WorldWideScience

Sample records for californium 243

  1. Historical review of californium-252 discovery and development

    International Nuclear Information System (INIS)

    Stoddard, D.H.

    1985-01-01

    This paper discusses the discovery and history of californium 252. This isotope may be synthesized by irradiating plutonium 239, plutonium 242, americium 243, or curium 244 with neutrons in a nuclear reactor. Various experiments and inventions involving 252 Cf conducted at the Savannah River Plant are discussed. The evolution of radiotherapy using californium 252 is reviewed

  2. Californium-252

    International Nuclear Information System (INIS)

    1975-01-01

    This meeting constituted the third phase of a project initiated by the Dosimetry Section of the IAEA in 1973. The first step, early in 1973, consisted of the development of a programme for the loan of Cf-252 sources to the Member States in support of education, training and some limited research. To date, 14 institutions in 13 Member States have participated in this loan programme. In August last year, the Agency published an instructional syllabus and laboratory manual authored by Professors Eric J. Hall and Harald H. Rossi of Columbia University (Californium-252 in Teaching and Research, Technical Reports Series No. 159). The appearance of this publication, including guidance on the design and construction of a storage and use facility, was the second phase of this programme aimed at providing some support to potential users in the fields of radiation biology and dosimetry. The objective of the programme's third phase - the convening of an Educational Seminar - was to provide a forum to bring together participants in the Agency's loan programme and experts in various scientific fields. Specifically, the Seminar consisted of a series of expert presentations in spectrometry, activation and prompt gamma analyses, on-stream analysis, dosimetry, health physics, radiology and radiotherapy. (author)

  3. Magnetism in californium

    International Nuclear Information System (INIS)

    Moore, J.R.

    1988-03-01

    A SQUID-based magnetic susceptometer has been constructed for studying small radioactive samples at temperatures below 350 K and in magnetic fields up to 50 kilogauss. The device has been used to study californium (element 98) in a number of solid-state forms: the dhcp metal, several oxides (Cf 2 O 3 in both the bcc and monoclinic structures, Cf 7 O 12 , CfO 2 and BaCfO 3 ), several monopnictides (CfN, CfAs and CfSb) and the trichloride (in both the hexagonal and orthorhombic structures). All of these materials were studied in polycrystalline form, and hexagonal CfCl 3 was studied in single-crystal form as well. The susceptometer has the sensitivity to measure samples containing less than 10 micrograms of californium. The magnetic susceptibilities of all of the californium materials at temperatures above about 100 K are described well by the Curie-Weiss relationship. This behavior is consistent with the assumption that the magnetic 5f electrons are localized and that the paramagnetic behavior can be interpreted in terms of the properties of the free ion. The measured values of the effective paramagnetic moment, μ/sub eff/, for all the californium materials that were studied are reasonably consistent with theoretical values based on intermediate coupling models. All of the californium materials showed some indications of cooperative magnetic effects. The dhcp metal was observed to order ferromagnetically at 52 K, and all of the californium compounds studied showed signs of antiferromagnetic ordering, mostly at temperatures below 25 K. 91 refs., 50 figs., 19 tabs

  4. Medical applications of californium-252

    International Nuclear Information System (INIS)

    Oliver, G.D. Jr.

    1975-01-01

    Primarily, californium-252 sources have been utilized in medicine for the treatment of neoplastic lesions. For five years, a coordinated effort between several cancer research institutions and national laboratories has developed the necessary physics, radiobiology, and engineering skills to establish an evaluation program for californium. Several more years of combined effort are required before it is known whether californium therapy is as good as or better than conventional therapy with sources like radium. Recently, development of diagnostic applications of californium in medicine has received attention. Studies comparing neutron decay activation analysis versus prompt capture gamma ray analysis are in progress. A hopeful application of prompt analysis with reasonable quantities (200 μg) of californium is the elemental analysis of bone in the human body. (U.S.)

  5. Californium loan programme

    International Nuclear Information System (INIS)

    1974-01-01

    The offer of the United States to loan Californium-252 sources to the IAEA was made by Dr. Glenn T. Seaborg, then chairman of the USAEC, in his opening statement at the 15th. General Conference of the IAEA held in Vienna in 1971. The purpose of this loan was to make neutron emitting sources available to universities in the Member States for use in educational programmes. The sources, in the form of small needles designed for medical use in radiation therapy, were judged highly suitable for didactic applications due to their small size, limited activity and well documented radiological parameters. Subsequently, in May 1973, the Director General announced the availability of the Californium sources to the Member States. To date, numerous sources have been loaned to universities in Czechoslovakia, Costa Rica, the Federal Republic of Germany, Ghana, India, Iran, Israel, Japan, South Africa, Switzerland, the United Kingdom and Uruguay; additional applications for loans are being processed. It is anticipated that the loan programme will be terminated in 1975 once all the available sources have been distributed. n order to provide guidance for the Member States on the safe exploitation of these sources, a prototype use and storage facility was designed by IAEA staff of the Dosimetry Section of the Division of Life Sciences, and constructed at the IAEA laboratory in Seibersdorf, Austria. Figures 2-5 illustrate some of the details of this container, which is being given to the Ghana Nuclear Centre in support of a training programme for students at the university in Accra. Further advice to users of these sources will be provided by the publication of an instructional syllabus, a laboratory manual for experiments and the safety precautions inherent in the proper handling of neutron emitting radionuclides, authored by Professors Erich J. Hall and Harald H. Rossi of Columbia University. The syllabus and manual will be published as part of the IAEA Technical Series in September

  6. Californium source transfer

    International Nuclear Information System (INIS)

    Wallace, C.R.

    1995-01-01

    In early 1995, the receipt of four sealed californium-252 sources from Oak Ridge National Lab was successfully accomplished by a team comprised of Radiological Engineering, Radiological Operations and Health Physics Instrumentation personnel. A procedure was developed and walked-down by the participants during a Dry Run Evolution. Several special tools were developed during the pre-planning phases of the project which reduced individual and job dose to minimal levels. These included a mobile lifting device for attachment of a transfer ball valve assembly to the undercarriage of the Cannonball Carrier, a transfer tube elbow to ensure proper angle of the source transfer tube, and several tools used during emergency response for remote retrieval and handling of an unshielded source. Lessons were learned in the areas of contamination control, emergency preparedness, and benefits of thorough pre-planning, effectiveness of locally creating and designing special tools to reduce worker dose, and methods of successfully accomplishing source receipt evolutions during extreme or inclement weather

  7. Californium-252 progress, report No. 7, April 1971

    Energy Technology Data Exchange (ETDEWEB)

    1971-12-31

    This report contains discusses of the following topics on Californium-252: First sales of californium-252; encapsulation services discussed; three new participants in market evaluation program; summer training programs to use californium; Californium-252 shipping casks available; Californium-252 questions and answers, radiotherapy; neutron radiography; natural resources exploration; nuclear safeguards; process control; dosimetry; neutron radiography; neutron shielding; and nuclear safeguards.

  8. Uranium standards for Californium Shuffler

    International Nuclear Information System (INIS)

    Gibbs, A.; Boynton, S.P.

    1978-10-01

    The Laboratories Department analyzed pieces of a U-Al log which were to be canned and used as a set of standards for the nondestructive Californium Shuffler instrument. Evaluation of this instrument is part of an on-going Safeguards Program and is a joint project between LASL and SRP. A U-Al casting of a nominal 30% to 70% composition was made with enriched uranium (56 wt % 235 U). The log was 6 in. in diameter and approximately 2 ft long. A 1/4-in. slice was made before and after each 1-in. slice taken for use as a standard. The 1-in. slices were scanned nondestructively by collimated gamma pulse height analysis. The 1/4-in. slices were divided into quadrants and one quadrant for each slice was destructively analyzed. Results from these tests showed an approximate 1.5% relative variation in uranium concentration from the high to the low point. Successive pieces showed less than 1% relative difference. The 1-in. pieces have been canned and shipped to LASL for testing and will be returned with the Californium Shuffler. The remaining 1/4-in. slices have been sent to NBL and LASL for destructive analysis

  9. Radiography using californium-252 neutron sources

    International Nuclear Information System (INIS)

    Ray, J.W.

    1975-01-01

    The current status in the technology of neutron radiography using californium-252 neutron sources is summarized. Major emphasis is on thermal neutron radiography since it has the widest potential applicability at the present time. Attention is given to four major factors which affect the quality and useability of thermal neutron radiography: source neutron thermalization, neutron beam extraction geometry, neutron collimator dimensions, and neutron imaging methods. Each of these factors has a major effect on the quality of the radiographs which are obtained from a californium source neutron radiography system and the exposure times required to obtain the radiographs; radiograph quality and exposure time in turn affect the practicality of neutron radiography for specific nondestructive inspection applications. A brief discussion of fast neutron radiography using californium-252 neutron sources is also included. (U.S.)

  10. Californium-252 radiotherapy sources for interstitial afterloading

    International Nuclear Information System (INIS)

    Permar, P.H.; Walker, V.W.

    1976-01-01

    Californium-252 neutron sources for interstitial afterloading were developed to investigate the value of this radionuclide in cancer therapy. Californium-252 seed assemblies contain essentially point sources of 252 Cf permanently sealed on 1-cm centers within a flexible plastic tube. The seed assemblies are fabricated with remotely operated, specially designed machines. The fabrication process involves the production of a Pt-10 percent Ir-clad wire with a 252 Cf 2 O 3 -Pd cermet core. The wire is swaged and drawn to size, cut to length, and welded in a Pt-10 percent Ir capsule 0.8 mm in diameter and 6 mm long. Each seed capsule contains approximately 0.5 microgram of 252 Cf. Because the effective half-life of 252 Cf is 2.6 years, the seed assemblies are not disposable and must be reused until their activities have decreased to unsuitable levels. The flexible plastic components must therefore have sufficient resistance to radiation damage to survive the neutron-plus-gamma radiation from 252 Cf. On the basis of accelerated irradiation tests with a large 252 Cf source, a recently developed fluoropolymer, ''Tefzel'' (trademark of E. I. du Pont de Nemours and Company) has adequate radiation resistance for this application. Californium-252 seed assembly systems are loaned by the United States Energy Research and Development Administration for clinical investigations under a protocol of the Radiation Therapy Oncology Group, U.S. National Cancer Institute

  11. Californium-252: a remarkable versatile radioisotope

    International Nuclear Information System (INIS)

    Osborne-Lee, I.W.; Alexander, C.W.

    1995-01-01

    A product of the nuclear age, Californium-252 ( 252 Cf) has found many applications in medicine, scientific research, industry, and nuclear science education. Californium-252 is unique as a neutron source in that it provides a highly concentrated flux and extremely reliable neutron spectrum from a very small assembly. During the past 40 years, 252 Cf has been applied with great success to cancer therapy, neutron radiography of objects ranging from flowers to entire aircraft, startup sources for nuclear reactors, fission activation for quality analysis of all commercial nuclear fuel, and many other beneficial uses, some of which are now ready for further growth. Californium-252 is produced in the High Flux Isotope Reactor (HFIR) and processed in the Radiochemical Engineering Development Center (REDC), both of which are located at the Oak Ridge National Laboratory (ORNL) in Oak Ridge, Tennessee. The REDC/HFIR facility is virtually the sole supplier of 252 Cf in the western world and is the major supplier worldwide. Extensive exploitation of this product was made possible through the 252 Cf Market Evaluation Program, sponsored by the United States Department of Energy (DOE) [then the Atomic Energy Commission (AEC) and later the Energy Research and Development Administration (ERDA)]. This program included training series, demonstration centers, seminars, and a liberal loan policy for fabricated sources. The Market Evaluation Program was instituted, in part, to determine if large-quantity production capability was required at the Savannah River Laboratory (SRL). Because of the nature of the product and the means by which it is produced, 252 Cf can be produced only in government-owned facilities. It is evident at this time that the Oak Ridge research facility can meet present and projected near-term requirements. The production, shipment, and sales history of 252 Cf from ORNL is summarized herein

  12. Californium-252: a remarkable versatile radioisotope

    Energy Technology Data Exchange (ETDEWEB)

    Osborne-Lee, I.W.; Alexander, C.W.

    1995-10-10

    A product of the nuclear age, Californium-252 ({sup 252}Cf) has found many applications in medicine, scientific research, industry, and nuclear science education. Californium-252 is unique as a neutron source in that it provides a highly concentrated flux and extremely reliable neutron spectrum from a very small assembly. During the past 40 years, {sup 252}Cf has been applied with great success to cancer therapy, neutron radiography of objects ranging from flowers to entire aircraft, startup sources for nuclear reactors, fission activation for quality analysis of all commercial nuclear fuel, and many other beneficial uses, some of which are now ready for further growth. Californium-252 is produced in the High Flux Isotope Reactor (HFIR) and processed in the Radiochemical Engineering Development Center (REDC), both of which are located at the Oak Ridge National Laboratory (ORNL) in Oak Ridge, Tennessee. The REDC/HFIR facility is virtually the sole supplier of {sup 252}Cf in the western world and is the major supplier worldwide. Extensive exploitation of this product was made possible through the {sup 252}Cf Market Evaluation Program, sponsored by the United States Department of Energy (DOE) [then the Atomic Energy Commission (AEC) and later the Energy Research and Development Administration (ERDA)]. This program included training series, demonstration centers, seminars, and a liberal loan policy for fabricated sources. The Market Evaluation Program was instituted, in part, to determine if large-quantity production capability was required at the Savannah River Laboratory (SRL). Because of the nature of the product and the means by which it is produced, {sup 252}Cf can be produced only in government-owned facilities. It is evident at this time that the Oak Ridge research facility can meet present and projected near-term requirements. The production, shipment, and sales history of {sup 252}Cf from ORNL is summarized herein.

  13. Californium-252 sales and loans at Oak Ridge National Laboratory

    International Nuclear Information System (INIS)

    King, L.J.

    1987-01-01

    The production and distribution in the United States of 252 Cf has recently been consolidated at the Oak Ridge National Laboratory (ORNL). The 252 Cf Industrial Sales/Loan Program and the 252 Cf University Load Program, which were formerly located at the Savannah River Plant (SRP), have been combined with the californium production and distribution activities of the Transuranium Element Production Program at ORNL. Californium-252 is sold to commercial users in the form of bulk californium oxide, palladium-californium alloy pellets, or alloy wires. Neutron source capsules, which are fabricated for loans to DOE or other US government agencies, are still available in all forms previously available. The consolidation of all 252 Cf distribution activities at the production site is expected to result in better service to users. In particular, customers for neutrons sources will be ale to select from a wider range of neutron source forms, including custom designs, through a single contact point

  14. Calibration of a Modified Californium Shuffler

    International Nuclear Information System (INIS)

    Sadowski, E.T.; Armstrong, F.; Oldham, R.; Ceo, R.; Williams, N.

    1995-01-01

    A californium shuffler originally designed to assay hollow cylindrical pieces of UA1 has been modified to assay solid cylinders. Calibration standards were characterized via chemical analysis of the molten UA1 taken during casting of the standards. The melt samples yielded much more reliable characterization data than drill samples taken from standards after the standards had solidified. By normalizing one well-characterized calibration curve to several standards at different enrichments, a relatively small number of standards was required to develop an enrichment-dependent calibration. The precision of this shuffler is 0.65%, and the typical random and systematic uncertainties are 0.53% and 0.73%, respectively, for a six minute assay of an ingot containing approximately 700 grams of 235 U. This paper will discuss (1) the discrepancies encountered when UA1 standards were characterized via melt samples versus drill samples, (2) a calibration methodology employing a small number of standards, and (3) a comparison of results from a previously unused shuffler with an existing shuffler. A small number of UA1 standards have been characterized using samples from the homogeneous molten state and have yielded enrichment-dependent and enrichment-independent calibration curves on two different shufflers

  15. Californium production at the transuranium processing plant

    International Nuclear Information System (INIS)

    King, L.J.

    1976-01-01

    The Transuranium Processing Plant (TRU) at ORNL, which is the production, storage, and distribution center for the ERDA heavy element research program, is described. About 0.5 percent of 252 Cf is currently being produced. TRU is a hot-cell, chemical processing facility of advanced design. New concepts have been incorporated into the facility for absolute containment, remote operation, remote equipment installation, and remote maintenance. The facilities include a battery of nine heavily shielded process cells served by master-slave manipulators and eight laboratories, four on each of two floors. Processing includes chemical dissolution of the targets followed by a series of solvent extraction, ion exchange, and precipitation steps to separate and purify the transuranium elements. The transcurium elements Bk, Cf, Es, and Fm are distributed to users. Remote techniques are used to fabricate the Am and Cm into target rods for reirradiation in the HFIR. Californium-252 that is in excess of the needs of the heavy element research program and the Cf sales program is stored at TRU and processed repeatedly to recover the daughter product 248 Cm, which is a highly desirable research material

  16. Fabrication of californium-252 sources in the United Kingdom

    International Nuclear Information System (INIS)

    Ainsworth, A.; Brady, M.W.; Thornett, W.H.

    1975-01-01

    The advent of californium-252 in weighable quantities and at a reasonable price has caused some rethinking among neutron source suppliers. To explore this market the Radiochemical Center Ltd. has purchased 2 mg of californium-252, and subdivided this into a wide range of sources. To take advantage of its high specific neutron emission, a small double welded stainless steel capsule 7.8mm diameter x 10mm high was chosen for stock sources and this entailed the use of a microdispensing technique which had to be specially developed. The apparatus and procedure for subdividing milligram amounts of californium-252 are described. Some details of our experience in processing these one milligram shipments are given. 100 sources with activities from 200 microgram to 0.01 microgram have been produced. Losses have been small. Measurement of neutron spectra gamma spectra and dose rates from encapsulated sources has confirmed published data. Though it is early days, little industrial interest in californium-252 sources has been detected, most of the sources have so far been required for research into activation analysis and two examples of this are given. (U.S.)

  17. Californium Multiplier. Part I. Design for neutron radiography

    International Nuclear Information System (INIS)

    Crosbie, K.L.; Preskitt, C.A.; John, J.; Hastings, J.D.

    1982-01-01

    The Californium Multiplier (CFX) is a subcritical assembly of enriched uranium surrounding a californium-252 neutron source. The function of the CFX is to multiply the neutrons emitted by the source to a number sufficient for neutron radiography. The CFX is designed to provide a collimated beam of thermal neutrons from which the gamma radiation is filtered, and the scattered neutrons are reduced to make it suitable for high resolution radiography. The entire system has inherent safety features, which provide for system and personnel safety, and it operates at moderate cost. In Part I, the CFX and the theory of its operation are described in detail. Part II covers the performance of the Mound Facility CFX

  18. Gclust Server: 243 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available 243 CEL_K07E3.3_17568735 Cluster Sequences Related Sequences(40) 303 dao-3: Dauer or Aging... sequences Related Sequences(40) Sequence length 303 Representative annotation dao-3: Dauer or Aging

  19. Production, Distribution, and Applications of Californium-252 Neutron Sources

    International Nuclear Information System (INIS)

    Balo, P.A.; Knauer, J.B.; Martin, R.C.

    1999-01-01

    The radioisotope 252 Cf is routinely encapsulated into compact, portable, intense neutron sources with a 2.6-year half-life. A source the size of a person's little finger can emit up to 10 11 neutrons/s. Californium-252 is used commercially as a reliable, cost-effective neutron source for prompt gamma neutron activation analysis (PGNAA) of coal, cement, and minerals, as well as for detection and identification of explosives, laud mines, and unexploded military ordnance. Other uses are neutron radiography, nuclear waste assays, reactor start-up sources, calibration standards, and cancer therapy. The inherent safety of source encapsulations is demonstrated by 30 years of experience and by U.S. Bureau of Mines tests of source survivability during explosions. The production and distribution center for the U. S Department of Energy (DOE) Californium Program is the Radiochemical Engineering Development Center (REDC) at Oak Ridge National Laboratory (ORNL). DOE sells 252 Cf to commercial reencapsulators domestically and internationally. Sealed 252 Cf sources are also available for loan to agencies and subcontractors of the U.S. government and to universities for educational, research, and medical applications. The REDC has established the Californium User Facility (CUF) for Neutron Science to make its large inventory of 252 Cf sources available to researchers for irradiations inside uncontaminated hot cells. Experiments at the CUF include a land mine detection system, neutron damage testing of solid-state detectors, irradiation of human cancer cells for boron neutron capture therapy experiments, and irradiation of rice to induce genetic mutations

  20. 243Cm half-life determinaton

    International Nuclear Information System (INIS)

    Timofeev, G.A.; Kalygin, V.V.; Privalova, P.A.

    1986-01-01

    By molar ratios of 243 Cm mixture with 244 Cm and Pu nuclides formed as a result of Cm nuclides α-decay the 243 Cm half-life T α243 is determined. The 244 Cm half-life is measured earlier with high accuracy. The 243 Cm/ 244 Cm ratio measured by means of a mass spectrometer equals 0.989+-0.004. The obtained value T α243 =29.20+-0.14 years

  1. Prompt neutron spectrum of the spontaneous fission of californium-252

    International Nuclear Information System (INIS)

    Zamyatnin, Yu.S.; Kroshkin, N.I.; Korostylev, V.A.; Nefedov, V.N.; Ryazanov, D.K.; Starostov, B.I.; Semenov, A.F.

    1976-01-01

    The californium-252 spontaneous fission neutron spectrum was measured in the energy range of 0.01 to 10 MeV by the time-of-flight technique using various neutron detectors. The measurements of 252 Cf neutron spectrum at energies of 0.01 to 5 MeV were performed as a function of fission fragment kinetic energy. The mean neutron spectrum energy in the range of 0.7 to 10 MeV was found from the results of measurements. The irregularity in the 252 Cf neutron spectrum in the neutron energy range of less than 0.7 MeV compared to theoretical values is discussed. The mechanism of 252 Cf neutron emission is also discussed on the basis of neutron yield angle measurements. 12 references

  2. A californium-252 source for radiobiological studies at Hiroshima University

    International Nuclear Information System (INIS)

    Kato, Kazuo; Takeoka, Seiji; Kuroda, Tokue; Tsujimura, Tomotaka; Kawami, Masaharu; Hoshi, Masaharu; Sawada, Shozo

    1987-01-01

    A 1.93 Ci (3.6 mg) californium-252 source was installed in the radiation facility of the Research Institute for Nuclear Medicine and Biology, Hiroshima University. This source produces fission neutrons (8.7 x 10 9 n/s at the time of its installation), which are similar to neutron spectrum of the atomic bombs. It is useful for studying biological effects of fission neutrons and neutron dosimetry. An apparatus was dosigned to accomodate this source and to apply it to such studies. It has resulted in profitable fission neutron exposures, while suppressing scattered neutrons and secondary gamma rays. This apparatus incorporates many safety systems, including one which interlocks with all of doors and an elevator serving the exposure room, so as to prevent accidents involving users. (author)

  3. 49 CFR 192.243 - Nondestructive testing.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Nondestructive testing. 192.243 Section 192.243... BY PIPELINE: MINIMUM FEDERAL SAFETY STANDARDS Welding of Steel in Pipelines § 192.243 Nondestructive testing. (a) Nondestructive testing of welds must be performed by any process, other than trepanning, that...

  4. 40 CFR 243.201 - Safety.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Safety. 243.201 Section 243.201 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES GUIDELINES FOR THE STORAGE... Procedures § 243.201 Safety. ...

  5. 48 CFR 243.204 - Administration.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Administration. 243.204... OF DEFENSE CONTRACT MANAGEMENT CONTRACT MODIFICATIONS Change Orders 243.204 Administration. Follow the procedures at PGI 243.204 for administration of change orders. [75 FR 48277, Aug. 10, 2010] ...

  6. 7 CFR 58.243 - Checking quality.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Checking quality. 58.243 Section 58.243 Agriculture... Procedures § 58.243 Checking quality. All milk, milk products and dry milk products shall be subject to inspection and analysis by the dairy plant for quality and condition throughout each processing operation...

  7. 40 CFR 243.204 - Collection management.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Collection management. 243.204 Section 243.204 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES GUIDELINES... and Recommended Procedures § 243.204 Collection management. ...

  8. Application of californium-252 neutron sources for analytical chemistry

    International Nuclear Information System (INIS)

    Ishii, Daido

    1976-01-01

    The researches made for the application of Cf-252 neutron sources to analytical chemistry during the period from 1970 to 1974 including partly 1975 are reviewed. The first part is the introduction to the above. The second part deals with general review of symposia, publications and the like. Attention is directed to ERDA publishing the periodical ''Californium-252 Progress'' and to a study group of Cf-252 utilization held by Japanese Radioisotope Association in 1974. The third part deals with its application for radio activation analysis. The automated absolute activation analysis (AAAA) of Savannha River is briefly explained. The joint experiment of Savannha River operation office with New Brunswick laboratory is mentioned. Cf-252 radiation source was used for the non-destructive analysis of elements in river water. East neutrons of Cf-252 were used for the quantitative analysis of lead in paints. Many applications for industrial control processes have been reported. Attention is drawn to the application of Cf-252 neutron sources for the field search of neutral resources. For example, a logging sonde for searching uranium resources was developed. the fourth part deals with the application of the analysis with gamma ray by capturing neutrons. For example, a bore hole sonde and the process control analysis of sulfur in fuel utilized capture gamma ray. The prompt gamma ray by capturing neutrons may be used for the nondestructive analysis of enrivonment. (Iwakiri, K.)

  9. Teratogenic effect of Californium-252 irradiation in rats

    International Nuclear Information System (INIS)

    Satow, Yukio; Lee, Juing-Yi; Hori, Hiroshi; Okuda, Hiroe; Tsuchimoto, Shigeo; Sawada, Shozo; Yokoro, Kenjiro

    1989-01-01

    The teratogenicity of Californium-252 (Cf-252) irradiation which generates approximately 70% 2.3 MeV fast neutron and 30% gamma rays was evaluated. A single whole body exposure of Cf-252 at various doses was given to pregnant rats on day 8 or 9 of pregnancy, followed by microscopic autopsy of the fetuses at the terminal stage of pregnancy to search for external and internal malformations. For comparison, pregnant rats were irradiated with various doses of Cobalt-60 (Co-60) standard gamma rays at the same dose rate (1 rad/min.). The doses were 20-120 rad of Cf-252 and 80-220 rad of Co-60. Using frequency of radiation induced malformations observed on day 8 of pregnancy as an index, relative biological effectiveness (RBE) of 2.3-2.7 was obtained from the straight line obtained by modifying by the least squares method the frequency curves of malformed fetuses in total implants and in surviving fetuses. The types of malformations induced by Cf-252 and Co-60 irradiation were alike. Using fetal LD 50 as an index, 2.4 was obtained as RBE when irradiated on day 8 of pregnancy and 3.1 as that when irradiated on day 9. The results showed that Cf-252 had stronger a teratogenic effect than Co-60 gamma rays. (author)

  10. Experimental studies on californium bioavailability to marine benthic invertebrates

    International Nuclear Information System (INIS)

    Fowler, S.W.; Carvalho, F.P.; Aston, S.R.

    1986-01-01

    252 Cf is readily taken up by benthic invertebrates from sea water, reaching whole-body concentration factors of 763 in the polychaete Hermione hystrix, 220 in the shrimp Lysmata seticaudata, 665 in the crab Pilumnus hirtellus and 78 in the bivalve mollusc Venerupis decussata after 3 weeks exposure. Surface sorption plays a predominant role in the uptake process. Depuration in clean sea water was a relatively slow process. The shrimp Lysmata eliminated 252 Cf very rapidly due to moulting. Absorption coefficients for ingested 252 Cf were high, approx. 23% in crabs and approx. 97% in brittlestars. The absorbed fraction was excreted twice as fast from crabs as brittlestars. Exposure of organisms to labelled sediment resulted in low transfer factors that were species dependent. There is some evidence to suggest that uptake from sediments is primarily due to 252 Cf transfer from the pore water. Comparison of these results with published experimental data on other transuranic nuclides in the same or similar species suggests that californium bioavailability is roughly equivalent to that of plutonium and americium. (author)

  11. Biomedical neutron research at the Californium User Facility for Neutron Science

    International Nuclear Information System (INIS)

    Martin, R.C.; Byrne, T.E.; Miller, L.F.

    1998-01-01

    The Californium User Facility for Neutron Science has been established at Oak Ridge National Laboratory (ORNL). The Californium User Facility (CUF) is a part of the larger Californium Facility, which fabricates and stores compact 252 Cf neutron sources for worldwide distribution. The CUF can provide a cost-effective option for research with 252 Cf sources. Three projects at the CUF that demonstrate the versatility of 252 Cf for biological and biomedical neutron-based research are described: future establishment of a 252 Cf-based neutron activation analysis system, ongoing work to produce miniature high-intensity, remotely afterloaded 252 Cf sources for tumor therapy, and a recent experiment that irradiated living human lung cancer cells impregnated with experimental boron compounds to test their effectiveness for boron neutron capture therapy. (author)

  12. Proposed Californium-252 User Facility for Neutron Science at Oak Ridge National Laboratory

    International Nuclear Information System (INIS)

    Martin, R.C.; Laxson, R.R.; Knauer, J.B.

    1996-01-01

    The Radiochemical Engineering Development Center (REDC) at ORNL has petitioned to establish a Californium-252 User Facility for Neutron Science for academic, industrial, and governmental researchers. The REDC Californium Facility (CF) stores the national inventory of sealed 252 Cf neutron source for university and research loans. Within the CF, the 252 Cf storage pool and two uncontaminated hot cells currently in service for the Californium Program will form the physical basis for the User Facility. Relevant applications include dosimetry and experiments for neutron tumor therapy; fast and thermal neutron activation analysis of materials; experimental configurations for prompt gamma neutron activation analysis; neutron shielding and material damage studies; and hardness testing of radiation detectors, cameras, and electronics. A formal User Facility simplifies working arrangements and agreements between US DOE facilities, academia, and commercial interests

  13. Biomedical neutron research at the Californium User Facility for neutron science

    International Nuclear Information System (INIS)

    Martin, R.C.; Byrne, T.E.; Miller, L.F.

    1997-01-01

    The Californium User Facility for Neutron Science has been established at Oak Ridge National Laboratory (ORNL). The Californium User Facility (CUF) is a part of the larger Californium Facility, which fabricates and stores compact 252 Cf neutron sources for worldwide distribution. The CUF can provide a cost-effective option for research with 252 Cf sources. Three projects at the CUF that demonstrate the versatility of 252 Cf for biological and biomedical neutron-based research are described: future establishment of a 252 Cf-based neutron activation analysis system, ongoing work to produce miniature high-intensity, remotely afterloaded 252 Cf sources for tumor therapy, and a recent experiment that irradiated living human lung cancer cells impregnated with experimental boron compounds to test their effectiveness for boron neutron capture therapy

  14. X-ray-diffraction study of californium metal to 16 GPa

    International Nuclear Information System (INIS)

    Peterson, J.R.; Benedict, U.; Dufour, C.; Birkel, I.; Haire, R.G.

    1983-01-01

    The first series of measurements to determine the structural behavior of californium (Cf) metal under pressure has been carried out. The initial dhcp structure transformed sluggishly with increasing pressure to a fcc structure. A bulk modulus of 50(5) GPa was derived for dhcp Cf metal from the relative volume (V/V 0 ) data to 10 GPa

  15. Study of the shielding for spontaneous fission sources of Californium-252

    International Nuclear Information System (INIS)

    Davila R, I.

    1991-06-01

    A shielding study is made to attenuate, until maximum permissible levels, the neutrons radiation and photons emitted by spontaneous fission coming from a source of Californium-252. The compound package by a database (Library DLC-23) and the ANISNW code is used, in it version for personal computer. (Author)

  16. Assessment of the neutron component in a neutron-gamma field of a californium-252 source

    International Nuclear Information System (INIS)

    Tetteh, G.K.

    1978-12-01

    Experiments have been performed to determine the percentages of the different components in the radiation field of californium-252 which has now some clinical applications. Using Rossi Chambers in conjunction with absorption investigations involving lead and aluminium thimbles, it is observed that the dose rates due to the different components are: neutrons 54%; gammas 30%; betas 16%

  17. 27 CFR 24.243 - Filtering aids.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Filtering aids. 24.243... OF THE TREASURY LIQUORS WINE Storage, Treatment and Finishing of Wine § 24.243 Filtering aids. Inert fibers, pulps, earths, or similar materials, may be used as filtering aids in the cellar treatment and...

  18. 7 CFR 1220.243 - Confidential treatment.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 10 2010-01-01 2010-01-01 false Confidential treatment. 1220.243 Section 1220.243 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (MARKETING... Confidential treatment. Except as otherwise provided in the Act, financial or commercial information that is...

  19. 40 CFR 86.243-94 - [Reserved

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 18 2010-07-01 2010-07-01 false [Reserved] 86.243-94 Section 86.243-94 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED) CONTROL OF... Year Gasoline-Fueled New Light-Duty Vehicles, New Light-Duty Trucks and New Medium-Duty Passenger...

  20. Local Structure in Americium and Californium Hexa-cyanoferrates - Comparison with Their Lanthanide Analogues

    International Nuclear Information System (INIS)

    Dupouy, G.; Bonhoure, I.; Dumas, Th.; Moisy, Ph.; Petit, S.; Den Auwer, Ch.; Conradson, St.D.; Hennig, Ch.; Scheinost, A.C.; Le Naour, C.; Simoni, E.

    2011-01-01

    Metal hexa-cyanoferrates are well known molecular solids for a large variety of cations, although very little has been described for actinide adducts. Two new members of actinide(III) hexa-cyanoferrates were synthesized with the cations americium and californium. They were structurally characterized by infrared and X-ray absorption spectroscopy. Combined EXAFS data at the iron K edge and actinide L 3 edge provide evidence for a three-dimensional model for these two new compounds. Structural data in terms of bond lengths were compared to those reported for the parent lanthanide(III) compounds, neodymium and gadolinium hexa-cyanoferrates, respectively: the americium compound with (KNd(III)Fe(II)-Fe-III(CN) 6 .4H 2 O and the californium compound with (KGd(III)Fe(II)(CN) . 3.5H 2 O and (KGd(III)Fe(II)(CN) 6 .3H 2 O. This comparison between actinide and lanthanide homologues has been carried out on the basis of ionic radii considerations. The americium and neodymium environments appear to be very similar and are arranged in a tri-capped trigonal prism polyhedron of coordination number 9 (CN: 9), in which the americium atom is bonded to six nitrogen atoms and to three water molecules. For the californium adduct, a similar comparison and bond length and angle values derived from EXAFS studies suggest that the californium cation sits in a bi-capped trigonal prism (CN: 8) as in (KGd(III)Fe(II)(CN) 6 . 3H 2 O. This arrangement differs from that in the structure of (KGd(III)Fe(II)(CN) 6 .3.5H 2 O, in which the gadolinium atom is surrounded by 9 atoms. This is one of the rare pieces of information revealed by EXAFS spectroscopy for americium and californium in comparison to lanthanide atoms in molecular solid compounds. A discussion on the decrease in bond length and coordination number from americium to californium is also provided, on the basis of crystallographic results reported in the literature for actinide(III) and lanthanide(III) hydrate series. (authors)

  1. Atlantic Richfield Hanford Company californium multiplier/delayed neutron counter safety analysis

    International Nuclear Information System (INIS)

    Zimmer, W.H.

    1976-08-01

    The Californium Multiplier (CFX) is a subcritical assembly of uranium surrounding 252 Cf spontaneously fissioning neutron sources; its function is to multiply the neutron flux to a level useful for activation analysis. This document summarizes the safety analysis aspects of the CFX, DNC, pneumatic transfer system, and instrumentation and to detail all the aspects of the total facility as a starting point for the ARHCO Safety Analysis Review. Recognized hazards and steps already taken to neutralize them are itemized

  2. Instrumental neutron activation determination of gold in mineral raw materials using a californium neutron source

    International Nuclear Information System (INIS)

    Shilo, N.A.; Ippolitov, E.G.; Ivanenko, V.V.; Kustov, B.N.; Zheleznov, V.V.; Aristov, G.N.; Kovalenko, V.V.; Kondrat'ev, N.B.

    1983-01-01

    A facility using a californium neutron source and a method for the neutron activation analysis of gold were developed. The sensitivity of the determination is 0.1 g/t. The causes of random and systematic errors have been studied. It is concluded that in prospection and evaluation of gold ore deposists, the traditional test tube analysis for gold may be replaced with the developed method. (author)

  3. Safety Analysis Report for Packaging (SARP) of the Oak Ridge National Laboratory TRU Californium Shipping Container

    International Nuclear Information System (INIS)

    Box, W.D.; Shappert, L.B.; Seagren, R.D.; Klima, B.B.; Jurgensen, M.C.; Hammond, C.R.; Watson, C.D.

    1980-01-01

    An analytical evaluation of the Oak Ridge National Laboratory TRU Californium Shipping Container was made in order to demonstrate its compliance with the regulations governing off-site shipment of packages that contain radioactive material. The evaluation encompassed five primary categories: structural integrity, thermal resistance, radiation shielding, nuclear criticality safety, and quality assurance. The results of this evaluation demonstrate that the container complies with the applicable regulations

  4. Spectroscopic and redox properties of curium and californium ions in concentrated aqueous carbonate-bicarbonate media

    International Nuclear Information System (INIS)

    Hobart, D.E.; Varlashkin, P.G.; Samhoun, K.; Haire, R.G.; Peterson, J.R.

    1983-01-01

    Multimilligram quantities of trivalent curium-248 and californium-249 were investigated by absorption spectroscopy, cyclic voltammetry, and bulk solution electrolysis in concentrated aqueous carbonate-bicarbonate solution. Actinide concentrations between 10 -4 and 10 -2 M were studied in 2 M sodium carbonate and 5.5 M potassium carbonate solutions at pH values from 8 to 14. The solution absorption spectra of Cm(III) and Cf(III) in carbonate media are presented for the first time and compared to literature spectra of these species in noncomplexing aqueous solution. It was anticipated that carbonate complexation of the actinide ions could provide a sufficient negative shift in the formal potentials of the M(IV)/M(III) couples of Cm and Cf to permit the generation and stabilization of their tetravalent states in aqueous carbonate-bicarbonate medium. No conclusive evidence was found in the present work to indicate the existence of any higher oxidation states of curium or californium in carbonate solution. Some possible reasons for our inability to generate and detect oxidized species of curium and californium in this medium are discussed

  5. Dicty_cDB: SLH243 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLH243 (Link to dictyBase) - - - Contig-U15469-1 SLH243P (Link to Original site) SLH2...43F 436 SLH243Z 369 SLH243P 805 - - Show SLH243 Library SL (Link to library) Clone ID SLH2... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLH2-B/SLH243Q.Seq.d/ Representative seq. ID SLH2...43P (Link to Original site) Representative DNA sequence >SLH243 (SLH243Q) /CSM/SL/SLH2-B/SLH2...SA605. 785 0.0 1 ( AU062023 ) Dictyostelium discoideum slug cDNA, clone SLH243. 785 0.0 1 ( BJ416791 ) Dicty

  6. 39 CFR 243.2 - Quarters.

    Science.gov (United States)

    2010-07-01

    ... UNITED STATES POSTAL SERVICE ORGANIZATION AND ADMINISTRATION CONDUCT OF OFFICES § 243.2 Quarters. (a.... Postal Service, General Accounting Office Building, Washington, DC 20260, with a memorandum of... depositing mail in front of or next to the post office. Show collection time schedules on letterboxes. At...

  7. Käibemaksu maksmine maksab 243 miljonit

    Index Scriptorium Estoniae

    2005-01-01

    Poliitikauuringute keskuse PRAXIS uurimus näitas, et Eesti ettevõtetel kulub käibemaksu administreerimisele ja seadustega kursis hoidmisele aastas kokku 243 miljonit krooni, mis võrdub 0,25% SKP-st. Tabel: Suurim kulu ettevõtetele on enda kursishoidmine käibemaksuküsimustes. Vt. samas: Kuidas PRAXIS halduskoormust hindas

  8. Convenient method of simultaneously analyzing aluminum and magnesium in pharmaceutical dosage forms using californium-252 thermal neutron activation

    International Nuclear Information System (INIS)

    Landolt, R.R.; Hem, S.L.

    1983-01-01

    A commercial antacid suspension containing aluminum hydroxide and magnesium hydroxide products was used as a model sample to study the use of a californium-252 thermal neutron activation as a method for quantifying aluminum content as well as for the simultaneous assay of aluminum and magnesium. A 3.5-micrograms californium-252 source was used for the activation, and the induced aluminum-28 and magnesium-27 activity was simultaneously measured by sodium iodide crystal gamma-ray spectrometry using dual single-channel analyzers and scalers. The antacid suspension was contained in a chamber designed with the unique capability of serving as the container for counting the induced radioactivity in addition to being the irradiation chamber itself. This pilot study demonstrated that use of more intense californium-252 sources, which are commonly available, would provide a method that is competitive with the ethylenediaminetetraacetic acid titration method in precision and in other aspects as well

  9. Measurement of californium-252 gamma photons depth dose distribution in tissue equivalent material. Vol. 4

    Energy Technology Data Exchange (ETDEWEB)

    Fadel, M A; El-Fiki, M A; Eissa, H M; Abdel-Hafez, A; Naguib, S H [National Institute of Standards, Cairo (Egypt)

    1996-03-01

    Phantom of tissue equivalent material with and without bone was used measuring depth dose distribution of gamma-rays from californium-252 source. The source was positioned at center of perspex walled phantom. Depth dose measurements were recorded for X, Y and Z planes at different distances from source. TLD 700 was used for measuring the dose distribution. Results indicate that implantation of bone in tissue equivalent medium cause changes in the gamma depth dose distribution which varies according to variation in bone geometry. 9 figs.

  10. Measurements of integral cross sections in the californium-252 fission neutron spectrum

    International Nuclear Information System (INIS)

    Alberts, W.G.; Guenther, E.; Matzke, M.; Rassl, G.

    1977-01-01

    In a low-scattering arrangement cross sections averaged over the californium-252 spontaneous fission neutron spectrum were measured. The reactions 27 Al(n,α) 46 Ti, 47 Ti, 48 Ti(n,p), 54 Fe, 56 Fe(n,p), 58 Ni(n,p), 64 Zn(n,p), 115 In(n,n') were studied in order to obtain a consistent set of threshold detectors used in fast neutron flux density measurements. Overall uncertainties between 2 and 2.5% could be achieved; corrections due to neutron scattering in source and samples are discussed

  11. Neutron emission in fission of highly excited californium nuclei (E*=76 MeV)

    International Nuclear Information System (INIS)

    Blinov, M.V.; Bordyug, V.M.; Kozulin, Eh.M.; Mozhaev, A.N.; Levitovich, M.; Muzychka, Yu.A.; Penionzhkevich, Yu.Eh.; Pustyl'nik, B.I.

    1990-01-01

    The differential cross sections for neutron production in the fission of highly excited californium nuclei formed in the 238 U+ 12 C (105 MeV) reaction have been measured. From the analysis of the experimental data is follows that the number of pre-fission neutrons substantially exceeds the value obtained in the framework of the standard statistical model. The saddle-to-scission time of the excited nucleus is estimated on the basis of the neutron multiplicity. The dependences of the neutron number and neutron average energies upon the fragment mass are determined

  12. Neutron emission in fission of highly excited californium nuclei (E* = 76 MeV)

    International Nuclear Information System (INIS)

    Blinov, M.V.; Bordyug, V.M.; Kozulin, E.M.; Levitovich, M.; Mozhaev, A.N.; Muzychka, Yu.A.; Penionzhkevich, Yu.E.; Pustyl'nik, B.I.

    1990-01-01

    Differential cross sections for neutron production have been measured in fission of excited californium nuclei produced in the reaction 238 U + 12 C (105 MeV). It follows from analysis of the experimental results that the number of neutrons emitted before fission considerably exceeds the number obtained in the framework of the standard statistical model. On the basis of the multiplicity of neutrons they authors have estimated the time of fission of the excited nucleus. The dependence of the number of neutrons and their average energies on the mass of the fragments is determined

  13. Californium oxygen system for 1.50 < O/Cf < 1.72

    International Nuclear Information System (INIS)

    Turcotte, R.P.; Haire, R.G.

    1975-01-01

    The californium-oxygen system was studied as a function of temperature, oxygen pressure, and stoichiometry by manometric and x-ray diffraction methods. The results establish rhombohedral Cf 7 O 12 as the stable compound obtained by heating Cf 2 O 3 in air. The isobaric oxidation-reduction cycles Cf 2 O 3 → Cf 7 O 12 → Cf 2 O 3 , observed in constant rate of heating (cooling) experiments, occur with large hysteresis. A close parallel to other fluorite related lanthanide and actinide oxide systems is established. (auth)

  14. Possible stabilization of the tetravalent oxidation state of berkelium and californium in acetonitrile with triphenylarsine oxide

    International Nuclear Information System (INIS)

    Payne, G.F.; Peterson, J.R.

    1987-01-01

    It appears that we may have prepared Bk(IV) nitrate.nTPAs0 and Bk(IV) perchlorate.nTPAs0 complexes which formed the corresponding Cf(IV) complexes through the beta decay of Bk-249. Definitive proof should come from similar experiments with quantities of Bk-249 large enough to allow spectrophotometric detection of the characteristic f→f transitions in these berkelium and californium species. It is clear, however, that TPAs0 and acetonitrile can play a pivotal role in the stabilization of lanact(IV) species

  15. Comparison of the Savannah River Site billet active well coincidence counter and two Californium Shufflers

    International Nuclear Information System (INIS)

    Sadowski, E.T.; Griffin, J.C.; Rinard, P.M.

