collection instruments, it compares the adolescent groups' degrees of loneliness, levels of positive self-concept, academic competence, problem behaviors, and social skills. Results indicate…

  7. Drug: D03287 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D03287 Drug Elcatonin (JP16/INN); Adevirock (TN) C148H244N42O47 3361.7994 3363.7742 Therapeutic ... ) Neuroactive ligand-receptor interaction map07047 Osteoporosis ... drugs Therapeutic category of drugs in Japan [BR:b ...

  8. Drug: D03545 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D03545 Drug Clodronic acid (USAN/INN) CH4Cl2O6P2 243.886 244.8924 D03545.gif Regulator [calcium] ... ATC code: M05BA02 map07047 Osteoporosis ... drugs Anatomical Therapeutic Chemical (ATC) classi ...

  9. Reprezentace shodných zobrazení

    Czech Academy of Sciences Publication Activity Database

    Roubíček, Filip

    Olomouc : Univerzita Palackého v Olomouci, 2012 - (Uhlířová, M.), s. 241-245 ISBN 978-80-244-3048-5. [Elementary Mathematics Education 2012. Olomouc (CZ), 25.04.2012-27.04.2012] Institutional support: RVO:67985840 Keywords : elementary geometry * isometry in plane * modelling Subject RIV: AM - Education

  10. Die Professoren und Dozenten der Friedrich-Alexander-Universität 1743-1960 : Teil 1: Theologische Fakultät, Juristische Fakultät

    OpenAIRE

    Wedel-Schaper, Eva; Hafner, Christoph; Ley, Astrid

    2010-01-01

    Das Verzeichnis enthält 244 kurze Personalbiographien der Professoren und Privatdozenten, die zwischen 1743 und 1960 mindestens ein Semester lang in der Juristischen oder Rechtswissenschaftlichen Fakultät der Universität Erlangen gelehrt haben. Die Einträge sind alphabetisch nach den Familiennamen geordnet, jedoch nach den Fakultäten getrennt.

  11. Cestopis jako prostředek ke spáse? Poutnické itineráře a odpustkové seznamy do Svaté země ze střední Evropy (14.-16. století)

    Czech Academy of Sciences Publication Activity Database

    Svátek, Jaroslav

    Olomouc: Univerzita Palackého v Olomouci, 2015 - (Hrabal, J.), s. 43-54 ISBN 978-80-244-4876-3 R&D Projects: GA ČR(CZ) GBP405/12/G148 Institutional support: RVO:67985955 Keywords : travelogues * pilgrimage * fourteenth century * fifteenth century * Jerusalem Subject RIV: AB - History

  12. Academic Self-Efficacy Beliefs of Undergraduate Mathematics Education Students

    Science.gov (United States)

    Turgut, Melih

    2013-01-01

    The present paper investigated academic self-efficacy beliefs of undergraduate mathematics education students with respect to gender, academic performance and grade level. The participants were a total of 244 undergraduate students (195 females and 49 males) enrolled to department of mathematics education (57 freshmen, 106 sophomores and 81…

  13. : a highly water-soluble biradical for efficient dynamic nuclear polarization of biomolecules.

    Science.gov (United States)

    Jagtap, Anil P; Geiger, Michel-Andreas; Stöppler, Daniel; Orwick-Rydmark, Marcella; Oschkinat, Hartmut; Sigurdsson, Snorri Th

    2016-05-19

    Dynamic nuclear polarization (DNP) is an efficient method to overcome the inherent low sensitivity of magic-angle spinning (MAS) solid-state NMR. We report a new polarizing agent (), designed for biological applications, that yielded an enhancement value of 244 in a microcrystalline SH3 domain sample at 110 K. PMID:27161650

  14. Deprese z pohledu psychologie osobních konstruktů

    Czech Academy of Sciences Publication Activity Database

    Kovářová, Marie; Filip, Miroslav

    2012-01-01

    Roč. 56, č. 5 (2012), s. 435-447. ISSN 0009-062X R&D Projects: GA ČR(CZ) GAP407/12/2432 Institutional support: RVO:68081740 Keywords : depression * psychology of personal constructs * psychotherapy Subject RIV: AN - Psychology Impact factor: 0.244, year: 2012

  15. Psychologické souvislosti ekonomické recese

    Czech Academy of Sciences Publication Activity Database

    Šolcová, Iva; Slezáčková, Alena; Franková, E.; Greenglass, E.

    2012-01-01

    Roč. 56, č. 1 (2012), s. 64-72. ISSN 0009-062X Institutional research plan: CEZ:AV0Z70250504 Keywords : economic recession * unemployment * financial strain * mental state Subject RIV: AN - Psychology Impact factor: 0.244, year: 2012

  16. 77 FR 18260 - Outer Continental Shelf (OCS), Alaska OCS Region, Cook Inlet Planning Area, Proposed Oil and Gas...