    1991-01-01

    A Scrap Californium Shuffler at the Savannah River Site (SRS) was calibrated to assay the U-Al cores of billets (an intermediate step in the SRS reactor fuel fabrication cycle.) The precision of the Scrap Shuffler over several years has been approximately 0.50%. A typical total uncertainty for the assay of a core on the Scrap Shuffler is approximately 0.33% for a twelve minute assay. The precision over several months and a typical total uncertainty for the Billet Active Well (neutron) Coincidence Counter (BAWCC) are approximately 1.0% and 1.9%, respectively, for a fifteen minute assay. A new Billet Californium Shuffler specifically designed for assaying SRS billets has yielded precision (over one month) and total uncertainty results of 0.40% and 0.69%, respectively, for an eight minute assay. The introduction of a measurement point into the fuel fabrication cycle to replace estimates based upon material weight will greatly enhance material and process control in the Reactor Materials area of SRS. The use of all three instruments provides a comparison of the relative merits of Active Well (neutron) Coincidence Counters (AWCCs) and shufflers for assay of homogeneous and geometrically simple material containing 235 U. The measurement precisions, systematic and random uncertainties, as well as the procurement and operation of each instrument will be compared. 3 refs., 5 figs., 1 tab

  16. 49 CFR 372.243 - Controlling distances and population data.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 5 2010-10-01 2010-10-01 false Controlling distances and population data. 372.243 Section 372.243 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL MOTOR... EXEMPTIONS, COMMERCIAL ZONES, AND TERMINAL AREAS Commercial Zones § 372.243 Controlling distances and...

  17. 20 CFR 243.4 - Taxation of benefits.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Taxation of benefits. 243.4 Section 243.4 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD RETIREMENT ACT TRANSFER, ASSIGNMENT, OR WAIVER OF PAYMENTS § 243.4 Taxation of benefits. (a) Annuities paid by the Board are subject...

  18. 43 CFR 24.3 - General jurisdictional principles.

    Science.gov (United States)

    2010-10-01

    ... 43 Public Lands: Interior 1 2010-10-01 2010-10-01 false General jurisdictional principles. 24.3 Section 24.3 Public Lands: Interior Office of the Secretary of the Interior DEPARTMENT OF THE INTERIOR FISH AND WILDLIFE POLICY: STATE-FEDERAL RELATIONSHIPS § 24.3 General jurisdictional principles. (a) In...

  19. 12 CFR 24.3 - Public welfare investments.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 1 2010-01-01 2010-01-01 false Public welfare investments. 24.3 Section 24.3... DEVELOPMENT ENTITIES, COMMUNITY DEVELOPMENT PROJECTS, AND OTHER PUBLIC WELFARE INVESTMENTS § 24.3 Public welfare investments. A national bank or national bank subsidiary may make an investment directly or...

  20. Neutron capture cross section of ^243Am

    Science.gov (United States)

    Jandel, M.

    2009-10-01

    The Detector for Advanced Neutron Capture Experiments (DANCE) at Los Alamos National Laboratory (LANL) was used for neutron capture cross section measurement on ^243Am. The high granularity of DANCE (160 BaF2 detectors in a 4π geometry) enables the efficient detection of prompt gamma-rays following neutron capture. DANCE is located on the 20.26 m neutron flight path 14 (FP14) at the Manuel Lujan Jr. Neutron Scattering Center at the Los Alamos Neutron Science Center (LANSCE). The methods and techniques established in [1] were used for the determination of the ^243Am neutron capture cross section. The cross sections were obtained in the range of neutron energies from 0.02 eV to 400 keV. The resonance region was analyzed using SAMMY7 and resonance parameters were extracted. The results will be compared to existing evaluations and calculations. Work was performed under the auspices of the U.S. Department of Energy at Los Alamos National Laboratory by the Los Alamos National Security, LLC under Contract No. DE-AC52-06NA25396 and at Lawrence Livermore National Laboratory by the Lawrence Livermore National Security, LLC under Contract No. DE-AC52-07NA27344. [4pt] [1] M. Jandel et al., Phys. Rev. C78, 034609 (2008)

  1. Spectral investigation of neutron radiation in three-sectional concrete labyrinth from a californium-252 source

    International Nuclear Information System (INIS)

    Belogorlov, E.A.; Britvich, G.I.; Getmanov, V.B.

    1985-01-01

    Construction of labyrinths in points of communication output from the storage-ring under construction is accompanied by numerous difficulties due to a considerable number of gas and cryogenic pipelines, which require large cross sections at the minimal length of the pipelines proper for their location. It results in unfavourable for radiation attenuation ratios between cross section and length of the labyrinth separate sections. Neutron spectra in a model concrete labyrinth, at the entrance to which a neutron source with fission spectrum (californium-252) and the same source in a polyethylene moderator are located, are measured. On the basis of the spectra obtained the formation of fluence and equivalent dose along the labyrinth geometric axis is analyzed. Conditions permitting actually to reduce radiation dose in the labyrinth (dead end provision, the use of cover materials, construction of diaphragms and shielding plates) are simulated

  2. Transport calculations of. gamma. -ray flux density and dose rate about implantable californium-252 sources

    Energy Technology Data Exchange (ETDEWEB)

    Shapiro, A; Lin, B I [Cincinnati Univ., Ohio (USA). Dept. of Chemical and Nuclear Engineering; Windham, J P; Kereiakes, J G

    1976-07-01

    ..gamma.. flux density and dose rate distributions have been calculated about implantable californium-252 sources for an infinite tissue medium. Point source flux densities as a function of energy and position were obtained from a discrete-ordinates calculation, and the flux densities were multiplied by their corresponding kerma factors and added to obtain point source dose rates. The point dose rates were integrated over the line source to obtain line dose rates. Container attenuation was accounted for by evaluating the point dose rate as a function of platinum thickness. Both primary and secondary flux densities and dose rates are presented. The agreement with an independent Monte Carlo calculation was excellent. The data presented should be useful for the design of new source configurations.

  3. Dicty_cDB: VHP243 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHP243 (Link to dictyBase) - - - Contig-U16236-1 - (Link to Or...iginal site) VHP243F 134 - - - - - - Show VHP243 Library VH (Link to library) Clone ID VHP243 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16236-1 Original site URL http://dictycdb.b...AXXXXXXXXXX sequence update 2002.10.25 Translated Amino Acid sequence CWPTGIXKTTICT...kilsif*ynfkyyqqpkkk--- Frame B: llaywyxqnnnlyqyyyyfyl*kyflsfniilniinnpkk--- Frame C: CWPTGIXKTTICTNTTIISICKN

  4. 12 CFR 19.243 - Removal, suspension, or debarment.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 1 2010-01-01 2010-01-01 false Removal, suspension, or debarment. 19.243 Section 19.243 Banks and Banking COMPTROLLER OF THE CURRENCY, DEPARTMENT OF THE TREASURY RULES OF PRACTICE AND PROCEDURE Removal, Suspension, and Debarment of Accountants From Performing Audit Services § 19...

  5. 14 CFR 243.15 - Conflict with foreign laws.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Conflict with foreign laws. 243.15 Section... PROCEEDINGS) ECONOMIC REGULATIONS PASSENGER MANIFEST INFORMATION § 243.15 Conflict with foreign laws. (a) If a... portion of this part is not required because of a conflict with applicable foreign law. [Doc. No. OST-95...

  6. 48 CFR 243.204-70-2 - Price ceiling.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Price ceiling. 243.204-70..., DEPARTMENT OF DEFENSE CONTRACT MANAGEMENT CONTRACT MODIFICATIONS Change Orders 243.204-70-2 Price ceiling. Unpriced change orders shall include a not-to-exceed price. [75 FR 48277, Aug. 10, 2010] ...

  7. Fast and efficient charge breeding of the Californium rare isotope breeder upgrade electron beam ion source

    International Nuclear Information System (INIS)

    Ostroumov, P. N.; Barcikowski, A.; Dickerson, C. A.; Perry, A.; Sharamentov, S. I.; Vondrasek, R. C.; Zinkann, G. P.; Pikin, A. I.

    2015-01-01

    The Electron Beam Ion Source (EBIS), developed to breed Californium Rare Isotope Breeder Upgrade (CARIBU) radioactive beams at Argonne Tandem Linac Accelerator System (ATLAS), is being tested off-line. A unique property of the EBIS is a combination of short breeding times, high repetition rates, and a large acceptance. Overall, we have implemented many innovative features during the design and construction of the CARIBU EBIS as compared to the existing EBIS breeders. The off-line charge breeding tests are being performed using a surface ionization source that produces singly charged cesium ions. The main goal of the off-line commissioning is to demonstrate stable operation of the EBIS at a 10 Hz repetition rate and a breeding efficiency into single charge state higher than 15%. These goals have been successfully achieved and exceeded. We have measured (20% ± 0.7%) breeding efficiency into the single charge state of 28+ cesium ions with the breeding time of 28 ms. In general, the current CARIBU EBIS operational parameters can provide charge breeding of any ions in the full mass range of periodic table with high efficiency, short breeding times, and sufficiently low charge-to-mass ratio, 1/6.3 for the heaviest masses, for further acceleration in ATLAS. In this paper, we discuss the parameters of the EBIS and the charge breeding results in a pulsed injection mode with repetition rates up to 10 Hz

  8. Manganese determination om minerals by activation analysis, using the californium-252 as a neutron source

    International Nuclear Information System (INIS)

    Cardoso, Antonio

    1976-01-01

    Neutron Activation Analysis, using a Californium-252 neutron source, has been applied for the determination of manganese in ores such as pyrolusite, rodonite (manganese silicate)' and blending used in dry-batteries The favorable nuclear properties of manganese, such as high thermal neutron cross-section for the reaction 55 Mn (n.gamma) 56 Mn, high concentration of manganese in the matrix and short half - life of 56 Mn, are an ideal combination for non-destructive analysis of manganese in ores. Samples and standards of manganese dioxide were irradiated for about 20 minutes, followed by a 4 to 15 minutes decay and counted in a single channel pulse-height discrimination using a NaI(Tl) scintillation detector. Counting time was equal to 10 minutes. The interference of nuclear reactions 56 Fe(n,p) 56 Mn and 59 Co (n, α) 56 were studied, as well as problems in connection with neutron shadowing during irradiation, gamma-rays attenuation during counting and influence of granulometry of samples. One sample,was also analysed by wet-chemical method (sodium bismuthate) in order to compare results. As a whole, i t was shown that the analytical method of neutron activation for manganese in ores and blending, is a method simple, rapid and with good precision and accuracy. (author)

  9. Long-term effects of an intracavitary treatment with californium-252 on normal tissue

    International Nuclear Information System (INIS)

    Sullivan, M.F.; Beamer, J.L.; Mahony, T.D.; Cross, F.T.; Lund, J.E.; Endres, G.W.R.

    1976-01-01

    About one hundred fifty swine were exposed to either radium-226 or californium-252 sources in the uterine cervix to determine an RBE for both acute and long-term effects. That value for early changes in the tissues at risk in the treatment of cervical cancer was between 6.2 and 6.8. The incidence of complications increased with time after exposure, especially among animals treated with 252 Cf. Analysis of rectal injury showed that ulceration occurred frequently within a year postexposure at doses between 1600 and 2400 rad calculated at 2 cm lateral to the source midline. Fat necrosis and smooth muscle atrophy, resulting in a local rectal stricture, were delayed changes observed in some animals. The lower ureter was the site for a greater frequency of complications than the GI tract. Ureteral stricture often occurred at doses of 1200 rad from 252 Cf and 7000 rad from 226 Ra. Observation of delayed effects in the uterine-cervix in animals held up to 4 years postexposure indicate that the RBE for 252 Cf may be increased to a value as high as 18, while repair may have even decreased it to about 5.6 in the rectum. Fifty swine are still being observed for long-term effects after doses above 800 rad from 252 Cf and 5000 rad from 226 Ra

  10. Neutron activation analysis at the Californium User Facility for Neutron Science

    International Nuclear Information System (INIS)

    Martin, R.C.; Smith, E.H.; Glasgow, D.C.; Jerde, E.A.; Marsh, D.L.; Zhao, L.

    1997-12-01

    The Californium User Facility (CUF) for Neutron Science has been established to provide 252 Cf-based neutron irradiation services and research capabilities including neutron activation analysis (NAA). A major advantage of the CUF is its accessibility and controlled experimental conditions compared with those of a reactor environment The CUF maintains the world's largest inventory of compact 252 Cf neutron sources. Neutron source intensities of ≤ 10 11 neutrons/s are available for irradiations within a contamination-free hot cell, capable of providing thermal and fast neutron fluxes exceeding 10 8 cm -2 s -1 at the sample. Total flux of ≥10 9 cm -2 s -1 is feasible for large-volume irradiation rabbits within the 252 Cf storage pool. Neutron and gamma transport calculations have been performed using the Monte Carlo transport code MCNP to estimate irradiation fluxes available for sample activation within the hot cell and storage pool and to design and optimize a prompt gamma NAA (PGNAA) configuration for large sample volumes. Confirmatory NAA irradiations have been performed within the pool. Gamma spectroscopy capabilities including PGNAA are being established within the CUF for sample analysis

  11. Feasibility and market potential of protein determination of wheat using californium-252

    International Nuclear Information System (INIS)

    Roberts, T.C. Jr.; Eckhoff, N.D.; Clack, R.W.; Roberts, T.C. Sr.

    1976-01-01

    To evaluate the feasibility of protein determination by capture gamma-ray analysis using californium-252 neutrons, an in-situ protein analysis system for use by grain handlers has been examined. Three 227 kilogram (approximately) lots of wheat were used to determine the amount of nitrogen present. Protein analyses by the Kjeldahl method were obtained from samples taken before and after the capture gamma-ray analyses. The 5.267-MeV gamma-ray was selected for use in this study as a compromise between efficiency and interference from other elements. The associated counting equipment was a multichannel analyzer with pulse shaping electronic and analysis computing equipment. A linear regression program was used to compare the regions of interest to the Kjeldahl protein averages. The counts composing each peak were summed and normalized using the total count of the hydrogen peak. The normalized nitrogen percentages indicate a significant correlation between the spectral regions and the Kjeldahl analyses. To a first approximation, the value of wheat is the wheat protein. At the present time, protein testing of wheat is destructive, cumbersome, and time-consuming as compared to the potential for capture gamma-ray analysis testing. Assuming that such a protein analysis unit can analyze 42 tonne of wheat per hour, over 120 units would be needed to monitor one-half the U.S. annual wheat production. A 0.5% improvement in processor realizations and grain throughput value of $167.00 per tonne will result in a projected savings of $150,000 per year per unit

  12. Neutron reflector design with Californium 252 neutron for Boron neutron chapter therapy facility using MCNP5 simulation method

    International Nuclear Information System (INIS)

    Muhammad Fakhrurreza; Kusminanto; Y Sardjono

    2014-01-01

    In this research has made a reflector design to provide beams of Neutron for BNCT with Californium-252 radioactive source. This collimator is useful to obtain optimum epithermal neutron flux with the smallest impurity radiation (thermal neutron, fast neutron, and gamma). The design process is done using Monte Carlo N-Particle simulation version 5 (MCNP5) code to calculate the neutron flux tally form. The chosen reflector design is the reflectors which use material such as BeO ceramic with 13 cm thick. Moderator use sulfur material with the slope angle of the cone is 30°. From the calculation result, it is obtained that Reflector with 1 gram Californium-252 source can produce a neutron output thermal which has thermal neutron specification 2.23189 x 10 9 n/s.cm 2 , epithermal neutron 3.51548 x 10 9 n/s.cm 2 , and fast neutron 4.82241 x 10 9 n/s.cm 2 From the result, it needs additional collimator because the BNCT requirement. (author)

  13. Hypoxic versus normoxic external-beam irradiation of cervical carcinoma combined with californium-252 neutron brachytherapy. Comparative treatment results of a 5-year randomized study

    Czech Academy of Sciences Publication Activity Database

    Tačev, T.; Vacek, Antonín; Ptáčková, B.; Strnad, V.

    2005-01-01

    Roč. 181, č. 5 (2005), s. 273-284 ISSN 0179-7158 Institutional research plan: CEZ:AV0Z50040507 Keywords : cervical carcinoma * hypoxyradiotherapy * californium-252 Subject RIV: BO - Biophysics Impact factor: 3.490, year: 2005

  14. Study of the shielding for spontaneous fission sources of Californium-252; Estudio de blindaje para fuentes de fision espontanea de Californio-252

    Energy Technology Data Exchange (ETDEWEB)

    Davila R, I

    1991-06-15

    A shielding study is made to attenuate, until maximum permissible levels, the neutrons radiation and photons emitted by spontaneous fission coming from a source of Californium-252. The compound package by a database (Library DLC-23) and the ANISNW code is used, in it version for personal computer. (Author)

  15. 48 CFR 52.243-6 - Change Order Accounting.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Change Order Accounting....243-6 Change Order Accounting. As prescribed in 43.205(f), the contracting officer may insert a clause, substantially the same as follows: Change Order Accounting (APR 1984) The Contracting Officer may require change...

  16. 27 CFR 46.243 - Articles at multiple locations.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 2 2010-04-01 2010-04-01 false Articles at multiple... Cigarette Tubes Held for Sale on April 1, 2009 Records § 46.243 Articles at multiple locations. The dealer must maintain a list of all places where the dealer holds articles subject to the floor stocks tax...

  17. 5 CFR 531.243 - Promotion of a GM employee.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Promotion of a GM employee. 531.243... Promotion of a GM employee. (a) Upon promotion, an employee's status as a GM employee ends, as provided in § 531.241(b). (b) When an employee loses status as a GM employee because of a temporary promotion and is...

  18. 48 CFR 52.243-1 - Changes-Fixed-Price.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Changes-Fixed-Price. 52....243-1 Changes—Fixed-Price. As prescribed in 43.205(e), insert the following clause: Changes—Fixed-Price (AUG 1987) (a) The Contracting Officer may at any time, by written order, and without notice to...

  19. 40 CFR 98.243 - Calculating GHG emissions.

    Science.gov (United States)

    2010-07-01

    ... feedstock). (MWf)i = Molecular weight of gaseous feedstock i (kg/kg-mole). MVC = Molar volume conversion... (CONTINUED) MANDATORY GREENHOUSE GAS REPORTING Petrochemical Production § 98.243 Calculating GHG emissions. (a) If you route all process vent emissions and emissions from combustion of process off-gas to one...

  20. 48 CFR 52.243-2 - Changes-Cost-Reimbursement.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Changes-Cost-Reimbursement....243-2 Changes—Cost-Reimbursement. As prescribed in 43.205(b)(1), insert the following clause. The 30-day period may be varied according to agency procedures. Changes—Cost-Reimbursement (AUG 1987) (a) The...

  1. Simulation and design of an electron beam ion source charge breeder for the californium rare isotope breeder upgrade

    Directory of Open Access Journals (Sweden)

    Clayton Dickerson

    2013-02-01

    Full Text Available An electron beam ion source (EBIS will be constructed and used to charge breed ions from the californium rare isotope breeder upgrade (CARIBU for postacceleration into the Argonne tandem linear accelerator system (ATLAS. Simulations of the EBIS charge breeder performance and the related ion transport systems are reported. Propagation of the electron beam through the EBIS was verified, and the anticipated incident power density within the electron collector was identified. The full normalized acceptance of the charge breeder with a 2 A electron beam, 0.024π  mm mrad for nominal operating parameters, was determined by simulating ion injection into the EBIS. The optics of the ion transport lines were carefully optimized to achieve well-matched ion injection, to minimize emittance growth of the injected and extracted ion beams, and to enable adequate testing of the charge bred ions prior to installation in ATLAS.

  2. Neutron activation analysis of the calcium content in vivo, using a 50μg source of californium 252

    International Nuclear Information System (INIS)

    Guey, A.; Zech, P.Y.; Meary, M.F.; Leitienne, P.

    1975-01-01

    Owing to the recent commercialisation of californium 252 it is now possible to obtain neutron fluxes strong enough for precise activation of the calcium content of biological targets. After the preliminary measurements necessary to establish the most suitable conditions for irradiating 3 to 5cm thick targets, two parallel sets of experiments were developed. In the first the medium-term total calcium variation was studied in 20 rats, 16 suffering from chronic kidney deficiency. In the second the precision expected as a function of the calcium content of the irradiated target was examined, using 3 sets of tissue equivalent standards of calcium contents 5, 20 and 50g respectively. The first results obtained on calcium 49 in vivo show that a calcium content variation can be followed with a sensitivity threshold below that obtained by conventional methods [fr

  3. Extraction of Trivalent Actinides and Lanthanides from Californium Campaign Rework Solution Using TODGA-based Solvent Extraction System

    Energy Technology Data Exchange (ETDEWEB)

    Benker, Dennis [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Delmau, Laetitia Helene [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Dryman, Joshua Cory [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States)

    2017-07-01

    This report presents the studies carried out to demonstrate the possibility of quantitatively extracting trivalent actinides and lanthanides from highly acidic solutions using a neutral ligand-based solvent extraction system. These studies stemmed from the perceived advantage of such systems over cationexchange- based solvent extraction systems that require an extensive feed adjustment to make a low-acid feed. The targeted feed solutions are highly acidic aqueous phases obtained after the dissolution of curium targets during a californium (Cf) campaign. Results obtained with actual Cf campaign solutions, but highly diluted to be manageable in a glove box, are presented, followed by results of tests run in the hot cells with Cf campaign rework solutions. It was demonstrated that a solvent extraction system based on the tetraoctyl diglycolamide molecule is capable of quantitatively extracting trivalent actinides from highly acidic solutions. This system was validated using actual feeds from a Cf campaign.

  4. Californium-252 Brachytherapy Combined With External-Beam Radiotherapy for Cervical Cancer: Long-Term Treatment Results

    International Nuclear Information System (INIS)

    Lei Xin; Qian Chengyuan; Qing Yi; Zhao Kewei; Yang Zhengzhou; Dai Nan; Zhong Zhaoyang; Tang Cheng; Li Zheng; Gu Xianqing; Zhou Qian; Feng Yan; Xiong Yanli; Shan Jinlu; Wang Dong

    2011-01-01

    Purpose: To observe, by retrospective analysis, the curative effects and complications due to californium-252 ( 252 Cf) neutron intracavitary brachytherapy (ICBT) combined with external-beam radiotherapy (EBRT) in the treatment of cervical cancer. Methods and Materials: From February 1999 to December 2007, 696 patients with cervical cancer (Stages IB to IIIB) were treated with 252 Cf-ICBT in combination of EBRT. Of all, 31 patients were at Stage IB, 104 at IIA, 363 at IIB, 64 at IIIA, and 134 at IIIB. Californium-252 ICBT was delivered at 7–12 Gy per insertion per week, with a total dose of 29–45 Gy to reference point A in three to five insertions. The whole pelvic cavity was treated with 8-MV X-ray external irradiation at 2 Gy per fraction, four times per week. After 16–38 Gy of external irradiation, the center of the whole pelvic field was blocked with a 4-cm-wide lead shield, with a total external irradiation dose of 44–56 Gy. The total treatment course was 5 to 6 weeks. Results: Overall survival rate at 3 and 5 years for all patients was 76.0% and 64.9%, respectively. Disease-free 3- and 5-year survival rates of patients were 71.2% and 58.4%, respectively. Late complications included vaginal contracture and adhesion, radiation proctitis, radiation cystitis, and inflammatory bowel, which accounted for 5.8%, 7.1%, 6.2%, and 4.9%, respectively. Univariate analysis results showed significant correlation of stage, age, histopathologic grade, and lymph node status with overall survival. Cox multiple regression analysis showed that the independent variables were stage, histopathologic grade, tumor size, and lymphatic metastasis in all patients. Conclusion: Results of this series suggest that the combined use of 252 Cf-ICBT with EBRT is an effective method for treatment of cervical cancer.

  5. Beyond Californium-A Neutron Generator Alternative for Dosimetry and Instrument Calibration in the U.S.

    Science.gov (United States)

    Piper, Roman K; Mozhayev, Andrey V; Murphy, Mark K; Thompson, Alan K

    2017-09-01

    Evaluations of neutron survey instruments, area monitors, and personal dosimeters rely on reference neutron radiations, which have evolved from the heavy reliance on (α,n) sources to a shared reliance on (α,n) and the spontaneous fission neutrons of californium-252 (Cf). Capable of producing high dose equivalent rates from an almost point source geometry, the characteristics of Cf are generally more favorable when compared to the use of (α,n) and (γ,n) sources or reactor-produced reference neutron radiations. Californium-252 is typically used in two standardized configurations: unmoderated, to yield a fission energy spectrum; or with the capsule placed within a heavy-water moderating sphere to produce a softened spectrum that is generally considered more appropriate for evaluating devices used in nuclear power plant work environments. The U.S. Department of Energy Cf Loan/Lease Program, a longtime origin of affordable Cf sources for research, testing and calibration, was terminated in 2009. Since then, high-activity sources have become increasingly cost-prohibitive for laboratories that formerly benefited from that program. Neutron generators, based on the D-T and D-D fusion reactions, have become economically competitive with Cf and are recognized internationally as important calibration and test standards. Researchers from the National Institute of Standards and Technology and the Pacific Northwest National Laboratory are jointly considering the practicality and technical challenges of implementing neutron generators as calibration standards in the U.S. This article reviews the characteristics of isotope-based neutron sources, possible isotope alternatives to Cf, and the rationale behind the increasing favor of electronically generated neutron options. The evaluation of a D-T system at PNNL has revealed characteristics that must be considered in adapting generators to the task of calibration and testing where accurate determination of a dosimetric quantity is

  6. Photodissociation of the OD radical at 226 and 243 nm

    International Nuclear Information System (INIS)

    Radenovic, Dragana C.; Roij, Andre J.A. van; Chestakov, Dmitri A.; Eppink, Andre T.J.B.; Meulen, J.J. ter; Parker, David H.; Loo, Mark P.J. van der; Groenenboom, Gerrit C.; Greenslade, Margaret E.; Lester, Marsha I.

    2003-01-01

    The photodissociation dynamics of state selected OD radicals has been examined at 243 and 226 nm using velocity map imaging to probe the angle-speed distributions of the D( 2 S) and O( 3 P 2 ) products. Both experiment and complementary first principle calculations demonstrate that photodissociation occurs by promotion of OD from high vibrational levels of the ground X 2 Π state to the repulsive 1 2 Σ - state

  7. 5 CFR 591.243 - How many members are on each COLA Advisory Committee?

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false How many members are on each COLA Advisory Committee? 591.243 Section 591.243 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL... Areas Program Administration § 591.243 How many members are on each COLA Advisory Committee? A COLA...

  8. 30 CFR 243.201 - How will MMS determine if I am financially solvent?

    Science.gov (United States)

    2010-07-01

    ... Section by one of the methods in § 243.200(a): (1) A written request asking us to consult a business... active appeals. (d) If you request that we consult a business-information or credit-reporting service or... solvent? 243.201 Section 243.201 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR...

  9. 30 CFR 243.202 - When will MMS monitor my financial solvency?

    Science.gov (United States)

    2010-07-01

    ... you ask us to consult a business-information or credit-reporting service or program under § 243.201(c...? 243.202 Section 243.202 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR MINERALS REVENUE MANAGEMENT SUSPENSIONS PENDING APPEAL AND BONDING-MINERALS REVENUE MANAGEMENT Financial...

  10. 42 CFR 456.243 - Content of medical care evaluation studies.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 4 2010-10-01 2010-10-01 false Content of medical care evaluation studies. 456.243 Section 456.243 Public Health CENTERS FOR MEDICARE & MEDICAID SERVICES, DEPARTMENT OF HEALTH AND HUMAN... Ur Plan: Medical Care Evaluation Studies § 456.243 Content of medical care evaluation studies. Each...

  11. Use of californium-252 neutron irradiator for in-vivo analysis of the bone calcium content of the hand

    International Nuclear Information System (INIS)

    Guey, A.; Leitienne, P.; Zech, P.Y.; Traeger, J.; Doyen, J.B.; Breton, J.P.

    1979-01-01

    With californium-252 it is easy to obtain a high neutron flux of the order of 10 9 n/s. The mean energy of this radiation, which is close on 2 MeV, activates calcium very well. The authors describe a storage and irradiator unit with a 100 μg californium source, with which it will henceforth be possible to develop this technique of measuring the calcium of the hand in a hospital. The test programme has three distinct phases: (1) irradiation of the biological target for 10 min; (2) after a transfer period of 30 s, detection of the radiation emitted by the 49 Ca for 600 s; (3) processing of the numerical data received, which are transmitted on line to a T 1600 calculator. The weight is found by comparing the activity induced in the unknown calcium mass with that induced in a phantom chosen as the activity standard. The reproducibility of the method is of the order of 3% (5% at the worst). The gross standardized result is edited automatically. For physical and clinical reasons, the hand is chosen as the reference part of the body in 70 control subjects. The local irradiation dose is less than 2 rem. The bone calcium content is 14.3+-1.9 g in men and 10.1+-1.3 g in women. In clinical application of the technique it is necessary to differentiate between the normal calcium content and the calcium content found with a pathological state. This makes it necessary to express the measurement in the form of a volume mass (rho). The volume of the hand skeleton (V in cm 3 ) is calculated from the corresponding bone surface (S in cm 2 ) measured by planimetry with the relationship V=8.925 exp 0.0205.S, found after studying 80 hand skeletons. In our control subjects the calcium bone volume mass was 0.288 g/cm 3 in men and 0.282 g/cm 3 in women. There is a very significant difference (p<0.001) in a population of 88 subjects with chronic renal insufficiencies at the terminal stage: rho=0.233 in men and 0.235 in women

  12. Long-term effects of an intracavitary treatment with californium-252 on normal tissue. [Swine, /sup 226/Ra

    Energy Technology Data Exchange (ETDEWEB)

    Sullivan, M.F.; Beamer, J.L.; Mahony, T.D.; Cross, F.T.; Lund, J.E.; Endres, G.W.R.

    1976-01-01

    About one hundred fifty swine were exposed to either radium-226 or californium-252 sources in the uterine cervix to determine an RBE for both acute and long-term effects. That value for early changes in the tissues at risk in the treatment of cervical cancer was between 6.2 and 6.8. The incidence of complications increased with time after exposure, especially among animals treated with /sup 252/Cf. Analysis of rectal injury showed that ulceration occurred frequently within a year postexposure at doses between 1600 and 2400 rad calculated at 2 cm lateral to the source midline. Fat necrosis and smooth muscle atrophy, resulting in a local rectal stricture, were delayed changes observed in some animals. The lower ureter was the site for a greater frequency of complications than the GI tract. Ureteral stricture often occurred at doses of 1200 rad from /sup 252/Cf and 7000 rad from /sup 226/Ra. Observation of delayed effects in the uterine-cervix in animals held up to 4 years postexposure indicate that the RBE for /sup 252/Cf may be increased to a value as high as 18, while repair may have even decreased it to about 5.6 in the rectum. Fifty swine are still being observed for long-term effects after doses above 800 rad from /sup 252/Cf and 5000 rad from /sup 226/Ra.

  13. Neutron flux characterization of californium-252 Neutron Research Facility at the University of Texas - Pan American by nuclear analytical technique

    Science.gov (United States)

    Wahid, Kareem; Sanchez, Patrick; Hannan, Mohammad

    2014-03-01

    In the field of nuclear science, neutron flux is an intrinsic property of nuclear reaction facilities that is the basis for experimental irradiation calculations and analysis. In the Rio Grande Valley (Texas), the UTPA Neutron Research Facility (NRF) is currently the only neutron facility available for experimental research purposes. The facility is comprised of a 20-microgram californium-252 neutron source surrounded by a shielding cascade containing different irradiation cavities. Thermal and fast neutron flux values for the UTPA NRF have yet to be fully investigated and may be of particular interest to biomedical studies in low neutron dose applications. Though a variety of techniques exist for the characterization of neutron flux, neutron activation analysis (NAA) of metal and nonmetal foils is a commonly utilized experimental method because of its detection sensitivity and availability. The aim of our current investigation is to employ foil activation in the determination of neutron flux values for the UTPA NSRF for further research purposes. Neutron spectrum unfolding of the acquired experimental data via specialized software and subsequent comparison for consistency with computational models lends confidence to the results.

  14. Review of fission product yields and delayed neutron data for the actinides NP-237, PU-242, AM-242M, AM-243, CM-243 and CM-245

    International Nuclear Information System (INIS)

    Mills, R.W.

    1990-07-01

    A review of fission product yields and delayed neutron data for Np-237, Pu-242, Am-242m, Am-243, Cm-243 and Cm-245 has been undertaken. Gaps in understanding and inconsistencies in existing data were identified and priority areas for further experimental, theoretical and evaluation investigation detailed

  15. Americium-241 and -243 as an ion-engine propellant

    International Nuclear Information System (INIS)

    Schachter, M.M.

    1994-01-01

    Commercially available americium-241 and -243 can be obtained as the mixture of the two isotopes in 100-gram quantities--a product of reprocessing spent nuclear powerplant fuel elements along with plutonium. The half-lives of the isotopes are 450 years for the -241 and 8,000 years for the -243 (the plutonium half-life isotope so obtained is 24,000 years). Americium rolled out in thin foil sheets emits alpha-rays (helium-4 ions) and beta-rays--2 valence electrons for each helium ion. Electrons are also considered as ions. As a foil, the americium radiates only a minimal amount of gamma-rays via the Curie effect. With appropriately designed permanent magnet rings insulated with Wood's alloy, the + and - ions can be accelerated from their already 5.5 million electron-Volts to billion and even trillions of electron-Volts by electronic control grids powered by the magnetohydrodynamic effect of electrons and helium ions streaming at the post-rocket nozzle of the ion engine. Protocol for the estimated thrust of this ion rocket engine is more than ten kilograms continuously sustainable for several thousand years

  16. Biological transport of curium-243 in dairy animals

    International Nuclear Information System (INIS)

    Sutton, W.W.; Patzer, R.G.; Hahn, P.B.; Potter, G.D.

    1979-04-01

    Lactating cows and goats were used to examine the biological transport of curium-243 in dairy animals. After either single oral or intravenous nuclide doses were administered, samples of milk, urine, blood, and feces were taken over a 144-hr priod, and the curium concentrations were determined by gamma counting. Gastrointestinal uptake of curium was estimated to be 0.02 and 0.006% of the oral dose for cows and goats, respectively. The cumulative percentage of oral dose transported to milk and urine was 4.6 x 10 -4 and 1.9 x 10 -3 , respectively, for a cow and 2.7 x 10 -4 and 1.6 x 10 -4 , respectively, for goats. Plasma concentrations of curium decreased rapidly following all intravenous injections. The average percentage of injected curium transferred to milk, urine, and feces was 2, 8, and 1, respectively, for a cow and 2, 5, and 5, respectively, for goats. All animals were sacrificed one week after dosing. Bovine bone retained the greatest fraction of the administered dose and the next highest was the liver. However, in all three intravenously dosed goats the liver contained the greatest amount of curium. Nuclide deposition in bone and liver was essentially equal for two of the three orally dosed goats while the skeleton contained the most curium in the other animal. Comparisons are presented between curium-243 and americium-241 transport in dairy cows

  17. Evaluation of neutron nuclear data for 243Am

    International Nuclear Information System (INIS)

    Igarasi, Sin-iti; Nakagawa, Tsuneo

    1977-06-01

    Evaluation of neutron nuclear data for 243 Am was performed below 16 MeV. The energy region above 250 eV was separated from the lower region where the resonance parameters were given. Evaluation was made to select suitable resonance parameters, and thermal values of the capture and fission cross sections were obtained with the adopted resonance parameters. An average fission width was assumed to bridge the cross sections at 0.0253 eV and above 250 eV. Using a semi-empirical formula, the fission cross section was reproduced above 250 eV. Optical and statistical model calculations were made in order to obtain the total, capture, inelastic and elastic scattering, and (n,2n) reaction cross sections. (auth.)

  18. Functional annotation of the genome unravels probiotic potential of Bacillus coagulans HS243.

    Science.gov (United States)

    Kapse, N G; Engineer, A S; Gowdaman, V; Wagh, S; Dhakephalkar, P K

    2018-05-30

    Spore forming Bacillus species are widely used as probiotics for human dietary supplements and in animal feeds. However, information on genetic basis of their probiotic action is obscure. Therefore, the present investigation was undertaken to elucidate probiotic traits of B. coagulans HS243 through its genome analysis. Genome mining revealed the presence of an arsenal of marker genes attributed to genuine probiotic traits. In silico analysis of HS243 genome revealed the presence of multi subunit ATPases, ADI pathway genes, chologlycine hydrolase, adhesion proteins for surviving and colonizing harsh gastric transit. HS243 genome harbored vitamin and essential amino acid biosynthetic genes, suggesting the use of HS243 as a nutrient supplement. Bacteriocin producing genes highlighted the disease preventing potential of HS243. Thus, this work established that HS243 possessed the genetic repertoire required for surviving harsh gastric transit and conferring health benefits to the host which were further validated by wet lab evidences. Copyright © 2018. Published by Elsevier Inc.

  19. Ab initio full-potential study of mechanical properties and magnetic phase stability of californium monopnictides (CfN and CfP)

    Energy Technology Data Exchange (ETDEWEB)

    Amari, S., E-mail: siham_amari@yahoo.fr [Faculté des Sciences de la Nature et de la Vie, Université Hassiba Benbouali, Chlef, 02000 (Algeria); Bouhafs, B. [Laboratoire de Modélisation et Simulation en Sciences des Matériaux, Université Djillali Liabès de Sidi Bel-Abbés, Sidi Bel-Abbés, 22000 (Algeria)

    2016-09-15

    Based on the first-principles methods, the structural, elastic, electronic, properties and magnetic ordering of californium monopnictides CfX (X = P) have been studied using the full-potential augmented plane wave plus local orbitals (FP-L/APW + lo) method within the framework of density functional theory (DFT). The electronic exchange correlation energy is described by generalized gradient approximation GGA and GGA+U (U is the Hubbard correction). The GGA+U method is applied to the rare-earth 5f states. We have calculated the lattice parameters, bulk modulii and the first pressure derivatives of the bulk modulii. The elastic properties of the studied compounds are only investigated in the most stable calculated phase. In order to gain further information, we have calculated Young’s modulus, shear modulus, anisotropy factor and Kleinman parameter by the aid of the calculated elastic constants. The results mainly show that californium monopnictides CfX (X = P) have an antiferromagnetic spin ordering. Density of states (DOS) and charge densities for both compounds are also computed in the NaCl (B1) structure.

  20. Use of polyethylene pellets in the design and construction of a storage safe, a transport vessel and a portable shield for californium-252

    International Nuclear Information System (INIS)

    Sharma, S.

    1986-01-01

    A storage and shielding facility for 300 μg of Californium-252 sources was designed and constructed. Though the safe was in a permanent location, the fact that it consisted of a lead bucket surrounded by polyethylene pellets made it simple, movable and inexpensive. If need be, more quantities of Cf-252 could be added without altering the basic design and sacrificing the radiation protection guidelines. The measured radiation levels from 300 μg of stored Cf-252 in and around the storage vault were lower than the expected dose rates by a factor of 5. The measured radiation levels around the occupied environs of the facility were below the maximum permissible yearly dose of 500mrem for non-occupational workers. A transport vessel was designed and constructed to carry up to 50 μg of Californium-252 sources. It consisted of a standard 55 gallon steel drum on casters containing cylindrical lead shield surrounded by polyethylene pellets. The measured maximum surface dose rates on the drum and at one meter away were within the radiation protection guidelines and were less than the expected dose rates. A portable shield was designed and constructed to protect the body in afterloading operations and handling of the sources. It consisted of polyethylene pellets in an aluminum box and an attached 10 cm thick plexiglass eye shield. The simple design, with the ease of using polyethylene pellets can be extended to construct bedside shields

  1. Motion of the moonlet in the binary system 243 Ida

    Science.gov (United States)

    Lan, L.; Ni, Y.; Jiang, Y.; Li, J.

    2018-02-01

    The motion of the moonlet Dactyl in the binary system 243 Ida is investigated in this paper. First, periodic orbits in the vicinity of the primary are calculated, including the orbits around the equilibrium points and large-scale orbits. The Floquet multipliers' topological cases of periodic orbits are calculated to study the orbits' stabilities. During the continuation of the retrograde near-circular orbits near the equatorial plane, two period-doubling bifurcations and one Neimark-Sacker bifurcation occur one by one, leading to two stable regions and two unstable regions. Bifurcations occur at the boundaries of these regions. Periodic orbits in the stable regions are all stable, but in the unstable regions are all unstable. Moreover, many quasi-periodic orbits exist near the equatorial plane. Long-term integration indicates that a particle in a quasi-periodic orbit runs in a space like a tire. Quasi-periodic orbits in different regions have different styles of motion indicated by the Poincare sections. There is the possibility that moonlet Dactyl is in a quasi-periodic orbit near the stable region I, which is enlightening for the stability of the binary system.

  2. 19 CFR 24.3a - CBP bills; interest assessment; delinquency; notice to principal and surety.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false CBP bills; interest assessment; delinquency; notice to principal and surety. 24.3a Section 24.3a Customs Duties U.S. CUSTOMS AND BORDER PROTECTION....3a CBP bills; interest assessment; delinquency; notice to principal and surety. (a) Due date of CBP...

  3. 40 CFR 61.243-2 - Alternative standards for valves in VHAP service-skip period leak detection and repair.

    Science.gov (United States)

    2010-07-01

    ... VHAP service-skip period leak detection and repair. 61.243-2 Section 61.243-2 Protection of Environment... AIR POLLUTANTS National Emission Standard for Equipment Leaks (Fugitive Emission Sources) § 61.243-2 Alternative standards for valves in VHAP service—skip period leak detection and repair. (a)(1) An owner or...

  4. 76 FR 13075 - Airworthiness Directives; Airbus Model A330-243F Airplanes

    Science.gov (United States)

    2011-03-10

    ... Airworthiness Directives; Airbus Model A330-243F Airplanes AGENCY: Federal Aviation Administration (FAA... recent in-service event the flight crew of a Trent 700 powered A330 aircraft [[Page 13076

  5. Erosion and Ejecta Reaccretion on 243 Ida and Its Moon

    Science.gov (United States)

    Geissler, Paul; Petit, Jean-Marc; Durda, Daniel D.; Greenberg, Richard; Bottke, William; Nolan, Michael; Moore, Jeffrey

    1996-03-01

    Galileo images of Asteroid 243 Ida and its satellite Dactyl show surfaces which are dominantly shaped by impact cratering. A number of observations suggest that ejecta from hypervelocity impacts on Ida can be distributed far and wide across the Ida system, following trajectories substantially affected by the low gravity, nonspherical shape, and rapid rotation of the asteroid. We explore the processes of reaccretion and escape of ejecta on Ida and Dactyl using three-dimensional numerical simulations which allow us to compare the theoretical effects of orbital dynamics with observations of surface morphology. The effects of rotation, launch location, and initial launch speed are first examined for the case of an ideal triaxial ellipsoid with Ida's approximate shape and density. Ejecta launched at low speeds (V≪Vesc) reimpact near the source craters, forming well-defined ejecta blankets which are asymmetric in morphology between leading and trailing rotational surfaces. The net effect of cratering at low ejecta launch velocities is to produce a thick regolith which is evenly distributed across the surface of the asteroid. In contrast, no clearly defined ejecta blankets are formed when ejecta is launched at higher initial velocities (V∼Vesc). Most of the ejecta escapes, while that which is retained is preferentially derived from the rotational trailing surfaces. These particles spend a significant time in temporary orbit around the asteroid, in comparison to the asteroid's rotation period, and tend to be swept up onto rotational leading surfaces upon reimpact. The net effect of impact cratering with high ejecta launch velocities is to produce a thinner and less uniform soil cover, with concentrations on the asteroids' rotational leading surfaces. Using a realistic model for the shape of Ida (P. Thomas, J. Veverka, B. Carcich, M. J. S. Belton, R. Sullivan, and M. Davies 1996,Icarus120, 000-000), we find that an extensive color/albedo unit which dominates the

  6. CL316,243, a β3-adrenergic receptor agonist, induces muscle hypertrophy and increased strength.

    Science.gov (United States)

    Puzzo, Daniela; Raiteri, Roberto; Castaldo, Clotilde; Capasso, Raffaele; Pagano, Ester; Tedesco, Mariateresa; Gulisano, Walter; Drozd, Lisaveta; Lippiello, Pellegrino; Palmeri, Agostino; Scotto, Pietro; Miniaci, Maria Concetta

    2016-11-22

    Studies in vitro have demonstrated that β3-adrenergic receptors (β3-ARs) regulate protein metabolism in skeletal muscle by promoting protein synthesis and inhibiting protein degradation. In this study, we evaluated whether activation of β3-ARs by the selective agonist CL316,243 modifies the functional and structural properties of skeletal muscles of healthy mice. Daily injections of CL316,243 for 15 days resulted in a significant improvement in muscle force production, assessed by grip strength and weight tests, and an increased myofiber cross-sectional area, indicative of muscle hypertrophy. In addition, atomic force microscopy revealed a significant effect of CL316,243 on the transversal stiffness of isolated muscle fibers. Interestingly, the expression level of mammalian target of rapamycin (mTOR) downstream targets and neuronal nitric oxide synthase (NOS) was also found to be enhanced in tibialis anterior and soleus muscles of CL316,243 treated mice, in accordance with previous data linking β3-ARs to mTOR and NOS signaling pathways. In conclusion, our data suggest that CL316,243 systemic administration might be a novel therapeutic strategy worthy of further investigations in conditions of muscle wasting and weakness associated with aging and muscular diseases.

  7. Fission-product yields for thermal-neutron fission of curium-243

    International Nuclear Information System (INIS)

    Breederland, D.G.

    1982-01-01

    Cumulative fission yields for 25 gamma rays emitted during the decay of 23 fission products produced by thermal-neutron fission of 243 Cm have been determined. Using Ge(Li) spectroscopy, 33 successive pulse-height spectra of gamma rays emitted from a 77-ng sample of 243 Cm over a period of approximately two and one-half months were analyzed. Reduction of these spectra resulted in the identification and matching of gamma-ray energies and half-lives to specific radionuclides. Using these results, 23 cumulative fission-product yields were calculated. Only those radionuclides having half-lives between 6 hours and 65 days were observed. Prior to this experiment, no fission-product yields had been recorded for 243 Cm

  8. Measurement of 24.3 keV activation cross sections with the iron filter technique

    International Nuclear Information System (INIS)

    Rimawi, K.; Chrien, R.E.

    1975-01-01

    By using high-resolution detection techniques, intensities of specific activation lines from 197 Au(n,gamma), 238 U(n,gamma), 127 I(n,gamma), and 115 In(n,gamma) [54 min + 2.2 sec] were recorded, by using the BNL HFBR iron-filtered neutron beam. From a com- parison with the reaction 10 B(n,αgamma), cross sections at 24.3 keV were determined. (24.3 keV neutron activation cross sections, relative 10 B standard). (4 figures) (U.S.)

  9. Pesticides: Benefaction or Pandora's Box? A synopsis of the environmental aspects of 243 pesticides

    NARCIS (Netherlands)

    Linders JBHJ; Jansma JW; Mensink BJWG; Otermann K; ACT

    1994-01-01

    The report provides an overview of physical, chemical and environmental data of 243 pesticides. The data mentioned are based on confidential information supplied by the manufacturers of the pesticides. For all pesticides mentioned a Final Environmental File, which is public, is derived. Tables with

  10. Californium interrogation prompt neutron (CIPN) instrument for non-destructive assay of spent nuclear fuel—Design concept and experimental demonstration

    Energy Technology Data Exchange (ETDEWEB)

    Henzlova, D., E-mail: henzlova@lanl.gov [Los Alamos National Laboratory, Los Alamos, NM 87545 (United States); Menlove, H.O.; Rael, C.D.; Trellue, H.R.; Tobin, S.J. [Los Alamos National Laboratory, Los Alamos, NM 87545 (United States); Park, Se-Hwan; Oh, Jong-Myeong; Lee, Seung-Kyu; Ahn, Seong-Kyu; Kwon, In-Chan; Kim, Ho-Dong [Korea Atomic Energy Research Institute, Daejeong (Korea, Republic of)

    2016-01-11

    This paper presents results of the first experimental demonstration of the Californium Interrogation Prompt Neutron (CIPN) instrument developed within a multi-year effort launched by the Next Generation Safeguards Initiative Spent Fuel Project of the United States Department of Energy. The goals of this project focused on developing viable non-destructive assay techniques with capabilities to improve an independent verification of spent fuel assembly characteristics. For this purpose, the CIPN instrument combines active and passive neutron interrogation, along with passive gamma-ray measurements, to provide three independent observables. This paper describes the initial feasibility demonstration of the CIPN instrument, which involved measurements of four pressurized-water-reactor spent fuel assemblies with different levels of burnup and two initial enrichments. The measurements were performed at the Post-Irradiation Examination Facility at the Korea Atomic Energy Institute in the Republic of Korea. The key aim of the demonstration was to evaluate CIPN instrument performance under realistic deployment conditions, with the focus on a detailed assessment of systematic uncertainties that are best evaluated experimentally. The measurements revealed good positioning reproducibility, as well as a high degree of insensitivity of the CIPN instrument's response to irregularities in a radial burnup profile. Systematic uncertainty of individual CIPN instrument signals due to assembly rotation was found to be <4.5%, even for assemblies with fairly extreme gradients in the radial burnup profile. These features suggest that the CIPN instrument is capable of providing a good representation of assembly average characteristics, independent of assembly orientation in the instrument.

  11. Californium interrogation prompt neutron (CIPN) instrument for non-destructive assay of spent nuclear fuel—Design concept and experimental demonstration

    International Nuclear Information System (INIS)

    Henzlova, D.; Menlove, H.O.; Rael, C.D.; Trellue, H.R.; Tobin, S.J.; Park, Se-Hwan; Oh, Jong-Myeong; Lee, Seung-Kyu; Ahn, Seong-Kyu; Kwon, In-Chan; Kim, Ho-Dong

    2016-01-01

    This paper presents results of the first experimental demonstration of the Californium Interrogation Prompt Neutron (CIPN) instrument developed within a multi-year effort launched by the Next Generation Safeguards Initiative Spent Fuel Project of the United States Department of Energy. The goals of this project focused on developing viable non-destructive assay techniques with capabilities to improve an independent verification of spent fuel assembly characteristics. For this purpose, the CIPN instrument combines active and passive neutron interrogation, along with passive gamma-ray measurements, to provide three independent observables. This paper describes the initial feasibility demonstration of the CIPN instrument, which involved measurements of four pressurized-water-reactor spent fuel assemblies with different levels of burnup and two initial enrichments. The measurements were performed at the Post-Irradiation Examination Facility at the Korea Atomic Energy Institute in the Republic of Korea. The key aim of the demonstration was to evaluate CIPN instrument performance under realistic deployment conditions, with the focus on a detailed assessment of systematic uncertainties that are best evaluated experimentally. The measurements revealed good positioning reproducibility, as well as a high degree of insensitivity of the CIPN instrument's response to irregularities in a radial burnup profile. Systematic uncertainty of individual CIPN instrument signals due to assembly rotation was found to be <4.5%, even for assemblies with fairly extreme gradients in the radial burnup profile. These features suggest that the CIPN instrument is capable of providing a good representation of assembly average characteristics, independent of assembly orientation in the instrument.

  12. Critical mass calculations for 241Am, 242mAm and 243Am

    International Nuclear Information System (INIS)

    Dias, Hemanth; Tancock, Nigel; Clayton, Angela

    2003-01-01

    Criticality mass calculations are reported for 241 Am, 242m Am and 243 Am using the MONK and MCNP computer codes with the UKNDL, JEF-2.2, ENDF/B-VI and JENDL-3.2 nuclear data libraries. Results are reported for spheres of americium metal and dioxide in bare, water reflected and steel reflected systems. Comparison of results led to the identification of a serious inconsistency in the 241 Am ENDF/B-VI DICE library used by MONK - this demonstrates the importance of using different codes to verify critical mass calculations. The 241 Am critical mass estimates obtained using UKNDL and ENDF/B-VI show good agreement with experimentally inferred data, whilst both JEF-2.2 and JENDL-3.2 produce higher estimates of critical mass. The computed critical mass estimates for 242m Am obtained using ENDF/B-VI are lower than the results produced using the other nuclear data libraries - the ENDF/B-VI fission cross-section for 242m Am is significantly higher than the other evaluations in the fast region and is not supported by recent experimental data. There is wide variation in the computed 243 Am critical mass estimates suggesting that there is still considerable uncertainty in the 243 Am nuclear data. (author)

  13. Hydration Experiments and Physical Observations at 193 K and 243 K for Mg-Sulfates Relevant to Mars

    Science.gov (United States)

    Vaniman, D. T.; Chipera, S. J.; Carey, J. W.

    2006-03-01

    Hydration of kieserite and amorphous Mg-sulfate at 243 K progresses along simple pathways involving only hexahydrite and kieserite. Kieserite forms a duricrust-like cement, but the anhydrous precursor does not.

  14. Measurements of neutron cross section of the {sup 243}Am(n,{gamma}){sup 244}Am reaction

    Energy Technology Data Exchange (ETDEWEB)

    Hatsukawa, Yuichi; Shinohara, Nobuo; Hata, Kentaro [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment

    1998-03-01

    The effective thermal neutron cross section of {sup 243}Am(n,{gamma}){sup 244}Am reaction was measured by the activation method. Highly-purified {sup 243}Am target was irradiated in an aluminum capsule by using a research reactor JRR-3M. The tentative effective thermal neutron cross sections are 3.92 b, and 84.44 b for the production of {sup 244g}Am and {sup 244m}Am, respectively. (author)

  15. Measurement of fission cross section with pure Am-243 sample using lead slowing-down spectrometer

    Energy Technology Data Exchange (ETDEWEB)

    Kobayashi, Katsuhei; Yamamoto, Shuji; Kai, T.; Fujita, Yoshiaki; Yamamoto, Hideki; Kimura, Itsuro [Kyoto Univ. (Japan); Shinohara, Nobuo

    1997-03-01

    By making use of back-to-back type double fission chambers and a lead slowing-down spectrometer coupled to an electron linear accelerator, the fission cross section for the {sup 243}Am(n,f) reaction has been measured relative to that for the {sup 235}U(n,f) reaction in the energy range from 0.1 eV to 10 keV. The measured result was compared with the evaluated nuclear data appeared in ENDF/B-VI and JENDL-3.2, whose evaluated data were broadened by the energy resolution function of the spectrometer. General agreement was seen between the evaluated data and the measurement except that the ENDF/B-VI data were lower in the range from 15 to 60 eV and that the JENDL-3.2 data seemed to be lower above 100 eV. (author)

  16. Evaluation of neutron nuclear data for 241Am and 243Am

    International Nuclear Information System (INIS)

    Kikuchi, Yasuyuki

    1982-08-01

    Neutron nuclear data of 241 Am and 243 Am were evaluated for JENDL-2. Evaluated quantities are the total, elastic and inelastic scattering, fission, capture, (n,2n), (n,3n) and (n,4n) reaction cross sections, the resolved and unresolved resonance parameters, the angular or energy distribution of the emitted neutrons, and the average number of neutrons emitted per fission. The fission cross section was evaluated on the basis of newly measured data, and lower values than JENDL-1 were given in the subthreshold energy region. The reliability of the calculation parameters are also much improved, because experimental data became available for the total and capture cross sections of 241 Am in the high energy region. (author)

  17. Cluster decay channel in 238U + 40Ar (243 MeV)

    International Nuclear Information System (INIS)

    Pyatkov, Yu.V.; Penionzhkevich, Yu.Eh.; Osetrov, O.I.

    1999-01-01

    The reaction 238 U + 40 Ar (E lab = 243 MeV) was studied. For the first time a pronounced fine structure (FS) in the form of distinct peaks has been observed in the mass yields of the fragments of the 278 110 nuclear system decay at the initial excitation of about 60 MeV. The FS peaks are located in the vicinity of the mass numbers A ∼ 70, 100, 130, which are specific for magic nuclei (clusters) of Ni, Ge, Zr, Sn, Sr. The FS peaks contain only low-energy events linked with the very elongated prescission configurations of the system. Some events are observed which can be treated as an indication of ternary fission via such configurations with the appearance of two equal clusters. Hence presumably the collinear cluster tripartition channel is realized observed earlier in the spontaneous fission of 248 Cm and 252 Cf nuclei

  18. Tat protein vaccination of cynomolgus macaques influences SHIV-89.6P cy243 epitope variability.

    Science.gov (United States)

    Ridolfi, Barbara; Genovese, Domenico; Argentini, Claudio; Maggiorella, Maria Teresa; Sernicola, Leonardo; Buttò, Stefano; Titti, Fausto; Borsetti, Alessandra; Ensoli, Barbara

    2008-02-01

    In a previous study we showed that vaccination with the native Tat protein controlled virus replication in five out of seven monkeys against challenge with the simian human immunodeficiency virus (SHIV)-89.6P cy243 and that this protection correlated with T helper (Th)-1 response and cytotoxic T lymphocyte (CTL) activity. To address the evolution of the SHIV-89.6P cy243 both in control and vaccinated infected monkeys, the sequence of the human immunodeficiency virus (HIV)-1 Tat protein and the C2-V3 Env region of the proviral-DNA-derived clones were analyzed in both control and vaccinated but unprotected animals. We also performed analysis of the T cell epitope using a predictive epitope model taking into consideration the phylogeny of the variants. Our results suggest that even though the viral evolution observed in both groups of monkeys was directed toward variations in the major histocompatibility complex (MHC)-I epitopes, in the control animals it was associated with mutational escape of such epitopes. On the contrary, it is possible that viral evolution in the vaccinated monkeys was linked to mutations that arose to keep high the viral fitness. In the vaccinated animals the reduction of epitope variability, obtained prompting the immune system by vaccination and inducing a specific immunological response against virus, was able to reduce the emergence of escape mutants. Thus the intervention of host's selective forces in driving CTL escape mutants and in modulating viral fitness appeared to be different in the two groups of monkeys. We concluded that in the vaccinated unprotected animals, vaccination with the Tat protein induced a broad antiviral response, as demonstrated by the reduced ability to develop escape mutants, which is known to help in the control of viral replication.

  19. Californium-252 Program Equipment Evaluation

    Energy Technology Data Exchange (ETDEWEB)

    Chattin, Fred Rhea [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Wilson, Kenton [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Ezold, Julie G. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States)

    2017-12-01

    To successfully continue the 252Cf production and meet the needs of the customers, a comprehensive evaluation of the Building 7920 processing equipment was requested to identify equipment critical to the operational continuity of the program.

  20. Californium Recovery from Palladium Wire

    Energy Technology Data Exchange (ETDEWEB)

    Burns, Jon D. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States)

    2014-08-01

    The recovery of 252Cf from palladium-252Cf cermet wires was investigated to determine the feasibility of implementing it into the cermet wire production operation at Oak Ridge National Laboratory’s Radiochemical Engineering Development Center. The dissolution of Pd wire in 8 M HNO3 and trace amounts of HCl was studied at both ambient and elevated temperatures. These studies showed that it took days to dissolve the wire at ambient temperature and only 2 hours at 60°C. Adjusting the ratio of the volume of solvent to the mass of the wire segment showed little change in the kinetics of dissolution, which ranged from 0.176 mL/mg down to 0.019 mL/mg. A successful chromatographic separation of 153Gd, a surrogate for 252Cf, from Pd was demonstrated using AG 50x8 cation exchange resin with a bed volume of 0.5 mL and an internal diameter of 0.8 cm.

  1. 3-Amino-1,2,4-triazolium ion in [24(3at)]Cl and [24(3at)]2SnCl6·H2O. Comparative X-ray, vibrational and theoretical studies

    Science.gov (United States)

    Daszkiewicz, Marek; Marchewka, Mariusz K.

    2012-09-01

    Crystal structures of 3-amino-1,2,4-triazolium chloride and bis(3-amino-1,2,4-triazolium) hexachloridostannate monohydrate were determined by means of X-ray single crystal diffraction. The route of protonation of organic molecule and tautomer equilibrium constants for the cationic forms were calculated using B3LYP/6-31G* method. The most stable protonated species is 2,4-H2-3-amino-1,2,4-triazolium ion, 24(3at)+. Very good agreement between theoretical and experimental frequencies was achieved due to very weak interactions existing in studied compounds. Significantly weaker intermolecular interactions are found in [24(3at)]2SnCl6·H2O than in [24(3at)]Cl. The differences in strength of interactions are manifested in red and blue shifts for stretching and bending motions, respectively. PED calculations show that for 24(3at)+ ion the stretching type of motion of two Nringsbnd H bonds is independent, whereas bending is coupled.

  2. Measurement of fast neutron induced fission cross sections of 232Th, 238U, 237Np and 243Am

    International Nuclear Information System (INIS)

    Kanda, Kazutaka; Sato, Osamu; Yoshida, Kazuo; Imaruoka, Hiromitsu; Terayama, Hiromichi; Yoshida, Masashi; Hirakawa, Naohiro

    1984-01-01

    Neutron induced fission cross sections of 232 Th, 238 U, 237 Np and 243 Am relative to 235 U were measured in the energy range from 1.5 to 6.6 MeV. The present results are compared with experimental results of others and evaluated data in JENDL-2 and ENDF/B-IV. (author)

  3. Recoil-alpha-fission and recoil-alpha-alpha-fission events observed in the reaction Ca-48 + Am-243

    NARCIS (Netherlands)

    Forsberg, U.; Rudolph, D.; Andersson, L. -L.; Nitto, A. Di; Düllmann, Ch E.; Gates, J. M.; Golubev, P.; Gregorich, K. E.; Gross, C. J.; Herzberg, R. -D.; Hessberger, F. P.; Khuyagbaatar, J.; Kratz, J. V.; Rykaczewski, K.; Sarmiento, L. G.; Schädel, M.; Yakushev, A.; Åberg, S.; Ackermann, D.; Block, M.; Brand, H.; Carlsson, B. G.; Cox, D.; Derkx, X.; Dobaczewski, J.; Eberhardt, K.; Even, J.; Fahlander, C.; Gerl, J.; Jäger, E.; Kindler, B.; Krier, J.; Kojouharov, I.; Kurz, N.; Lommel, B.; Mistry, A.; Mokry, C.; Nazarewicz, W.; Nitsche, H.; Omtvedt, J. P.; Papadakis, P.; Ragnarsson, I.; Runke, J.; Schaffner, H.; Schausten, B.; Shi, Y.; Thörle-Pospiech, P.; Torres, T.; Traut, T.; Trautmann, N.; Türler, A.; Ward, A.; Ward, D. E.; Wiehl, N.

    2016-01-01

    Products of the fusion-evaporation reaction Ca-48 + Am-243 were studied with the TASISpec set-up at the gas-filled separator TASCA at the GSI Helmholtzzentrum f\\"ur Schwerionenforschung. Amongst the detected thirty correlated alpha-decay chains associated with the production of element Z=115, two

  4. Measurement and analysis of the $^{243}$Am neutron capture cross section at the n_TOF facility at CERN

    CERN Document Server

    Mendoza, E; Guerrero, C; Berthoumieux, E; Abbondanno, U; Aerts, G; Alvarez-Velarde, F; Andriamonje, S; Andrzejewski, J; Assimakopoulos, P; Audouin, L; Badurek, G; Balibrea, J; Baumann, P; Becvar, F; Belloni, F; Calvino, F; Calviani, M; Capote, R; Carrapico, C; Carrillo de Albornoz, A; Cennini, P; Chepel, V; Chiaveri, E; Colonna, N; Cortes, G; Couture, A; Cox, J; Dahlfors, M; David, S; Dillmann, I; Dolfini, R; Domingo-Pardo, C; Dridi, W; Duran, I; Eleftheriadis, C; Ferrant†, L; Ferrari, A; Ferreira-Marques, R; Fitzpatrick, L; Frais-Koelbl, H; Fujii, K; Furman, W; Goncalves, I; Gonz alez-Romero, E; Goverdovski, A; Gramegna, F; Griesmayer, E; Gunsing, F; Haas, B; Haight, R; Heil, M; Herrera-Martinez, A; Igashira, M; Isaev, S; Jericha, E; Kappeler, F; Kadi, Y; Karadimos, D; Karamanis, D; Ketlerov, V; Kerveno, M; Koehler, P; Konovalov, V; Kossionides, E; Krticka, M; Lampoudis, C; Leeb, H; Lindote, A; Lopes, I; Lossito, R; Lozano, M; Lukic, S; Marganiec, J; Marques, L; Marrone, S; Martınez, T; Massimi, C; Mastinu, P; Mengoni, A; Milazzo, P M; Moreau, C; Mosconi, M; Neves, F; Oberhummer, H; O’Brien, S; Oshima, M; Pancin, J; Papachristodoulou, C; Papadopoulos, C; Paradela, C; Patronis, N; Pavlik, A; Pavlopoulos, P; Perrot, L; Pigni, M T; Plag, R; Plompen, A; Plukis, A; Poch, A; Praena, J; Pretel, C; Quesada, J; Rauscher, T; Reifarth, R; Rosetti, M; Rubbia, C; Rudolf, G; Rullhusen, P; Salgado, J; Santos, C; Sarchiapone, L; Savvidis, I; Stephan, C; Tagliente, G; Tain, J L; Tassan-Got, L; Tavora, L; Terlizzi, R; Vannini, G; Vaz, P; Ventura, A; Villamarin, D; Vicente, M C; Vlachoudis, V; Vlastou, R; Voss, F; Walter, S; Wendler, H; Wiescher, M; Wisshak, K

    2014-01-01

    Background:The design of new nuclear reactors and transmutation devices requires to reduce the present neutron cross section uncertainties of minor actinides. Purpose: Reduce the $^{243}$Am(n,$\\gamma$) cross section uncertainty. Method: The $^{243}$Am(n,$\\gamma$) cross section has been measured at the n_TOF facility at CERN with a BaF$_{2}$ Total Absorption Calorimeter, in the energy range between 0.7 eV and 2.5 keV. Results: The $^{243}$Am(n,$\\gamma$) cross section has been successfully measured in the mentioned energy range. The resolved resonance region has been extended from 250 eV up to 400 eV. In the unresolved resonance region our results are compatible with one of the two incompatible capture data sets available below 2.5 keV. The data available in EXFOR and in the literature has been used to perform a simple analysis above 2.5 keV. Conclusions: The results of this measurement contribute to reduce the $^{243}$Am(n,$\\gamma$) cross section uncertainty and suggest that this cross section is underestimate...

  5. Measurement of the 241Am and the 243Am Neutron Capture Cross Sections at the n_TOF Facility at CERN

    CERN Document Server

    Mendoza, E; Guerrero, C; Altstadt, S; Andrzejewski, J; Audouin, L; Barbagallo, M; Bécares, V; Bečvář, F; Belloni, F; Berthoumieux, E; Billowes, J; Boccone, V; Bosnar, D; Brugger, M; Calviani, M; Calviño, F; Carrapiço, C; Cerutti, F; Chiaveri, E; Chin, M; Colonna, N; Cortés, G; Cortés-Giraldo, M A; Diakaki, M; Domingo-Pardo, C; Duran, I; Dressler, R; Dzysiuk, N; Eleftheriadis, C; Ferrari, A; Fraval, K; Ganesan, S; García, A R; Giubrone, G; Gómez-Hornillos, M B; Gonçalves, I F; González-Romero, E; Griesmayer, E; Gunsing, F; Gurusamy, P; Jenkins, D G; Jericha, E; Kadi, Y; Käppeler, F; Karadimos, D; Kivel, N; Koehler, P; Kokkoris, M; Korschinek, G; Krtička, M; Kroll, J; Langer, C; Lederer, C; Leeb, H; Leong, L S; Losito, R; Manousos, A; Marganiec, J; Martínez, T; Mastinu, P F; Mastromarco, M; Massimi, C; Meaze, M; Mengoni, A; Milazzo, P M; Mingrone, F; Mirea, M; Mondelaers, W; Paradela, C; Pavlik, A; Perkowski, J; Pignatari, M; Plompen, A; Praena, J; Quesada, J M; Rauscher, T; Reifarth, R; Riego, A; Roman, F; Rubbia, C; Sarmento, R; Schillebeeckx, P; Schmidt, S; Schumann, D; Tagliente, G; Tain, J L; Tarrío, D; Tassan-Got, L; Tsinganis, A; Valenta, S; Vannini, G; Variale, V; Vaz, P; Ventura, A; Versaci, R; Vermeulen, M J; Vlachoudis, V; Vlastou, R; Wallner, A; Ware, T; Weigand, M; Weiß, C; Wright, T J; Žugec, P

    2014-01-01

    The capture cross sections of Am-241 and Am-243 were measured at the n\\_TOF facility at CERN in the epithermal energy range with a BaF2 Total Absorption Calorimeter. A preliminary analysis of the Am-241 and a complete analysis of the Am-243 measurement, including the data reduction and the resonance analysis, have been performed.

  6. Investigating SLIM Disk Solutions FOR HLX-1 IN ESO 243-49

    Science.gov (United States)

    Godet, O.; Plazolles, B.; Kawaguchi, T.; Lasota, J.-P; Barret, d.; Farrell, S. A.; Braito, V.; Servillat, M.; Webb, N.; Gehrels, N.

    2012-01-01

    The hyperluminous X-ray source HLX-1 in the galaxy ESO 243-49, currently the best intermediate-mass blackhole (BH) candidate, displays spectral transitions similar to those observed in Galactic BH binaries, but with aluminosity 100-1000 times higher. We investigated the X-ray properties of this unique source by fitting multiepochdata collected by Swift, XMM-Newton, and Chandra with a disk model computing spectra for a wide rangeof sub- and super-Eddington accretion rates assuming a non-spinning BH and a face-on disk (i=0 deg.). Under theseassumptions we find that the BH in HLX-1 is in the intermediate-mass range (approximately 2 x 10(exp 4) solar mass) and the accretionflow is in the sub-Eddington regime. The disk radiation efficiency is eta = 0.11 plus or minus 0.03. We also show that the source does follow the LX is proportional to T(exp 4) relation for our mass estimate. At the outburst peaks, the source radiates near the Eddington limit. The accretion rate then stays constant around 4 x 10(exp 4) solar mass yr (sup -1) for several days and then decreases exponentially. Such plateaus in the accretion rate could be evidence that enhanced mass-transfer rateis the driving outburst mechanism in HLX-1. We also report on the new outburst observed in 2011 August by theSwift X-Ray Telescope. The time of this new outburst further strengthens the approximately 1 year recurrence timescale.

  7. The influence of impurities for cross section measurement of {sup 241,243}Am(n,f) reactions

    Energy Technology Data Exchange (ETDEWEB)

    Kai, Tetsuya; Kobayashi, Katsuhei; Yamamoto, Shuji; Fujita, Yoshiaki; Kimura, Itsuro; Miyoshi, Mitsuharu; Yamamoto, Hideki [Kyoto Univ. (Japan); Shinohara, Nobuo

    1997-03-01

    The influence of the impurities on the fission cross section measurements for {sup 241}Am and {sup 243}Am has been investigated with the practical results. Following cases have been considered as the influence of impurities; (a) experiments with the {sup 241}Am sample that contains impurities originally, and (b) experiments with the {sup 243}Am sample that contains impurities produced by {alpha}, {beta} decays after the chemical purification. The present study has demonstrated the usefulness of pure samples by the comparison of the experiments using the sample on the market with those using the pure sample processed by the authors. Particularly on the case (b), the correction of the impurity through the periodical measurements was experimentally performed (about 18% around 0.3 eV in 4 weeks after the chemical purification). (author)

  8. Independent Yields of Kr and Xe Fragments at Photofission of Odd Nuclei ^{237}Np and ^{243}Am

    CERN Document Server

    Gangrsky, Yu P; Myshinskii, G V; Penionzhkevich, Yu E

    2004-01-01

    he independent yields of fragments Kr (A=89-93) and Xe (A=135-142) at photofission of odd nuclei 237Np and 243Am are presented. The experiments were performed using the bremsstrahlung of 25 MeV electrons on the microtron of FLNR, JINR. A technique was used that included the transportation of fragments which escaped from the target with the gas flow through a capillary and the condensation of inert gases in a cryostat at the temperature of liquid nitrogen. Kr and Xe isotopes were identified by the spectra of their daughter products. The mass number distributions of the independent yields of Kr and Xe isotopes and of the complementary fragments (Y and La at the photofission of ^{237}Np and Nb and Pr at the photofission of ^{243}Am) were obtained.

  9. Reaction mechanisms in 24.3 MeV/nucleon 238U induced reactions through a comprehensive study of fission

    International Nuclear Information System (INIS)

    Chbihi, A.; Galin; Guerreau, D.; Lewitowicz, M.; Morjean, M.; Pouthas, J.; Piasecki, E.; Kordyasz, A.; Iwanicki, J.; Jastrzebski, J.; Pienkowski, L.; Crema, E.; Gatty, B.; Jacquet, D.; Muchorowska, M.

    1994-01-01

    Nuclear reaction mechanisms for system characterized by very different asymmetries (U+C, Si, Ni, Au) have been investigated at 24.3 MeV/nucleon, using as observables both the fission products and the neutron multiplicity. It is clearly observed that the fusion process-whatever its completeness- can only occur with rather light target nuclei, indicating the persistence of potential energy effects much above the interaction barrier. (authors). 22 refs., 1 fig

  10. Manganese determination om minerals by activation analysis, using the californium-252 as a neutron source; Determinacao de manganes em minerios, por analise por ativacao, usando californio-252 como fonte de neutrons

    Energy Technology Data Exchange (ETDEWEB)

    Cardoso, Antonio

    1976-07-01

    Neutron Activation Analysis, using a Californium-252 neutron source, has been applied for the determination of manganese in ores such as pyrolusite, rodonite (manganese silicate)' and blending used in dry-batteries The favorable nuclear properties of manganese, such as high thermal neutron cross-section for the reaction {sup 55}Mn (n.gamma){sup 56} Mn, high concentration of manganese in the matrix and short half - life of {sup 56}Mn, are an ideal combination for non-destructive analysis of manganese in ores. Samples and standards of manganese dioxide were irradiated for about 20 minutes, followed by a 4 to 15 minutes decay and counted in a single channel pulse-height discrimination using a NaI(Tl) scintillation detector. Counting time was equal to 10 minutes. The interference of nuclear reactions {sup 56}Fe(n,p){sup 56}Mn and {sup 59} Co (n, {alpha}){sup 56} were studied, as well as problems in connection with neutron shadowing during irradiation, gamma-rays attenuation during counting and influence of granulometry of samples. One sample,was also analysed by wet-chemical method (sodium bismuthate) in order to compare results. As a whole, i t was shown that the analytical method of neutron activation for manganese in ores and blending, is a method simple, rapid and with good precision and accuracy. (author)

  11. Design of a homogeneous subcritical nuclear reactor based on thorium with a source of californium 252; Diseno de un reactor nuclear subcritico homogeneo a base de Torio con una fuente de Californio 252

    Energy Technology Data Exchange (ETDEWEB)

    Delgado H, C. E.; Vega C, H. R. [Universidad Autonoma de Zacatecas, Unidad Academica de Estudios Nucleares, Cipres No. 10, Fracc. La Penuela, 98068 Zacatecas, Zac. (Mexico); Sajo B, L., E-mail: ce_delgado89@hotmail.com [Universidad Simon Bolivar, Laboratorio de Fisica Nuclear, Apdo. 89000, 1080A Caracas (Venezuela, Bolivarian Republic of)

    2015-10-15

    Full text: One of the energy alternatives to fossil fuels which do not produce greenhouse gases is the nuclear energy. One of the drawbacks of this alternative is the generation of radioactive wastes of long half-life and its relation to the generation of nuclear materials to produce weapons of mass destruction. An option to these drawbacks of nuclear energy is to use Thorium as part of the nuclear fuel which it becomes in U{sup 233} when capturing neutrons, that is a fissile material. In this paper Monte Carlo methods were used to design a homogeneous subcritical reactor based on thorium. As neutron reflector graphite was used. The reactor core is homogeneous and is formed of 70% light water as moderator, 12% of enriched uranium UO{sub 2}(NO{sub 3}){sub 4} and 18% of thorium Th(NO{sub 3}){sub 4} as fuel. To start the nuclear fission chain reaction an isotopic source of californium 252 was used with an intensity of 4.6 x 10{sup 7} s{sup -1}. In the design the value of the effective multiplication factor, whose value turned out k{sub eff} <1 was calculated. Also, the neutron spectra at different distances from the source and the total fluence were calculated, as well as the values of the ambient dose equivalent in the periphery of the reactor. (Author)

  12. Manganese determination om minerals by activation analysis, using the californium-252 as a neutron source; Determinacao de manganes em minerios, por analise por ativacao, usando californio-252 como fonte de neutrons

    Energy Technology Data Exchange (ETDEWEB)

    Cardoso, Antonio

    1976-07-01

    Neutron Activation Analysis, using a Californium-252 neutron source, has been applied for the determination of manganese in ores such as pyrolusite, rodonite (manganese silicate)' and blending used in dry-batteries The favorable nuclear properties of manganese, such as high thermal neutron cross-section for the reaction {sup 55}Mn (n.gamma){sup 56} Mn, high concentration of manganese in the matrix and short half - life of {sup 56}Mn, are an ideal combination for non-destructive analysis of manganese in ores. Samples and standards of manganese dioxide were irradiated for about 20 minutes, followed by a 4 to 15 minutes decay and counted in a single channel pulse-height discrimination using a NaI(Tl) scintillation detector. Counting time was equal to 10 minutes. The interference of nuclear reactions {sup 56}Fe(n,p){sup 56}Mn and {sup 59} Co (n, {alpha}){sup 56} were studied, as well as problems in connection with neutron shadowing during irradiation, gamma-rays attenuation during counting and influence of granulometry of samples. One sample,was also analysed by wet-chemical method (sodium bismuthate) in order to compare results. As a whole, i t was shown that the analytical method of neutron activation for manganese in ores and blending, is a method simple, rapid and with good precision and accuracy. (author)

  13. Implications of the delayed 2013 outburst of ESO 243-49 HLX-1

    Energy Technology Data Exchange (ETDEWEB)

    Godet, O.; Webb, N. A. [Institut de Recherche en Astrophysique and Planétologie (IRAP), Université de Toulouse, UPS, 9 Avenue du colonel Roche, F-31028 Toulouse Cedex 4 (France); Lombardi, J. C.; Vingless, J.; Thomas, M. [Department of Physics, Allegheny College, Meadville, PA 16335 (United States); Antonini, F.; Barret, D. [Canadian Institute for Theoretical Astrophysics, University of Toronto, 60 St. George Street, Toronto, Ontario M5S 3H8 (Canada)

    2014-10-01

    After showing four quasi-periodic outbursts spaced by ∼1 yr from 2009 to 2012, the hyper luminous X-ray source ESO 243-49 HLX-1, currently the best intermediate mass black hole (IMBH) candidate, showed an outburst in 2013 delayed by more than a month. In Lasota et al., we proposed that the X-ray light curve is the result of enhanced mass transfer episodes at periapsis from a donor star orbiting the IMBH in a highly eccentric orbit. In this scenario, the delay can be explained only if the orbital parameters can change suddenly from orbit to orbit. To investigate this, we ran Newtonian smooth particle hydrodynamical simulations starting with an incoming donor approaching an IMBH on a parabolic orbit. We survey a large parameter space by varying the star-to-black hole mass ratio (10{sup –5}-10{sup –3}) and the periapsis separation r{sub p} from 2.2 to 2.7r{sub t} with r{sub t} , the tidal radius. To model the donor, we choose several polytropes (Γ = 5/2, n = 3/2, Γ = 3/2, n = 2, Γ = 5/3, n = 2, and Γ = 5/3, n = 3). Once the system is formed, the orbital period decreases until reaching a minimum that may be shallow. Then, the period tends to increase over several periapsis passages due to tidal effects and increasing mass transfer, leading ultimately to the ejection of the donor. We show that the development of stochastic fluctuations inside the donor by adding or removing orbital energy from the system could lead to sudden changes in the orbital period from orbit to orbit with the appropriate order of magnitude to that which has been observed for HLX-1. We also show that given the constraints on the black hole (BH) mass (M {sub BH} > 10{sup 4} M {sub ☉}) and assuming that the HLX-1 system is currently near a minimum in period of ∼1 yr, the donor has to be a white dwarf or a stripped giant core. We predict that if HLX-1 is indeed emerging from a minimum in orbital period, then the period would generally increase with each passage, although substantial

  14. RV SONNE SO243 Cruise Report / Fahrtbericht Guayaquil, Ecuador: 05. October 2015 Antofagasta, Chile: 22. October 2015 SO243 ASTRA-OMZ: AIR SEA INTERACTION OF TRACE ELEMENTS IN OXYGEN MINIMUM ZONES

    OpenAIRE

    Marandino, Christa A.

    2016-01-01

    The ASTRA-OMZ SO243 cruise on board the R/V Sonne took place between the 5th and 22nd October 2015 from Guayaquil, Ecuador to Antofagasta, Chile. Scientists from Germany, the U.S.A, and Norway participated, spanning chemical, biological, and physical oceanography, as well as atmospheric science. The main goal of the cruise was to determine the impact of low oxygen conditions on trace element cycling and distributions, as well as to determine how air-sea exchange of trace elements is influence...

  15. LncRNA CASC2 inhibited the viability and induced the apoptosis of hepatocellular carcinoma cells through regulating miR-24-3p.

    Science.gov (United States)

    Zeng, Fei; Le, Yi-Guan; Fan, Ji-Chang; Xin, Lin

    2017-11-01

    Background Cancer susceptibility candidate 2 (CASC2), a recently discovered long non-coding RNA (lncRNA), was confirmed to play numerous roles in several human cancers. However, the involvement and concrete mechanism of CASC2 in hepatocellular carcinoma (HCC) still need to be further elucidated. Methods The relative expressions of CASC2 and miR-24-3p in HCC tissue and cell lines were determined by quantitative real-time PCR (qRT-PCR). The effects of CASC2 and miR-24-3p on HCC cells were further assessed via cell viability and apoptosis. In vivo tumorigenesis assay was performed to verify the inhibition effect of CASC2 on the tumor growth and further clarify the important role of miR-24-3p in this mechanism. Results Compared with the paired normal tissues, the relative expression of CASC2 significantly reduced in the HCC tissues, while miR-24-3p as determined by qRT-PCR obviously increased in the HCC tissues. This observation was also found in HCC cell lines. Meanwhile, the expression of CASC2 was negatively related to miR-24-3p expression in the HCC tissues (r = -0.804, p cells, but the up-regulation of miR-24-3p greatly eliminated the CASC2-induced effects. The tumorigenesis of HCC cells was restrained significantly by CASC2 overexpression as shown by decreased tumor volume and growth rate. However, miR-24-3p up-regulation rescued the inhibition of CASC2 on the tumor growth in tumor-bearing mice. Conclusion LncRNA CASC2 inhibited the viability and induced the apoptosis of HCC cells through regulating miR-24-3p. This article is protected by copyright. All rights reserved. This article is protected by copyright. All rights reserved.

  16. 2.43 kW narrow linewidth linearly polarized all-fiber amplifier based on mode instability suppression

    Science.gov (United States)

    Su, Rongtao; Tao, Rumao; Wang, Xiaolin; Zhang, Hanwei; Ma, Pengfei; Zhou, Pu; Xu, Xiaojun

    2017-08-01

    We demonstrate an experimental study on scaling mode instability (MI) threshold in fiber amplifiers based on fiber coiling. The experimental results show that coiling the active fiber in the cylindrical spiral shape is superior to the coiling in the plane spiral shape. When the polarization maintained Yb-doped fiber (PM YDF: with a core/inner-cladding diameter of 20/400 µm) is coiled on an aluminous plate with a bend diameter of 9-16 cm, the MI threshold is ~1.55 kW. When such a PM YDF is coiled on an aluminous cylinder with diameter of 9 cm, no MI is observed at the output power of 2.43 kW, which is limited by the available pump power. The spectral width and polarization extinction ratio is 0.255 nm and 18.3 dB, respectively, at 2.43 kW. To the best of our knowledge, this is the highest output power from a linear polarized narrow linewidth all-fiberized amplifier. By using a theoretical model, the potential MI-free scaling capability in such an amplifier is estimated to be 3.5 kW.

  17. Chemical Identification of Dubnium as a Decay Product of Element 115 Produced in the Reaction $\\rm {^{48}Ca}+{^{243}Am}$

    CERN Document Server

    Dmitriev, S N; Utyonkov, V K; Shishkin, S V; Eremin, A V; Lobanov, Yu V; Chepigin, V I; Sokol, E A; Tsyganov, Yu S; Vostokin, G K; Aksenov, N V; Hussonnois, M; Itkis, M G; Aggeler, H W; Schumann, D; Bruchertseifer, H; Eichler, R; Shaughnessy, D A; Wilk, P A; Kenneally, J M; Stoyer, M A; Wild, J F

    2004-01-01

    The results of an experiment designed to identify $^{268}$Db as the terminal isotope in the $\\alpha $-decay chain of element 115 produced via the ${\\rm {^{243}Am}}({\\rm {^{48}Ca}},3n){\\rm {^{288}115}}$ reaction are presented. The $^{243}$Am target was bombarded with a beam dose of $3.4\\cdot 10^{18}$ $^{48}$Ca projectiles at an energy of 247 MeV at the center of the target. The reaction products were collected in the surface layer of a copper catcher block, which was removed with a lathe and then dissolved in concentrated HNO$_{3}$. The group-5 elements were separated by sorption onto Dowex $50{\\times} 8$ cation-exchange resin with subsequent desorption using 1 M HF, which forms anionic fluoride complexes of group-5 elements. The eluent was evaporated onto a 0.4 $\\mu$m thick polyethylene foil that was placed between a pair of semiconductor detectors surrounded by $^{3}$He neutron counters for measurement of $\\alpha$ particles, fission fragments, and neutrons. In the course of the experiment, we observed 15 spo...

  18. miR-24-3p/FGFR3 Signaling as a Novel Axis Is Involved in Epithelial-Mesenchymal Transition and Regulates Lung Adenocarcinoma Progression

    Directory of Open Access Journals (Sweden)

    Pengyu Jing

    2018-01-01

    Full Text Available Our previous studies showed that Fibroblast growth factor receptor 3 (FGFR3 contributed to cell growth in lung cancer. However, the correlation between FGFR3 and tumor progression, coupled with the underlying mechanisms, are not fully understood. The clinical significance of FGFR3 was determined in two cohorts of clinical samples (n=22, n=78. A panel of biochemical assays and functional experiments was utilized to elucidate the underlying mechanisms and effects of FGFR3 and miR-24-3p on lung adenocarcinoma progression. Upregulated FGFR3 expression indicated an adverse prognosis for lung adenocarcinoma individuals and promoted metastatic potential of lung adenocarcinoma cells. Owing to the direct regulation towards FGFR3, miR-24-3p could interfere with the potential of proliferation, migration, and invasion in lung adenocarcinoma, following variations of EMT-related protein expression. As a significant marker of EMT, E-cadherin was negatively correlated with FGFR3, of which ectopic overexpression could neutralize the antitumour effects of miR-24-3p and reverse its regulatory effects on EMT markers. Taken together, these findings define a novel insight into the miR-24-3p/FGFR3 signaling axis in regulating lung adenocarcinoma progression and suggest that targeting the miR-24-3p/FGFR3 axis could be an effective and efficient way to prevent tumor progression.

  19. Investigating the Role of the Post-transcriptional Gene Regulator MiR-24-3p in the Proliferation, Migration and Apoptosis of Human Arterial Smooth Muscle Cells in Arteriosclerosis Obliterans

    Directory of Open Access Journals (Sweden)

    Xiao-feng Zhu

    2015-07-01

    Full Text Available Aims: To explore the expression of miR-24-3p in human arteries with arteriosclerosis obliterans (ASO as well as the role of miR-24-3p in the pathogenesis of ASO. Methods: We used quantitative real-time PCR (qRT-PCR and in situ hybridization to monitor miR-24-3p expression in human arteries. To investigate the effect of miR-24-3p on human arterial smooth muscle cells (HASMCs, we applied cell counting and EdU assays to monitor proliferation and transwell and wound healing assays to investigate migration and flow cytometry to investigate apoptosis. Furthermore, we applied 3'-untranslated region (3'-UTR luciferase assays to investigate the role of miR-24-3p in targeting platelet-derived growth factor receptor B (PDGFRB and c-Myc. Results: MiR-24-3p was mainly located in the media of arteries and was downregulated in ASO arteries compared with normal arteries. Platelet-derived growth factor BB (PDGF-BB treatment reduced the expression of miR-24-3p in primary cultured HASMCs. MiR-24-3p mimic oligos inhibited the proliferation and migration, and promotes apoptosis of HASMCs. Our 3'-UTR luciferase assays confirmed that PDGFRB and c-Myc were targets of miR-24-3p. Conclusion: The results suggest that miR-24-3p regulates the proliferation and migration of HASMCs by targeting PDGFRB and c-Myc. The PDGF/miR-24-3p/PDGFRB and PDGF/miR-24-3p/c-Myc pathways may play critical roles in the pathogenesis of ASO. These findings highlight the potential for new therapeutic targets for ASO.

  20. Partial monosomy 8q and partial trisomy 9q due to the maternal translocation t(8;9(q24.3;q34.1)

    DEFF Research Database (Denmark)

    Tos, T; Alp, M Y; Eker, H K

    2014-01-01

    Partial trisomy 9q34-qter and partial monosomy 8q24.3-qter are very rare chromosomal abnormalities. Characteristic features of partial trisomy 9q34-qter are hypotonia, developmental delay, mild intellectual disability, dolichocephaly, distinct facial phenotype, long and thin fingers, and cardiac...

  1. Enhanced anticaries efficacy of a 0.243% sodium fluoride/10% xylitol/silica dentifrice: 3-year clinical results.

    Science.gov (United States)

    Sintes, J L; Escalante, C; Stewart, B; McCool, J J; Garcia, L; Volpe, A R; Triol, C

    1995-10-01

    To evaluate the efficacy of a sodium fluoride (NaF)/silica/xylitol dentifrice compared with that of a positive control NaF/silica dentifrice on caries increments in school children over a 3-year period in an area without an optimal level of fluoride in the drinking water (mean level schools in the San Jose, Costa Rica metropolitan area. Clinical dental examinations were performed at participating schools utilizing portable dental equipment. Caries evaluations employed conventional tactile/visual methodology consisting of artificial light, dental mirrors and single-edge #23 explorers. Children accepted into the study were stratified by age and sex into two balanced groups within each school, and randomly assigned to use either a positive control dentifrice containing 0.243% NaF/silica or a test dentifrice containing 0.234% NaF/silica/10% xylitol. Children were instructed to brush with the assigned dentifrice twice daily. Caries evaluations were conducted at baseline, 2 years, and 3 years. After 3 years, subjects using the 0.234% NaF/silica/10% xylitol dentifrice had statistically significantly reduced decayed/filled surfaces (DFS; -12.3% reduction; P < or = 0.001) and decayed/filled buccal and lingual surfaces (DFS-BL; -10.5% reduction; P < or = 0/01).