    Science.gov (United States)

    2012-03-27

    ... ecological and socio-cultural effects of oil and gas activities. NEPA analyses were prepared for the previous... level of environmental analysis, if the level of industry interest is such that BOEM recommends... Area, Proposed Oil and Gas Lease Sale 244 for OCS Oil and Gas Leasing Program 2012-2017 AGENCY:...

  17. Long-Term Effects of the Family Bereavement Program on Multiple Indicators of Grief in Parentally Bereaved Children and Adolescents

    Science.gov (United States)

    Sandler, Irwin N.; Ma, Yue; Tein, Jenn-Yun; Ayers, Tim S.; Wolchik, Sharlene; Kennedy, Cara; Millsap, Roger

    2010-01-01

    Objectives: This article reports on results from a randomized experimental trial of the effects of the Family Bereavement Program (FBP) on multiple measures of grief experienced by parentally bereaved children and adolescents over a 6-year period. Method: Participants were 244 youths (ages 8-16, mean age = 11.4 years) from 156 families that had…

  18. Novel recurrent mutations in ethanolamine kinase 1 (ETNK1) gene in systemic mastocytosis with eosinophilia and chronic myelomonocytic leukemia

    International Nuclear Information System (INIS)

    Although KITD816V occurs universally in adult systemic mastocytosis (SM), the clinical heterogeneity of SM suggests presence of additional phenotype-patterning mutations. Because up to 25% of SM patients have KITD816V-positive eosinophilia, we undertook whole-exome sequencing in a patient with aggressive SM with eosinophilia to identify novel genetic alterations. We conducted sequencing of purified eosinophils (clone/tumor sample), with T-lymphocytes as the matched control/non-tumor sample. In addition to KITD816V, we identified a somatic missense mutation in ethanolamine kinase 1 (ETNK1N244S) that was not present in 50 healthy controls. Targeted resequencing of 290 patients showed ETNK1 mutations to be distributed as follows: (i) SM (n=82; 6% mutated); (ii) chronic myelomonocytic leukemia (CMML; n=29; 14% mutated); (iii) idiopathic hypereosinophilia (n=137; <1% mutated); (iv) primary myelofibrosis (n=32; 0% mutated); and (v) others (n=10; 0% mutated). Of the 82 SM cases, 25 had significant eosinophilia; of these 20% carried ETNK1 mutations. The ten mutations (N244S=6, N244T=1, N244K=1, G245A=2) targeted two contiguous amino acids in the ETNK1 kinase domain, and are predicted to be functionally disruptive. In summary, we identified novel somatic missense ETNK1 mutations that were most frequent in SM with eosinophilia and CMML; this suggests a potential pathogenetic role for dysregulated cytidine diphosphate-ethanolamine pathway metabolites in these diseases

  19. Tributyltin disrupts feeding and energy metabolism in the goldfish (Carassius auratus).

    Science.gov (United States)

    Zhang, Jiliang; Sun, Ping; Yang, Fan; Kong, Tao; Zhang, Ruichen

    2016-06-01

    Tributyltin (TBT) can induce obesogen response. However, little is known about the adverse effects of TBT on food intake and energy metabolism. The present study was designed to investigate the effects of TBT, at environmental concentrations of 2.44 and 24.4 ng/L (1 and 10 ng/L as Sn), on feeding and energy metabolism in goldfish (Carassius auratus). After exposure for 54 d, TBT increased the weight gain and food intake in fish. The patterns of brain neuropeptide genes expression were in line with potential orexigenic effects, with increased expression of neuropeptide Y and apelin, and decreased expression of pro-opiomelanocortin, ghrelin, cocaine and amphetamine-regulated transcript, and corticotropin-releasing factor. Interestingly, the energy metabolism indicators (oxygen consumption, ammonia exertion and swimming activity) and the serum thyroid hormones were all significantly increased at the 2.44 ng/L TBT group in fish. However, no changes of energy metabolism indicators or a decrease of thyroid hormones was found at the 24.4 ng/L TBT group, which indicated a complex disrupting effect on metabolism of TBT. In short, TBT can alter feeding and energy metabolism in fish, which might promote the obesogenic responses. PMID:26971175

  20. The stabilization of hypoxia inducible factor modulates differentiation status and inhibits the proliferation of mouse embryonic stem cells

    Czech Academy of Sciences Publication Activity Database

    Binó, Lucia; Kučera, J.; Štefková, K.; Šindlerová, Lenka; Lanová, M.; Kudová, J.; Kubala, Lukáš; Pachernik, J.

    2016-01-01

    Roč. 244, JAN2016 (2016), s. 204-214. ISSN 0009-2797 R&D Projects: GA MŠk(CZ) EE2.3.30.0030 Institutional support: RVO:68081707 Keywords : Hypoxia * HIF-1 * Prolyl hydroxylase Subject RIV: BO - Biophysics Impact factor: 2.577, year: 2014