  2. Neutron capture cross section measurements of $^{238}$U, $^{241}$Am and $^{243}$Am at n_TOF

    CERN Multimedia

    Koehler, P E; Plag, R

    The increase of the world energy demand and the need of low carbon energy sources have triggered the renaissance and/or enhancement of nuclear energy in many countries. Fundamental nuclear physics can contribute in a practical way to the sustainability and safety of the nuclear energy production and the management of the nuclear waste. There exists a series of recent studies which address the most relevant isotopes, decay data, nuclear reaction channels and energy ranges which have to be investigated in more detail for improving the design of different advanced nuclear systems [1] and nuclear fuel cycles [2]. In this proposal, we aim at the measurement of the neutron capture cross sections of $^{238}$U, $^{241}$Am and $^{243}$Am. All three isotopes are listed in the NEA High Priority Request List [37], are recommended for measurements [1] and play an important role in the nuclear energy production and fuel cycle scenarios. The measurements will provide as well valuable nuclear structure data necessary for the...

  3. Neutron capture and fission cross section of Americium-243 in the energy range from 5 to 250 keV

    International Nuclear Information System (INIS)

    Wisshak, K.; Kaeppeler, F.

    1983-04-01

    The neutron capture and subthreshold fission cross section of 243 Am was measured in the energy range from 5 to 250 keV using 197 Au and 235 U as the respective standards. Neutrons were produced via the 7 Li(p,n) and the T(p,n) reaction with the Karlsruhe 3-MV pulsed Van de Graaff accelerator. Capture events were detected by two MoxonRae detectors with graphite and bismuthgraphite converters, respectively. Fission events were registered by a NE-213 liquid scintillator with pulse-shape discriminator equipment. Flight paths as short as 50-70 mm were used to obtain optimum signal-to-background ratio. After correction for the different efficiency of the individual converter materials the capture cross section could be determined with a total uncertainty of 3-6%. The respective values for the fission cross section are 8-12%. The results are compared to predictions of recent evaluations, which in some cases are severely discrepant. (orig.)

  4. Experiments on the Synthesis of Element 115 in the Reaction ^{243}Am (^{48}Ca, xn)^{291-x}115

    CERN Document Server

    Oganessian, Yu T; Lobanov, Yu V; Abdullin, F S; Polyakov, A N; Shirokovsky, I V; Tsyganov, Yu S; Gulbekyan, G G; Bogomolov, S L; Mezentsev, A N; Iliev, S; Subbotin, V G; Sukhov, A M; Voinov, A A; Buklanov, G V; Subotic, K M; Zagrebaev, V I; Itkis, M G; Patin, J B; Moody, K J; Wild, J F; Stoyer, M A; Stoyer, N J; Shaughnessy, D A; Kenneally, J M; Lougheed, R W

    2003-01-01

    The results of experiments designed to synthesize element 115 isotopes in the ^{243}Am(^{48}Ca,xn)^{291-x}115 reaction are presented. With a beam dose of 4.3\\cdot 10^{18} 248-Mev ^{48}Ca projectiles, we observed three similar decay chains consisting of five consecutive alpha-decays, all detected in time intervals of about 20 s and terminated at a later time by a spontaneous fission with a high energy release (TKE \\sim 220 MeV). At a higher bombarding energy of 253 MeV, with an equal ^{48}Ca beam dose, we registered a different decay chain of four consecutive alpha-decays detected in a time interval of about 0.5 s, also terminated by spontaneous fission. The alpha-decay energies and half-lives for nine new alpha-decaying nuclei were determined. The decay properties of these synthesized nuclei are consistent with consecutive alpha-decays originating from the parent isotopes of the new element 115, ^{288}115 and ^{287}115, produced in the 3n- and 4n-evaporation channels with cross sections of about 3 and 1 pb, r...

  5. Measurement of the 243Am capture cross section at the n{sub T}OF facility; Medida de la sección eficaz de captura del 243Am en la instalación n{sub T}OF

    Energy Technology Data Exchange (ETDEWEB)

    Mendoza Cembranos, E.

    2014-07-01

    Nuclear data for minor actinides are necessary for improving the design and performance of advanced reactors and transmutation devices for the incineration of radioactive nuclear waste [Sal08, Gon09, Ali04, Ali06]. In particular, the 243Am isotope is relevant since it is the minor actinide which contributes more to the radiotoxicity of the nuclear waste between s3 03 and s3 04 years. In addition, the neutron capture in 243Am is the main gate to the creation of 244Cm and higher mass isotopes. The purpose of the this work is to provide experimental data on the 243Am(n, ) for improving the current evaluations. At present, there is no published neutron capture measurement of 243Am below 250 eV, and all the existing evaluations of the elastic and capture cross sections are based essentially on a single transmission measurement [Sim74]. Above 250 eV there are only a few capture measurements available [Wes85, Wis83], which show discrepancies that make them incompatible. Due to the lack of experimental data on 243Am the standard ENDF-6 format libraries present sizeable di rences between each other...(Author)

  6. 243 ORIGINAL ARTICLE

    African Journals Online (AJOL)

    boaz

    Isolates were identified as A. baumannii using API 20NE and E-test was used to define IRAB. Out of 146 A. ... L'étude des facteurs de risque associe à l'infection IRAB est d'une importance capitale ..... Pimentel JD1, Low J, Styles K, Harris OC,.

  7. pmker 24(3)

    African Journals Online (AJOL)

    HP Pro 2000

    L. AFOUDA1, H. BAIMEY2, F. X. BACHABI2, D. H. SERO-KPERA1 et R. BALOGOUN1. 1Faculté ... rates ranging from 20 to 95 % 6 days after exposure. The effect of extracts was found ... integrated management of Meloidogyne spp. Keywords ...

  8. Preparation and study of elemental californium-249

    International Nuclear Information System (INIS)

    Noe, M.; Peterson, J.R.

    1975-01-01

    Bulk samples of 249 Cf metal were prepared on the 10 μg scale via the Li metal vapor reduction of 249 CfF 3 . Above about 725 0 C elemental Cf exhibits a face-centered cubic (fcc) structure with an average, room-temperature lattice parameter of 5.75(1)A. Between about 600 0 C and 725 0 C, the stable form of Cf metal is another fcc structure with an average, room-temperature lattice parameter of 4.94(1)A. Below 600 0 C metallic Cf exhibits a double hexagonal closest packed (dhcp) structure with average, room temperature lattice parameters of a 0 = 3.39(1)A and c 0 = 11.01(5)A. By comparison of the metallic radii calculated for these three forms with those of the receding transuranium elements, it is suggested that the two, lower temperature modifications represent Cf with a metallic valence of three, while the highest temperature form represents a metallic valence of two. Although the data reported here are from the most complete study to date of elemental Cf, the limitations accompanying such microscale research are duly noted. (U.S.)

  9. Californium Cf-252 for pelvic radiotherapy

    Energy Technology Data Exchange (ETDEWEB)

    Maruyama, Y; Feola, J M; Tai, D; Wilson, L C; Van Nagell, J R; Yoneda, J

    1978-01-01

    Clinical data about therapy concerning tumors of the female gynecological cancers of the cervix, vagina and uterus are reviewed. Dosimetric, laboratory and radiobiological research data form the basis for an approach to such tumors using Cf-252 as a form of boost brachytherapy. Extreme personnel hazards are a real and important consideration and indicate that maximal containment and isolation procedures should be exercised in its use.

  10. Fission-product yields for thermal-neutron fission of 243Cm determined from measurements with a high-resolution low-energy germanium gamma-ray detector

    International Nuclear Information System (INIS)

    Merriman, L.D.

    1984-04-01

    Cumulative fission-product yields have been determined for 13 gamma rays emitted during the decay of 12 fission products created by thermal-neutron fission of 243 Cm. A high-resolution low-energy germanium detector was used to measure the pulse-height spectra of gamma rays emitted from a 77-nanogram sample of 243 Cm after the sample had been irradiated by thermal neutrons. Analysis of the data resulted in the identification and matching of gamma-ray energies and half-lives to individual radioisotopes. From these results, 12 cumulative fission product yields were deduced for radionuclides with half-lives between 4.2 min and 84.2 min. 7 references

  11. In vitro evaluation of Lactobacillus crispatus K313 and K243: high-adhesion activity and anti-inflammatory effect on Salmonella braenderup infected intestinal epithelial cell.

    Science.gov (United States)

    Sun, Zhilan; Huang, Lihua; Kong, Jian; Hu, Shumin; Zhang, Xiaowei; Kong, Wentao

    2012-09-14

    Currently, there is an increasing interest in the use of probiotics as an alternative strategy to antimicrobial compounds. In this study, two high adhesive strains Lactobacillus crispatus K313 adhering to HT-29 cells as well as Lb. crispatus K243 adhering to collagen type IV were isolated from chicken intestines. SDS-PAGE analysis revealed the presence of the potential S-proteins SlpA and SlpB in Lb. crispatus K243 and K313. SlpA and SlpB, rich in hydrophobic amino acids, were proved to be involved in adhering to collagen type IV and HT-29 cells, respectively, based on the LiCl treatment assay. After removal of S-proteins, the viability and tolerance of the two Lb. crispatus strains to simulated gastric and small intestinal juice were reduced, indicating the protective role of S-proteins against the hostile environments. Lb. crispatus K313 exhibited the stronger autoaggregation ability and inhibitive activity against Salmonella braenderup H9812 adhesion to HT-29 cells than the strain K243. To elucidate the inhibitive mechanism, cultured epithelial cells were exposed with Lb. crispatus strains, and followed by a challenge with S. braenderup H9812. The pro-inflammatory signaling factors (IL-8, CXCL1 and CCL20) from HT-29 were detected by real-time PCR technology. The results showed that both of Lb. crispatus strains down-regulated the transcription level of those pro-inflammatory genes induced by S. braenderup H9812 by 36.2-58.8%. ELISA analysis was further confirmed that Lb. crispatus K243 and K313 inhibited the IL-8 secretion triggered by S. braenderup H9812 by 32.8% and 47.0%, indicating that the two isolates could attenuate the pro-inflammatory signaling induced by S. braenderup H9812, and have the potential application in clinical practice to prevent diarrhea. Copyright © 2012 Elsevier B.V. All rights reserved.

  12. Backbone and sidechain methyl Ile (δ1), Leu and Val chemical shift assignments of RDE-4 (1-243), an RNA interference initiation protein in C. elegans.

    Science.gov (United States)

    Chiliveri, Sai Chaitanya; Kumar, Sonu; Marelli, Udaya Kiran; Deshmukh, Mandar V

    2012-10-01

    The RNAi pathway of several organisms requires presence of double stranded RNA binding proteins for functioning of Dicer in gene regulation. In C. elegans, a double stranded RNA binding protein, RDE-4 (385 aa, 44 kDa) recognizes long exogenous dsRNA and initiates the RNAi pathway. We have achieved complete backbone and stereospecific methyl sidechain Ile (δ1), Leu and Val chemical shifts of first 243 amino acids of RDE-4, namely RDE-4ΔC.

  13. Decay properties of Bk97243 and Bk97244

    Energy Technology Data Exchange (ETDEWEB)

    Ahmad, I.; Kondev, F. G.; Greene, J. P.; Zhu, S.

    2018-01-01

    Electron capture decays of Bk-243 and Bk-244 have been studied by measuring the gamma-ray spectra of mass-separated sources and level structures of Cm-243 and Cm-244 have been deduced. In Cm-243, the electron capture population to the ground state, 1/2(+)[631], and 1/2(+)[620] Nilsson states have been observed. The octupole K-pi = 2(-) band was identified in Cm-244 at 933.6 keV. In addition, spins and parities were deduced for several other states and two-quasiparticle configurations have been tentatively assigned to them

  14. (-)-P7C3-S243 Protects a Rat Model of Alzheimer's Disease From Neuropsychiatric Deficits and Neurodegeneration Without Altering Amyloid Deposition or Reactive Glia.

    Science.gov (United States)

    Voorhees, Jaymie R; Remy, Matthew T; Cintrón-Pérez, Coral J; El Rassi, Eli; Khan, Michael Z; Dutca, Laura M; Yin, Terry C; McDaniel, Latisha N; Williams, Noelle S; Brat, Daniel J; Pieper, Andrew A

    2017-11-06

    In addition to cognitive deficits, Alzheimer's disease (AD) is associated with other neuropsychiatric symptoms, including severe depression. Indeed, depression often precedes cognitive deficits in patients with AD. Unfortunately, the field has seen only minimal therapeutic advances, underscoring the critical need for new treatments. P7C3 aminopropyl carbazoles promote neuronal survival by enhancing nicotinamide adenine dinucleotide flux in injured neurons. Neuroprotection with P7C3 compounds has been demonstrated in preclinical models of neurodegeneration by virtue of promoting neuronal survival independently of early disease-specific pathology, resulting in protection from cognitive deficits and depressive-like behavior. We hypothesize that P7C3 compounds might be uniquely applicable to patients with AD, given the comorbid presentation of depression and cognitive deficits. Aging male and female wild-type and TgF344-AD rats, a well-characterized preclinical AD model, were administered (-)-P7C3-S243 daily for 9 and 18 months, beginning at 6 months of age. Behavioral phenotypes related to cognition and depression were assessed at 15 and 24 months, and brain pathology and biochemistry were assessed at 24 months. (-)-P7C3-S243 safely protected aging male and female wild-type and TgF344-AD rats from cognitive deficits and depressive-like behavior. Depressive-like behavior occurred earlier than cognitive deficits in TgF344-AD rats, consistent with AD in many patients. Treatment with (-)-P7C3-S243 blocked neurodegeneration in TgF344-AD rats, without altering amyloid deposition or indicators of neuroinflammation. Neuronal cell death-specific treatment approaches, such as P7C3 compounds, may represent a new treatment approach for patients experiencing the combination of cognitive deficits and depression associated with AD. Published by Elsevier Inc.

  15. Interstitial deletion of 14q24.3-q32.2 in a male patient with plagiocephaly, BPES features, developmental delay, and congenital heart defects

    DEFF Research Database (Denmark)

    Cingöz, Sultan; Bache, Iben; Bjerglund, Lise

    2011-01-01

    Distal interstitial deletions of chromosome 14 involving the 14q24-q23.2 region are rare, and only been reported so far in 20 patients. Ten of these patients were analyzed both clinically and genetically. Here we present a de novo interstitial deletion of chromosome 14q24.3-q32.2 in a male patient...... on genotype-phenotype comparisons of the 10 previously published patients and the present case, we suggest that the shortest regions for deletion overlap may include candidate genes for speech impairment, mental retardation, and hypotonia....

  16. Remaining Sites Verification Package for the 600-243 Petroleum-Contaminated Soil Bioremediation Pad. Attachment to Waste Site Reclassification Form 2007-033

    International Nuclear Information System (INIS)

    Capron, J.M.

    2008-01-01

    The 600-243 waste site consisted of a bioremediation pad for petroleum-contaminated soils resulting from the 1100 Area Underground Storage Tank (UST) upgrades in 1994. In accordance with this evaluation, the verification sampling results support a reclassification of this site to Interim Closed Out. The results of verification sampling show that residual contaminant concentrations do not preclude any future uses and allow for unrestricted use of shallow zone soils. The results also demonstrate that residual contaminant concentrations are protective of groundwater and the Columbia River

  17. Thermal neutron capture cross-section measurements of 243Am and 242Pu using the new mini-INCA α- and γ-spectroscopy station

    International Nuclear Information System (INIS)

    Marie, F.; Letourneau, A.; Fioni, G.; Deruelle, O.; Veyssiere, Ch.; Faust, H.; Mutti, P.; AlMahamid, I.; Muhammad, B.

    2006-01-01

    In the framework of the Mini-INCA project, dedicated to the study of Minor Actinide transmutation process in high neutron fluxes, an α- and γ-spectroscopy station has been developed and installed at the High Flux Reactor of the Laue-Langevin Institut. This set-up allows short irradiations as well as long irradiations in a high quasi-thermal neutron flux and post-irradiation spectroscopy analysis. It is well suited to measure precisely, in reference to 59 Co cross-section, neutron capture cross-sections, for all the actinides, in the thermal energy region. The first measurements using this set-up were done on 243 Am and 242 Pu isotopes. Cross-section values, at E n =0.025eV, were found to be (81.8+/-3.6)b for 243 Am and (22.5+/-1.1)b for 242 Pu. These values differ from evaluated data libraries by a factor of 9% and 17%, respectively, but are compatible with the most recent measurements, validating by the way the experimental apparatus

  18. The production of {sup 238-242}Pu(n,γ){sup 239-243}Pu fissionable fluids in a fusion-fission hybrid reactor

    Energy Technology Data Exchange (ETDEWEB)

    Guenay, Mehtap [Inoenue Univ., Malatya (Turkey). Physics Dept.

    2014-03-15

    In this study, the effect of spent fuel grade plutonium content on {sup 239-243}Pu was investigated in a designed hybrid reactor system. In this system, the fluids were composed of a molten salt, heavy metal mixture with increased mole fractions 99-95 % Li{sub 20}Sn{sub 80}-1-5 % SFG-Pu, 99-95 % Li{sub 20}Sn{sub 80}-1-5 % SFG-PuF{sub 4}, 99-95 % Li{sub 20}Sn{sub 80}-1-5 % SFG-PuO{sub 2}. Beryllium (Be) is a neutron multiplier by (n,2n) reactions. Thence, a Be zone of 3 cm thickness was used in order to contribute to fissile fuel breeding between the liquid first wall and a 9Cr2WVTa ferritic steel blanket which is used as structural material. The production of {sup 238-242}Pu(n,γ){sup 239-243}Pu was calculated in liquid first wall, blanket and shielding zones. Three-dimensional nucleonic calculations were performed by using the most recent version MCNPX-2.7.0 Monte Carlo code and nuclear data library ENDF/B-VII.0. (orig.)

  19. De novo 14q24.2q24.3 microdeletion including IFT43 is associated with intellectual disability, skeletal anomalies, cardiac anomalies, and myopia.

    Science.gov (United States)

    Stokman, Marijn F; Oud, Machteld M; van Binsbergen, Ellen; Slaats, Gisela G; Nicolaou, Nayia; Renkema, Kirsten Y; Nijman, Isaac J; Roepman, Ronald; Giles, Rachel H; Arts, Heleen H; Knoers, Nine V A M; van Haelst, Mieke M

    2016-06-01

    We report an 11-year-old girl with mild intellectual disability, skeletal anomalies, congenital heart defect, myopia, and facial dysmorphisms including an extra incisor, cup-shaped ears, and a preauricular skin tag. Array comparative genomic hybridization analysis identified a de novo 4.5-Mb microdeletion on chromosome 14q24.2q24.3. The deleted region and phenotype partially overlap with previously reported patients. Here, we provide an overview of the literature on 14q24 microdeletions and further delineate the associated phenotype. We performed exome sequencing to examine other causes for the phenotype and queried genes present in the 14q24.2q24.3 microdeletion that are associated with recessive disease for variants in the non-deleted allele. The deleted region contains 65 protein-coding genes, including the ciliary gene IFT43. Although Sanger and exome sequencing did not identify variants in the second IFT43 allele or in other IFT complex A-protein-encoding genes, immunocytochemistry showed increased accumulation of IFT-B proteins at the ciliary tip in patient-derived fibroblasts compared to control cells, demonstrating defective retrograde ciliary transport. This could suggest a ciliary defect in the pathogenesis of this disorder. © 2016 Wiley Periodicals, Inc. © 2016 Wiley Periodicals, Inc.

  20. The use of isotopic correlation technique for determination of sup(241)Am and sup(243)Am concentration in nuclear irradiated fuels

    International Nuclear Information System (INIS)

    Souza Sarkis, J.E. de.

    1990-01-01

    In the last years the isotopic correlation technique is emerging as a powerful tool for the determination of concentration and isotopic composition of heavy nuclides in the nuclear fuel cycle. Accordingly, this technique has gained significant importance for the safeguard of the nuclear materials as well as for the accounting and build up of actinides elements in the irradiated nuclear fuels. In this work 42 isotopic correlations between the nuclides sup(241)Am and sup(243)Am and post irradiation isotopic data of 7 samples from fuel element BE-124 and 1 sample from fuel element BE-120 from the Obrigheim pressurized water nuclear power reactor, Federal Republic of Germany, were proposed. These isotopic correlations allowed to estimate the isotopic concentrations of sup(241)Am and sup(243)Am with an average deviation, relative to the experimental data obtained from isotopic dilution mass spectrometry technique, of 10%. These results are more precise than those found using the computer code ORIGEN 2 demonstrating the great potential of this technique for the determination of isotopic concentration and build up of those nuclides in irradiated nuclear fuels. The analytical and other experimental aspects of the post irradiation isotopic analysis of nuclear fuels are also discussed. (author)

  1. Critical and subcritical mass calculations of curium-243 to -247 based on JENDL-3.2 for revision of ANSI/ANS-8.15

    International Nuclear Information System (INIS)

    Okuno, Hiroshi

    2002-01-01

    Critical and subcritical masses were calculated for a sphere of five curium isotopes from 243 Cm to 247 Cm in metal and in metal-water mixtures considering three reflector conditions: bare, with a water reflector or a stainless steel reflector. The calculation were made mainly with a combination of a continuous energy Monte Carlo neutron transport calculation code, MCNP, and the Japanese Evaluated Nuclear Data Library, JENDL-3.2. Other evaluated nuclear data files, ENDF/B-VI and JEF-2.2, were also applied to find differences in calculation results of the neutron multiplication factor originated from different nuclear data files. A large dependence on the evaluated nuclear data files was found in the calculation results: more than 10%Δk/k relative differences in the neutron multiplication factor for a homogeneous mixture of 243 Cm metal and water when JENDL-3.2 was replaced with ENDF/B-VI and JEF-2.2, respectively; and a 44% reduction in the critical mass by changing from JENDL-3.2 to ENDF/B-VI for 246 Cm metal. The present study supplied basic information to the ANSI/ANS-8.15 Working Group for revision of the standard for nuclear criticality control of special actinide elements. The new or revised values of the subcritical mass limits for curium isotopes accepted by the ANSI/ANS-8.15 Working Group were finally summarized. (author)

  2. Critical and subcritical mass calculations of curium-243 to -247 based on JENDL-3.2 for revision of ANSI/ANS-8.15

    Energy Technology Data Exchange (ETDEWEB)

    Okuno, Hiroshi [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment; Kawasaki, Hiromitsu [CRC Solutions Corporation, Hitachinaka, Ibaraki (Japan)

    2002-10-01

    Critical and subcritical masses were calculated for a sphere of five curium isotopes from {sup 243}Cm to {sup 247}Cm in metal and in metal-water mixtures considering three reflector conditions: bare, with a water reflector or a stainless steel reflector. The calculation were made mainly with a combination of a continuous energy Monte Carlo neutron transport calculation code, MCNP, and the Japanese Evaluated Nuclear Data Library, JENDL-3.2. Other evaluated nuclear data files, ENDF/B-VI and JEF-2.2, were also applied to find differences in calculation results of the neutron multiplication factor originated from different nuclear data files. A large dependence on the evaluated nuclear data files was found in the calculation results: more than 10%{delta}k/k relative differences in the neutron multiplication factor for a homogeneous mixture of {sup 243}Cm metal and water when JENDL-3.2 was replaced with ENDF/B-VI and JEF-2.2, respectively; and a 44% reduction in the critical mass by changing from JENDL-3.2 to ENDF/B-VI for {sup 246}Cm metal. The present study supplied basic information to the ANSI/ANS-8.15 Working Group for revision of the standard for nuclear criticality control of special actinide elements. The new or revised values of the subcritical mass limits for curium isotopes accepted by the ANSI/ANS-8.15 Working Group were finally summarized. (author)

  3. Fission Cross-section Measurements of (233)U, (245)Cm and (241,243)Am at CERN n_TOF Facility

    CERN Document Server

    Calviani, M; Andriamonje, S; Chiaveri, E; Vlachoudis, V; Colonna, N; Meaze, M H; Marrone, S; Tagliente, G; Terlizzi, R; Belloni, F; Abbondanno, U; Fujii, K; Milazzo, P M; Moreau, C; Aerts, G; Berthoumieux, E; Dridi, W; Gunsing, F; Pancin, J; Perrot, L; Plukis, A; Alvarez, H; Duran, I; Paradela, C; Alvarez-Velarde, F; Cano-Ott, D; Gonzalez-Romero, E; Guerrero, C; Martinez, T; Villamarin, D; Vicente, M C; Andrzejewski, J; Marganiec, J; Assimakopoulos, P; Karadimos, D; Karamanis, D; Papachristodoulou, C; Patronis, N; Audouin, L; David, S; Ferrant, L; Isaev, S; Stephan, C; Tassan-Got, L; Badurek, G; Jericha, E; Leeb, H; Oberhummer, H; Pigni, M T; Baumann, P; Kerveno, M; Lukic, S; Rudolf, G; Becvar, F; Krticka, M; Calvino, F; Capote, R; Carrillo De Albornoz, A; Marques, L; Salgado, J; Tavora, L; Vaz, P; Cennini, P; Dahlfors, M; Ferrari, A; Gramegna, F; Herrera-Martinez, A; Kadi, Y; Mastinu, P; Praena, J; Sarchiapone, L; Wendler, H; Chepel, V; Ferreira-Marques, R; Goncalves, I; Lindote, A; Lopes, I; Neves, F; Cortes, G; Poch, A; Pretel, C; Couture, A; Cox, J; O'brien, S; Wiescher, M; Dillman, I; Heil, M; Kappeler, F; Mosconi, M; Plag, R; Voss, F; Walter, S; Wisshak, K; Dolfini, R; Rubbia, C; Domingo-Pardo, C; Tain, J L; Eleftheriadis, C; Savvidis, I; Frais-Koelbl, H; Griesmayer, E; Furman, W; Konovalov, V; Goverdovski, A; Ketlerov, V; Haas, B; Haight, R; Reifarth, R; Igashira, M; Koehler, P; Kossionides, E; Lampoudis, C; Lozano, M; Quesada, J; Massimi, C; Vannini, G; Mengoni, A; Oshima, M; Papadopoulos, C; Vlastou, R; Pavlik, A; Pavlopoulos, P; Plompen, A; Rullhusen, P; Rauscher, T; Rosetti, M; Ventura, A

    2011-01-01

    Neutron-induced fission cross-sections of minor actinides have been measured using the n_TOF white neutron source at CERN, Geneva, as part of a large experimental program aiming at collecting new data relevant for nuclear astrophysics and for the design of advanced reactor systems. The measurements at n_TOF take advantage of the innovative features of the n_TOF facility, namely the wide energy range, high instantaneous neutron flux and good energy resolution. Final results on the fission cross-section of 233U, 245Cm and 243Am from thermal to 20 MeV are here reported, together with preliminary results for 241Am. The measurement have been performed with a dedicated Fast Ionization Chamber (FIC), a fission fragment detector with a very high efficiency, relative to the very well known cross-section of 235U, measured simultaneously with the same detector.

  4. Estimation of Ni63, Pu241, Pu242 and Am243 from Co60, Pu239, and Cm244 activities in groundwater samples

    International Nuclear Information System (INIS)

    Holcomb, H.P.

    1993-01-01

    The Part B Permit for F ampersand H Seepage Basins calls for analysis of several constituents of concern in groundwater monitoring wells. Four of these analytes are the radionuclides Ni 63 , Pu 241 , Pu 242 , and Am 243 . These are currently not being analyzed due to their very difficult, tedious analytical schemes coupled with their relatively low activity values. This report demonstrates how the activity value for Ni 63 , a week beta emitter, can be estimated from that of Co 60 , an easily detectable, high-energy gamma emitter. Similarly, estimates of Pu 241 , a beta emitter, and the alpha-emitting Pu 242 can be made from the activity value of the more easily detected Pu 239 . Am 243 can be estimated from the activity of Cm 244 , which is easier to detect because of a shorter half-life (higher specific activity) and the emission of higher energy alpha particles. These correlations are made under very specific parameters in order to ensure the validity of this approach. Therefore, assumptions must be established setting ground rules for establishing these activity relationships. Bases for these assumptions are explained and/or referenced. Their degree of uncertainty limits the accuracy of the data so that the term ''estimate'' is used. Such soundly-based, conservative estimates for these four rads can provide a tool for evaluating any hazards from their presence over the next several years. Hopefully, during this time, sufficient advances will be made in their radiochemical analyses and in counting techniques so that in the future, their activities may be quantitatively determined more easily and also more cost effectively

  5. Monozygotic twins with a de novo 0.32 Mb 16q24.3 deletion, including TUBB3 presenting with developmental delay and mild facial dysmorphism but without overt brain malformation

    DEFF Research Database (Denmark)

    Grønborg, Sabine; Kjaergaard, Susanne; Hove, Hanne

    2015-01-01

    been associated with missense mutations in this group of genes. Here, we report two patients, monozygotic twins, carrying a de novo 0.32 Mb deletion of chromosome 16q24.3 including the TUBB3 gene. The patients presented with global developmental delay, mild facial dysmorphism, secondary microcephaly...

  6. Intellectual disability, muscle weakness and characteristic face in three siblings: A newly described recessive syndrome mapping to 3p24.3-p25.3.

    Science.gov (United States)

    Kariminejad, Ariana; Nafissi, Shahriar; Nilipoor, Yalda; Tavasoli, Alireza; Van Veldhoven, Paul P; Bonnard, Carine; Ng, Yeng Ting; Majoie, Charles B; Reversade, Bruno; Hennekam, Raoul C

    2015-11-01

    We report on a sister and two brothers born to healthy Iranian parents with mild intellectual disability, progressive muscle weakness, and characteristic facies. including highly arched eyebrows, down-slanting palpebral fissures, prominent nasal bridge, prominent nose, columella extending below alae nasi, narrow mouth, narrow palate, and dental caries, and in one of them an inability to abduct the left eye. Electrophysiological studies showed signs of myopathy, and muscle biopsies demonstrated only nonspecific signs. Brain MRIs in two of the sibs showed leukencephalopathy with delayed myelination, frontal and parietal hyperintensities, and hippocampal atrophy in one. We have been unable to find a description of this association of features in literature. Based on the occurrence in siblings, no significant difference in phenotype between the brothers and sister, absence of manifestations in parents, and a likely consanguinity between parents we performed a homozygosity mapping. A single identical-by-descent bloc encompassing 57 genes located at 3p24.3-p25.3 was found to segregate within the family with this phenotype. © 2015 Wiley Periodicals, Inc. © 2015 Wiley Periodicals, Inc.

  7. Genome-wide linkage scan for maximum and length-dependent knee muscle strength in young men: significant evidence for linkage at chromosome 14q24.3.

    Science.gov (United States)

    De Mars, G; Windelinckx, A; Huygens, W; Peeters, M W; Beunen, G P; Aerssens, J; Vlietinck, R; Thomis, M A I

    2008-05-01

    Maintenance of high muscular fitness is positively related to bone health, functionality in daily life and increasing insulin sensitivity, and negatively related to falls and fractures, morbidity and mortality. Heritability of muscle strength phenotypes ranges between 31% and 95%, but little is known about the identity of the genes underlying this complex trait. As a first attempt, this genome-wide linkage study aimed to identify chromosomal regions linked to muscle and bone cross-sectional area, isometric knee flexion and extension torque, and torque-length relationship for knee flexors and extensors. In total, 283 informative male siblings (17-36 years old), belonging to 105 families, were used to conduct a genome-wide SNP-based multipoint linkage analysis. The strongest evidence for linkage was found for the torque-length relationship of the knee flexors at 14q24.3 (LOD = 4.09; p<10(-5)). Suggestive evidence for linkage was found at 14q32.2 (LOD = 3.00; P = 0.005) for muscle and bone cross-sectional area, at 2p24.2 (LOD = 2.57; p = 0.01) for isometric knee torque at 30 degrees flexion, at 1q21.3, 2p23.3 and 18q11.2 (LOD = 2.33, 2.69 and 2.21; p<10(-4) for all) for the torque-length relationship of the knee extensors and at 18p11.31 (LOD = 2.39; p = 0.0004) for muscle-mass adjusted isometric knee extension torque. We conclude that many small contributing genes rather than a few important genes are involved in causing variation in different underlying phenotypes of muscle strength. Furthermore, some overlap in promising genomic regions were identified among different strength phenotypes.

  8. Determination of Neptunium, Americium and Curium in Spent Nuclear Fuel Samples by Alpha Spectrometry Using 239Np and 243Am as a Spike and a Tracer

    International Nuclear Information System (INIS)

    Jeo, Kih-Soo; Song, Byung-Chul; Kim, Young-Bok; Han, Sun-Ho; Jeon, Young-Shin; Jung, Euo-Chang; Jee, Kwang-Yong

    2007-01-01

    Determination of actinide elements and fission products in spent nuclear fuels is of importance for a burnup determination and source term evaluation. Especially, the amounts of uranium and plutonium isotopes are used for the evaluation of a burnup credit in spent nuclear fuels. Additionally, other actinides such as Np, Am and Cm in spent nuclear fuel samples is also required for the purposes mentioned above. In this study, 237 Np, 241 Am and 244 Cm were determined by an alpha spectrometry for the source term data for high burnup spent nuclear fuels ranging from 37 to 62.9 GWD/MtU as a burnup. Generally, mass spectrometry has been known as the most powerful method for isotope determinations such as high concentrations of uranium and plutonium. However, in the case of minor actinides such as Np, Am and Cm, alpha spectrometry would be recommended instead. Determination of the transuranic elements in spent nuclear fuel samples is different from that for environmental samples because the amount of each nuclide in the spent fuel samples is higher and the relative ratios between each nuclide are also different from those for environmental samples. So, it is important to select an appropriate tracer and an optimum sample size depending on the nuclides and analytical method. In this study 237 Np was determined by an isotope dilution alpha(gamma) spectrometry using 239 Np as a spike, and 241 Am and curium isotopes were determined by alpha spectrometry using 243 Am as a tracer. The content of each nuclide was compared with that by the Origen-2 code

  9. Association of the −243A>G, +61450C>A Polymorphisms of the Glutamate Decarboxylase 2 (GAD2) Gene with Obesity and Insu¬lin Level in North Indian Population

    OpenAIRE

    Jai PRAKASH; Balraj MITTAL; Shally AWASTHI; Neena SRIVASTAVA

    2016-01-01

    Background: Obesity associated with type 2 diabetes, and hypertension increased mortality and morbidity. Glutamate decarboxylase 2 (GAD2) gene is associated with obesity and it regulate food intake and insulin level. We investigated the association of GAD-2gene −243A>G (rs2236418) and +61450C>A (rs992990) polymorphisms with obesity and related phenotypes.Methods: Insulin, glucose and lipid levels were estimated using standard protocols. All subjects were genotyped (PCR-RFLP) method.Resu...

  10. Viscosity of n-hexadecane, n-octadecane and n-eicosane at pressures up to 243 MPa and temperatures up to 534 K

    International Nuclear Information System (INIS)

    Baled, Hseen O.; Xing, Dazun; Katz, Harrison; Tapriyal, Deepak; Gamwo, Isaac K.; Soong, Yee; Bamgbade, Babatunde A.; Wu, Yue; Liu, Kun; McHugh, Mark A.; Enick, Robert M.

    2014-01-01

    Highlights: • A novel windowed Inconel rolling-ball viscometer is designed and used by our team. • Viscosity data are reported for n-hexadecane, n-octadecane, and n-eicosane at high temperatures and pressures. • The viscosity results are compared with the available literature data. • The viscosity results are modeled with the free volume theory model. - Abstract: Viscosity data are reported for n-hexadecane (C16), n-octadecane (C18), and n-eicosane (C20) at pressures between (3 and 243) MPa and temperatures between (304 and 534) K. These extreme conditions are representative of those encountered in ultra-deep petroleum formations beneath the deepwaters of the Gulf of Mexico. The measurements are taken with a novel windowed Inconel rolling-ball viscometer designed by our team that is calibrated with n-decane. A comparison of the reported viscosity values with the available literature data that cover limited pressure and temperature ranges, shows that the mean absolute percentage deviation, δ, ranges between 1.1% and 4.8%. The reported data extend the database of viscosity to the high-temperature, high-pressure region where most gaps occur in the literature data for n-hexadecane and n-octadecane. To the best of our knowledge, the results for n-eicosane are the first reported viscosity values at pressures above 2 MPa over the entire temperature range. The viscosity results are modeled with the free volume theory model in conjunction with density values obtained using the Peng–Robinson equation of state (EoS) and the PC-SAFT EoS. The δ values obtained with this model range from 2.0% to 3.5%. The data are also correlated by a non-linear surface fit as a simultaneous function of temperature and pressure that yields δ values of 0.40%, 0.43%, and 0.38% for C16, C18, and C20, respectively

  11. A DETAILED GRAVITATIONAL LENS MODEL BASED ON SUBMILLIMETER ARRAY AND KECK ADAPTIVE OPTICS IMAGING OF A HERSCHEL-ATLAS SUBMILLIMETER GALAXY AT z = 4.243 {sup ,} {sup ,}

    Energy Technology Data Exchange (ETDEWEB)

    Bussmann, R. S.; Gurwell, M. A. [Harvard-Smithsonian Center for Astrophysics, 60 Garden Street, Cambridge, MA 02138 (United States); Fu Hai; Cooray, A. [Department of Physics and Astronomy, University of California, Irvine, CA 92697 (United States); Smith, D. J. B.; Bonfield, D.; Dunne, L. [Centre for Astrophysics, Science and Technology Research Institute, University of Hertfordshire, Hatfield, Herts AL10 9AB (United Kingdom); Dye, S.; Eales, S. [School of Physics and Astronomy, University of Nottingham, University Park, Nottingham NG7 2RD (United Kingdom); Auld, R. [Cardiff University, School of Physics and Astronomy, Queens Buildings, The Parade, Cardiff CF24 3AA (United Kingdom); Baes, M.; Fritz, J. [Sterrenkundig Observatorium, Universiteit Gent, Krijgslaan 281 S9, B-9000 Gent (Belgium); Baker, A. J. [Department of Physics and Astronomy, Rutgers, the State University of New Jersey, 136 Frelinghuysen Road, Piscataway, NJ 08854-8019 (United States); Cava, A. [Departamento de Astrofisica, Facultad de CC. Fisicas, Universidad Complutense de Madrid, E-28040 Madrid (Spain); Clements, D. L.; Dariush, A. [Imperial College London, Blackett Laboratory, Prince Consort Road, London SW7 2AZ (United Kingdom); Coppin, K. [Department of Physics, McGill University, Ernest Rutherford Building, 3600 Rue University, Montreal, Quebec, H3A 2T8 (Canada); Dannerbauer, H. [Universitaet Wien, Institut fuer Astronomie, Tuerkenschanzstrasse 17, 1180 Wien, Oesterreich (Austria); De Zotti, G. [Universita di Padova, Dipto di Astronomia, Vicolo dell' Osservatorio 2, IT 35122, Padova (Italy); Hopwood, R., E-mail: rbussmann@cfa.harvard.edu [Department of Physics and Astronomy, Open University, Walton Hall, Milton Keynes, MK7 6AA (United Kingdom); and others

    2012-09-10

    We present high-spatial resolution imaging obtained with the Submillimeter Array (SMA) at 880 {mu}m and the Keck adaptive optics (AO) system at the K{sub S}-band of a gravitationally lensed submillimeter galaxy (SMG) at z = 4.243 discovered in the Herschel Astrophysical Terahertz Large Area Survey. The SMA data (angular resolution Almost-Equal-To 0.''6) resolve the dust emission into multiple lensed images, while the Keck AO K{sub S}-band data (angular resolution Almost-Equal-To 0.''1) resolve the lens into a pair of galaxies separated by 0.''3. We present an optical spectrum of the foreground lens obtained with the Gemini-South telescope that provides a lens redshift of z{sub lens} = 0.595 {+-} 0.005. We develop and apply a new lens modeling technique in the visibility plane that shows that the SMG is magnified by a factor of {mu} = 4.1 {+-} 0.2 and has an intrinsic infrared (IR) luminosity of L{sub IR} = (2.1 {+-} 0.2) Multiplication-Sign 10{sup 13} L{sub Sun }. We measure a half-light radius of the background source of r{sub s} = 4.4 {+-} 0.5 kpc which implies an IR luminosity surface density of {Sigma}{sub IR} (3.4 {+-} 0.9) Multiplication-Sign 10{sup 11} L{sub Sun} kpc{sup -2}, a value that is typical of z > 2 SMGs but significantly lower than IR luminous galaxies at z {approx} 0. The two lens galaxies are compact (r{sub lens} Almost-Equal-To 0.9 kpc) early-types with Einstein radii of {theta}{sub E1} 0.57 {+-} 0.01 and {theta}{sub E2} = 0.40 {+-} 0.01 that imply masses of M{sub lens1} = (7.4 {+-} 0.5) Multiplication-Sign 10{sup 10} M{sub Sun} and M{sub lens2} = (3.7 {+-} 0.3) Multiplication-Sign 10{sup 10} M{sub Sun }. The two lensing galaxies are likely about to undergo a dissipationless merger, and the mass and size of the resultant system should be similar to other early-type galaxies at z {approx} 0.6. This work highlights the importance of high spatial resolution imaging in developing models of strongly lensed galaxies

  12. Impaction grafting in the femur in cementless modular revision total hip arthroplasty: a descriptive outcome analysis of 243 cases with the MRP-TITAN revision implant

    Directory of Open Access Journals (Sweden)

    Wimmer Matthias D

    2013-01-01

    Full Text Available Abstract Background We present a descriptive and retrospective analysis of revision total hip arthroplasties (THA using the MRP-TITAN stem (Peter Brehm, Weisendorf, GER with distal diaphyseal fixation and metaphyseal defect augmentation. Our hypothesis was that the metaphyseal defect augmentation (Impaction Bone Grafting improves the stem survival. Methods We retrospectively analyzed the aggregated and anonymized data of 243 femoral stem revisions. 68 patients with 70 implants (28.8% received an allograft augmentation for metaphyseal defects; 165 patients with 173 implants (71.2% did not, and served as controls. The mean follow-up was 4.4 ± 1.8 years (range, 2.1–9.6 years. There were no significant differences (p > 0.05 between the study and control group regarding age, body mass index (BMI, femoral defects (types I-III as described by Paprosky, and preoperative Harris Hip Score (HHS. Postoperative clinical function was evaluated using the HHS. Postoperative radiologic examination evaluated implant stability, axial implant migration, signs of implant loosening, periprosthetic radiolucencies, as well as bone regeneration and resorption. Results There were comparable rates of intraoperative and postoperative complications in the study and control groups (p > 0.05. Clinical function, expressed as the increase in the postoperative HHS over the preoperative score, showed significantly greater improvement in the group with Impaction Bone Grafting (35.6 ± 14.3 vs. 30.8 ± 15.8; p ≤ 0.05. The study group showed better outcome especially for larger defects (types II C and III as described by Paprosky and stem diameters ≥ 17 mm. The two groups did not show significant differences in the rate of aseptic loosening (1.4% vs. 2.9% and the rate of revisions (8.6% vs. 11%. The Kaplan-Meier survival for the MRP-TITAN stem in both groups together was 93.8% after 8.8 years. [Study group 95.7% after 8.54 years ; control group 93

  13. Savannah River Plant californium-252 Shuffler electronics manual

    International Nuclear Information System (INIS)

    Bourret, S.C.; Crane, T.W.; Eccleston, G.W.; Gallegos, E.A.; Garcia, D.L.

    1980-03-01

    Detailed information is presented in this report, an electronics manual for the Savannah River Plant Shuffler, about the electronics associated with the various control and data acquisition functions of the Shuffler subsystems. Circuit diagrams, interconnection information, and details about computer control and programming are included

  14. Survey of potential markets for devices using Californium-252

    International Nuclear Information System (INIS)

    Permar, P.H.

    1975-01-01

    Potential applications for devices or systems containing 252 Cf in the years from 1975 to 1980 are estimated. The estimated number of devices and associated business value were derived from a survey of 46 industrial, educational and governmental organizations conducted from Jan. to May, 1975. Applications for devices and systems based on 252 Cf are expected to increase by a factor of 7 in the 6-y period from 1975 to 1980. The annual business value of 252 Cf devices should increase from 1.5 million dollars in 1975 to 10.8 million dollars in 1980. The potential European market should be several times as large as the US market, based on actual sales of 252 Cf, which have been two to four times greater in Europe than in the US

  15. The protective cell petrus for the production of californium 252

    International Nuclear Information System (INIS)

    Sontag, R.; Berger, R.

    1967-01-01

    The alpha, beta, gamma, neutron cell which is described in the present paper is devoted to the transplutonium element production and study. It is located at the CEN in Fontenay-aux-Roses (France). The 4 feet ordinary concrete shielding made of stacked blocs allows the manipulation of radioactive sources as high as 1000 curies of 1 MeV gamma rays and with a fast neutrons flux of 10 9 n.cm -2 .s -1 . The airtight alpha containment box is equipped with two transfer systems, one consists of a parallelepiped shaped airtight box located in a turntable, the other uses standard cylindrical containers made of polyethylene. The general equipment and the main setting up are also described. (authors) [fr

  16. Automated absolute activation analysis with californium-252 sources

    International Nuclear Information System (INIS)

    MacMurdo, K.W.; Bowman, W.W.

    1978-09-01

    A 100-mg 252 Cf neutron activation analysis facility is used routinely at the Savannah River Laboratory for multielement analysis of many solid and liquid samples. An absolute analysis technique converts counting data directly to elemental concentration without the use of classical comparative standards and flux monitors. With the totally automated pneumatic sample transfer system, cyclic irradiation-decay-count regimes can be pre-selected for up to 40 samples, and samples can be analyzed with the facility unattended. An automatic data control system starts and stops a high-resolution gamma-ray spectrometer and/or a delayed-neutron detector; the system also stores data and controls output modes. Gamma ray data are reduced by three main programs in the IBM 360/195 computer: the 4096-channel spectrum and pertinent experimental timing, counting, and sample data are stored on magnetic tape; the spectrum is then reduced to a list of significant photopeak energies, integrated areas, and their associated statistical errors; and the third program assigns gamma ray photopeaks to the appropriate neutron activation product(s) by comparing photopeak energies to tabulated gamma ray energies. Photopeak areas are then converted to elemental concentration by using experimental timing and sample data, calculated elemental neutron capture rates, absolute detector efficiencies, and absolute spectroscopic decay data. Calculational procedures have been developed so that fissile material can be analyzed by cyclic neutron activation and delayed-neutron counting procedures. These calculations are based on a 6 half-life group model of delayed neutron emission; calculations include corrections for delayed neutron interference from 17 O. Detection sensitivities of 239 Pu were demonstrated with 15-g samples at a throughput of up to 140 per day. Over 40 elements can be detected at the sub-ppM level

  17. Savannah River Plant Californium-252 Shuffler software manual

    International Nuclear Information System (INIS)

    Johnson, S.S.; Crane, T.W.; Eccleston, G.W.

    1979-03-01

    A software manual for operating the Savannah River Plant Shuffler nondestructive assay instrument is presented. The procedures for starting up the instrument, making assays, calibrating, and checking the performance of the hardware units are described. A list of the error messages with an explanation of the circumstances prompting the message and possible corrective measures is given. A summary of the software package is included showing the names and contents of the files and subroutines. The procedure for modifying the software package is outlined

  18. Californium-252 interstitial implants in carcinoma of the tongue

    International Nuclear Information System (INIS)

    Vtyurin, B.M.; Ivanov, V.N.; Medvedev, V.S.; Galantseva, G.F.; Abdulkadyrov, S.A.; Ivanova, L.F.; Petrovskaya, G.A.; Plichko, V.I.

    1985-01-01

    A clinical study using 252 Cf sources in brachytherapy of tumors began in the Research Institute of Medical Radiology of the Academy of Medical Sciences of the USSR in 1973. 252 Cf afterloading cells were utilized by the method of simple afterloading. Dosimetry and radiation protection of medical personnel were developed. To substantiate optimal therapeutic doses of 252 Cf neutrons, a correlation of dose, time, and treatment volume factors with clinical results of 252 Cf interstitial implants in carcinoma of the tongue for 47 patients with a minimum follow-up period of 1 year was studied. Forty-nine interstitial implants have been performed. Seventeen patients received 252 Cf implants alone (Group I), 17 other patients received 252 Cf implants in combination with external radiation (Group II), and 15 patients were treated with interstitial implants for recurrent or residual tumors (Groups III). Complete regression of carcinoma of the tongue was obtained in 48 patients (98%). Thirteen patients (27%) developed radiation necrosis. The therapeutic dose of neutron radiation from 252 Cf sources in interstitial radiotherapy of primary tongue carcinomas (Group I) was found to be 7 to 9 Gy. Optimal therapeutic neutron dose in combined interstitial and external radiotherapy of primary tumors (Group II) was 5 to 6 Gy with an external radiation dose of 40 Gy. For recurrent and residual tumors (Group III), favorable results were obtained with tumor doses of 6.5 to 7 Gy

  19. Undergraduate experiments using the neutron radiation from californium-252

    International Nuclear Information System (INIS)

    Rossel, J.; Golecki, I.

    1976-01-01

    Three experiments designed to demonstrate and measure several properties of the neutron radiation emitted by a 3μg 252 Cf source are described. The experiments constitute a special project carried out by a third-year undergraduate student at the Institute of Physics of the University of Neuchatel. The 252 Cf source is enclosed in a shield which allows a pencil of fast neutrons to pass through a central tube, while reducing the ambient radiation below the tolerance level. The shield consists of layers of borated paraffin wax, iron and cadmium. The first experiment uses an air-alcohol diffusion cloud chamber for the demonstration of tracks of recoil protons produced by the neutrons. Semi-quantitative measurements of track lengths give the correct order of magnitude of the proton energies. In the second experiment a liquid scintillator detector is used to scan the beam profile across the radiation shield enclosing the source. A pulse-shape-discrimination system discriminates between neutrons and gamma photons. The third experiment makes use of the nuclear emulsion technique to study the neutron energy distribution of 252 Cf. Preliminary results are compared with published values. (author)

  20. Role of the functional MNS16A VNTR-243 variant of the human telomerase reverse transcriptase gene in progression and response to therapy of patients with non-Hodgkin's B-cell lymphomas.

    Science.gov (United States)

    Wysoczanska, B; Wrobel, T; Dobrzynska, O; Mazur, G; Bogunia-Kubik, K

    2015-04-01

    MNS16A is a functional polymorphic tandem repeat within the human telomerase reverse transcriptase (hTERT) gene. To investigate whether any of the MNS16A repeats represents a genetic risk factor for NHL susceptibility, progression of or response to therapy in 75 patients with non-Hodgkin's lymphomas (NHLs) and 126 healthy individuals were genotyped using the PCR-VNTR technique. A slightly higher frequency of the MNS16A VNTR-243 variant was detected among patients who did not respond to treatment (NR) as compared to patients with complete or partial remission (0.83 vs. 0.51, P = 0.055). NR patients more frequently developed aggressive than indolent type of the disease (0.92 vs. 0.41, P = 0.001). The VNTR-243 allele was more frequently detected among patients with an intermediate-high/high International Prognostic Index (IPI 3-4) score (P = 0.063), especially in patients with advanced age and IPI 3-4 (P = 0.040). In multivariate analysis, higher IPI 3-4 score (OR = 11.364, P = 0.051) and aggressive type of the disease (OR = 18.182, P = 0.012) were found to be independent genetic markers associated with nonresponse to treatment. Presence of the MNS16A VNTR-243 variant also strongly tended to affect the risk of a less favourable response to therapy and was more frequently present among nonresponders (OR = 5.848, P = 0.059). Genetic variation within the hTERT gene may affect the progression and treatment of lymphoproliferative disorders. © 2015 John Wiley & Sons Ltd.

  1. Modified salicylanilide and 3-phenyl-2H-benzo[e][1,3]oxazine-2,4(3H)-dione derivatives as novel inhibitors of osteoclast differentiation and bone resorption.

    Science.gov (United States)

    Chen, Chun-Liang; Liu, Fei-Lan; Lee, Chia-Chung; Chen, Tsung-Chih; Ahmed Ali, Ahmed Atef; Sytwu, Huey-Kang; Chang, Deh-Ming; Huang, Hsu-Shan

    2014-10-09

    Inhibition of osteoclast formation is a potential strategy to prevent inflammatory bone resorption and to treat bone diseases. In the present work, the purpose was to discover modified salicylanilides and 3-phenyl-2H-benzo[e][1,3]oxazine-2,4(3H)-dione derivatives as potential antiosteoclastogenic agents. Their inhibitory effects on RANKL-induced osteoclastogenesis from RAW264.7 cells were evaluated by TRAP stain assay. The most potent compounds, 1d and 5d, suppressed RANKL-induced osteoclast formation and TRAP activity dose-dependently. The cytotoxicity assay on RAW264.7 cells suggested that the inhibition of osteoclastic bone resorption by these compounds did not result from their cytotoxicity. Moreover, both compounds downregulated RANKL-induced NF-κB and NFATc1 in the nucleus, suppressed the expression of osteoclastogenesis-related marker genes during osteoclastogenesis, and prevented osteoclastic bone resorption but did not impair osteoblast differentiation in MC3T3-E1. Therefore, these modified salicylanilides and 3-phenyl-2H-benzo[e][1,3]oxazine-2,4(3H)-diones could be potential lead compounds for the development of a new class of antiresorptive agents.

  2. Measurement of the Neutron Capture Cross Sections of $^{233}$U, $^{237}$Np, $^{240,242}$Pu, $^{241,243}$Am and $^{245}$Cm with a Total Absorption Calorimeter at n_TOF

    CERN Multimedia

    Beer, H; Wiescher, M; Cox, J; Rapp, W; Embid, M; Dababneh, S

    2002-01-01

    Accurate and reliable neutron capture cross section data for actinides are necessary for the poper design, safety regulation and precise performance assessment of transmutation devices such as Fast Critical Reactors or Accelerator Driven Systems (ADS). The goal of this proposal is the measurement of the neutron capture cross sections of $^{233}$U, $^{237}$Np, $^{240,242}$Pu, $^{241,243}$Am and $^{245}$Cm at n_TOF with an accuracy of 5~\\%. $^{233}$U plays an essential role in the Th fuel cycle, which has been proposed as a safer and cleaner alternative to the U fuel cycle. The capture cross sections of $^{237}$Np,$^{240,242}$Pu, $^{241,243}$Am and $^{245}$Cm play a key role in the design and optimization of a strategy for the Nuclear Waste Transmutation. A high accuracy can be achieved at n_TOF in such measurements due to a combination of features unique in the world: high instantaneous neutron fluence and excellent energy resolution of the facility, innovative Data Acquisition System based on flash ADCs and t...

  3. Neutron-induced fission cross-section of 233U, 241Am and 243Am in the energy range 0.5 MeV ≤ En ≤ 20 MeV

    International Nuclear Information System (INIS)

    Belloni, F.; Milazzo, P.M.; Calviani, M.

    2011-01-01

    Neutron-induced fission cross-sections of 233 U, 241 Am and 243 Am relative to 235 U have been measured in a wide energy range at the neutron time of flight facility n-TOF in Geneva to address the present discrepancies in evaluated and experimental databases for reactions and isotopes relevant for transmutation and new generation fast reactors. A dedicated fast ionization chamber was used. Each isotope was mounted in a different cell of the modular detector. The measurements took advantage of the characteristics of the n-TOF installation. Its intrinsically low background, coupled to its high instantaneous neutron flux, results in high accuracy data. Its wide energy neutron spectrum helps to reduce systematic uncertainties due to energy-domain matching problems while the 185 m flight path and a 6 ns pulse width assure an excellent energy resolution. This paper presents results obtained between 500 keV and 20 MeV neutron energy. (authors)

  4. Thermomechanical behavior and microstructural evolution of a Ni(Pd)-rich Ni{sub 24.3}Ti{sub 49.7}Pd{sub 26} high temperature shape memory alloy

    Energy Technology Data Exchange (ETDEWEB)

    Benafan, O., E-mail: othmane.benafan@nasa.gov [NASA Glenn Research Center, Structures and Materials Division, Cleveland, OH 44135 (United States); Garg, A. [University of Toledo, Toledo, OH 43606 (United States); NASA Glenn Research Center, Structures and Materials Division, Cleveland, OH 44135 (United States); Noebe, R.D.; Bigelow, G.S.; Padula, S.A. [NASA Glenn Research Center, Structures and Materials Division, Cleveland, OH 44135 (United States); Gaydosh, D.J. [Ohio Aerospace Institute, Cleveland, OH 44142 (United States); NASA Glenn Research Center, Structures and Materials Division, Cleveland, OH 44135 (United States); Vaidyanathan, R. [Advanced Materials Processing and Analysis Center, Materials Science and Engineering Department, University of Central Florida, Orlando, FL 32816 (United States); Clausen, B.; Vogel, S.C. [Materials Science and Technology Division, Los Alamos National Laboratory, Los Alamos, NM 87545 (United States)

    2015-09-15

    Highlights: • A Ni(Pd)-rich Ni{sub 24.3}Ti{sub 49.7}Pd{sub 26} high temperature shape memory alloy was characterized. • Aging resulted in fine dispersion of nano-sized precipitates. • Thermomechanical cycling resulted in dimensional instabilities due to lattice defects. • A two-way shape memory effect strain of 2% strain was obtained after cycling. - Abstract: The effect of thermomechanical cycling on a slightly Ni(Pd)-rich Ni{sub 24.3}Ti{sub 49.7}Pd{sub 26} (near stochiometric Ni–Ti basis with Pd replacing Ni) high temperature shape memory alloy was investigated. Aged tensile specimens (400 °C/24 h/furnace cooled) were subjected to constant-stress thermal cycling in conjunction with microstructural assessment via in situ neutron diffraction and transmission electron microscopy (TEM), before and after testing. It was shown that in spite of the slightly Ni(Pd)-rich composition and heat treatment used to precipitation harden the alloy, the material exhibited dimensional instabilities with residual strain accumulation reaching 1.5% over 10 thermomechanical cycles. This was attributed to insufficient strengthening of the material (insufficient volume fraction of precipitate phase) to prevent plasticity from occurring concomitant with the martensitic transformation. In situ neutron diffraction revealed the presence of retained martensite while cycling under 300 MPa stress, which was also confirmed by transmission electron microscopy of post-cycled samples. Neutron diffraction analysis of the post-thermally-cycled samples under no-load revealed residual lattice strains in the martensite and austenite phases, remnant texture in the martensite phase, and peak broadening of the austenite phase. Texture developed in the martensite phase was composed mainly of those martensitic tensile variants observed during thermomechanical cycling. Presence of a high density of dislocations, deformation twins, and retained martensite was revealed in the austenite state via in

  5. The investigation on the vapour liquid phase equilibrium of (ammonia + 1,1,1,2-tetrafluoroethane) system over the temperatures ranging from (243.150 to 283.150) K

    International Nuclear Information System (INIS)

    Zhao, Yanxing; Dong, Xueqiang; Zhong, Quan; Gong, Maoqiong; Shen, Jun

    2017-01-01

    Highlights: • The vapour liquid equilibrium for ammonia + 1,1,1,2-tetrafluoroethane system was studied. • Measurements were based on vapour phase single recirculation method. • A positive azeotropic behaviour was exhibited at the experimental temperature range. - Abstract: To blend ammonia with some hydrofluorocarbons may give these mixed refrigerants lower flammability and global warming potential. In this paper, the isothermal vapour liquid equilibrium (VLE) of (ammonia + 1,1,1,2-tetrafluoroethane) system at temperatures ranging from (243.150 to 283.150) K are presented. Two models were employed to regress the experimental VLE results, namely the Peng–Robinson (PR) equation of state with the simple van der waals (VDW) mixing rule; the Peng–Robinson equation of state combined non-random two-liquid (NRTL) activity coefficient model with the modified Huron-Vidal one-order (MHV1) mixing rule. The maximum average absolute relative deviation of pressure (AARDp) and average absolute deviation of the vapour phase mole fraction (AADy) for PR-VDW are 0.56% and 0.010, respectively, while the maximum AARDp and AADy for PR-MHV1-NRTL are 0.27% and 0.014, respectively. Positive azeotropic behaviour was exhibited at each temperature investigated.

  6. 15 CFR 24.3 - Definitions.

    Science.gov (United States)

    2010-01-01

    ..., nonexpendable, personal property having a useful life of more than one year and an acquisition cost of $5,000 or... are made for construction work according to the percentage of completion of the work, rather than to... the unobligated balance in a prior period; (2) Withdrawal of the unobligated balance as of the...

  7. Galileo photometry of asteroid 243 Ida

    Science.gov (United States)

    Helfenstein, P.; Veverka, J.; Thomas, P.C.; Simonelli, D.P.; Klaasen, K.; Johnson, T.V.; Fanale, F.; Granahan, J.; McEwen, A.S.; Belton, M.; Chapman, C.

    1996-01-01

    Galileo imaging observations over phase angles 19.5?? to 109.8?? are combined with near-opposition Earth-based data to derive the photometric properties of Ida. To first order these properties are uniform over the surface and well modeled at ?? = 0.55 ??m by Hapke parameters ????0 = 0.22, h = 0.020, B0 = 1.5, g = -0.33, and ?? = 18?? with corresponding geometric albedo p = 0.21??0.030.01 and Bond albedo AB = 0.081??0.0170.008. Ida's photometric properties are more similar to those of "average S-asteroids" (P. Helfenstein and J. Veverka 1989, Asteroids II, Univ. of Arizona Press, Tucson) than are those of 951 Gaspra. Two primary color units are identified on Ida: Terrain A exhibits a spectrum with relatively shallower 1-??m absorption and a relatively steeper red spectral slope than average Ida, while Terrain B has a deeper 1-??m absorption and a less steep red slope. The average photometric properties of Ida and Terrain A are similar while those of Terrain B differ mostly in having a slightly higher value of ????0 (0.22 versus 0.21), suggesting that Terrain B consists of slightly brighter, more transparent regolith particles. Galileo observations of Ida's satellite Dactyl over phase angles 19.5?? to 47.6?? suggest photometric characteristics similar to those of Ida, the major difference being Dactyl's slightly lower albedo (0.20 compared to 0.21). ?? 1990 Academic Press, Inc.

  8. Publications | Page 243 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    In Guyana and Colombia, as in most Latin American countries, mining has dramatically increased over the past two decades. But from the contamination of healthy rivers to the lawless atmosphere of mining towns, few have felt the ill effects. ... Collecting data in the slums of Nairobi, Kenya can be a dangerous job.

  9. 28 CFR 2.43 - Early termination.

    Science.gov (United States)

    2010-07-01

    ... terminated because there is a likelihood that the parolee will engage in conduct violating any criminal law... shall review the status of the parolee to determine the need for continued supervision. The Commission shall also conduct a status review whenever the supervision officer recommends early termination of the...

  10. 40 CFR 243.101 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... means the act of removing solid waste (or materials which have been separated for the purpose of recycling) from a central storage point. (f) Collection frequency means the number of times collection is... the purpose of these guidelines. United States Government installations located on foreign soil or on...

  11. 40 CFR 243.200-1 - Requirement.

    Science.gov (United States)

    2010-07-01

    ... for the purpose of recycling) shall be stored in such a manner that they do not constitute a fire... recycling) must meet the standards established by the American National Standards Institute (ANSI) for waste...

  12. 40 CFR 243.202-1 - Requirement.

    Science.gov (United States)

    2010-07-01

    ... solid waste (or materials which have been separated for the purpose of recycling) which are considered... transportation of solid waste (or materials which have been separated for the purpose of recycling) shall be... materials which have been separated for the purpose of recycling) shall be constructed, operated, and...

  13. Publications | Page 243 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    IDRC works with developing-country researchers and institutions to build local ... aim to widen the impact of our investment and advance development research. ... A new window on the world for women ... In doing so, it emphasizes obstacles to peace rather than root causes of conflict. ... Declining poverty, rising inequality.

  14. 40 CFR 243.100 - Scope.

    Science.gov (United States)

    2010-07-01

    ... additional actions or preferred methods by which the objectives of the requirements can be realized. The... post offices, military recruiting stations, and other offices where local community solid waste...

  15. The protective cell petrus for the production of californium 252; Cellule blindee petrus pour la production et l'etude du californium 252

    Energy Technology Data Exchange (ETDEWEB)

    Sontag, R; Berger, R [Commissariat a l' Energie Atomique, Fontenay-aux-Roses (France). Centre d' Etudes Nucleaires

    1967-07-01

    The alpha, beta, gamma, neutron cell which is described in the present paper is devoted to the transplutonium element production and study. It is located at the CEN in Fontenay-aux-Roses (France). The 4 feet ordinary concrete shielding made of stacked blocs allows the manipulation of radioactive sources as high as 1000 curies of 1 MeV gamma rays and with a fast neutrons flux of 10{sup 9} n.cm{sup -2}.s{sup -1}. The airtight alpha containment box is equipped with two transfer systems, one consists of a parallelepiped shaped airtight box located in a turntable, the other uses standard cylindrical containers made of polyethylene. The general equipment and the main setting up are also described. (authors) [French] La cellule alpha, beta, gamma, neutron, qui fait l'objet du present article, est destinee a la production et a l'etude des elements transplutoniens. Elle est construite au C.E.N. de Fontenay-aux-Roses (France). La protection biologique, calculee pour une activite de 1000 curies de rayonnement gamma d'energie 1 MeV accompagnee d'un flux de neutrons rapides de 10{sup 9}/cm{sup 2}s, est constituee par des parois en beton de 1,20 m d'epaisseur. L'enceinte alpha est une boite etanche qui comporte devx systemes de transferts: l'un consiste en une boite parallelepipedique etanche logee dans un barillet, l'autre fait appel a des recipients cylindriques standard en polyethylene. L'equipement general et les installations les plus importantes sont ensuite decrits. (auteurs)

  16. Application of fission track detectors to californium-252 neutron dosimetry in tissue near the radiation source

    International Nuclear Information System (INIS)

    Oswald, R.A.; Lanzl, L.H.; Rozenfeld, M.

    1981-01-01

    Fission track detectors were applied to a unique problem in neutron dosimetry. Measurements of neutron doses were required at locations within a tumor of 1 cm diameter implanted on the back of a mouse and surrounded by a square array of four 252 Cf medical sources. Measurements made in a tissue-equivalent mouse phantom showed that the neutron dose rate to the center of the tumor was 2.18 rads mg -1 h -1 +- 8.4%. The spatial variation of neutron dose to the tumor ranged from 1.88 to 2.55 rads mg -1 h -1 . These measurements agree with calculated values of neutron dose to those locations in the phantom. Fission track detectors have been found to be a reliable tool for neutron dosimetry for geometries in which one wishes to know neutron dose values which may vary considerably over distances of 1 cm or less

  17. Application of fission track detectors to californium-252 neutron dosimetry in tissue near the radiation source

    International Nuclear Information System (INIS)

    Oswald, R.A.; Lanzl, L.H.; Rozenfeld, M.

    1981-01-01

    Fission track detectors were applied to a unique problem in neutron dosimetry. Measurements of neutron doses were required at locations within a tumor of 1 cm diameter implanted on the back of a mouse and surrounded by a square array of four 252 Cf medical sources. Measurements made in a tissue-equivalent mouse phantom showed that the neutron dose rate to the center of the tumor was 2.18 rads micrograms-1 h-1 +/- 8.4%. The spatial variation of neutron dose to the tumor ranged from 1.88 to 2.55 rads micrograms-1 h-1. These measurements agree with calculated values of neutron dose to those locations in the phantom. Fission track detectors have been found to be a reliable tool for neutron dosimetry for geometries in which one wishes to know neutron dose values which may vary considerably over distances of 1 cm or less

  18. Neutron Protection Factor Determination and Validation for a Vehicle Surrogate Using a Californium Fission Source

    Science.gov (United States)

    2017-06-01

    study the laws governing shock wave propagation, and evaluate the suitability of military operations after being subjected to their use. During...14]. MCNP6.1 then outputs a dose spectrum, instead of the standard fluence spectrum created from the “ f4 ” tally [14]. In order to produce the dose...manually, an unmodified fluence tally ( f4 ) was exported externally to a spreadsheet. The energy bins were summed and grouped to mimic the energy bin

  19. Californium-252 neutron activation analysis of high-level processed nuclear tank waste

    International Nuclear Information System (INIS)

    Troyer, G.L.; Purcell, M.A.

    2000-01-01

    The basis for production assessment of the vitrification of Hanford nuclear fuel reprocessing wastes will be high-precision measurements of the elemental sodium content. However, the chemical analysis of both radioactive and nonradioactive components in nuclear waste can be challenged by high radiation dose rates. The dose rates compromise many analytical techniques as well as pose personnel dosimetry risks. In many cases, reduction of dose rates through dilution compromises the precision and sensitivity for certain key components. The use of neutron activation analysis (NAA) provides a method of analysis that avoids the need for dilutions or extensive sample preparation. These waste materials also contain trace quantities of fissionable isotopes, which, through neutron activation, can be estimated by delayed neutron counting of fissioned fragments

  20. Multiplicity and correlated energy of gamma rays emitted in the spontaneous fission of Californium-252

    International Nuclear Information System (INIS)

    Brunson, G.S. Jr.

    1982-06-01

    An array of eight high-speed plastic scintillation detectors has been used to infer a mathematical model for the emission multipliciy of prompt gammas in the spontaneous fission of 252 Cf. Exceptional time resolution and coincidence capability permitted the separation of gammas from fast neutrons over a flight path of approximately 10 cm. About 20 different distribution models were tested. The average energy of the prompt gammas is inversely related to the number emitted; however, this inverse relationship is not strong and the total gamma energy does increase with increasing gamma number. An extension of the experiment incorporated a lithium-drifted germanium gamma spectrometer that resolved nearly 100 discrete gammas associated with fission. Of these gammas, some were preferentially associated with fission in which few gammas were emitted. Certain others were more frequent when many gammas were emitted. Results are presented

  1. Use of californium-252 sources in Hungary for teaching and research

    International Nuclear Information System (INIS)

    Csikai, J.

    1976-01-01

    An activation facility was designed to accommodate up to 50 mg of 252 Cf; it contains at present a 500 μg source. The absolute values of thermal, epithermal and fast neutron fluxes were determined by the foil activation method using In, Dy, Au, Al and Fe detectors. Cross-sections averaged for unmoderated 252 Cf neutrons were determined for 22 different reactions for elements with atomic weights lying between A=27 and 204. The sensitivity for determination of Al, Ti, Cu, As, Sr, Mo, In, Cd, Ba, Au, Hg and Pb was calculated for NaI(Tl) and Ge(Li) detectors. Average (n,2n) cross-sections for 252 Cf spectrum were calculated for 49 nuclei lying between A=14 and 204. Angular distributions and cross-sections for the fragments from 252 Cf neutron-induced fission of 232 Th and 238 U were measured. Titanium in bauxite and manganese in aluminium alloys were determined with a 252 Cf source. The applicability of solid-state track detectors for neutron dosimetry, radiography and for the determination of fuel burn-up were investigated using 252 Cf neutron and fragment sources. Characteristics of a jumping spark counter for counting fission fragments were studied with 252 Cf sources. (author)

  2. Chromatographic cation exchange separation of decigram quantities of californium and other transplutonium elements

    Energy Technology Data Exchange (ETDEWEB)

    Benker, D.E.; Chattin, F.R.; Collins, E.D.; Knauer, J.B.; Orr, P.B.; Ross, R.G.; Wiggins, J.T.

    1980-01-01

    Decigram quantities of highly radioactive transplutonium elements are routinely partitioned at TRU by chromatographic elution from cation resin using AHIB eluent. By using two high-pressure ion exchange columns, a small one for the initial loading of the feed and a large one for the elution, batch runs containing up to 200 mg of /sup 252/Cf can be made in about 5 hours (2 hours to load the feed and 3 hours for the elution). The number of effluent product fractions and the amount of actinides that must be collected in intermediate fractions are minimized by monitoring response from a flow-through alpha-detector. This process has been reliable and relatively easy to operate, and will continue to be used for partitioning transplutonium elements at TRU.

  3. Determination of the average number of neutrons per fission event for californium-252

    International Nuclear Information System (INIS)

    Aleksandrov, B.M.; Belov, L.M.; Drapchinskij, L.V.

    1982-01-01

    By means of a separate determination of neutron yields and fission event rates, the value of #betta#-bar( 252 Cf) has been measured for a series of new high-purity sources. The improved quality of the source active layers has reduced the error in determining the fission rate to 0.35%. The value obtained for #betta#-bar( 252 Cf) is 3.747+-0.036. A description is given of the design and the parameters of a spherical manganese bath in which the work on refining the value of #betta#-bar( 252 Cf) will be continued. (author)

  4. Remarkably High Stability of Late Actinide Dioxide Cations: Extending Chemistry to Pentavalent Berkelium and Californium.

    Science.gov (United States)

    Dau, Phuong D; Vasiliu, Monica; Peterson, Kirk A; Dixon, David A; Gibson, John K

    2017-12-06

    Actinyl chemistry is extended beyond Cm to BkO 2 + and CfO 2 + through transfer of an O atom from NO 2 to BkO + or CfO + , establishing a surprisingly high lower limit of 73 kcal mol -1 for the dissociation energies, D[O-(BkO + )] and D[O-(CfO + )]. CCSD(T) computations are in accord with the observed reactions, and characterize the newly observed dioxide ions as linear pentavalent actinyls; these being the first Bk and Cf species with oxidation states above IV. Computations of actinide dioxide cations AnO 2 + for An=Pa to Lr reveal an unexpected minimum for D[O-(CmO + )]. For CmO 2 + , and AnO 2 + beyond EsO 2 + , the most stable structure has side-on bonded η 2 -(O 2 ), as An III peroxides for An=Cm and Lr, and as An II superoxides for An=Fm, Md, and No. It is predicted that the most stable structure of EsO 2 + is linear [O=Es V =O] + , einsteinyl, and that FmO 2 + and MdO 2 + , like CmO 2 + , also have actinyl(V) structures as local energy minima. The results expand actinide oxidation state chemistry, the realm of the distinctive actinyl moiety, and the non-periodic character towards the end of the periodic table. © 2017 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.

  5. Californium-252: isotope for modern radiotherapy of cervix, uterine and vaginal carcinomas

    International Nuclear Information System (INIS)

    Maruyama, J.; Beach, J.L.; Nagell, J.R. van

    1984-01-01

    Cf-252 is an isotope that can easily be afterloaded into available gynecological applicators and used for bulky cervix, uterus or vaginal cancer therapy. It is economical, time and cost effective in use, and can be applied to the therapy of many patients throughout the world. It is more effective for neutron therapy than machine fast neutron therapy and is the only form of neutron therapy producing consistent complication-free 5-year cure of advanced cancers currently available. Cf-252 is an isotope for modern gynecological tumor therapy for the future. Isodose curves for Cf-252 implants revealed dose distributions conforming well to tumor. (orig.) [de

  6. Testing of ENDF/B cross section data in the Californium-252 neutron benchmark field

    International Nuclear Information System (INIS)

    Mannhart, W.

    1979-01-01

    The fission neutron field of 252 Cf presently represents one of the most well-known neutron benchmark fields. For 13 neutron reactions which are of importance in reactor metrology, measurements of spectrum-averaged cross sections, [sigma], performed in this neutron field were compared with calculated average cross sections. This comparison allows one to draw conclusions as to the quality of different sigma(E) data taken from ENDF/B-IV, from ENDF/B-V, and from recent experiments and used in the calculation of average cross sections. The comparison includes an uncertainty analysis regarding the different uncertainty contributions of [sigma], of sigma(E), and of the spectral distribution of 252 Cf fission neutrons. Additionally, in a few examples, sensitivity studies were carried out. The sensitivity of the spectrum-averaged cross sections to individual characteristics of the sigma(E) data, such as normalization factors or shifts in the energy scale, was investigated. Similarly, the sensitivity of [sigma] to the spectral distribution of 252 Cf was determined. 4 figures, 2 tables

  7. Total neutron cross sections of berkelium-249 and californium-249 below 100 eV

    International Nuclear Information System (INIS)

    Benjamin, R.W.; Harvey, J.A.; Hill, N.W.; Pandey, M.S.; Carlton, R.F.

    1979-01-01

    The neutron total cross sections of 249 Bk and 249 Cf have been measured from 0.03 to 100 eV using the Oak Ridge Electron Linear Accelerator (ORELA) as a source of pulsed neutrons. The 1.6 mm dia. cylindrical transmission samples contained initially up to 5.3 mg of 98% 249 Bk and 2% 249 Cf: 4.5 years later, when the final measurements were made, the composition of the samples had become 2.5% 249 Bk, 96.9% 249 Cf, and 0.6% 245 Cm. Samples were cooled with liquid nitrogen to reduce Doppler broadening. Thirty-nine resonances were identified in 249 Bk and analyzed using a single-level Breit-Wigner formalism. Fifty-five resonances were identified in 249 Cf and analyzed using an R-matrix multilevel formalism. Fifty-five resonances were identified in 249 Cf and analyzed using an R-matrix multilevel formalism. The resonance parameters obtained have been used to determine the average level spacings and the s-wave neutron and fission strength functions. Where possible, bound-level parameters were derived to fit the thermal neutron total cross section data

  8. 48 CFR 252.243-7002 - Requests for equitable adjustment.

    Science.gov (United States)

    2010-10-01

    ... clause does not apply to— (1) Requests for routine contract payments; for example, requests for payment for accepted supplies and services, routine vouchers under a cost-reimbursement type contract, or progress payment invoices; or (2) Final adjustment under an incentive provision of the contract. (End of...

  9. All projects related to | Page 243 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Rethinking Political Legitimacy: Citizen Inclusion and Social Digital Media. Project. In Chile, a mobilized, invigorated civil society is using new digital technologies to transform political participation. ... Program: Agriculture and Food Security.

  10. 48 CFR 243.204-70-6 - Allowable profit.

    Science.gov (United States)

    2010-10-01

    ... profit allowed reflects— (a) Any reduced cost risk to the contractor for costs incurred during contract performance before negotiation of the final price; (b) The contractor's reduced cost risk for costs incurred during performance of the remainder of the contract; and (c) The extent to which costs have been incurred...

  11. Preface: phys. stat. sol. (b) 243/5

    Science.gov (United States)

    Artacho, Emilio; Beck, Thomas L.; Hernández, Eduardo

    Between 20 and 24 June 2005 the Centre Européen de Calcul Atomique et Moléculaire - or CECAM, as it is more widely known - hosted a workshop entitled State-of-the-art, developments and perspectives of real-space electronic structure methods in condensed-matter and chemical physics, organized with the support of CECAM itself and the ?k network. The workshop was attended by some forty participants coming from fifteen countries, and about thirty presentations were given. The workshop provided a lively forum for the discussion of recent methodological developments in electronic structure calculations, ranging from linear-scaling methods, mesh techniques, time-dependent density functional methods, and a long etcetera, which had been our ultimate objective when undertaking its organization.The first-principles simulation of solids, liquids and complex matter in general has jumped in the last few years from the relatively confined niches in condensed matter and materials physics and in quantum chemistry, to cover most of the sciences, including nano, bio, geo, environmental sciences and engineering. This effect has been propitiated by the ability of simulation techniques to deal with an ever larger degree of complexity. Although this is partially to be attributed to the steady increase in computer power, the main factor behind this change has been the coming of age of the main theoretical framework for most of the simulations performed today, together with an extremely active development of the basic algorithms for its computer implementation. It is this latter aspect that is the topic of this special issue of physica status solidi.There is a relentless effort in the scientific community seeking to achieve not only higher accuracy, but also more efficient, cost-effective and if possible simpler computational methods in electronic structure calculations [1]. From the early 1990s onwards there has been a keen interest in the computational condensed matter and chemical physics communities in methods that had the potential to overcome the unfavourable scaling of the computational cost with the system size, implicit in the momentum-space formalism familiar to solid-state physicists and the quantum chemistry approaches more common in chemical physics and physical chemistry. This interest was sparkled by the famous paper in which Weitao Yang [2] introduced the Divide and Conquer method. Soon afterwards several practical schemes aiming to achieve linear-scaling calculations, by exploiting what Walter Kohn called most aptly the near-sightedness of quantum mechanics [3], were proposed and explored (for a review on linear-scaling methods, see [4]). This search for novel, more efficient and better scaling algorithms proved to be fruitful in more than one way. Not only was it the start of several packages which are well-known today (such as Siesta, Conquest, etc.), but it also leads to new ways of representing electronic states and orbitals, such as grids [5, 6], wavelets [7], finite elements, etc. Also, the drive to exploit near-sightedness attracted computational solid state physicists to the type of atomic-like basis functions traditionally used in the quantum chemistry community. At the same time computational chemists learnt about plane waves and density functional theory, and thus a fruitful dialogue was started between two communities that hitherto had not had much contact.Another interesting development that has begun to take place over the last decade or so is the convergence of several branches of science, notably physics, chemistry and biology, at the nanoscale. Experimentalists in all these different fields are now performing highly sophisticated measurements on systems of nanometer size, the kind of systems that us theoreticians can address with our computational methods, and this convergence of experiment and theory at this scale has also been very fruitful, particularly in the fields of electronic transport and STM image simulation. It is now quite common to find papers at the cutting edge of nanoscience and nanotechnology co-authored by experimentalists and theorists, and it can only be expected that this fruitful interplay between theory and experiment will increase in the future.It was considerations such as these that moved us to propose to CECAM and ?k the celebration of a workshop devoted to the discussion of recent developments in electronic structure techniques, a proposal that was enthusiastically received, not just by CECAM and ?k, but also by our invited speakers and participants. Interest in novel electronic structure methods is now as high as ever, and we are therefore very happy that physica status solidi has given us the opportunity to devote a special issue to the topics covered in the workshop. This special issue of physica status solidi gathers invited contributions from several attendants to the workshop, contributions that are representative of the range of topics and issues discussed then, including progress in linear scaling methods, electronic transport, simulation of STM images, time-dependent DFT methods, etc. It rests for us to thank all the contributors to this special issue for their efforts, CECAM and ?k for funding the workshop, physica status solidi for agreeing to devote this special issue to the workshop, and last but not least Emmanuelle and Emilie, the CECAM secretaries, for their invaluable practical help in putting this workshop together

  12. 40 CFR 243.202-3 - Recommended procedures: Operations.

    Science.gov (United States)

    2010-07-01

    ... receive periodic vehicle safety checks, including, but not limited to, inspection of brakes, windshield wipers, taillights, backup lights, audible reverse warning devices, tires, and hydraulic systems. Any... should only be left in a vehicle overnight when this practice does not constitute a fire, health, or...

  13. 1935 15' Quad #243 Aerial Photo Mosaic Index

    Data.gov (United States)

    Earth Data Analysis Center, University of New Mexico — Aerial Photo Reference Mosaics contain aerial photographs that are retrievable on a frame by frame basis. The inventory contains imagery from various sources that...

  14. 48 CFR 1852.243-71 - Shared savings.

    Science.gov (United States)

    2010-10-01

    ... organizational support of a contract or group of contracts. These alternatives must result in a net reduction of... organizational support which are proposed to be changed. (2) A description of the difference between the current... make any structural or organizational changes in order to implement an approved CRP. (5) Government...

  15. 40 CFR 243.204-2 - Recommended procedures: Operations.

    Science.gov (United States)

    2010-07-01

    ... achieve the most efficient compaction. (3) Compactor trucks should be used to reduce the number of trips... commercial wastes which do not contain food wastes, storage capacity should be increased in lieu of more...

  16. 29 CFR 1910.243 - Guarding of portable powered tools.

    Science.gov (United States)

    2010-07-01

    ..., powered tampers, jack hammers, rock drills, garden appliances, household and kitchen appliances, personal... clearance between the wheel hole and the machine spindle (or wheel sleeves or adaptors) is essential to...

  17. Dicty_cDB: AFL243 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available llsc*rl*wwcs*twsirsh*trytnyldhfr***fsinesrr*rskskrcsyyrhyk *fnfg*tyrs*yhfnsk*wyfnctfscnsitiiaxkgncknmtqtskkl...SQVTVLSLVANWFAQHRGIEEG KRRQVNRFSSSFTNKFGYGITCS*tm*snrsknl*kefnlcfg*rfr*tnri*rcfen*r nhllsc*rl*wwcs*twsirsh*trytnyldhfr***fsines

  18. 40 CFR 243.200-2 - Recommended procedures: Design.

    Science.gov (United States)

    2010-07-01

    ... waste containers should be constructed of corrosion resistant metal or other material which will not.... Containers should have covers which are tight-fitting to resist the intrusion of water and vectors, and...

  19. 7 CFR 2.43 - Administrator, Foreign Agricultural Service.

    Science.gov (United States)

    2010-01-01

    ... the provisions concerning the end-use certificate system authorized pursuant to section 321(f) of that... amended (7 U.S.C. 5601 et seq.). (15) Formulate policies and administer barter programs under which... intelligence and reporting system, including provision for foreign agricultural representation abroad to...

  20. 19 CFR 10.243 - Articles eligible for preferential treatment.

    Science.gov (United States)

    2010-04-01

    ... articles had been imported directly from Canada or Mexico; or (iv) Fabrics or yarns that the President or... folklore apparel or other textile article of an ATPDEA beneficiary country that the President or his....61.00 of the HTSUS and that is entered free of duty from Canada, Mexico, or Israel. (d) Imported...

  1. 9 CFR 354.243 - Operations and procedures.

    Science.gov (United States)

    2010-01-01

    ... INSPECTION AND CERTIFICATION VOLUNTARY INSPECTION OF RABBITS AND EDIBLE PRODUCTS THEREOF Maintenance of..., and insects), considering the means intended to be employed in transporting the product from the plant... hygiene of personnel: (1) All employees coming in contact with exposed edible products or edible products...

  2. 40 CFR Appendix to Part 243 - Recommended Bibliography

    Science.gov (United States)

    2010-07-01

    .... Government Printing Office, 1974. 3. Grupenhoff, B. L., and K. A. Shuster. Paper and plastic solid waste... Sanitation Foundation standard no. 32 for paper refuse sacks. Ann Arbor, The National Sanitation Foundation..., General Services Administration, Washington, DC 20409. 9. Ralph Stone and Company, Inc. The use of bags...

  3. 48 CFR 1852.243-70 - Engineering change proposals.

    Science.gov (United States)

    2010-10-01

    ... reserves the right to request additional information if that provided by the Contractor is considered... cost or pricing data, it shall cite the exception and provide rationale for its applicability. (e) If...

  4. 29 CFR 1952.243 - Final approval determination.

    Science.gov (United States)

    2010-07-01

    ... over agricultural temporary labor camps for employees engaged in egg, poultry, or red meat production... Labor Regulations Relating to Labor (Continued) OCCUPATIONAL SAFETY AND HEALTH ADMINISTRATION..., or the U.S. Department of Commerce—National Oceanic and Atmospheric Administration, and operated by...

  5. 12 CFR 303.243 - Brokered deposit waivers.

    Science.gov (United States)

    2010-01-01

    ... and use of brokered deposits; (7) A recent consolidated financial statement with balance sheet and income statements; and (8) The reasons the institution believes its acceptance, renewal or rollover of...) The time period for which the waiver is requested; (2) A statement of the policy governing the use of...

  6. Dicty_cDB: SHB243 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available R103667 |CR103667.1 Forward strand read from insert in 3'HPRT insertion targeting and chromosome engineering... in 3'HPRT insertion targeting and chromosome engineering clone MHPP186g09. 50 0.13 1 dna update 2005.12.21

  7. 40 CFR 243.201-2 - Recommended procedures: Operations.

    Science.gov (United States)

    2010-07-01

    ..., safety glasses, respirators, and footwear should be used by collection employees, as appropriate. This equipment should meet the applicable provisions of the Occupational Safety and Health Administration...

  8. Synthesis and characterization of a pentadentate Schiff base N3O2 ligand and its neutral technetium(V) complex. X-ray structure of (N,N'-3-azapentane-1,5-diylbis(3-(1-iminoethyl)-6-methyl-2H-pyran-2,4(3H)-dionato)(3-)-O,O',N,N',N double-prime)oxotechnetium(V)

    International Nuclear Information System (INIS)

    Shuang Liu; Rettig, S.J.; Orvig, C.

    1991-01-01

    Preparations of a potentially pentadentate ligand, N,N'-3-azapentane-1,5-diylbis(3-(1-iminoethyl)-6-methyl-2H-pyran-2,4-(3H)-dione) (H 3 apa), and its neutral technetium(V) complex, [TcO(apa)], are described. The 13 C and 1 H NMR, infrared, optical, and mass spectra of the pentadentate ligand and its technetium(V) complex are reported. The X-ray structure of [TcO(apa)] has been determined. Crystals are orthorhombic, space group Pbca, with a = 12.833 (2) angstrom, b = 33.320 (5) angstrom, c = 9.942(4) angstrom, V = 4251 (2) angstrom, and Z = 8. The structure was solved by Patterson and Fourier methods and was refined by full-matrix least-squares procedures to R = 0.028 and R W = 0.032 for 4054 reflections with I ≥ 3σ(I). The technetium(V) complex has a highly distorted octahedral coordination geometry comprising a [TcO] 3+ core and the triply deprotonated pentadentate ligand wrapping around the metal center. One of the two oxygen donor atoms of the pentadentate ligand is located trans to the Tc double-bond O bond while the remaining four donor atoms, N 3 O, occupy the equatorial sites. The distance between the deprotonated N(1) atom to the Tc center is significantly shorter than a normal Tc-N single bond length of 2.10 angstroms, but longer than that for a Tc-N triple bond. 1 H NMR spectral data reveal a rigid solution structure for the complex, which undergoes no conformational and configurational exchange at temperatures up to 50C

  9. Oxidation-reduction properties of americium, curium, berkelium, californium, einsteinium and fermium, and thermodynamic consequences for the 5f series

    International Nuclear Information System (INIS)

    Samhoun, K.

    1976-01-01

    The amalgamation of 5f elements from Am to Fm has been studied by using 241 Am, 244 Cm, 249 Bk, 249 Cf, 252 Cf, 253 Es, 254 Es, 252 Fm and 255 Fm with two electrochemical methods, radiocoulometry and radiopolarography, perfectly adapted to investigate extremely diluted solutions when the concentration of electroactive species is as low as 10 -16 M. The theory of radiocoulometry has been developed in the general cases of reversible and irreversible electrode process. It has been used to interpret the experimental data on the kinetic curves of amalgamation, and to estimate the standard rate constant of the electrode process in complexing medium (citric). On the other hand the radiopolarographic method has been applied to study the mechanism of reduction at the dropping mercury electrode of cations M 3+ in aqueous medium to the metal M with formation of amalgam. The results are exploited into two directions: 1- Acquisition of some data concerning the oxidation-reduction properties of elements from Am to Fm. Therefore the standard electrode E 0 [M(III-0)] potentials for Bk, Cf and Es, and the standard electrode E 0 [M(II-0)] potential for Fm are estimated and the relative stability of each oxidation state (from II to VII) of 5f elements is discussed; 2- Acquisition of unknown thermodynamic data on transcalifornium elements. Correlations between 4f and 5f elements are precised and some divergences appear for the second half of 4f and 5f series (i.e. for 65 [fr

  10. Inverse gamma ray dose rate effect in californium-252 RBE experiment with human T-1 cells irradiated in vitro

    International Nuclear Information System (INIS)

    Todd, P.; Feola, J.M.

    1986-01-01

    Metabolically deoxygenated suspensions of human T-1 cells were used to determine the RBE in hypoxia of low dose rate (LDR) Cf-252 radiation compared to LDR gamma radiation. Based upon the initial portion of the survival curves the RBE was 5.0 ± 1.0 for all components of the Cf-252 radiation and 7.1 ± 1.7 for the neutrons alone. An inverse dose rate effect was observed for LDR gamma radiation in which greater cell sensitivity was observed at lower dose rates and longer irradiation periods. It was demonstrated that there was little or no sublethal damage repair or cell progression during LDR at 21 deg C, and the observed decrease in cell survival probability with increasing irradiation time at a given dose was attributable to reoxygenation of the cell suspensions during the course of LDR exposures. (Auth.)

  11. In situ x-ray fluorescence and californium-252 neutron activation analysis for marine and terrestrial mineral exploration

    International Nuclear Information System (INIS)

    Wogman, N.A.

    1976-12-01

    Instrumentation has been designed for in situ analysis of marine and terrestrial minerals using the techniques of x-ray fluorescence and neutron activation analysis. The energy-dispersive x-ray fluorescence analyzer allows more than 20 elements to be quantitatively measured at the 10 ppM level in water depths to 300 m. The analyzer consists of a solid cryogen-cooled Si(Li) detector, a 50 mCi 109 Cd or 57 Co excitation source, and an analyzer-computer system for data storage and manipulation. The neutron activation analysis, which is designed to measure up to 30 elements at parts per hundred to ppM levels, utilizes the man-made element 252 Cf as its neutron activation source. The resulting radioelements which emit characteristic gamma radiation are then analyzed in situ during 2- to 200-s counting intervals with Ge(Li) or NaI(T1) detector systems. An extension of this latter technique, which uses a 252 Cf- 235 U fueled subcritical multiplier, is also being studied. The subcritical facility allows the neutrons from the 252 Cf source to be multiplied, thus providing greater neutron flux. Details of these in situ analysis systems, actual in situ spectra, and recorded data are discussed with respect to the detection of minerals at their varying concentration levels. The system response of each illustrates its usefulness for various rapid environmental mineral exploration studies. These techniques can be utilized on terrestrial surfaces and marine or fresh water sediments. 5 figures, 2 tables

  12. SU-F-T-243: Major Risks in Radiotherapy. A Review Based On Risk Analysis Literature

    Energy Technology Data Exchange (ETDEWEB)

    López-Tarjuelo, J; Guasp-Tortajada, M; Iglesias-Montenegro, N; Monasor-Denia, P [Servicio de Radiofísica y Protección Radiológica, Consorcio Hospitalario Provincial de Castellón, Castellón de la Plana, España/Spain (Spain); Bouché-Babiloni, A; Morillo-Macías, V; Ferrer-Albiach, C [Servicio de Oncología Radioterápica, Consorcio Hospitalario Provincial de Castellón, Castellón de la Plana, España/Spain (Spain)

    2016-06-15

    Purpose: We present a literature review of risk analyses in radiotherapy to highlight the most reported risks and facilitate the spread of this valuable information so that professionals can be aware of these major threats before performing their own studies. Methods: We considered studies with at least an estimation of the probability of occurrence of an adverse event (O) and its associated severity (S). They cover external beam radiotherapy, brachytherapy, intraoperative radiotherapy, and stereotactic techniques. We selected only the works containing a detailed ranked series of elements or failure modes and focused on the first fully reported quartile as much. Afterward, we sorted the risk elements according to a regular radiotherapy procedure so that the resulting groups were cited in several works and be ranked in this way. Results: 29 references published between 2007 and February 2016 were studied. Publication trend has been generally rising. The most employed analysis has been the Failure mode and effect analysis (FMEA). Among references, we selected 20 works listing 258 ranked risk elements. They were sorted into 31 groups appearing at least in two different works. 11 groups appeared in at least 5 references and 5 groups did it in 7 or more papers. These last sets of risks where choosing another set of images or plan for planning or treating, errors related with contours, errors in patient positioning for treatment, human mistakes when programming treatments, and planning errors. Conclusion: There is a sufficient amount and variety of references for identifying which failure modes or elements should be addressed in a radiotherapy department before attempting a specific analysis. FMEA prevailed, but other studies such as “risk matrix” or “occurrence × severity” analyses can also lead professionals’ efforts. Risk associated with human actions ranks very high; therefore, they should be automated or at least peer-reviewed.

  13. 243 The Challenges of Theatre Workshop in Katsina-Ala and Oju ...

    African Journals Online (AJOL)

    USER

    recommends more funding by the College management for Theatre. Arts Department ... exploring and expressing human feelings and predicaments. This is because .... atmosphere where talents and creativity is built in students, fostering ...

  14. Sor/88-243, 21 April 1988, uranium and thorium mining regulations

    International Nuclear Information System (INIS)

    1988-05-01

    These Regulations deal with radiological health and safety in uranium mining facilities and in effect, they formalise previous requirements imposed on such facilities through licence conditions. Licences are required for removing or excavating uranium or thorium; siting, constructing or operating a mine or a mill; and for decommissioning a mining facility. Applications for licences include technical conditions relevant to each type of activity concerned, the common condition being detailed descriptions of the activity, the radiation protection and environmental protection measures as well as the radiation monitoring programme [fr

  15. 43 CFR 30.243 - How will the judge decide my petition for reopening?

    Science.gov (United States)

    2010-10-01

    ... 43 Public Lands: Interior 1 2010-10-01 2010-10-01 false How will the judge decide my petition for... the judge decide my petition for reopening? (a) If the judge finds that proper grounds are not shown, the judge will issue an order denying the petition for reopening and giving the reasons for the denial...

  16. : tous les projets | Page 243 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Sujet: Climate change, ADAPTATION TO CHANGE, DROUGHT, FLOODS, HYDROLOGY, AGRICULTURAL LAND, CULTIVATED LAND, LAND USE, PLANNING. Région: Argentina, South America, Paraguay, North and Central America. Programme: Changements climatiques. Financement total : CA$ 391,900.00.

  17. Synthesis of [2,4-3H] 17β-dihydroequilin sulfate

    International Nuclear Information System (INIS)

    Bhavnani, B.R.

    1994-01-01

    [2,4- 3 H] 17β-dihydroequilin-3-sulfate ammonium salt suitable for in vivo pharmacokinetic studies was synthesized from [2,4- 3 H] equilin. Sulfation of [2,4- 3 H] equilin with pyridine-chlorosulfonic acid mixture gave in high yields [2,4- 3 H] equilin sulfate, which was then reduced with sodium borohydride to yield [2,4- 3 H] 17β-dihydroequilin sulfate. The reduction was sterospecific and no 17α-reduced products were formed. (author)

  18. People and things. CERN Courier, Apr 1984, v. 24(3)

    Energy Technology Data Exchange (ETDEWEB)

    Anon.

    1984-04-15

    The article reports on achievements of various people, staff changes and position opportunities within the CERN organization and contains news updates on upcoming or past events. The CERN Accelerator School, in collaboration with the Orsay and Saclay Laboratories, is organizing a 'General Accelerator Physics' course at the Ecole Supérieure d'Electricité, Gif-sur-Yvette, France, from 3-14 September.The Scottish Universities Summer School in Physics will be held in St. Andrews from 12 August to 1 September. This is the twenty-seventh school in a series of NATO Advanced Study Institutes organized by the Scottish Universities.From 10-14 September, Geneva University will host the first of a planned biennial series of scientific lectures, sponsored by Dudley Wright. A Conference on the Intersections between Particle and Nuclear Physics' will be held from 23-30 May in Steamboat Springs, Colorado, USA. The meetings will focus on the physics interests of the many diverse groups who work in Particle and/or Nuclear Physics.

  19. 243 Caractérisation floristique et analyse des formes de pression ...

    African Journals Online (AJOL)

    Afrique Sciences

    Résumé. L'objectif de cette étude est d'évaluer les ressources biologiques des forêts sacrées en vue de définir des stratégies pour leur maintien. Le SIG a permis de réaliser la carte de végétation de la forêt qui a servi de base pour la collecte des données floristiques et dendrométriques. La classification hiérarchique des ...

  20. SU-F-T-243: Major Risks in Radiotherapy. A Review Based On Risk Analysis Literature

    International Nuclear Information System (INIS)

    López-Tarjuelo, J; Guasp-Tortajada, M; Iglesias-Montenegro, N; Monasor-Denia, P; Bouché-Babiloni, A; Morillo-Macías, V; Ferrer-Albiach, C

    2016-01-01

    Purpose: We present a literature review of risk analyses in radiotherapy to highlight the most reported risks and facilitate the spread of this valuable information so that professionals can be aware of these major threats before performing their own studies. Methods: We considered studies with at least an estimation of the probability of occurrence of an adverse event (O) and its associated severity (S). They cover external beam radiotherapy, brachytherapy, intraoperative radiotherapy, and stereotactic techniques. We selected only the works containing a detailed ranked series of elements or failure modes and focused on the first fully reported quartile as much. Afterward, we sorted the risk elements according to a regular radiotherapy procedure so that the resulting groups were cited in several works and be ranked in this way. Results: 29 references published between 2007 and February 2016 were studied. Publication trend has been generally rising. The most employed analysis has been the Failure mode and effect analysis (FMEA). Among references, we selected 20 works listing 258 ranked risk elements. They were sorted into 31 groups appearing at least in two different works. 11 groups appeared in at least 5 references and 5 groups did it in 7 or more papers. These last sets of risks where choosing another set of images or plan for planning or treating, errors related with contours, errors in patient positioning for treatment, human mistakes when programming treatments, and planning errors. Conclusion: There is a sufficient amount and variety of references for identifying which failure modes or elements should be addressed in a radiotherapy department before attempting a specific analysis. FMEA prevailed, but other studies such as “risk matrix” or “occurrence × severity” analyses can also lead professionals’ efforts. Risk associated with human actions ranks very high; therefore, they should be automated or at least peer-reviewed.

  1. Electrochemical oxidation of 243Am(III) in nitric acid by a terpyridyl-derivatized electrode

    Energy Technology Data Exchange (ETDEWEB)

    Dares, C. J.; Lapides, A. M.; Mincher, B. J.; Meyer, T. J.

    2015-11-05

    A high surface area, tin-doped indium oxide electrode surface-derivatized with a terpyridine ligand has been applied to the oxidation of trivalent americium to Am(V) and Am(VI) in nitric acid. Potentials as low as 1.8 V vs. the saturated calomel electrode are used, 0.7 V lower than the 2.6 V potential for one-electron oxidation of Am(III) to Am(IV) in 1 M acid. This simple electrochemical procedure provides, for the first time, a method for accessing the higher oxidation states of Am in non-complexing media for developing the coordination chemistries of Am(V) and Am(VI) and, more importantly, for separation of americium from nuclear waste streams.

  2. 243 The Challenges of Theatre Workshop in Katsina-Ala and Oju ...

    African Journals Online (AJOL)

    USER

    primary and secondary methods of carrying out research with interviews, focus ... people working together in order to communicate ideas and also explore social issues to ... affected the effective teaching and learning of Theatre Arts thereby affecting the training of ..... making it different for students to misbehave. Besides, he ...

  3. Mercado/Robb/Buchdahl coefficients: an update of 243 common glasses

    Science.gov (United States)

    Bolser, Michael

    2002-12-01

    The 1983 Mercado/Robb listing of Buchdahl chromatic coordinate coefficients is supplemented with glasses from the Schott and O'Hara catalogues. The coefficients were calculated by using Buchdahl's cubic model. Appropriately selected materials yield a superachromat.

  4. People and things. CERN Courier, Apr 1984, v. 24(3)

    International Nuclear Information System (INIS)

    Anon.

    1984-01-01

    The article reports on achievements of various people, staff changes and position opportunities within the CERN organization and contains news updates on upcoming or past events. The CERN Accelerator School, in collaboration with the Orsay and Saclay Laboratories, is organizing a 'General Accelerator Physics' course at the Ecole Supérieure d'Electricité, Gif-sur-Yvette, France, from 3-14 September.The Scottish Universities Summer School in Physics will be held in St. Andrews from 12 August to 1 September. This is the twenty-seventh school in a series of NATO Advanced Study Institutes organized by the Scottish Universities.From 10-14 September, Geneva University will host the first of a planned biennial series of scientific lectures, sponsored by Dudley Wright. A Conference on the Intersections between Particle and Nuclear Physics' will be held from 23-30 May in Steamboat Springs, Colorado, USA. The meetings will focus on the physics interests of the many diverse groups who work in Particle and/or Nuclear Physics

  5. 30 CFR 250.243 - What general information must accompany the DPP or DOCD?

    Science.gov (United States)

    2010-07-01

    ... characteristics of the produced oil (see definition under 30 CFR 254.6) that you will handle or store at the... definition under § 250.200) you will use to carry out your proposed development and production activities. In... that you expect will have the highest volume of liquid hydrocarbons. Include the estimated flow rate...

  6. Sud du Sahara | Page 243 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Langue English. Read more about Autres modèles de prestation de services publics dans les domaines de la santé, de l'eau et de l'éléctricité (Afrique, Asie, Amérique latine)103828. Langue French. Read more about Alternative Public Service Delivery Models in Health, Water and Electricity (Africa, Asia, Latin America).

  7. [An improved method of preparing protein and peptide probes in mass spectrometry with ionization of division fragments by californium-252 (TOF-PDMS)].

    Science.gov (United States)

    Chivanov, V D; Zubarev, R A; Aksenov, S A; Bordunova, O G; Eremenko, V I; Kabanets, V M; Tatarinova, V I; Mishnev, A K; Kuraev, V V; Knysh, A N; Eremenko, I A

    1996-08-01

    The addition of organic acids (picric, oxalic, citric, or tartaric) to peptide and protein samples was found to significantly increase the yield of their quasi-molecular ions (QMI) in time-of-flight 252Cf plasma desorption mass spectrometry. The yield of the ions depended on the pKa of the acid added.

  8. The development and medical applications of a simple facility for partial body in vivo neutron activation analysis using californium-252 sources

    International Nuclear Information System (INIS)

    Boddy, K.

    1978-11-01

    A simple and cheap facility for partial body neutron activation analysis has been designed, based on the use of two 100 μg 252 Cf neutron sources. The results reported show that calcium can be measured in parts of the body such as the tibia with a precision as good as +- 1.6 % for a radiation dose of 2 rem. The uniformity of the thermal neutron flux density is better than +- 3 % over 10 cm. Some applications of this irradiation facility for studies of trace elements, in particular cadmium in liver and aluminium in liver or brain, have also been explored. However, the sensitivity attainable is not yet sufficient for the study of normal levels, but could be of interest in toxicological investigations

  9. Radiological Characterization Technical Report on Californium-252 Sealed Source Transuranic Debris Waste for the Off-Site Source Recovery Project at Los Alamos National Laboratory

    Energy Technology Data Exchange (ETDEWEB)

    Feldman, Alexander [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2014-04-24

    This document describes the development and approach for the radiological characterization of Cf-252 sealed sources for shipment to the Waste Isolation Pilot Plant. The report combines information on the nuclear material content of each individual source (mass or activity and date of manufacture) with information and data on the radionuclide distributions within the originating nuclear material. This approach allows for complete and accurate characterization of the waste container without the need to take additional measurements. The radionuclide uncertainties, developed from acceptable knowledge (AK) information regarding the source material, are applied to the summed activities in the drum. The AK information used in the characterization of Cf-252 sealed sources has been qualified by the peer review process, which has been reviewed and accepted by the Environmental Protection Agency.

  10. Calculation of neutron and gamma-ray energy spectra in liquid air and liquid nitrogen due to 14-MeV neutron and californium-252 sources

    International Nuclear Information System (INIS)

    Straker, E.A.; Gritzner, M.L.; Harris, L. Jr.

    1978-01-01

    Calculations of neutron and gamma-ray fluences from 14-MeV neutron and 252 Cf sources in liquid air and liquid nitrogen have been performed. These calculations were made specifically for comparison with experimental data measured at Stohl, Federal Republic of Germany. The discrete-ordinates method was utilized with neutron and gamma-ray cross sections from ENDF/B-IV. One-dimensional calculational models were developed for the sources and tank. Limited comparisons are made with experimental data

  11. Measurement and model description of differential neutron spectra of the californium 252 spontaneous fission depending on THETA, Msub(T), Esub(kin sum)

    International Nuclear Information System (INIS)

    Vasil'ev, Yu.A.; Sidorov, L.V.; Vasil'eva, N.K.; Barashkov, Yu.A.; Golovanov, O.A.; Kopalkin, N.V.; Nemudrov, N.I.; Surin, V.M.; Khachaturov, Yu.F.

    1984-01-01

    The results of the 4π-spectrometer mesurement of the neutron spectra in the 26-154 deg angle range for seven groups of fragments with different masses and total kinetic energies are given. Experimental spectra have been analyzed for consistency with the evaporation model of neutrons from moving fragments. The results of an analysis of differential neutron spectra shows that the main reason of the ''yearly'' neutron emission is a neutron evaporation from fragments with large excitation energy and from fragments with neutron number N>82 during the time as compared with the time of fragment acceleration

  12. Efficacy of brachytherapy with californium-252 neutrons versus cesium-137 photons for eradication of bulky localized cervical cancer: single-institution study

    International Nuclear Information System (INIS)

    Maruyama, Y.; van Nagell, J.R.; Yoneda, J.; Donaldson, E.; Gallion, H.; Higgins, R.; Powell, D.; Turner, C.; Kryscio, R.

    1988-01-01

    A fast-neutron-emitting radioisotope, 252 Cf, is being tested in clinical trials of neutron brachytherapy for cervical cancer. The efficacy for histological eradication of bulky stage IB cervical tumors (mean diameter, approximately 6 cm) using combined radiation and surgery was studied in 65 patients treated with 137 Cs or 252 Cf before surgery during 1983-1986. Forty-four patients were treated with 137 Cs and 21 were treated with 252 Cf at equivalent doses of radiation. Fifteen of the 44 specimens (34%) were positive after 137Cs therapy. Only one of the 21 specimens was positive after 252 Cf therapy (P = .025), and that patient was treated in a delayed schedule 21 days after the start of external-beam irradiation rather than early in the course. 252 Cf therapy required a much lower radiation dose and shorter treatment time. The study compared tumor destruction of an identically staged human cervical tumor in situ by direct histological means, using 252 Cf neutron therapy or conventional photon therapy at an identical and equivalent dose adjusted by a relative biological effectiveness of 6.0 for 252 Cf

  13. Accurate determination of Curium and Californium isotopic ratios by inductively coupled plasma quadrupole mass spectrometry (ICP-QMS) in 248Cm samples for transmutation studies

    Energy Technology Data Exchange (ETDEWEB)

    Gourgiotis, A.; Isnard, H.; Aubert, M.; Dupont, E.; AlMahamid, I.; Cassette, P.; Panebianco, S.; Letourneau, A.; Chartier, F.; Tian, G.; Rao, L.; Lukens, W.

    2011-02-01

    The French Atomic Energy Commission has carried out several experiments including the mini-INCA (INcineration of Actinides) project for the study of minor-actinide transmutation processes in high intensity thermal neutron fluxes, in view of proposing solutions to reduce the radiotoxicity of long-lived nuclear wastes. In this context, a Cm sample enriched in {sup 248}Cm ({approx}97 %) was irradiated in thermal neutron flux at the High Flux Reactor (HFR) of the Laue-Langevin Institute (ILL). This work describes a quadrupole ICP-MS (ICP-QMS) analytical procedure for precise and accurate isotopic composition determination of Cm before sample irradiation and of Cm and Cf after sample irradiation. The factors that affect the accuracy and reproducibility of isotopic ratio measurements by ICP-QMS, such as peak centre correction, detector dead time, mass bias, abundance sensitivity and hydrides formation, instrumental background, and memory blank were carefully evaluated and corrected. Uncertainties of the isotopic ratios, taking into account internal precision of isotope ratio measurements, peak tailing, and hydrides formations ranged from 0.3% to 1.3%. This uncertainties range is quite acceptable for the nuclear data to be used in transmutation studies.

  14. SU-E-T-243: Design of a Novel Testing Port for Radiation Protection and Shielding Measurements

    International Nuclear Information System (INIS)

    Tanny, S; Parsai, E; Harrell, D; Noller, J; Chopra, M

    2015-01-01

    Purpose: The majority of radiation shielding research utilizes Monte Carlo simulation because of the difficulty in eliminating secondary radiations from measurements. We have designed a test port into a primary barrier of our newest vault to allow for shielding measurements while ensuring adequate protection to the public and staff during normal machine operation. This port allows for measurement of attenuation values of shielding materials, differential dose albedos, and radiation scatter fractions. Methods: The vault design utilized the maze as part of a compound primary barrier. The test port is contained within the maze and is centered along isocenter. The inner 30 cm has a 20×20 cm 2 opening, while the remaining length has a 30×30 cm 2 opening. The block that contains the port has a density of 200 pcf to minimize internal scatter. The 30×30 cm 2 opening is occupied by removable 215 pcf concrete blocks. The innermost and outermost blocks activate an interlock wired into the beam-enable loop. This disallows beam-on in treatment mode if the interlock isn’t closed. The interlock can be overridden in service mode, or by-passed via an override switch in case of circuit failure. Results: The test port was installed in August. The beam is disabled when the interlock is tripped. Measurements taken when the primary beam is not incident on the port are indistinguishable from background. Ambient dose levels surrounding the vault with the designed shielding blocks in place are all within allowable limits for occupational workers. Conclusions: We have designed and installed a unique testing port for radiation protection and shielding measurements. This port is appropriately interlocked and designed to mitigate any risks of incidental exposure to staff or members of the public. The test port design allows measurements with “good geometry” and efficient removal of contaminating sources of radiation present in many shielding measurements. Daniel Harrell and Jim Noller are employees of Shielding Construction Solutions, Inc, the shielding construction company that built the vault discussed in this abstract. Manjit Chopra is an employee of Universal Minerals International, Inc, the company that provided the aggregates for the high density concretes used in the vault construction

  15. Homeopathy and Isopathy in the periodontal maintenance therapy of aggressive periodontitis patients - doi:10.5020/18061230.2007.p243

    Directory of Open Access Journals (Sweden)

    Edivaldo Barbosa da Silva

    2012-01-01

    Full Text Available Periodontal maintenance care is an essential part of periodontal therapy for patients diagnosed with Aggressive Periodontitis, being, however, hard to instruct and to motivate these patients to follow a careful and effective program of maintenance for all their lives. A literature review was done, by means of relevant papers published on the last four decades, pointing out the importance of individual susceptibility for the appearance of aggressive periodontitis and to discuss the importance of a maintenance therapy on its treatment, applying Homeopathy and Isopathy. Homeopathy consists on a complex therapeutic system mainly based on the “Law of Similarity”, that is, the illness may be healed by drugs that produce similar symptoms in a healthy organism and, in this conception, the disease is understood as an energetic unbalance, in which internal and external factors acting on the subject’s susceptibility are considered and can be expressed by an individual symptomathology that goes from the rational sphere to the somatic sphere. On the other hand, Isopathy is the method of treatment with therapeutic agent, which actions on a healthy subject consist on pharmacodynamic manifestations similar to those observed in a sick person. Based on these concepts, the authors establish a hypothesis of the effectiveness of Homeopathy and Isopathy, the latter through auto-medications or auto-biotherapies, that are products which the active principal is obtained from the patient himself (gingival tissue and secretions, and that may be used as auxiliary treatments in the maintenance therapy of Aggressive Periodontitis.

  16. Chromosome 12q24.3 controls sensitization to cat allergen in patients with asthma from Siberia, Russia

    Czech Academy of Sciences Publication Activity Database

    Gusareva, Elena; Bragina, E.J.; Buinova, S.N.; Chernyak, B.A.; Puzyrev, V.P.; Ogorodova, L.M.; Lipoldová, Marie

    2009-01-01

    Roč. 125, č. 1 (2009), s. 1-6 ISSN 0165-2478 R&D Projects: GA ČR GA310/06/1745; GA MŠk(CZ) LC06009 Grant - others:EC(XE) 05-1000004-7761 Institutional research plan: CEZ:AV0Z50520514 Keywords : IgE * asthma * cat allergens Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.906, year: 2009

  17. Geologic interpretation of seismic data relocation Route 2, Littleton Road grade separation stations 243-252 in Harvard, Mass.

    Science.gov (United States)

    May, James E.; Linehan, Rev. Daniel

    1950-01-01

    During parts of June and July 1949 nine seismic traverses were made at this site. Upon preliminary office development, the velocity data for some of these traverses were though to be inadequate and it was recommended that these lines be re-surveyed. Later surveys (March 1950), however, of nearby sites indicated that the original data were reliable and that a re-survey was unnecessary. The work was done as part of a cooperative program of the Massachusetts Department of Public Works and the United States Geological Survey.

  18. Beliefs and opinions in caregiving of elderly with AIDS: an exploratory study - doi:10.5020/18061230.2010.p243

    Directory of Open Access Journals (Sweden)

    Raquel Farias Diniz

    2012-01-01

    Full Text Available Objective: To explore what informal caregivers of elderly with AIDS think about the disease itself, the infection in elderly people, and about being a caregiver. Methods: A qualitative study in which the thematic content analysis of interviews resulted in the emergence of three categories: “conceptions about AIDS”, “AIDS in old age” and “being a caregiver”. Results: We observed the emergence of issues related to the three aspects, which must be considered in a broader analysis within the patient-caregiver relationship. Such questions involve information about the disease, living with the patient, gender differences and the specificities resulting from the infection at this stage of life. Conclusion: From this study, it is expected that greater attention be given to relationships of care provided by informal network of support to elderly people living with AIDS, in order to foster researches on social, affective, motivational and behavior aspects of caregivers.

  19. Angelman syndrome associated with an inversion of chromosome 15q11.2q24.3

    Energy Technology Data Exchange (ETDEWEB)

    Greger, V.; Knoll, J.H.M.; Wagstaff, J.; Lalande, M. [and others

    1997-03-01

    Angelman syndrome (AS) most frequently results from large ({ge}5 Mb) de novo deletions of chromosome 15q11-q13. The deletions are exclusively of maternal origin, and a few cases of paternal uniparental disomy of chromosome 15 have been reported. The latter finding indicates that AS is caused by the absence of a maternal contribution to the imprinted 15q11-q13 region. Failure to inherit a paternal 15q11-q13 contribution results in the clinically distinct disorder of Prader-Willi syndrome. Cases of AS resulting from translocations or pericentric inversions have been observed to be associated with deletions, and there have been no confirmed reports of balanced rearrangements in AS. We report the first such case involving a paracentric inversion with a breakpoint located {approximately}25 kb proximal to the reference marker D15S10. This inversion has been inherited from a phenotypically normal mother. No deletion is evident by molecular analysis in this case, by use of cloned fragments mapped to within {approximately}1 kb of the inversion breakpoint. Several hypotheses are discussed to explain the relationship between the inversion and the AS phenotype. 47 refs., 3 figs.

  20. 75 FR 60655 - Airworthiness Directives; Airbus Model A330-201, -202, -203, -223, and -243 Airplanes; Airbus...

    Science.gov (United States)

    2010-10-01

    ... time during which fuel tanks are exposed to flammable conditions is one of these criteria. The other... flammable fuel vapors, could result in fuel tank explosions and consequent loss of the airplane. [[Page... information and, in general, agree with their substance. But we might have found it necessary to use different...

  1. Fission Meter Information Barrier Attribute Measurement System - NA-243 FNI/UKC FY2017 Task 1-2 Report

    Energy Technology Data Exchange (ETDEWEB)

    Kerr, P. L. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Decman, D. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Prasad, M. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Castro, P. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

    2018-01-03

    An SNM attribute Information Barrier (IB) system was developed for a 2011 US/UK Exercise. The system was modified and extensively tested in a 2013-2014 US-UK Measurement Campaign. This work demonstrated rapid deployment of an IB system for potential treaty use. The system utilizes an Ortec Fission Meter neutron multiplicity counter and custom computer code. The system demonstrates a proof-of-principle automated Pu-240 mass determination with an information barrier. After a software start command is issued, the system automatically acquires and downloads data, performs an analysis, and displays the results. This system conveys the results of a Pu mass threshold measurements in a way the does not reveal sensitive information. In full IB mode, only the pass/fail result is displayed as a “Mass <= Threshold Amount” or “Mass >= Threshold Amount” as shown in Figure 4. This can easily be adapted to a red/green “lights” display similar to the Detective IB system for Pu isotopics as shown in Figure 6. In test mode, more detailed information is displayed. The code can also read in, analyze, and display results from previously acquired or simulated data. Because the equipment is commercial-off-the-shelf (COTS), the system demonstrates a low-cost short-lead-time technology for treaty SNM attribute measurements. A deployed system will likely require integration of additional authentication and tamper-indicating technologies. This will be discussed for the project in this and future progress reports.

  2. Transuranium Processing Plant semiannual report of production, status, and plans for period ending December 31, 1976

    International Nuclear Information System (INIS)

    King, L.J.; Bigelow, J.E.; Collins, E.D.

    1977-10-01

    During the period July 1, 1976, through December 31, 1976, transuranium elements were obtained from 11 irradiated HFIR targets; products recovered are 0.3 g 243 Am, 16.6 g 244 Cm, 23 g 249 Bk, 211 g 252 Cf, 1.15 mg 253 Es, and 0.4 pg 247 Fm. Two batches of high-purity 248 Cm were purified chemically for shipment, and another batch containing about 62 mg of 248 Cm was separated from 252 Cf. Thirty shipments were made from TRU during the period; recipients and the amounts of nuclides are listed in tabular form. Nine HFIR targets, each containing 8 to 9 g of curium, were fabricated. The sequence of chemical processing steps used to purify the californium product was changed; this change yielded a shorter recovery time for high-purity 253 Es, which enabled a 50% increase in the amount obtained. Eight neutron sources were fabricated during this report period, bringing the total fabricated to date to 92. Three sources that had previously been returned to TRU were reassigned; two others are also available for reassignment. The values currently being used for transuranium element decay data and for cross-section data in planning irradiation-processing cycles, calculating production forecasts, and assaying products are tabulated in the Appendix

  3. Transuranium Processing Plant semiannual report of production, status, and plans for period ending June 30, 1975

    Energy Technology Data Exchange (ETDEWEB)

    King, L.J.; Bigelow, J.E.; Collins, E.D.

    1976-03-01

    During the period January 1, 1975, through June 30, 1975, the following amounts of transuranium elements were recovered from 22 irradiated HFIR targets: 2g /sup 243/Am, 59 g /sup 244/Cm, 51 mg /sup 249/Bk, 465 mg /sup 252/Cf, 2.5 mg /sup 253/Es, and 1.4 pg /sup 257/Fm. In addition, 45 mg of high-purity /sup 248/Cm was operated from /sup 252/Cf which had been recovered and purified during earlier periods, and 56 mg of a lower-quality /sup 248/Cm was separated from californium purification rework solutions. Five HFIR targets, each containing approximately 9 g of actinides (predominantly curium), were fabricated. A new long-term projection showed that /sup 252/Cf production in the TRU-HFIR complex could increase to as much as 2.5 g/year. During the next 18 months, we expect to recover totals of 46 mg of /sup 249/Bk, 520 mg of /sup 252/Cf, 2.0 mg of /sup 253/Es (in a mixture of isotopes), 220 ..mu..g of high-purity /sup 253/Es, and 1.6 pg of /sup 257/Fm. We also expect to obtain 125 mg of high-purity /sup 248/Cm from purified californium now in storage. There are no plans to process any of the remaining SRP Pu-Al tubes or to irradiate any plutonium targets in the HFIR; thus, we do not expect to recover any /sup 244/Pu. No changes were made in the chemical processing flowsheets normally used at TRU. Two neutron sources were fabricated, bringing the total fabricated to 77. In special projects, we (1) produced about 1 mg of /sup 250/Cf by irradiation of /sup 249/Bk in HFIR rabbits, and (2) processed some irradiated /sup 248/Cm samples and obtained yield and isotopic composition data for use in determining the capture cross section of /sup 249/Cm in the HFIR. The values that are currently being used for transuranium element decay data and for cross-section data in planning irradiation-processing cycles, calculating production forecasts, and assaying products are tabulated in the Appendix.

  4. Transuranium Processing Plant semiannual report of production, status, and plans for period ending June 30, 1975

    International Nuclear Information System (INIS)

    King, L.J.; Bigelow, J.E.; Collins, E.D.

    1976-03-01

    During the period January 1, 1975, through June 30, 1975, the following amounts of transuranium elements were recovered from 22 irradiated HFIR targets: 2g 243 Am, 59 g 244 Cm, 51 mg 249 Bk, 465 mg 252 Cf, 2.5 mg 253 Es, and 1.4 pg 257 Fm. In addition, 45 mg of high-purity 248 Cm was operated from 252 Cf which had been recovered and purified during earlier periods, and 56 mg of a lower-quality 248 Cm was separated from californium purification rework solutions. Five HFIR targets, each containing approximately 9 g of actinides (predominantly curium), were fabricated. A new long-term projection showed that 252 Cf production in the TRU-HFIR complex could increase to as much as 2.5 g/year. During the next 18 months, we expect to recover totals of 46 mg of 249 Bk, 520 mg of 252 Cf, 2.0 mg of 253 Es (in a mixture of isotopes), 220 μg of high-purity 253 Es, and 1.6 pg of 257 Fm. We also expect to obtain 125 mg of high-purity 248 Cm from purified californium now in storage. There are no plans to process any of the remaining SRP Pu-Al tubes or to irradiate any plutonium targets in the HFIR; thus, we do not expect to recover any 244 Pu. Two neutron sources were fabricated, bringing the total fabricated to 77. Two sources that had been used previously in various projects were returned to the TRU inventory and are available for reassignment. In special projects, we (1) produced about 1 mg of 250 Cf by irradiation of 249 Bk in HFIR rabbits, and (2) processed some irradiated 248 Cm samples and obtained yield and isotopic composition data for use in determining the capture cross section of 249 Cm in the HFIR. The values that are currently being used for transuranium element decay data and for cross-section data in planning irradiation-processing cycles, calculating production forecasts, and assaying products are tabulated in the Appendix

  5. Freeze drying method for preparing radiation source material

    International Nuclear Information System (INIS)

    Mosley, W.C.; Smith, P.K.

    1976-01-01

    Fabrication of a neutron source is specifically claimed. A palladium/californium solution is freeze dried to form a powder which, through conventional powder metallurgy, is shaped into a source containing the californium evenly distributed through a palladium metal matrix. (E.C.B.)

  6. Characteristics of Private Schools in the United States: Results from the 2013-14 Private School Universe Survey. First Look. NCES 2016-243

    Science.gov (United States)

    Broughman, Stephen P.; Swaim, Nancy L.

    2016-01-01

    In 1988, the National Center for Education Statistics (NCES) developed a private school data collection that improved on the sporadic collection of private school data dating back to 1890 and at the same time developed an alternative to commercially available private school sampling frames. Since 1989, the U.S. Bureau of the Census has conducted…

  7. Benjamin Fondane notebooks. Benjamin Fondane facing the History. About the Existential Monday. The Poem time, no. 14/2011, Editions Kedem, Tel Aviv, 243 p.

    Directory of Open Access Journals (Sweden)

    Speranţa Sofia MILANCOVICI

    2011-01-01

    Full Text Available Luna august reprezintă, pentru membrii sau colaboratorii Socièté d’Etudes Benjamin Fondane, momentul întâlnirii ştiinţifice anuale sub genericul Rencontres de Peyresq. Fiecare astfel de reuniune este succedată de apariţia unui volum critic realizat cu sprijinul Centre National du Livre – France. Este vorba despre seria deja cunoscutelor, în bibliografia de specialitate, Cahiers Benjamin Fondane.Volumul recent apărut poartă titlul Benjamin Fondane devant l’Histoire. Autour du Lundi existentiel. Au temps du Poème şi este cel de al paisprezecelea număr din seria caietelor.În îngrijirea energicei şi competentei preşedinte a Société d’Etudes Benjamin Fondane, prof. dr. Monique Jutrin, volumul propune spre lectură cercetătorilor de specialitate un corpus de eseuri critice grupate pe secţiuni: editorial, filosofie, poezie, opera în limba română a lui Benjamin Fundoianu, bibliografie de specialitate etc.

  8. SCRIB and PUF60 are primary drivers of the multisystemic phenotypes of the 8q24.3 copy-number variant

    DEFF Research Database (Denmark)

    Dauber, Andrew; Golzio, Christelle; Guenot, Cécile

    2013-01-01

    phenotype, and the combinatorial suppression of both genes exacerbated some, but not all, phenotypic components. Consistent with these findings, we identified an individual with microcephaly, short stature, intellectual disability, and heart defects with a de novo c.505C>T variant leading to a p.His169Tyr...... genetic disease and demonstrate how CNVs can exhibit complex genetic architecture, with the phenotype being the amalgam of both discrete dosage dysfunction of single transcripts and also of binary genetic interactions....

  9. OPTICAL VARIABILITY OF THE ACCRETION DISK AROUND THE INTERMEDIATE-MASS BLACK HOLE ESO 243-49 HLX-1 DURING THE 2012 OUTBURST

    Energy Technology Data Exchange (ETDEWEB)

    Webb, N. A.; Godet, O.; Barret, D. [Université de Toulouse, UPS-OMP, IRAP, Toulouse (France); Wiersema, K. [University of Leicester, University Road, Leicester LE1 7RH (United Kingdom); Lasota, J.-P. [Institut d' Astrophysique de Paris, UMR 7095, CNRS, UPMC Université Paris 06, 98bis Boulevard Arago, F-75014 Paris (France); Farrell, S. A. [Sydney Institute for Astronomy, School of Physics, The University of Sydney, NSW 2006 (Australia); Maccarone, T. J. [Department of Physics, Box 41051, Texas Tech University, Lubbock TX 79409-1051 (United States); Servillat, M., E-mail: natalie.webb@irap.omp.eu [Laboratoire AIM (CEA/DSM/IRFU/SAp, CNRS, Université Paris Diderot), CEA Saclay, Bat. 709, F-91191 Gif-sur-Yvette (France)

    2014-01-01

    We present dedicated quasi-simultaneous X-ray (Swift) and optical (Very Large Telescope, V-, and R-band) observations of the intermediate-mass black hole candidate HLX-1 before and during the 2012 outburst. We show that the V-band magnitudes vary with time, thus proving that a portion of the observed emission originates in the accretion disk. Using the first quiescent optical observations of HLX-1, we show that the stellar population surrounding HLX-1 is fainter than V ∼ 25.1 and R ∼ 24.2. We show that the optical emission may increase before the X-ray emission consistent with the scenario proposed by Lasota et al. in which the regular outbursts could be related to the passage at periastron of a star circling the intermediate-mass black hole in an eccentric orbit, which triggers mass transfer into a quasi-permanent accretion disk around the black hole. Further, if there is indeed a delay in the X-ray emission we estimate the mass-transfer delivery radius to be ∼10{sup 11} cm.

  10. A comprehensive study of fission in 24.3 MeV/nucleon U reactions induced on C, Si, Ni, Au targets

    International Nuclear Information System (INIS)

    Piasecki, E.; Pienkowski, L.; Czosnyka, T.; Iwanicki, J.; Muchorowska, M.; Tucholski, A.; Czarnacki, W.; Chbihi, A.; Galin, J.; Crema, E.; Sao Paulo Univ., SP

    1995-01-01

    Fission is a powerful tool for studying the primary reaction mechanisms in nucleus-nucleus collisions involving at least one fissionable nucleus. This is well shown when an additional information on the violence of the collision is provided by a totally independent observable such as the neutron multiplicity. The mass asymmetry in the entrance channel and the impact parameter are shown to have a decisive influence on the fate of the collision leading to either fusion or a two-body deeply inelastic reaction, analogous to what is known at lower bombarding energies. The experimental approach allows also to single out electromagnetic fission of U after interaction with Au and to provide some characteristics of such a process. (author)

  11. A Rare Interstitial Duplication of 8q22.1–8q24.3 Associated with Syndromic Bilateral Cleft Lip/Palate

    Directory of Open Access Journals (Sweden)

    Regina Ferreira Rezek

    2014-01-01

    Full Text Available We present a rare case of 8q interstitial duplication derived from maternal balanced translocations in a patient with bilateral cleft lip and palate in syndromic form associated with other congenital malformations. G-banding cytogenetic analysis revealed a chromosomal abnormality in the form of the karyotype 46,XX der(22t(8;22(q22.1;p11.1mat. Chromosome microarray analysis evidenced a 49 Mb duplicated segment of chromosome 8q with no pathogenic imbalances on chromosome 22. Two siblings also carry the balanced translocation. We have compared this case with other “pure” trisomies of 8q patients reported in the literature and with genome wide association studies recently published. This work highlights the involvement of chromosome 8q in orofacial clefts.

  12. The synthesis of 7-chloro-5-pentadeuteriophenyl-1-methyl-1H-1, 5-benzodiazepine-2,4(3H, 5H)dione ([2H5]clobazam)

    International Nuclear Information System (INIS)

    Borel, A.G.; Abbott, F.S.

    1990-01-01

    Pentadeuteriophenyl clobazam was synthesized in essentially quantitative isotopic purity, and characterized by 1 H-NMR and mass spectroscopy. The title compound was found to be >98% pure by HPLC, and its retention time (t R 6.17 min) was less than that of an authentic clobazam standard (t R 6.32 min). Of the five steps in the synthesis of clobazam, the most susceptible to deuterium exchange was the nucleophilic substitution of 2,4-dichloronitrobenzene by aniline-d 7 to form N-(5-chloro-2-nitrophenyl)penta-deuteriophenylamine. In this step, the isotopic impurity aniline-2,3,4,5-d 5 introduced protons from nitrogen into the ortho and para positions of the deuteriophenyl ring of N-(5-chloro-2-nitrophenyl)pentadeuteriophenylamine. (author)

  13. Intellectual disability, muscle weakness and characteristic face in three siblings: A newly described recessive syndrome mapping to 3p24.3-p25.3

    NARCIS (Netherlands)

    Kariminejad, Ariana; Nafissi, Shahriar; Nilipoor, Yalda; Tavasoli, Alireza; van Veldhoven, Paul P.; Bonnard, Carine; Ng, Yeng Ting; Majoie, Charles B.; Reversade, Bruno; Hennekam, Raoul C.

    2015-01-01

    We report on a sister and two brothers born to healthy Iranian parents with mild intellectual disability, progressive muscle weakness, and characteristic facies. including highly arched eyebrows, down-slanting palpebral fissures, prominent nasal bridge, prominent nose, columella extending below alae

  14. Determinant factors of cardiorespiratory fitness in Portuguese adolescents of different ethnicities. DOI: 10.5007/1980-0037.2011v13n4p243

    Directory of Open Access Journals (Sweden)

    Diana Aguiar Santos

    2011-08-01

    Full Text Available Cardiorespiratory fitness is an important health indicator in young people. The aim of this study was to investigate the effects of age, gender, body adiposity, and ethnicity on cardiorespiratory fitness in a sample of Portuguese adolescents. The sample consisted of 266 adolescents aged 12-18 years [112 boys (80 Caucasians and 32 African-Portuguese, AP and 154 girls (109 Caucasians and 45 AP]. Percent body fat was estimated with a hand-to-hand bioelectrical impedance device (BF300, OMROM. Cardiorespiratory fitness was assessed by a shuttle run test (Fitnessgram battery. Multiple regression models were used for statistical analysis. The results showed that girls presented lower maximal oxygen consumption and higher percent body fat than boys. Cardiorespiratory fitness was lower in Caucasian than in AP girls. Multiple regression analysis showed that percent body fat, age and the interaction of age with being Caucasian and age with female gender were significant determinants that were negatively associated with cardiorespiratory fitness. The results suggest that maximal oxygen consumption is lower in adolescents with higher adiposity and in older adolescents. The findings highlight the importance of promoting physical fitness in schools across ages, especially in older adolescents, adjusting for determinant factors such as gender and ethnicity

  15. Comment on ”John’s stone: A possible fragment of the 1908 Tunguska meteorite” (Anfinogenov et al., 2014, Icarus 243, 139-147)

    DEFF Research Database (Denmark)

    Haack, Henning; Greenwood, Richard; Busemann, Henner

    2016-01-01

    et al. However, since sandstones can only form on a parent body with liquid water and by inference, also an atmosphere, we argue that there are only two possible parent bodies in the Solar System: the Earth and Mars. Mars can be ruled out for several reasons, including the oxygen isotopic and noble...... gas composition of John’s stone, which is clearly distinct from martian meteorites. Consistent with the O study, the noble gases do not provide any evidence for an extraterrestrial origin of the samples. The lack of any cosmogenic noble gases (particularly striking in 3He, 21Ne, 38Ar) is consistent...... with a terrestrial origin or an extraterrestrial origin under large shielding. Based on the combined evidence obtained in this study we infer that John’s stone is a terrestrial rock unrelated to the Tunguska impactor....

  16. 30 CFR 243.7 - What must a person do when posting a bond or other surety instrument or demonstrating financial...

    Science.gov (United States)

    2010-07-01

    ...(a), or any other theory, as a defense if MMS calls your bond or requires you to pay based on your... 30 Mineral Resources 2 2010-07-01 2010-07-01 false What must a person do when posting a bond or....7 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR MINERALS REVENUE...

  17. Synthesis of 24S and 24R-hydroxy-[24-3H] vitamin D3 and their metabolism in rachitic rats

    International Nuclear Information System (INIS)

    Tanaka, Y.; DeLuca, H.F.; Akaiwa, A.; Morisaki, M.; Ikekawa, N.

    1976-01-01

    An epimeric mixture of 24-hydroxy-[24- 3 H] vitamin D 3 was synthesized by the reduction of 24-ketovitamin D 3 by sodium borotritide. The epimeric mixture was converted to the trimethylsilylether derivatives and subjected to high-pressure liquid chromatography using silica gel columns to separate the 24-hydroxy-[24- 3 H] vitamin D 3 isomers. The 24R-hydroxy-[24- 3 H]vitamin D 3 induced calcification in rachitic rats while the 24S-hydroxy-[24- 3 H]vitamin D 3 had little or no such activity. As both isomers of 24-hydroxy-vitamin D 3 are metabolized to 24,25-dihydroxyvitamin D 3 , it appears that the 24-hydroxyvitamin D 3 -25-hydroxylase does not discriminate between the isomers. Only the R-isomer of 24-hydroxyvitamin D 3 is metabolized to 1,24-dihydroxyvitamin D 3 , although only trace amounts of this compound were found 2 days after the administration of 24-hydroxyvitamin D 3 . The striking difference in the metabolism of the isomers is the high selectivity of the 1-hydroxylase for the R-isomer. It is suggested that the high specificity of biological activity for the R-isomer of 24-hydroxyvitamin D 3 is because of the specificity of the 1-hydroxylation of 24,25-dihydroxyvitamin D 3 for the R configuration

  18. Konference o srovnávacím výzkumu bydlení, Delft, Nizozemsko, 24.3. – 25.3. 2010

    Czech Academy of Sciences Publication Activity Database

    Sládek, Jan

    2010-01-01

    Roč. 8, č. 5 (2010), s. 9 ISSN 1214-1720 R&D Projects: GA ČR GA403/09/1915 Institutional research plan: CEZ:AV0Z70280505 Keywords : methodology * city * theory Subject RIV: AO - Sociology, Demography http://www.socioweb.cz/upl/editorial/download/179_soc.web._05-2010%20final!.pdf

  19. 49 CFR 40.243 - What is the procedure for an alcohol screening test using an EBT or non-evidential breath ASD?

    Science.gov (United States)

    2010-10-01

    ...-evidential breath ASD? As the BAT or STT, you must take the following steps: (a) Select, or allow the... individually wrapped or sealed mouthpiece in view of the employee and insert it into the device in accordance... the mouthpiece for at least six seconds or until the device indicates that an adequate amount of...

  20. 76 FR 24832 - Airworthiness Directives; Airbus Model A330-201, -202, -203, -223, and -243 Airplanes, A330-300...

    Science.gov (United States)

    2011-05-03

    ... include vacuum loss and elasticity laminate checker inspections for damage including de-bonding between... exist or develop on other products of the same type design. Differences Between This AD and the MCAI or... elasticity laminate checker inspection on the trailing edge area (Area 2) for damage including de-bonding...

  1. SU-E-T-243: MonteCarlo Simulation Study of Polymer and Radiochromic Gel for Three-Dimensional Proton Dose Distribution

    International Nuclear Information System (INIS)

    Park, M; Jung, H; Kim, G; Ji, Y; Kim, K; Park, S

    2014-01-01

    Purpose: To estimate the three dimensional dose distributions in a polymer gel and a radiochromic gel by comparing with the virtual water phantom exposed to proton beams by applying Monte Carlo simulation. Methods: The polymer gel dosimeter is the compositeness material of gelatin, methacrylic acid, hydroquinone, tetrakis, and distilled water. The radiochromic gel is PRESAGE product. The densities of polymer and radiochromic gel were 1.040 and 1.0005 g/cm3, respectively. The shape of water phantom was a hexahedron with the size of 13 × 13 × 15 cm3. The proton beam energies of 72 and 116 MeV were used in the simulation. Proton beam was directed to the top of the phantom with Z-axis and the shape of beam was quadrangle with 10 × 10 cm2 dimension. The Percent depth dose and the dose distribution were evaluated for estimating the dose distribution of proton particle in two gel dosimeters, and compared with the virtual water phantom. Results: The Bragg-peak for proton particles in two gel dosimeters was similar to the virtual water phantom. Bragg-peak regions of polymer gel, radiochromic gel, and virtual water phantom were represented in the identical region (4.3 cm) for 72 MeV proton beam. For 116 MeV proton beam, the Bragg-peak regions of polymer gel, radiochromic gel, and virtual water phantom were represented in 9.9, 9.9 and 9.7 cm, respectively. The dose distribution of proton particles in polymer gel, radiochromic gel, and virtual water phantom was approximately identical in the case of 72 and 116 MeV energies. The errors for the simulation were under 10%. Conclusion: This work indicates the evaluation of three dimensional dose distributions by exposing proton particles to polymer and radiochromic gel dosimeter by comparing with the water phantom. The polymer gel and the radiochromic gel dosimeter show similar dose distributions for the proton beams

  2. Decree 243/994 National Direction of Especial Subjects it create and will operate in the orbit of the External Relation Ministere

    International Nuclear Information System (INIS)

    1994-01-01

    Creates in the Ministry of External Relationships the Direction of Special Matters, to which concerns to study, to coordinate and to execute in the pertinent thing, the foreign policy of the Republic in the related with Nuclear Energy, Dismantle, human rights and Humanitarian Right, Population, Migration and Refugees, Drug traffic, Terrorism, Space Right and all those topics of political character that require to be considered in form separated by their special characteristic . The Direction of Special Political Matters in opinion of the Ministry of External Relationships will depend directly on the General Direction for Political Matters [es

  3. Decree 243/994 National Direction of Especial Subjects it create and will operate in the orbit of the External Relation Ministere; Decreto 243/994 Direccion de Asuntos Especiales crease y funcionara en la orbita del Ministerio de Relaciones Exteriores

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1994-06-10

    Creates in the Ministry of External Relationships the Direction of Special Matters, to which concerns to study, to coordinate and to execute in the pertinent thing, the foreign policy of the Republic in the related with Nuclear Energy, Dismantle, human rights and Humanitarian Right, Population, Migration and Refugees, Drug traffic, Terrorism, Space Right and all those topics of political character that require to be considered in form separated by their special characteristic . The Direction of Special Political Matters in opinion of the Ministry of External Relationships will depend directly on the General Direction for Political Matters. [Spanish] Crease en el Ministerio de Relaciones Exteriores la Direccion de Asuntos Especiales, a la que compete estudiar, coordinar y ejecutar en lo pertinente, la politica exterior de la Republica en lo relacionado con Energia Nuclear, Desarme, Derechos Humanos y Derecho Humanitario, Poblacion, Migracion y Refugiados, Narcotrafico, Terrorismo, Derecho Espacial y todos aquellos temas de caracter politico que a juicio del Ministerio de Relaciones Exteriores requieran ser considerados en forma separada por sus caracteristicas especiales.La Direccion de Asuntos Politicos Especiales dependera directamente de la Direccion General para Asuntos Politicos.

  4. Radionuclides in rodents

    International Nuclear Information System (INIS)

    Taylor, G.N.

    1985-01-01

    Studies are being conducted in mice comparing the toxicity of radium-226, plutonium-239, americium-241, californium-249 and californium-252 in C57B1/Do (albino) mice and the toxicity of americium-241, plutonium-239 and radium-226 in deer mice (Peromyscus maniculatus) and grasshopper mice (Onychomys leucogaster). These experiments will ultimately enable comparison of the toxicity of the above actinide toxicity in man to be made using radium toxicity as the baseline

  5. Trends in radioisotope development and utilization in the United States

    Energy Technology Data Exchange (ETDEWEB)

    Mott, W E [Energy Research and Development Administration, Washington, D.C. (USA)

    1976-06-01

    The current trends in radioisotope and radiation technology in the United States are overviewed with emphasis on the developments since the 1973 Conference. The comments focus primarily on the research and development activities receiving the most attention today from the various agencies of the Government. Among the many available radionuclides, technetium-99m has played the single most important role for making possible the developments in the field of nuclear medicine. Many other short lived medium-lived nuclides are applied in the fields of nuclear medicine, cardiac pacemaker, artificial heart, and blood irradiator. Radiation processing is now firmly established in the United States. The trends in sewage treatment, polymer-impregnated materials, bioengineering, and food irradiation are reviewed. The programs for californium-252, strontium-90, cesium-137, plutonium-238, and krypton-85 are also reviewed. The author concludes this paper with the acknowledgement that Japanese researchers have contributed to and have been closely involved in many of the programs discussed. Of particular note is the participation in the clinical phase of the californium-252 radiotherapy program. Several Japanese hospitals have been cooperating with the United States since the very beginning of the californium-252 program in determining the value of the californium-252 neutron therapy. The research being performed is unique, and will contribute greatly to the decisions on the ultimate future of californium-252 for therapeutic purposes.

  6. VLBI observations of the quasars CTD20 (0234+285), OJ248 (0827+243), and 4C19.44 (1354+195), and the millimeter-x-ray connection

    International Nuclear Information System (INIS)

    Marscher, A.P.; Broderick, J.J.

    1983-01-01

    We have obtained limited VLBI data on the quasars CTD20, OJ248, and 4C19.44 at 2.8 cm. CTD20 was also observed at 6 and 18 cm. All three sources contain multicomponent structure, and rather large fractions of the 2.8-cm flux densities arise in unresolved regions. All of the radio flux density of CTD20 originates in compact components. 4C19.44 is dominated at low frequencies by a steep-spectrum component which exceeds about 7 mas in size. Above 2 GHz the spectrum is flat and variable owing to several compact components. CTD20 and OJ248 belong to a sample of millimeter-excess quasars which were shown by Owen, Helfand, and Spangler to have highly predictable ratios of 90 GHz to 2-keV flux densities. A self-Compton explanation of this relationship is supported by the existence of unresolved radio components. However, the rapid 90-GHz variability of OJ248 and other quasars with strong millimeter emission should destroy the observed tight correlation except under special circumstances. A synchrotron origin of the radio-to-x-ray emission requires that any variations in the radio should be time delayed relative to the x ray

  7. The synthesis of 7-chloro-5-pentadeuteriophenyl-1-methyl-1H-1, 5-benzodiazepine-2,4(3H, 5H)dione (( sup 2 H sub 5 )clobazam)

    Energy Technology Data Exchange (ETDEWEB)

    Borel, A.G.; Abbott, F.S. (British Columbia Univ., Vancouver, BC (Canada). Dept. of Pharmaceutical Sciences)

    1990-07-01

    Pentadeuteriophenyl clobazam was synthesized in essentially quantitative isotopic purity, and characterized by {sup 1}H-NMR and mass spectroscopy. The title compound was found to be >98% pure by HPLC, and its retention time (t{sub R} 6.17 min) was less than that of an authentic clobazam standard (t{sub R} 6.32 min). Of the five steps in the synthesis of clobazam, the most susceptible to deuterium exchange was the nucleophilic substitution of 2,4-dichloronitrobenzene by aniline-d{sub 7} to form N-(5-chloro-2-nitrophenyl)penta-deuteriophenylamine. In this step, the isotopic impurity aniline-2,3,4,5-d{sub 5} introduced protons from nitrogen into the ortho and para positions of the deuteriophenyl ring of N-(5-chloro-2-nitrophenyl)pentadeuteriophenylamine. (author).

  8. Frequency band analysis of muscle activation during cycling to exhaustion.DOI: http://dx.doi.org/10.5007/1980-0037.2012v14n3p243

    Directory of Open Access Journals (Sweden)

    Marco Aurélio Vaz

    2012-05-01

    Full Text Available Lower limb muscles activation was assessed during cycling to exhaustion using frequency band analysis. Nine cyclists were evaluated in two days. On the first day, cyclists performed a maximal incremental cycling exercise to measure peak power output, which was used on the second day to define the workload for a constant load time to exhaustion cycling exercise (maximal aerobic power output from day 1. Muscle activation of vastus lateralis (VL, long head of biceps femoris (BF, lateral head of gastrocnemius (GL, and tibialis anterior (TA from the right lower limb was recorded during the time to exhaustion cycling exercise. A series of nine band-pass Butterworth digital filters was used to analyze muscle activity amplitude for each band. The overall amplitude of activation and the high and low frequency components were defined to assess the magnitude of fatigue effects on muscle activity via effect sizes. The profile of the overall muscle activation during the test was analyzed using a second order polynomial, and the variability of the overall bands was analyzed by the coefficient of variation for each muscle in each instant of the test. Substantial reduction in the high frequency components of VL and BF activation was observed. The overall and low frequency bands presented trivial to small changes for all muscles. High relationship between the second order polynomial fitting and muscle activity was found (R2 > 0.89 for all muscles. High variability (~25% was found for muscle activation at the four instants of the fatigue test. Changes in the spectral properties of the EMG signal were only substantial when extreme changes in fatigue state were induced.

  9. SU-E-J-243: Possibility of Exposure Dose Reduction of Cone-Beam Computed Tomography in An Image Guided Patient Positioning System by Using Various Noise Suppression Filters

    International Nuclear Information System (INIS)

    Kamezawa, H; Arimura, H; Ohki, M; Shirieda, K; Kameda, N

    2014-01-01

    Purpose: To investigate the possibility of exposure dose reduction of the cone-beam computed tomography (CBCT) in an image guided patient positioning system by using 6 noise suppression filters. Methods: First, a reference dose (RD) and low-dose (LD)-CBCT (X-ray volume imaging system, Elekta Co.) images were acquired with a reference dose of 86.2 mGy (weighted CT dose index: CTDIw) and various low doses of 1.4 to 43.1 mGy, respectively. Second, an automated rigid registration for three axes was performed for estimating setup errors between a planning CT image and the LD-CBCT images, which were processed by 6 noise suppression filters, i.e., averaging filter (AF), median filter (MF), Gaussian filter (GF), bilateral filter (BF), edge preserving smoothing filter (EPF) and adaptive partial median filter (AMF). Third, residual errors representing the patient positioning accuracy were calculated as an Euclidean distance between the setup error vectors estimated using the LD-CBCT image and RD-CBCT image. Finally, the relationships between the residual error and CTDIw were obtained for 6 noise suppression filters, and then the CTDIw for LD-CBCT images processed by the noise suppression filters were measured at the same residual error, which was obtained with the RD-CBCT. This approach was applied to an anthropomorphic pelvic phantom and two cancer patients. Results: For the phantom, the exposure dose could be reduced from 61% (GF) to 78% (AMF) by applying the noise suppression filters to the CBCT images. The exposure dose in a prostate cancer case could be reduced from 8% (AF) to 61% (AMF), and the exposure dose in a lung cancer case could be reduced from 9% (AF) to 37% (AMF). Conclusion: Using noise suppression filters, particularly an adaptive partial median filter, could be feasible to decrease the additional exposure dose to patients in image guided patient positioning systems

  10. SU-E-J-243: Possibility of Exposure Dose Reduction of Cone-Beam Computed Tomography in An Image Guided Patient Positioning System by Using Various Noise Suppression Filters

    Energy Technology Data Exchange (ETDEWEB)

    Kamezawa, H [Graduate School of Medical Sciences, Kyushu University, Higashi-ku, Fukuoka (Japan); Fujimoto General Hospital, Miyakonojo, Miyazaki (Japan); Arimura, H; Ohki, M [Faculty of Medical Sciences, Kyushu University, Higashi-ku, Fukuoka (Japan); Shirieda, K; Kameda, N [Fujimoto General Hospital, Miyakonojo, Miyazaki (Japan)

    2014-06-01

    Purpose: To investigate the possibility of exposure dose reduction of the cone-beam computed tomography (CBCT) in an image guided patient positioning system by using 6 noise suppression filters. Methods: First, a reference dose (RD) and low-dose (LD)-CBCT (X-ray volume imaging system, Elekta Co.) images were acquired with a reference dose of 86.2 mGy (weighted CT dose index: CTDIw) and various low doses of 1.4 to 43.1 mGy, respectively. Second, an automated rigid registration for three axes was performed for estimating setup errors between a planning CT image and the LD-CBCT images, which were processed by 6 noise suppression filters, i.e., averaging filter (AF), median filter (MF), Gaussian filter (GF), bilateral filter (BF), edge preserving smoothing filter (EPF) and adaptive partial median filter (AMF). Third, residual errors representing the patient positioning accuracy were calculated as an Euclidean distance between the setup error vectors estimated using the LD-CBCT image and RD-CBCT image. Finally, the relationships between the residual error and CTDIw were obtained for 6 noise suppression filters, and then the CTDIw for LD-CBCT images processed by the noise suppression filters were measured at the same residual error, which was obtained with the RD-CBCT. This approach was applied to an anthropomorphic pelvic phantom and two cancer patients. Results: For the phantom, the exposure dose could be reduced from 61% (GF) to 78% (AMF) by applying the noise suppression filters to the CBCT images. The exposure dose in a prostate cancer case could be reduced from 8% (AF) to 61% (AMF), and the exposure dose in a lung cancer case could be reduced from 9% (AF) to 37% (AMF). Conclusion: Using noise suppression filters, particularly an adaptive partial median filter, could be feasible to decrease the additional exposure dose to patients in image guided patient positioning systems.

  11. Minerals and Trace Elements in Milk, Milk Products, Infant Formula, and Adult/Pediatric Nutritional Formula, ICP-MS Method: Collaborative Study, AOAC Final Action 2015.06, ISO/DIS 21424, IDF 243.

    Science.gov (United States)

    Pacquette, Lawrence H; Thompson, Joseph J; Malaviole, I; Zywicki, R; Woltjes, F; Ding, Y; Mittal, A; Ikeuchi, Y; Sadipiralla, B; Kimura, S; Veltman, H; Miura, A

    2018-03-01

    AOAC Final Action Official MethodSM 2015.06 "Minerals and Trace Elements in Milk, Milk Products, Infant Formula and Adult/Pediatric Nutritional Formula, ICP-MS Method" was collaboratively studied. Note that "milk, milk products" has now been added to the title of the Final Action method because whole milk and several dairy ingredients were successfully incorporated into the collaborative study for the purpose of developing an International Organization for Standardization/International Dairy Federation standard (ISO/DIS 21424; in progress). The method determines sodium, magnesium, phosphorus, potassium, calcium, iron, manganese, zinc, copper, chromium, molybdenum, and selenium by inductively coupled plasma (ICP)-MS after microwave digestion. Ten laboratories participated in the study, and data from five different model ICP-MS units were represented. Thirteen products, five placebo products, and six dairy samples were tested as blind duplicates in this study, along with a standard reference material, for a total 50 samples. The overall repeatability and reproducibility for all samples met Standard Method Performance Requirements put forth by the AOAC Stakeholder Panel on Infant Formula and Adult Nutritionals, with a few exceptions. Comparisons are made to ICP-atomic emission data from a collaborative study of AOAC Official Method 2011.14 carried out concurrently on these same samples.

  12. As Aventuras de Huckleberry Finn de Mark Twain, Tradução de Rosaura Eichenberg.DOI: 10.5007/2175-7968.2011v2n28p243

    Directory of Open Access Journals (Sweden)

    Vanessa Lopes Lourenço Hanes

    2011-12-01

    Full Text Available A obra The Adventures of Huckleberry Finn é tida pela maioria dos críticos literários como a obra-prima de Mark Twain. Este livro, escrito em 1885, foi inclusive considerado a origem de toda a literatura americana moderna pelo célebre Hemingway.

  13. Critical Masses for Unreflected Metal Spheres

    International Nuclear Information System (INIS)

    Westfall, Robert Michael; Wright, Richard Q.

    2009-01-01

    Calculated critical masses of bare metal spheres for 28 actinide isotopes, using the SCALE/XSDRNPM one-dimensional, discrete-ordinates system, are presented. ENDF/B-VI, ENDF/B-VII, and JENDL-3.3 cross sections were used in the calculations. Results are given for isotopes of uranium, neptunium, plutonium, americium, curium, californium, and for one isotope of einsteinium. Calculated k values for these same nuclides are also given. We show that, for non-threshold or low-threshold fission nuclides, a good approximation for the nuclide k is the value of nubar at 1 MeV. A plot of the critical mass versus k values is given for 19 nuclides with A-numbers between 232 and 250. The peaks in the critical mass curve (for seven nuclides) correspond to dips in the k curve. For the seven cases with the largest critical mass, six are even-even nuclides. Neptunium-237, with a critical mass of about 62.7 kg (ENDF/B-VI calculation), has an odd number of protons and an even number of neutrons. However, two cases with quite small critical masses, 232U and 236Pu, are also even-even. These two nuclides do not exhibit threshold fission behavior like most other even-even nuclides. The largest critical mass is 208.8 kg for 243Am and the smallest is 2.44 kg for 251Cf. The calculated k values vary from 1.5022 for 234U to 4.4767 for 251Cf. A correlation between the calculated critical mass (kg) and the fission spectrum averaged value of is given for the elements U, Np, Pu, Am, Cm, and Cf. For each of the five elements, a fit to the data for that element is provided. In each case the fit employs a negative exponential of the form mass = exp(A + B ∼ ln). The values of A and B are element dependent and vary slightly for each of the five elements. The method described here is mainly applicable for non-threshold fission nuclides (15 of the 28 nuclides considered in this paper). There are three exceptions, 238Pu, 244Cm, and 250Cf, which all exhibit threshold fission behavior.

  14. Quantum-chemical consideration of extermal valent forms of actinides

    International Nuclear Information System (INIS)

    Ionova, G.V.; Pershina, V.G.; Spitsyn, V.I.

    1982-01-01

    Stability of valent forms of actinides that has not yet studied experimentally, is considered within the framework of quantum-chemical considerations. Oxidizing potentials E 0 for actinide elements are determined theoretically. A dependence of the definite valent state stability on relativistic effect is shown. A conclusion is made that oxidizing potential E 0 (4-5) for americium should be higher than E 0 (4-5) for plutonium. A relatively small oxidizing potential E 0 (4-5) for curium speaks about principle possibility of production of five-valent curium in solution, though it is less stable than the six-valent one. Oxidizing potential corresponding to transition of three-valent californium into the four-valent state should be less than the value adopted in literature. A relatively small oxidizing potential of californium E 0 (4-5) speaks about possible existence of five-valent californium in solution

  15. Source storage and transfer cask: Users Guide

    International Nuclear Information System (INIS)

    Eccleston, G.W.; Speir, L.G.; Garcia, D.C.

    1985-04-01

    The storage and shield cask for the dual californium source is designed to shield and transport up to 3.7 mg (2 Ci) of 252 Cf. the cask meets Department of Transportation (DOT) license requirements for Type A materials (DOT-7A). The cask is designed to transfer sources to and from the Flourinel and Fuel Storage (FAST) facility delayed-neutron interrogator. Californium sources placed in the cask must be encapsulated in the SR-CF-100 package and attached to Teleflex cables. The cask contains two source locations. Each location contains a gear box that allows a Teleflex cable to be remotely moved by a hand crank into and out of the cask. This transfer procedure permits sources to be easily removed and inserted into the delayed-neutron interrogator and reduces personnel radiation exposure during transfer. The radiation dose rate with the maximum allowable quantity of californium (3.7 mg) in the cask is 30 mR/h at the surface and less than 2 mR/h 1 m from the cask surface. This manual contains information about the cask, californium sources, describes the method to ship the cask, and how to insert and remove sources from the cask. 28 figs

  16. Neutron spectra from radionuclide sources for cardiac pacemakers

    International Nuclear Information System (INIS)

    Kluge, H.

    1975-01-01

    Neutron spectra from Plutonium 238 radioisotope batteries powering cardiac pacemakers are measured in the energy range above 0.7 MeV. The results are used to calculate radiation doses within a cylindrical phantom. There are only minor differences between the different types of plutonium 238-batteries and californium 252-batteries

  17. Validation of the MCNP-DSP Monte Carlo code for calculating source-driven noise parameters of subcritical systems

    International Nuclear Information System (INIS)

    Valentine, T.E.; Mihalczo, J.T.

    1995-01-01

    This paper describes calculations performed to validate the modified version of the MCNP code, the MCNP-DSP, used for: the neutron and photon spectra of the spontaneous fission of californium 252; the representation of the detection processes for scattering detectors; the timing of the detection process; and the calculation of the frequency analysis parameters for the MCNP-DSP code

  18. Magnetic measurements of the transuranium elements. Progress report, January 1, 1984-December 31, 1984

    International Nuclear Information System (INIS)

    Huray, P.G.; Nave, S.E.

    1984-01-01

    Measurements of the magnetic properties of dhcp californium-249 metal indicated the presence of three regions of differing magnetic character. Additional measurements are also reported. Magnetic moments and valence states of terbium in TbF 3 , BaTbO 3 , and TbO 1 8 are discussed. Progress on high-field operation of the micro-magnetic susceptometer is reported

  19. Single-event burnout of power MOSFET devices for satellite application

    International Nuclear Information System (INIS)

    Xue Yuxiong; Tian Kai; Cao Zhou; Yang Shiyu; Liu Gang; Cai Xiaowu; Lu Jiang

    2008-01-01

    Single-event burnout (SEB) sensitivity was tested for power MOSFET devices, JTMCS081 and JTMCS062, which were made in Institute of Microelectronics, Chinese Academy of Sciences, using californium-252 simulation source. SEB voltage threshold was found for devices under test (DUT). It is helpful for engineers to choose devices used in satellites. (authors)

  20. ORF Alignment: NC_005071 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available GLDPKRGQCLEVGAILFHAPQRAVLAQHSFLLPVETNAAESI 60 ... Query: 190 DIAWPVDRQLRSRPSVRDLALAYGVPVWAAHRALTDCIYLAEVFARCKDL...ETLL 243 ... DIAWPVDRQLRSRPSVRDLALAYGVPVWAAHRALTDCIYLAEVFARCKDLETLL Sbjct: 121 DIAWPVDRQLRSRPSVRDLALAYGVPVWAAHRALTDCIYLAEVFARCKDLETLL 174

  1. Test Review: Wilkinson, G. S., & Robertson, G. J. (2006). Wide Range Achievement Test--Fourth Edition. Lutz, FL: Psychological Assessment Resources. WRAT4 Introductory Kit (Includes Manual, 25 Test/Response Forms [Blue and Green], and Accompanying Test Materials): $243.00

    Science.gov (United States)

    Dell, Cindy Ann; Harrold, Barbara; Dell, Thomas

    2008-01-01

    The Wide Range Achievement Test-Fourth Edition (WRAT4) is designed to provide "a quick, simple, psychometrically sound assessment of academic skills". The test was first published in 1946 by Joseph F. Jastak, with the purpose of augmenting the cognitive performance measures of the Wechsler-Bellevue Scales, developed by David Wechsler.…

  2. [Dimitri Steinke: Die Zivilrechtsordnungen des Baltikums unter dem Einfluss ausländischer, insbesondere deutscher Rechtsquellen. (Osnabrücker Schriften zur Rechtsgeschichte, Bd. 16.) V&R unipress. Göttingen 2009. 243 S. ISBN 978-3-89971-573-6] / M

    Index Scriptorium Estoniae

    Luts-Sootak, Marju, 1966-

    2011-01-01

    Arvustus: Dimitri Steinke. Die Zivilrechtsordnungen des Baltikums unter dem Einfluss ausländischer, insbesondere deutscher Rechtsquellen. (Osnabrücker Schriften zur Rechtsgeschichte ; 16). Göttingen, 2009

  3. Further Study is Needed to Define and Measure the Use of Reflective Practice in Library and Information Science. A review of: Grant, Maria J. “The Role of Reflection in the Library and Information Sector: A Systematic Review.” Health Information and Libraries Journal 24.3 (2007: 155‐66.

    Directory of Open Access Journals (Sweden)

    Carol Perryman

    2008-03-01

    Full Text Available Objectives ‐ To identify and review the literature of reflective practice in library and information science (LIS in order to understand its role, particularly with regard to health libraries.Design ‐ Systematic reviewSetting ‐ LIS English‐language articles published between 1969 and 2006, and indexed in the Library and Information Science Abstracts (LISA database.Subjects ‐ 929 citations retrieved from the LISA database.Methods ‐ The author conducted free text searches in the LISA database for the terms ‘reflective,’ ‘reflection*,’ or ‘reflexion*.’ An initial search series was conducted in 2004 in order to retrieve items published between 1969‐2003, then in 2007 for articles published between 2004‐2006. In all, 929 article citations were retrieved. Exclusion criteria included those articles addressing the facilitation of reflective practices in others, as well as non‐English language materials,and those pre-dating 1969. After review, 55 articles met the author’s relevance standard.Citation tracking then added 10 articles to the total. From this dataset, full‐text articles were obtained where possible, if determined on initial scrutiny to be deserving of further examination. Thirteen articles (.013% were ultimately selected for analysis. These articles were categorized as analytical or non‐analytical, with respect to perspective (individual or organizational, and recency of events (retrospective or recent. In addition, a determination was made about whether the articles’ foci were reflection occurring on (in retrospect to or in (during practice.Main results ‐ Of thirteen articles, five were found to be non‐analytical, with the other six being analytical. Three of the non-analytical items were the reflections of an individual, while the remaining two offered an organizational perspective. The non-analytical accounts were found to be descriptive accounts by an individual, mostly retrospective and offering no consideration of implications for LIS practice. Analytical reflective accounts attempt to systematically appraise events from the recent past, and draw conclusions in order to improve future actions.Conclusion – A gradual increase in the use of analytical reflective practice is demonstrated over the period from 1969‐2006, although insufficient examples of the practice were found in the published literature. Reflective practice is likely to be beneficial to LIS practitioners, especially when time is spent in considering the implications of lessons learned from practice.

  4. El servicio público de las telecomunicaciones: un reto para la regulación económica OECD (2014, Estudio de la OCDE sobre políticas y regulación de telecomunicaciones en Colombia, OECD, Publishing, 184 pp. 243

    Directory of Open Access Journals (Sweden)

    María Carolina Espitia Becerra

    2014-12-01

    Full Text Available The study, about the Organization for Economic Co-operation and Development (OECD, analyzes the socioeconomic role upon Colombia’s telecommunications (TIC. Colombia has profited from the importance of this new public service, therefore the country has orientated its legal framework to ensure the access and universal service of these technologies. This analysis is centered on the telecommunication sector; it studies the markets, the regulation structure and their amendments. Given the relevance of regulations to the administrative law, this paper will center on three fundamental axes: (i the TIC as a public service that is guided towards the universal access and service, (ii The need for an independent regulatory body (iii the adequacy or otherwise of the Telecommunications Regulatory Commission to Colombian reality, other institutions and the regulatory framework. Even though Colombia has strived to create regulatory institutions in this sector, there’s still the questionable matter of the independence of some administrative entities such as the TIC Regulation Commission (crc, for its Spanish initials. This independence would be of extreme importance for the effectiveness of the regulations they are to impose.

  5. El servicio público de las telecomunicaciones: un reto para la regulación económica OECD (2014), Estudio de la OCDE sobre políticas y regulación de telecomunicaciones en Colombia, OECD, Publishing, 184 pp. 243

    OpenAIRE

    María Carolina Espitia Becerra

    2014-01-01

    The study, about the Organization for Economic Co-operation and Development (OECD), analyzes the socioeconomic role upon Colombia’s telecommunications (TIC). Colombia has profited from the importance of this new public service, therefore the country has orientated its legal framework to ensure the access and universal service of these technologies. This analysis is centered on the telecommunication sector; it studies the markets, the regulation structure and their amendments. Given the releva...

  6. University Students Are Unaware of the Role of Academic Librarians. A Review of: Bickley, R. & Corral, S. (2011. Student perceptions of staff in the information commons: A survey at the University of Sheffield. Reference Services Review, 39(2, 223-243. doi:10.1108/00907321111135466

    Directory of Open Access Journals (Sweden)

    Kirsty Thomson

    2012-06-01

    Full Text Available Objective – To discover students’ perceptionsof information commons staff, and todetermine how these perceptions influence theuse of library resources.Design – Post-experience survey with onefollow-up interview.Setting – The University of Sheffield, a postsecondaryinstitution in England.Subjects – All undergraduate andpostgraduate students were invited to takepart. Just over 1% of the student population, or250 students, completed the survey.Methods – Information about the survey wassent to students’ institutional email addresses.One follow up interview was carried out viaemail using the critical incident technique.Main Results – Students do not understandthe academic roles of librarians. They areunlikely to approach library staff for academicsupport, preferring to turn to instructors, otherstudents, friends, and family. Most studentshad positive opinions about assistancereceived in the Information Commons, but asmall number reflected on previous badexperiences with staff, or on a fear of beingmade to feel foolish. The vast majority ofstudents who did not seek help in theInformation Commons stated that this wasbecause they did not require assistance. Most students do not perceive a difference between Information Commons staff and library staff.Conclusion – Students have positive views of Information Commons staff at the University of Sheffield, but have low awareness of the roles of professional librarians. Librarians need to develop partnerships with academic staff and strengthen their presence in both physical and online learning environments to promote their academic roles.

  7. Computer-assisted nuclear fuel manufacture

    International Nuclear Information System (INIS)

    Maloney, J.P.; Schaumann, S.M.; Stone, E.

    1976-01-01

    At the ERDA Savannah River Plant, a process monitor, which incorporates an online digital computer, assists in manufacturing fuel elements used to produce nuclides such as plutonium, tritium, and californium in the plant's nuclear reactors. Also, inventory functions assist in safeguarding fissile material and protecting against accidental nuclear criticality. Terminals at strategic locations throughout the process area enable production operators to send and receive instructions and information on each manufacturing step

  8. Computer-assisted nuclear fuel manufacture

    International Nuclear Information System (INIS)

    Maloney, J.P.; Schaumann, C.M.; Stone, E.

    1976-06-01

    At the ERDA Savannah River Plant, a process monitor, which incorporates an online digital computer, assists in manufacturing fuel elements used to produce nuclides such as plutonium, tritium, and californium in the plant's nuclear reactors. Also, inventory functions assist in safeguarding fissile material and protecting against accidental nuclear criticality. Terminals at strategic locations throughout the process area enable production operators to send and receive instructions and information on each manufacturing step. 11 fig

  9. Heavy ion tests on programmable VLSI

    International Nuclear Information System (INIS)

    Provost-Grellier, A.

    1989-11-01

    The radiation from space environment induces operation damages in onboard computers systems. The definition of a strategy, for the Very Large Scale Integrated Circuitry (VLSI) qualification and choice, is needed. The 'upset' phenomena is known to be the most critical integrated circuit radiation effect. The strategies for testing integrated circuits are reviewed. A method and a test device were developed and applied to space applications candidate circuits. Cyclotron, synchrotron and Californium source experiments were carried out [fr

  10. Charge breeding of radioactive isotopes at the CARIBU facility with an electron beam ion source

    Science.gov (United States)

    Vondrasek, R. C.; Dickerson, C. A.; Hendricks, M.; Ostroumov, P.; Pardo, R.; Savard, G.; Scott, R.; Zinkann, G.

    2018-05-01

    An Electron Beam Ion Source Charge Breeder (EBIS-CB) has been developed at Argonne National Laboratory as part of the californium rare ion breeder upgrade. For the past year, the EBIS-CB has been undergoing commissioning as part of the ATLAS accelerator complex. It has delivered both stable and radioactive beams with A/Q 18% into a single charge state. The operation of this device, challenges during the commissioning phase, and future improvements will be discussed.

  11. Solid-State Neutron Multiplicity Counting System Using Commercial Off-the-Shelf Semiconductor Detectors

    Energy Technology Data Exchange (ETDEWEB)

    Rozhdestvenskyy, S. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

    2017-08-09

    This work iterates on the first demonstration of a solid-state neutron multiplicity counting system developed at Lawrence Livermore National Laboratory by using commercial off-the-shelf detectors. The system was demonstrated to determine the mass of a californium-252 neutron source within 20% error requiring only one-hour measurement time with 20 cm2 of active detector area.

  12. Safety analysis report for packaging: neutron shipping cask, model 0.5T

    International Nuclear Information System (INIS)

    Peterson, R.T.

    1976-01-01

    The Safety Analysis Report for Packaging demonstrates that the neutron shipping cask can safely transport, in solid or powder form, all isotopes of uranium, plutonium, americium, curium, berkelium, californium, einsteinium, and fermium. The shipping cask and its contents are described. It also evaluates transport conditions, structural parameters (e.g., load resistance, pressure and impact effects, lifting and tiedown devices), and shielding. Finally, it discusses compliance with Chapter 0529 of the Energy Research and Development Administration Manual

  13. Directed evolution of the periodic table: probing the electronic structure of late actinides.

    Science.gov (United States)

    Marsh, M L; Albrecht-Schmitt, T E

    2017-07-25

    Recent investigations of the coordination chemistry and physical properties of berkelium (Z = 97) and californium (Z = 98) have revealed fundamental differences between post-curium elements and lighter members of the actinide series. This review highlights these developments and chronicles key findings and concepts from the last half-century that have helped usher in a new understanding of the evolution of electronic structure in the periodic table.

  14. NWIS casting measurements taken during demonstrations to Russian visitors

    International Nuclear Information System (INIS)

    Mullens, J.A.; Valentine, T.E.; Mihalczo, J.T.

    1998-01-01

    This report describes a set of NWIS measurements made during demonstrations to Russian visitors on August 28, 1997. These measurements will be given to the Russian visitors from Arzamus-16 as part of their NWIS training (part of a DOE laboratory-to-laboratory exchange program). These measurements are made on standard highly enriched Uranium annular castings (as used for storage). Associated NWIS calibration runs were made in air (no casting, just the NWIS Californium source and detectors)

  15. Properties of neutron sources

    International Nuclear Information System (INIS)

    1987-03-01

    The Conference presentations were divided into sessions devoted to the following topics: white neutron sources, primarily pulsed (6 papers); fast neutron fields (5 papers); Californium-252 prompt fission neutron spectra (14 papers); monoenergetic sources and filtered beams (11 papers); 14 MeV neutron sources (10 papers); selected special application (one paper); and a general interest session (4 papers). Individual abstracts were prepared separately for the papers

  16. Health physics aspects of 252Cf

    International Nuclear Information System (INIS)

    Bhagwat, A.M.

    1974-01-01

    After briefly describing the methods of production, radioactive, chemical and biological properties of californium-252, its health physics aspects are reviewed in detail. Its external and internal radiation hazards can be minimised through control of radiation and contamination and proper shield design. Use of various shielding materials is evaluated. The following aspects are also discussed : (1) radiation detectors for neutrons and gamma radiation (2) personnel monitoring techniques (3) bioassay and (4) storage and transportation. (M.G.B.)

  17. Definitive Brachytherapy for Kaposi's Sarcoma

    International Nuclear Information System (INIS)

    Williams, A.; Ezzell, G.; Zalupski, M.; Fontanesi, J.

    1996-01-01

    Purpose: To assess the efficacy and possible complications in patients diagnosed with Kaposi's sarcoma and treated with definitive brachytherapy. Methods and Materials: Between January, 1995 and December, 1995, four patients with Kaposi's sarcoma (KS) were treated with brachytherapy. Three patients, all with positive HIV status were treated using Iridium 192 (Ir-192) sources via a high-dose rate remote afterloader. One patient with endemic KS was treated using the application of catheters loaded with Californium 252. Eight sites were treated and included scalp, feet, nose, penis, hand, neck, and back. Dose rate for Ir-192 was 330cGy/fx to a total dose of 990cGy. The Californium was delivered as 100nGy/b.i.d. to a total dose of 900nGy. Follow-up as ranged from 2-6 months. Results: All four patients remain alive. Seven of eight sites have had complete clinical response and each patient has reported durable pain relief that has not subsided through last follow-up of 1/96. Two of eight sites, both treated with surface mold technique with Californium 252 developed moist desquamation. The remaining six sites did not demonstrate significant toxicity. Conclusion: Brachytherapy can offer Kaposi's sarcoma patients results that are equivalent to external beam radiation therapy, with minimal complications, a shorter treatment time and potential cost effectiveness

  18. ORF Alignment: NC_002940 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available FHAVLETVQKKQI Sbjct: 1 ... IPRIYHPEPLKNQTSCSLSEDATNHIGRVLRMNVGEKIILFDGSNHIFHAVLETVQKKQI 60 ... Query: 123 RQDKKLQQWQKIAIAACEQCERN...QVPQIRPIMKLTDWCKEQDEMLKLNLHPRAKYTIRQL 182 ... RQDKKLQQWQKIAIAACEQCERNQVPQIRPIMKLTDWCK...EQDEMLKLNLHPRAKYTIRQL Sbjct: 121 RQDKKLQQWQKIAIAACEQCERNQVPQIRPIMKLTDWCKEQDEMLKLNLHPRAKYTIRQL 180 ... Query: 243 L 243 ... L Sbjct: 241 L 241

  19. Protein (Cyanobacteria): 230634 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available ZP_11685390.1 1117:4412 1118:3009 263510:243 263511:243 423471:1998 Na-Ca exchanger/integri...n-beta4, partial Crocosphaera watsonii WH 0003 MDNTQFRGAFSRETNTIYFSEKLVRDTVLQFETVEDINSDNQYIQAFVAVWLEEIGHSVEAQLNEEEIAGDEGRI

  20. Zajímavý záchyt korynebakterie, maskující se jako koagulázanegativní stafylokok

    Czech Academy of Sciences Publication Activity Database

    Petráš, P.; Novotná, Gabriela; Machová, I.; Glavach-Hlaváčová, N.; Šimečková, E.

    2005-01-01

    Roč. 14, č. 5 (2005), s. 243-243 ISSN 1211-7358 Institutional research plan: CEZ:AV0Z50200510 Keywords : staphylococci * corynebacterium * biochemical identification Subject RIV: EE - Microbiology, Virology

  1. ORF Alignment: NC_003366 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available QFGKLISAYKRWGNEEALEE Sbjct: 121 AKPFHVGHLFTTAIGHSLYRMLNFEGYNPIRINHLGDWGTQFGKLISAYKRWGNEEALEE 180 ... Query: 243 DMLGVDFDSWAGES...FYNDKMDKVVEELEKANILTESNGAKVVMLDEYNMPPCIVVKSDGA 302 ... DMLGVDFDSWAGESFYNDKMDKVVEELEKAN...ILTESNGAKVVMLDEYNMPPCIVVKSDGA Sbjct: 241 DMLGVDFDSWAGESFYNDKMDKVVEELEKANILTESNGAK

  2. ORF Alignment: NC_006814 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available IANLVTENNTKIKAISISF 60 ... Query: 123 VSDFAVXXXXXXXXXXXXXXXKLFRGTSFSAGEFGMMITDYTGHGFKSAHELASTSALIS 182 ... ... ... VSDFAV ... KLFRGTSFSAGEFGMMITDYTGHGFKSAHELASTSALIS Sbjct: 121 VSDFAV...ITLGNGVGGGIFINNKLFRGTSFSAGEFGMMITDYTGHGFKSAHELASTSALIS 180 ... Query: 243 SQNSELIPIIKEKLNQIPNWTDFQAEIQSCRFFNDAS

  3. Protein (Cyanobacteria): 647660116 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available :162 ... hypothetical protein, partial Prochlorococcus sp. scB243_496A2 MRILLAAAECAPMIKVGGMGDVVGSLPPSLIKLGHDVRVIIPGYGKLWSLLEVSNEPVFRTNTMGTDFAVYEAKHPIHNYVIYLVGHPTFDSDQIYGGENEDWRFTFFASAT

  4. Protein (Cyanobacteria): 661290558 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available SPYFYASWMPEKEDDYRFTNKKRTPLECSTGTKDARSAALKAISWVKEKQKDCLRKITEYQEVKTKCLEHYWEEHFIDFSSTRASRKSVTKLINDEKLKWCSPTYGIG...6:352 ... hypothetical protein Prochlorococcus sp. scB243_495N4 MTSLSAMDGKLNDRTWINISESRYELELGNRVSFPINLYLKKRVN

  5. Local Purchasing of Journals is Required in Addition to a Nationally Purchased Collection to Meet the Information Needs of NHS Staff. A review of: Glover, Steven William, John Addison, Colette Gleghorn, and John Bramwell. “Journal Usage in NHS Hospitals: A Comparison Report of Total Usage at an Acute NHS Trust and a Specialist NHS Trust in the North West of England.” Health Information and Libraries Journal 24.3 (2007: 193‐9.

    Directory of Open Access Journals (Sweden)

    Jennie Kelson

    2008-03-01

    Full Text Available Objective ‐ To compare journal usage between an acute National Health Service (NHS Trust and a specialist NHS Trust located in North West England to provide some evidence as to how well the National Core Content Collection (provided by ProQuest meets the needs of staff in these settings.Design ‐ Comparative studySetting ‐ An acute NHS Trust, comprising four hospital sites, and a cancer specialist NHS Trust based on a single site. Both Trusts are located in North West England. The cancer specialist NHS Trust is a teaching hospital with undergraduate nurses, medical students, and student radiographers. This Trust is also closely associated with an adjoining cancer research institute. The acute NHS Trust has a large number of healthcare staff in training and was not described as a teaching hospital.Subjects ‐ Staff of the respective NHS Trusts. The staff numbers for each organisation were not provided.Methods ‐ COUNTER usage statistics of online journals, obtained from publisher administration tools, were collected for one year covering the period 1 December 2005 to 30 November 2006. Where available, the number of photocopies made from print journals during the same period by library users for their own use was also included. All full‐text downloads of journal articles were counted as part of this study, hence the possibility of double counting if a single article was requested in both HTML and PDF versions. Details of free or open access articles accessed without the need for a username and password were not included in the study. To encourage use of the electronic journals, library services at both Trusts implemented a number of initiatives to maximize publicity. These included direct e‐mails to staff, posters, and presentations to staff. Athens registration, required for access to the electronic journal collections, was promoted as part of the induction process for new library users. Staff members were encouraged to apply for the electronic table of contents alert for journals in their area of specialty. An A‐Z list of journals was accessible via the Trusts’ intranet and internet sites, and direct links to electronic journals were added to the NHS Dialog/Datastar databases and on PubMed.Main results ‐ The libraries at both Trusts in the study provide the majority of their journals in electronic‐only format. In addition to the National Core Content titles, the cancer specialist Trust provides access to an additional five journal collections: Science Direct Health Sciences, Blackwell Synergy Medical and Nursing collection, five journals selected from Nature Publishing Group, selected society journals via HighWire Press and Oxford University Press titles. Staff members of the acute Trust have access to an additional three journal collections: Science Direct Health Sciences, the BMJ Publishing Group (BMJPG collection and 16 LWW titles via Ovid. During the study period, a total of 93,376 articles were downloaded or copied. Of these, 47,079 articles were downloaded or copied by staff of the cancer specialist NHS Trust and 46,297 articles were downloaded or copied by staff of the acute NHS Trust. The usage of each of the journal collections during the study period for each Trust is shown in the table below with the most used resource shown in bold. (See article for table General information regarding some of the commonly used journal titles by staff of each Trust was included in the commentary, but levels of use were not enumerated. Staff of the cancer specialist NHS Trust favoured cancer‐related titles, whilst staff of the acute NHS Trust accessed journal titles over a greater range of subject areas. Details of the top titles accessed from the National Core Content collection were not provided for either Trust. A possible reason given for the lower usage level of the National Core Content collection by the cancer specialist NHS Trust compared to the acute NHS Trust was the presence of embargoes on many cancer‐related titles within the National Core Content collection. Information about training offered to staff, their level of access to computer facilities,or familiarity with accessing electronic journal collections was not provided.Conclusion ‐ Staff of both Trusts in the study recorded a high level of journal use, with a total of 93,376 articles downloaded or photocopied during the study period. There was a marked difference in the usage patterns of the National Core Content journals between the two Trusts studied with the acute NHS Trust showing a higher proportion of usage (29.9%compared with the cancer specialist Trust(4.5%. Staff members of the acute NHS Trust accessed a greater range of subject areas, while staff those at the cancer specialist NHS Trust favoured cancer related titles.The results indicated that the National Core Content collection did not meet the information needs of the specialist cancer Trust as well as it met the needs of the more generalist acute Trust. The National Core Content collection appears insufficient to meet the diverse information needs of all NHS staff. Local purchasing of journals, in addition to national level provision, is therefore required to ensure that the needs of local specialties are adequately supported.

  6. Determination of the relative power density distribution in a heterogeneous reactor from the results of measurements of the reactivity effects and the neutron importance function

    International Nuclear Information System (INIS)

    Bobrov, A. A.; Glushkov, E. S.; Zimin, A. A.; Kapitonova, A. V.; Kompaniets, G. V.; Nosov, V. I.; Petrushenko, R. P.; Smirnov, O. N.

    2012-01-01

    A method for experimental determination of the relative power density distribution in a heterogeneous reactor based on measurements of fuel reactivity effects and importance of neutrons from a californium source is proposed. The method was perfected on two critical assembly configurations at the NARCISS facility of the Kurchatov Institute, which simulated a small-size heterogeneous nuclear reactor. The neutron importance measurements were performed on subcritical and critical assemblies. It is shown that, along with traditionally used activation methods, the developed method can be applied to experimental studies of special features of the power density distribution in critical assemblies and reactors.

  7. Nuclear assay of coal. Volume 1. Coal composition by prompt neutron activation analysis: basic experiments. Final report

    International Nuclear Information System (INIS)

    Reynolds, G.; Bozorganesh, H.; Elias, E.; Gozani, T.; Maung, T.; Orphan, V.

    1979-01-01

    Using californium-252 as a source of exciting neutrons, prompt gamma photons emitted by elemental nuclei in the coal have been measured using several detectors, including sodium--iodide and germanium--lithium. Several coal types, including bituminous, subbituminous lignite and anthracite were crushed to various top sizes and analyzed carefully be traditional ASTM wet chemistry techniques at two or three different laboratories. The elements (sulfur, hydrogen, carbon, aluminum, silicon, iron, calcium, sodium, nitrogen, and chlorine) were determined by prompt neutron activations and the quantities compared with those of the wet chemical analyses

  8. PROCEEDINGS OF THE SYMPOSIUM COMMEMORATING THE 25th ANNIVERSARY OF ELEMENTS 97 and 98 HELD ON JAN. 20, 1975

    Energy Technology Data Exchange (ETDEWEB)

    Seaborg, Glenn T.; Street Jr., Kenneth; Thompson, Stanley G.; Ghiorso, Albert

    1976-07-01

    This volume includes the talks given on January 20, 1975, at a symposium in Berkeley on the occasion of the celebration of the 25th anniversary of the discovery of berkelium and californium. Talks were given at this symposium by the four people involved in the discovery of these elements and by a number of people who have made significant contributions in the intervening years to the investigation of their nuclear and chemical properties. The papers are being published here, without editing, in the form in which they were submitted by the authors in the months following the anniversary symposium, and they reflect rather faithfully the remarks made on that occasion.

  9. Radiological safety considerations in the design and operation of the ORNL Transuranium Research Laboratory (TRL)

    International Nuclear Information System (INIS)

    Haynes, C.E.

    1976-01-01

    The Transuranium Research Laboratory (TRL) is the central facility at Oak Ridge National Laboratory (ORNL) for chemical and physical research involving transuranium elements. Transuranium Research Laboratory investigations are about equally divided between studies of inorganic and structural chemistry of the heavy elements and nuclear structure and properties of their isotopes. Elements studied include neptunium, plutonium, americium, curium, berkelium, californium, and einsteinium, each in microgram-to-gram quantities depending upon availability and experimental requirements. This paper describes an eight-step safety procedure followed in planning and approving individual research projects. This procedure should provide an optimum margin of safety and should permit the accomplishment of successful research

  10. Neutron crosstalk between liquid scintillators

    Energy Technology Data Exchange (ETDEWEB)

    Verbeke, J.M., E-mail: verbeke2@llnl.gov; Prasad, M.K., E-mail: prasad1@llnl.gov; Snyderman, N.J., E-mail: snyderman1@llnl.gov

    2015-09-11

    A method is proposed to quantify the fractions of neutrons scattering between liquid scintillators. Using a spontaneous fission source, this method can be utilized to quickly characterize an array of liquid scintillators in terms of crosstalk. The point model theory due to Feynman is corrected to account for these multiple scatterings. Using spectral information measured by the liquid scintillators, fractions of multiple scattering can be estimated, and mass reconstruction of fissile materials under investigation can be improved. Monte Carlo simulations of mono-energetic neutron sources were performed to estimate neutron crosstalk. A californium source in an array of liquid scintillators was modeled to illustrate the improvement of the mass reconstruction.

  11. Method for measuring multiple scattering corrections between liquid scintillators

    Energy Technology Data Exchange (ETDEWEB)

    Verbeke, J.M., E-mail: verbeke2@llnl.gov; Glenn, A.M., E-mail: glenn22@llnl.gov; Keefer, G.J., E-mail: keefer1@llnl.gov; Wurtz, R.E., E-mail: wurtz1@llnl.gov

    2016-07-21

    A time-of-flight method is proposed to experimentally quantify the fractions of neutrons scattering between scintillators. An array of scintillators is characterized in terms of crosstalk with this method by measuring a californium source, for different neutron energy thresholds. The spectral information recorded by the scintillators can be used to estimate the fractions of neutrons multiple scattering. With the help of a correction to Feynman's point model theory to account for multiple scattering, these fractions can in turn improve the mass reconstruction of fissile materials under investigation.

  12. Neutron crosstalk between liquid scintillators

    International Nuclear Information System (INIS)

    Verbeke, J.M.; Prasad, M.K.; Snyderman, N.J.

    2015-01-01

    A method is proposed to quantify the fractions of neutrons scattering between liquid scintillators. Using a spontaneous fission source, this method can be utilized to quickly characterize an array of liquid scintillators in terms of crosstalk. The point model theory due to Feynman is corrected to account for these multiple scatterings. Using spectral information measured by the liquid scintillators, fractions of multiple scattering can be estimated, and mass reconstruction of fissile materials under investigation can be improved. Monte Carlo simulations of mono-energetic neutron sources were performed to estimate neutron crosstalk. A californium source in an array of liquid scintillators was modeled to illustrate the improvement of the mass reconstruction

  13. Beam test of a grid-less multi-harmonic buncher

    International Nuclear Information System (INIS)

    Ostroumov, P.N.; Aseev, V.N.; Barcikowski, A.; Clifft, B.; Pardo, R.; Sharamentov, S.I.; Sengupta, M.

    2008-01-01

    The Argonne Tandem Linear Accelerator System (ATLAS) is the first superconducting heavy-ion linac in the world. Currently ATLAS is being upgraded with the Californium Rare Ion Breeder Upgrade (CARIBU). The latter is a funded project to expand the range of shortlived, neutron-rich rare isotope beams available for nuclear physics research at ATLAS. To avoid beam losses associated with the existing gridded multi-harmonic buncher (MHB), we have developed and built a grid-less four-harmonic buncher with fundamental frequency of 12.125 MHz. In this paper, we report the results of the MHB commissioning and ATLAS beam performance with the new buncher.

  14. Radiation protection data sheet. Radiation protection data sheets for the use of radionuclides in unsealed sources

    International Nuclear Information System (INIS)

    Anon.

    1999-01-01

    These radiation protection data sheet are devoted to responsible persons and employees of various laboratories or medical, pharmaceutical, university and industrial departments where radionuclides are handled as well as all the persons who attend to satisfy in this field. They contain the essential radiation protection data for the use of unsealed sources: physical characteristics, risk assessment, administrative procedures, recommendations, regulations and bibliography. This new series includes the following radionuclides: californium 252, curium 244, gallium 67, indium 113m, plutonium 238, plutonium 239, polonium 210, potassium 42, radium 226, thorium 232, uranium 238 and zinc 65. (O.M.)

  15. Development of a transportable neutron radiography system for non-destructive tests application

    International Nuclear Information System (INIS)

    Silva, Ademir X. da; Crispim, Verginia R.

    1999-01-01

    This paper presents a study of a transportable neutron radiography system utilizing californium-252. Studies about moderation, collimation and shielding are showed. A Monte Carlo Code, MCNP3b, has been used to obtain a maximum and more homogeneous thermal neutron flux in the collimator outlet next to the image plain, and an adequate radiation shielding to attend radiological protection rules. With the presented collimator, it was possible to obtain for the thermal neutron flux, at the collimator outlet and next to the image plain, a L/D ratio 7,5, for neutron flux up to 6 X 10 -6 cm -2 .s -1 per neutron source. (author)

  16. Composition containing transuranic elements for use in the homeopathic treatment of aids

    International Nuclear Information System (INIS)

    Lustig, D.

    1996-01-01

    A homeopathic remedy consisting of a composition containing one or more transuranic elements, particularly plutonium, for preventing and treating acquired immunodeficiency syndrome (AIDS) in humans, as well as seropositivity for human immunodeficiency virus (HIV). Said composition is characterized in that it uses any chemical or isotopic form of one or more transuranic elements (neptunium, plutonium, americium, curium, berkelium, californium or einsteinium), particularly plutonium, said form being diluted and dynamized according to conventional homeopathic methods, particularly the so-called Hahnemann and Korsakov methods, and provided preferably but not exclusively in the form of lactose and/or saccharose globules or granules impregnated with the active principle of said composition. (author)

  17. Determination of alpha activity and fissile mass content in solid waste by systems using neutron interrogation

    International Nuclear Information System (INIS)

    Romeyer Dherbey, J.; Lacruche, G.; Berne, R.; Auge, J.; Martin Deidier, L.; Butez, M.

    1990-01-01

    The Quantitative control (determination of heavy nuclides and alpha activity) of alpha radioactive wastes is necessary, particularly to determine if the waste is in accordance with the surface storage limits. In order to reduce the uncertainty on the alpha activity resulting from unknown isotopic composition, inhomogeneity of heavy nuclides in the matrix, combination of several methods is necessary. In the paper we present the Cadarache development work in the NDA of solid waste using the Californium shuffler, 14 Mev neutron generator, and also passive techniques such as neutron emission measurement and gamma spectrometry. Experimental systems combining active and passive methods are presented (COSAC, BANCO, DANAIDE, PROMETHEE)

  18. Actinides

    International Nuclear Information System (INIS)

    Martinot, L.; Fuger, J.

    1985-01-01

    The oxidation behavior of the actinides is explained on the basis of their electronic structure. The actinide elements, actinium, thorium, protactinium, uranium, neptunium, plutonium, americium, curium, berkelium, californium, einsteinium, fermium, mendelevium, nobelium, and laurencium are included. For all except the last three elements, the points of discussion are oxidation states, Gibbs energies and potentials, and potential diagram for the element in acid solution; and thermodynamic properties of these same elements are tabulated. References are cited following discussion of each element with a total of 97 references being cited. 13 tables

  19. Safety analysis report for packaging: neutron shipping cask, model 4T

    International Nuclear Information System (INIS)

    Peterson, R.T.

    1977-01-01

    This Safety Analysis Report for Packaging demonstrates that the neutron shipping cask can safely transport, in solid or powder form, all isotopes of uranium, plutonium, americium, curium, berkelium, californium, einsteinium, and fermium. The cask and its contents are described. It also evaluates transport conditions, structural parameters (e.g., load resistance, pressure and impact effects, lifting and tiedown devices), and shielding. Finally, it discusses compliance with Chapter 0529 of the Energy Research and Development Administration Manual, Safety Standards for the Packaging of Fissile and Other Radioactive Materials

  20. TOWARD AN IMPROVED UNDERSTANDING OF STRUCTURE AND MAGNETISM IN NEPTUNIUM AND PLUTONIUM PHOSPHONATES AND SULFONATES

    Energy Technology Data Exchange (ETDEWEB)

    Albrecht-Schmitt, Thomas

    2012-03-01

    This grant supported the exploratory synthesis of new actinide materials with all of the actinides from thorium to californium with the exceptions of protactinium and berkelium. We developed detailed structure-property relationships that allowed for the identification of novel materials with selective ion-exchange, selective oxidation, and long-range magnetic ordering. We found novel bonding motifs and identified periodic trends across the actinide series. We identified structural building units that would lead to desired structural features and novel topologies. We also characterized many different spectroscopic trends across the actinide series. The grant support the preparation of approximately 1200 new compounds all of which were structurally characterized.

  1. Protein (Cyanobacteria): 661286037 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 0:477 ... hypothetical protein, partial Prochlorococcus sp. scB243_498P3 MSTKSDSLKEKLIENFSDFSKLSDYSFMNYLRADPQ...STKDGNDHKPRSVYSGHYVPVLPTAIPEPEYISHSKKLFKELRLSSDLTKDKNFCLFFSGDISVANYPMSPVGWATGYALSIYGTEYTQQCPFGTGNGYGDGIAISVFEGLFNGKRMEMQLKGGGPTPYCRGA

  2. ORF Alignment: NC_004605 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available VIATLDKHDYQVSLEELQARMLE Sbjct: 1 ... SFSGIVKAKETASLSFRVPGTVESVFVNKGSVVEKGQVIATLDKHDYQVSLEELQARMLE 60 ... Query: 184 TLRAPFTGIVADVSVDPHE...QTLPGGSVVSIQQEDSWEVDIDVPENMIAQFALGQPASLTW 243 ... TLRAPFTGIVADVSVDPHEQTLPGGSVVS...IQQEDSWEVDIDVPENMIAQFALGQPASLTW Sbjct: 121 TLRAPFTGIVADVSVDPHEQTLPGGSVVSIQQEDSWEVDIDVPENMIAQFALGQPASLTW 180 ...

  3. ORF Alignment: NC_006513 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ding ... response regulator [Azoarcus sp. EbN1] ... Length = 243 ... Query: 139 GRSRAMQDLYQKVLRVAASEAN...VLITGESGVGKELVARALHDNSTRAKGPYVAVHCASLP 198 ... GRSRAMQDLYQKVLRVAASEAN...VLITGESGVGKELVARALHDNSTRAKGPYVAVHCASLP Sbjct: 1 ... GRSRAMQDLYQKVLRVAASEANVLITGESGVGKELVARALHDNSTRAKGPYVAVHCAS

  4. ORF Alignment: NC_002754 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available SYPGDVYRNYKKHLEIIESSSADCVIFPELSLTGYIIKDLTYEIYKDAEEA 60 ... Query: 123 DPLKDLKIFEYKDLKFGVVICEDAWHPEPIEALSLMGADAIFIPSAS...PMRKLRENLAIEE 182 ... DPLKDLKIFEYKDLKFGVVICEDAWHPEPIEALSLMGADAIFIPSAS...PMRKLRENLAIEE Sbjct: 121 DPLKDLKIFEYKDLKFGVVICEDAWHPEPIEALSLMGADAIFIPSASPMRKLRENLAIEE 180 ... Query: 243 TENEL

  5. Nanoscale materials in chemistry

    National Research Council Canada - National Science Library

    Klabunde, Kenneth J; Richards, Ryan

    2009-01-01

    ...: Disordered, Porous Nanostructures Stephanie L. Brock 209 9 Ordered Microporous and Mesoporous Materials Freddy Kleitz 243 10 Applications of Microporous and Mesoporous Materials Anirban Ghosh,...

  6. Citric complexes of trivalent cerium and berkelium

    International Nuclear Information System (INIS)

    Boulhassa, S.

    1977-01-01

    The extraction by thenoyltrifluoroacetone (TTA) in benzene of trivalent cerium, berkelium and californium, at the indicator scale, hydrolysis and complexation by citric acid of these cations are studied. The radionuclides used were 144 Ce, 249 Bk and 249 Cf respectively γ, β and α emitters. The solvent extraction technique of the elements by TTA in benzene from a perchloric medium at the ionic stength 0.1 was employed. The distribution coefficients D were measured by the γ, β or α radiometry. Cerium and berkelium, which have a comparable redox behavior, show in solution a relatively stable valency IV. Therefore the study by solvent extraction of their trivalent form required the standing up of complete reducing conditions of these elements and their stabilization in solution at the valency III. The thermodynamic data obtained for berkelium and californium contribute to understand the chemistry of these elements and permit to complete the third 'tetrad branch' of 5f elements from Cm 3+ to Es 3+ . This tetrad effect is a manifestation of thermodynamic consequence of the 'nephelauxetic effect'. As for Ce(III), the data confirm the pronounced acid property and may be show no neglected ligand effect for f 1 configuration [fr

  7. Radioactive materials production

    International Nuclear Information System (INIS)

    Anon.

    1985-01-01

    The Radiochemical Processing Plant (RPP) at ORNL has served as the national repository and distribution center for 233 U for > 20 years. Several hundred kilograms of uranium, containing approximately 90 to 98% 233 U, are stored there in the form of metal, oxides, and nitrate solutions. All of these uranium materials contain small, but significant, concentrations of 232 U, ranging from 2 to 225 ppm. Most of the radioactivity associated with the 233 U comes from the decay daughters of 232 U (74-year half-life). The 252 Cf Industrial Sales/Loan Program involves loans of 252 Cf neutron sources to agencies of the US Government and sales of 252 Cf as the bulk oxide and as palladium-californium alloy pellets and wires. The program has been operated since 1968 in temporary facilities at the Savannah River Laboratory (SRL). The obsolete hot-cell facilities at SRL are now being decommissioned, and the program activities are being transferred to ORNL's Californium Facility in Bldg. 7930, which is managed by the staff of the Transuranium Processing Plant

  8. Browse Title Index

    African Journals Online (AJOL)

    Items 201 - 243 of 243 ... Vol 23, No 2 (2013), The Kidney in Pregnancy, Abstract. S Adam. Vol 12, No 4 ... Vol 14, No 2 (2004), The role of chemotherapy in the management of cervical cancer: review article, Details. WPW Mdluli ... Vol 13, No 3 (2003), The role of radiation therapy in epithelial ovarian cancer, Abstract. G Dreyer.

  9. Marine data and information management system for the Indian Ocean

    Digital Repository Service at National Institute of Oceanography (India)

    Sarupria, J.S.

    stream_size 8 stream_content_type text/plain stream_name IGBP_India_2000_243.pdf.txt stream_source_info IGBP_India_2000_243.pdf.txt Content-Encoding ISO-8859-1 Content-Type text/plain; charset=ISO-8859-1 ...

  10. 77 FR 26998 - Airworthiness Directives; Airbus Airplanes

    Science.gov (United States)

    2012-05-08

    ...-0428; Directorate Identifier 2011-NM-078-AD] RIN 2120-AA64 Airworthiness Directives; Airbus Airplanes...: We propose to adopt a new airworthiness directive (AD) for all Airbus Model A330-243, -243F, -342..., between 9 a.m. and 5 p.m., Monday through Friday, except Federal holidays. For Airbus service information...

  11. Threats to Aircraft Structural Safety Including a Compendium of Selected Structural Accidents/Incidents

    Science.gov (United States)

    2010-03-01

    April 28, 1988 Aloha Airlines Flight No. 243 departed Hilo , Hawaii with a crew and 89 passengers on board. When leveling off at 24,000 feet, there was an...89/03, “Aloha Airlines, Flight 243, Boeing 737-200, N73711, Near Maui, Hawaii April 28, 1988,” adopted on 14 June 1989, Washington DC. http

  12. Male gender, Charnley class C, and severity of bone defects predict the risk for aseptic loosening in the cup of ABG I hip arthroplasty

    Czech Academy of Sciences Publication Activity Database

    Gallo, J.; Havránek, Vítězslav; Zapletalová, J.; Lošťák, J.

    2010-01-01

    Roč. 11, č. 10 (2010), 243/1-243/7 E-ISSN 1471-2474 Institutional research plan: CEZ:AV0Z10100522 Keywords : hip arthroplasty * ABG I Subject RIV: BH - Optics, Masers, Lasers Impact factor: 1.941, year: 2010

  13. U.S. Trends in Solid Waste Management and GHG Emissions

    Science.gov (United States)

    In 2009, 243 million tons of municipal solid waste (MSW) was produced in the United States. Currently, 34% of the 243 million tons of MSW is recovered and recycled or composted which conserves energy and natural resources as well as avoid waste disposal. Of the remaining MSW th...

  14. Maslov. Evaluated neutron reaction data for Am and Cm isotopes. Summary documentation

    International Nuclear Information System (INIS)

    Lemmel, H.D.

    1996-01-01

    The nuclear data file by V.M. Maslov et al includes evaluated neutron reaction data for Am-241,243 Cm-243-245,246 in EDNF-6 format. The data are available from the IAEA Nuclear Data Section, costfree upon request. (author)

  15. Petroleum hydrocarbons in surface sediments in Kandla creek (Gujarat)

    Digital Repository Service at National Institute of Oceanography (India)

    Kadam, A.N.

    stream_size 6 stream_content_type text/plain stream_name Mahasagar_20_243.pdf.txt stream_source_info Mahasagar_20_243.pdf.txt Content-Encoding ISO-8859-1 Content-Type text/plain; charset=ISO-8859-1 ...

  16. Sacred Space and Sublime Sacramental Piety

    DEFF Research Database (Denmark)

    Petersen, Nils Holger

    2012-01-01

    Analyses and Discussions of Mozart's Sacramental Litanies K. 125 and K. 243 in relation to the notions of the Sacred and the Sublime.......Analyses and Discussions of Mozart's Sacramental Litanies K. 125 and K. 243 in relation to the notions of the Sacred and the Sublime....

  17. Reliability of semiconductor and gas-filled diodes for over-voltage protection exposed to ionizing radiation

    Directory of Open Access Journals (Sweden)

    Stanković Koviljka

    2009-01-01

    Full Text Available The wide-spread use of semiconductor and gas-filled diodes for non-linear over-voltage protection results in a variety of possible working conditions. It is therefore essential to have a thorough insight into their reliability in exploitation environments which imply exposure to ionizing radiation. The aim of this paper is to investigate the influence of irradiation on over-voltage diode characteristics by exposing the diodes to californium-252 combined neutron/gamma radiation field. The irradiation of semiconductor over-voltage diodes causes severe degradation of their protection characteristics. On the other hand, gas-filled over-voltage diodes exhibit a temporal improvement of performance. The results are presented with the accompanying theoretical interpretations of the observed changes in over-voltage diode behaviour, based on the interaction of radiation with materials constituting the diodes.

  18. The CARIBU EBIS control and synchronization system

    Science.gov (United States)

    Dickerson, Clayton; Peters, Christopher

    2015-01-01

    The Californium Rare Isotope Breeder Upgrade (CARIBU) Electron Beam Ion Source (EBIS) charge breeder has been built and tested. The bases of the CARIBU EBIS electrical system are four voltage platforms on which both DC and pulsed high voltage outputs are controlled. The high voltage output pulses are created with either a combination of a function generator and a high voltage amplifier, or two high voltage DC power supplies and a high voltage solid state switch. Proper synchronization of the pulsed voltages, fundamental to optimizing the charge breeding performance, is achieved with triggering from a digital delay pulse generator. The control system is based on National Instruments realtime controllers and LabVIEW software implementing Functional Global Variables (FGV) to store and access instrument parameters. Fiber optic converters enable network communication and triggering across the platforms.

  19. Designing on-line analyzer for coal on belt conveyor using neutron activation technique

    International Nuclear Information System (INIS)

    Rony Djokorayono; Agus Cahyono

    2014-01-01

    Basic design of on-line analyzer for coal on belt conveyor using neutron activation technique has been carried out. Compared with sampling technique, this neutron activation technique has some advantages in term of analysis accuracy and time. The design activities performed include the establishment of design requirements, functional requirements, technical requirements, technical specification, detection sub-system design, data acquisition subsystem design, and operator computer console design. This program will use Nal(Tl) scintillation detector to detect gamma-rays emitted by elements in coal due to neutron activation of a neutron source, "2"5"2Cf (Californium-252). This basic design of on-line analyzer for coal on belt conveyor using neutron activation technique should be followed up with the development of detailed design, prototype construction, and field testing. (author)

  20. Nuclear assay of coal. Volume 8. Continuous nuclear assay of coal (CONAC). Final report

    International Nuclear Information System (INIS)

    Lagarias, J.; Irminger, P.; Dodson, W.

    1979-01-01

    Using californium-252 as a source of exciting neutrons, prompt gamma photons emitted by elemental nuclei in the coal have been measured using several detectors, including sodium-iodide and germanium-lithium. Several coal types, including bituminous, subbituminous lignite and anthracite were crushed to various top sizes and analyzed carefully by traditional ASTM wet chemistry techniques at two or three different laboratories. The elements (sulfur, hydrogen, carbon, aluminum, silicon, iron, calcium, sodium, nitrogen, and chlorine) were determined by prompt neutron activations and the quantities compared with those of the wet chemical analyses. Since satisfactory correlation has been obtained at bench-scale level using 100 to 200 kG samples, an apparatus has been designed to analyze a coal stream of up to 50 ton/hour, at an electric power generating station

  1. Neutron dosimetry and spectrometry with Bonner spheres. Working out a log-normal reference matrix

    International Nuclear Information System (INIS)

    Zaborowski, Henrick.

    1981-11-01

    From the experimental and theoretical studies made upon the BONNER's spheres System with a I 6 Li(Eu) crystal and with a miniaturized 3 He counter we get the normalized energy response functions R*sub(i)(E). This normalization is obtained by the mathematization of the Resolution Function R*(i,E) in the Log-Normal distribution hypothesis to mono energetic neutrons given in April 1976 to the International Symposium on Californium 252. The fit of the Log-Normal Hypothesis with the experimental and Theoretical data is very satisfactory. The parameter's tabulated values allow a precise interpolation, at all energies between 0.4 eV and 15 MeV and for all spheres diameters between 2 and 12 inches, of the discretized R*sub(ij) Reference Matrix for the applications to neutron dosimetry and spectrometry [fr

  2. Experimental survey of the potential energy surfaces associated with fission

    International Nuclear Information System (INIS)

    Britt, H.C.

    1980-01-01

    Progress in the experimental determination of the properties of the potential energy surface associated with fission is reviewed. The importance of nuclear symmetry effects on the calculation of fission widths is demonstrated. Evidence is presented for the fragmentation of the mass-asymmetric second barrier in the thorium region and the axial asymmetric first barrier in the californium region. Detailed analyses of experimental data suggest the presence of two parallel second barriers; the normal mass-asymmetric, axial-symmetric barrier and a slightly higher mass-symmetric, axial-asymmetric barrier. Experimental barrier parameters are determined systematically and compared with calculations from various theoretical models. Techniques for expanding fission probability measurements to higher energies are discussed. (author)

  3. Dynamic vortex dust structures in a nuclear-track plasma

    International Nuclear Information System (INIS)

    Rykov, V A; Khudyakov, A V; Filinov, V S; Vladimirov, V I; Deputatova, L V; Krutov, D V; Fortov, V E

    2003-01-01

    Results are presented from Monte Carlo calculations of the electric charge on dust grains in a plasma produced during the slowing down of radioactive decay products of californium nuclei in neon. The dust grain charging is explained as being due to the drift of electrons and ions in an external electric field. It is shown that the charges of the grains depend on their coordinates and strongly fluctuate with time. The time-averaged grain charges agree with the experimental data obtained on ordered liquid-like dust structures in a nuclear-track plasma. The time-averaged dust grain charges are used to carry out computer modelling of the formation of dynamic vortex structures observed in experiments. Evidence is obtained for the fact that the electrostatic forces experienced by the dust grains are potential in character. The paper is supplemented by a video clip showing the typical dynamics of the simulated vortex dust structure

  4. Operation manual for the INEL on-line mass-separator facility

    International Nuclear Information System (INIS)

    Anderl, R.A.

    1984-06-01

    This report is an operation manual for an on-line mass-separator facility which is located in Building 661 at the Test Reactor Area of the Idaho National Engineering Laboratory. The facility provides mass-separated sources of short-lived fission-product radionuclides whose decay properties can be studied using a variety of nuclear spectroscopic techniques. This facility is unique in that it utilizes the gas-jet technique to transport fission products from a 252 Cf source located in a hot cell to the ion source of the mass separator. This document includes the following: (a) a detailed description of the facility, (b) identification of equipment hazards and safety controls, (c) detailed operating procedures for startup, continuous operation and shutdown, (d) operating procedures for the californium hot cell, and (e) an operator's manual for the automated moving tape collector/data acquisition system. 7 references, 16 figures, 8 tables

  5. Separation of 248Cm (III) from 252Cf (III) and its use in time resolved fluorescence spectroscopic (TRFS) studies

    International Nuclear Information System (INIS)

    Murali, M.S.; Nair, A.G.C.; Gujar, R.B.; Jain, A.; Tomar, B.S.; Godbole, S.V.; Reddy, A.V.R.; Manchanda, V.K.

    2008-07-01

    The present report gives a description of the methodology for the separation of 248 Cm(III) from decayed 252 Cf (III) waste solution. The waste solution was first assayed for 252 Cf content by neutron counting using a neutron well coincidence counter. The sample was subjected to the chemical separation of 248 Cm (III) from 252 Cf (III) following anion and cation exchange chromatography. The alpha spectrum of the separated curium fraction showed peaks due to 246 Cm and 248 Cm while the corresponding alpha spectrum of californium fraction showed 249,250,251,252 Cf. The gamma ray abundances of 249 Cf were determined with respect to its gamma rays of 387 keV and the data agreed well with that in literature. Separated Cm(III) was further characterized by recording its time resolved fluorescence spectrum (TRFS) in aqueous medium. (author)

  6. Decay Curves and Half-Lives of Gamma-Emitting States from a Study of Prompt Fission Gamma Radiation

    Energy Technology Data Exchange (ETDEWEB)

    Albinsson, H [Chalmers Univ. of Technology, Goeteborg (SE)

    1971-04-15

    Measurements were made on the time distributions of the prompt gamma radiation emitted from fragments in the thermal-neutron induced fission of 235U. The gamma radiation emitted during different time intervals after the fission event was studied with the help of a collimator, the position of which was changed along the path of the fragments. In this way decay curves were obtained from which half-lives could be estimated. Time components with half-lives of 7.5, 18 and 60 ps were found and their relative intensities were calculated. Half-lives and associated intensities are in good agreement with earlier data from uranium and californium fission. Problems involved in this type of study are discussed. The collimator technique has proved to be effective for determination of half lives down to less than 10 ps

  7. Utilization of radiation facilities at TNRC for shielding researches and related topics

    Energy Technology Data Exchange (ETDEWEB)

    Akki, T S [Physics Department, Nuclear Physics and Radiation Shielding Division Tajura Nuclear Research Center, Tripoli (Libyan Arab Jamahiriya)

    1997-12-31

    This paper presents the running shielding research activities at Tajura Nuclear research center. The main area of researches are concentrated on the investigation of different types of concrete made from local materials such as conventional concrete, Magnetite-Limonite concrete, and heat resistant concrete. The measuring techniques used were neutron-gamma spectrometry, and activation foils. The measurements were performed using collimated beam of reactor neutrons emitted from one of the horizontal channels, as well as from californium-252 neutron source. The transmitted neutron spectra through concrete barriers of different thicknesses were measured by a scintillation spectrometer with NE-213 liquid organic scintillator. A non-destructive testing of some reactor materials were also carried out using neutron and gamma ray computerized tomography technique (CT). Some experiments were also carried out related to measurements of neutron depth dose distributions inside tissue equivalent materials. 10 figs.

  8. Physical-chemical studies of transuranium elements: Progress report for the period April 1, 1985-March 31, 1988

    International Nuclear Information System (INIS)

    Peterson, J.R.

    1987-01-01

    New knowledge is being accumulated in the role of the 5f electrons in the bonding in actinide elements and compounds, the relationships of metallic structures to metallic valence and radius, the extent and magnitude of the actinide contraction, the magnetic, thermodynamic, spectroscopic, and crystallographic properties of these materials as related to general theories, the effect of self-irradiation on chemical and physical properties, the chemical and physical consequences of radioactive decay in the bulk-phase solid state, and in general, the range of validity of the actinide hypothesis. Separate reports are given on: spectrophotometric studies of Cf(III) ions in lanthanide trihalide hosts, new ternary transplutonium chalcogenide halides, Raman spectrometric studies of lanthanide trihalides as function of T or P, and solution calorimetry of californium halides

  9. Dust grain charges in a nuclear-track plasma and the formation of dynamic vortex dust structures

    International Nuclear Information System (INIS)

    Rykov, V.A.; Khudyakov, A.V.; Filinov, V.S.; Vladimirov, V.I.; Deputatova, L.V.; Krutov, D.V.; Nefedov, A.P.; Fortov, V.E.

    2002-01-01

    Results are presented from Monte Carlo calculations of the electric charge of dust grains in a plasma produced during the slowing down of the radioactive decay products of californium nuclei in neon. The dust grain charging is explained for the first time as being due to the drift of electrons and ions in an external electric field. It is shown that the charges of the grains depend on their coordinates and strongly fluctuate with time. The time-averaged grain charges agree with the experimental data obtained on ordered liquidlike dust structures in a nuclear-track plasma. The time-averaged dust grain charges are used to carry out computer modeling of the formation of dynamic vortex structures observed in experiments. Evidence is obtained of the fact that the electrostatic forces experienced by the dust grains are potential in character

  10. Neutron radiography for nondestructive testing

    International Nuclear Information System (INIS)

    John, J.

    1979-01-01

    Neutron radiography is similar to X-ray inspection in that both depend upon use of radiation that penetrates some materials and is absorbed by others to provide a contrast image of conditions not readily available for visual inspection. X-rays are absorbed by dense materials, such as metals, whereas neutrons readily penetrate metals, but are absorbed by materials containing hydrogen. The neutron radiography has been successfully applied to a number of inspection situations. These include the inspection of explosives, advanced composites, adhesively bonded structures and a number of aircraft engine components. With the availability of Californium-252, it has become feasible to construct mobile neutron radiography systems suitable for field use. Such systems have been used for in-situ inspection of flight line aircraft, particularly to locate and measure hidden corrosion

  11. Microscopic nature of inhomogeneous line broadening: Analysis of the excitation-line-narrowing spectra of Cf4+ in CeF4

    International Nuclear Information System (INIS)

    Liu, G.K.; Huang, J.; Beitz, J.V.

    1993-01-01

    Optical transitions between 5f states of tetravalent californium ion doped (1 metal-atom %) into CeF 4 exhibit unusually large inhomogeneous broadening. The nature of the inhomogeneous broadening in this system has been studied by using fluorescence line narrowing and excitation line narrowing (ELN). It is shown that the energy distributions of different electronic states of Cf 4+ in this system are correlated. In the ELN experiments, reduced excitation linewidth was obtained when selectively monitoring fluorescence emission. A linear relation was observed between the excitation energies of crystal-field states of the 5 G 4' manifold and the fluorescence wavelength monitored across the inhomogeneous profile of a 5 G 6' -- 7 F 6' transition. Analysis of these results by means of a microscopic theory proposed by Laird and Skinner [J. Chem. Phys. 90, 3880 (1989)] has provided insights into the structural properties of this disordered system

  12. Transuranic biokinetic parameters for marine invertebrates--a review.

    Science.gov (United States)

    Ryan, T P

    2002-04-01

    A catalogue of biokinetic parameters for the transuranic elements plutonium, americium, curium, neptunium, and californium in marine invertebrates is presented. The parameters considered are: the seawater-animal concentration factor (CF); the sediment-animal concentration ratio (CR); transuranic assimilation efficiency; transuranic tissue distribution and transuranic elimination rates. With respect to the seawater-animal CF, authors differ considerably on how they define this parameter and a seven-point reporting system is suggested. Transuranic uptake from sediment by animals is characterised by low CRs. The assimilation efficiencies of transuranic elements in marine invertebrates are high compared to vertebrates and mammals in general and the distribution of transuranics within the body tissue of an animal is dependent on the uptake path. The elimination of transuranics from most species examined conformed to a standard biphasic exponential model though some examples with three elimination phases were identified.

  13. Alternative irradiation system for efficiency manganese bath determination

    Energy Technology Data Exchange (ETDEWEB)

    Passos Leite, Sandro, E-mail: sandro@ird.gov.b [Programa de Engenharia Nuclear/COPPE, Universidade Federal do Rio de Janeiro, Ilha do Fundao, Caixa Postal 68509, 21945-970, Rio de Janeiro, RJ (Brazil); Wagner Pereira, Walsan, E-mail: walsan@ird.gov.b [Instituto de Radioprotecao e Dosimetria LNMRI/IRD/CNEN, Av. Salvador Allende, s/no, Recreio dos Bandeirantes, CEP: 22780-160, Rio de Janeiro (Brazil); Xavier da Silva, Ademir, E-mail: ademir@con.ufrj.b [Programa de Engenharia Nuclear/COPPE, Universidade Federal do Rio de Janeiro, Ilha do Fundao, Caixa Postal 68509, 21945-970, Rio de Janeiro, RJ (Brazil); Simoes da Fonseca, Evaldo, E-mail: evaldo@ird.gov.b [Instituto de Radioprotecao e Dosimetria LNMRI/IRD/CNEN, Av. Salvador Allende, s/no, Recreio dos Bandeirantes, CEP: 22780-160, Rio de Janeiro (Brazil); Souza Patrao, Karla Cristina de, E-mail: karla@ird.gov.b [Instituto de Radioprotecao e Dosimetria LNMRI/IRD/CNEN, Av. Salvador Allende, s/no, Recreio dos Bandeirantes, CEP: 22780-160, Rio de Janeiro (Brazil)

    2010-12-15

    An alternative irradiation system, which works with a radionuclide neutron source and manganese sulphate solution volume have been proposed for efficiency determination of a Manganese Bath System (MBS). This irradiation system was designed by simulation with MCNP5 code, considering a californium neutron source in several manganese sulphate volumes and different neutron reflectors. Although its solution specific activity are less than those in nuclear reactors, the simulation results have showed that the irradiation system proposed takes a manganese neutron capture increase up to 200 times when it compared to manganese neutron capture from a MBS whose diameter is about 100 cm. That becomes possible to use those samples for some of the absolute specific activity measuring methods.

  14. The CARIBU EBIS control and synchronization system

    Energy Technology Data Exchange (ETDEWEB)

    Dickerson, Clayton, E-mail: cdickerson@anl.gov; Peters, Christopher, E-mail: cdickerson@anl.gov [Argonne National Laboratory, Argonne, IL 60439 (United States)

    2015-01-09

    The Californium Rare Isotope Breeder Upgrade (CARIBU) Electron Beam Ion Source (EBIS) charge breeder has been built and tested. The bases of the CARIBU EBIS electrical system are four voltage platforms on which both DC and pulsed high voltage outputs are controlled. The high voltage output pulses are created with either a combination of a function generator and a high voltage amplifier, or two high voltage DC power supplies and a high voltage solid state switch. Proper synchronization of the pulsed voltages, fundamental to optimizing the charge breeding performance, is achieved with triggering from a digital delay pulse generator. The control system is based on National Instruments realtime controllers and LabVIEW software implementing Functional Global Variables (FGV) to store and access instrument parameters. Fiber optic converters enable network communication and triggering across the platforms.

  15. Review of microscopic integral cross section data in fundamental reactor dosimetry benchmark neutron fields

    International Nuclear Information System (INIS)

    Fabry, A.; McElroy, W.N.; Kellogg, L.S.; Lippincott, E.P.; Grundl, J.A.; Gilliam, D.M.; Hansen, G.E.

    1976-01-01

    This paper is intended to review and critically discuss microscopic integral cross section measurement and calculation data for fundamental reactor dosimetry benchmark neutron fields. Specifically the review covers the following fundamental benchmarks: the spontaneous californium-252 fission neutron spectrum standard field; the thermal-neutron induced uranium-235 fission neutron spectrum standard field; the (secondary) intermediate-energy standard neutron field at the center of the Mol-ΣΣ, NISUS, and ITN-ΣΣ facilities; the reference neutron field at the center of the Coupled Fast Reactor Measurement Facility; the reference neutron field at the center of the 10% enriched uranium metal, cylindrical, fast critical; the (primary) Intermediate-Energy Standard Neutron Field

  16. Measurements of the neutron capture cross sections and incineration potentials of minor-actinides in high thermal neutron fluxes: Impact on the transmutation of nuclear wastes; Mesures des sections efficaces de capture et potentiels d'incineration des actinides mineurs dans les hauts flux de neutrons: Impact sur la transmutation des dechets

    Energy Technology Data Exchange (ETDEWEB)

    Bringer, O

    2007-10-15

    This thesis comes within the framework of minor-actinide nuclear transmutation studies. First of all, we have evaluated the impact of minor actinide nuclear data uncertainties within the cases of {sup 241}Am and {sup 237}Np incineration in three different reactor spectra: EFR (fast), GT-MHR (epithermal) and HI-HWR (thermal). The nuclear parameters which give the highest uncertainties were thus highlighted. As a result of fact, we have tried to reduce data uncertainties, in the thermal energy region, for one part of them through experimental campaigns in the moderated high intensity neutron fluxes of ILL reactor (Grenoble). These measurements were focused onto the incineration and transmutation of the americium-241, the curium-244 and the californium-249 isotopes. Finally, the values of 12 different cross sections and the {sup 241}Am isomeric branching ratio were precisely measured at thermal energy point. (author)

  17. Environmental assessment of the thermal neutron activation explosive detection system for concourse use at US airports

    Energy Technology Data Exchange (ETDEWEB)

    Jones, C.G.

    1990-08-01

    This document is an environmental assessment of a system designed to detect the presence of explosives in checked airline baggage or cargo. The system is meant to be installed at the concourse or lobby ticketing areas of US commercial airports and uses a sealed radioactive source of californium-252 to irradiate baggage items. The major impact of the use of this system arises from direct exposure of the public to scattered or leakage radiation from the source and to induced radioactivity in baggage items. Under normal operation and the most likely accident scenarios, the environmental impacts that would be created by the proposed licensing action would not be significant. 44 refs., 19 figs., 18 tabs.

  18. Radionuclide toxicity

    International Nuclear Information System (INIS)

    Galle, P.

    1982-01-01

    The aim of this symposium was to review the radionuclide toxicity problems. Five topics were discussed: (1) natural and artificial radionuclides (origin, presence or emission in the environment, human irradiation); (2) environmental behaviour of radionuclides and transfer to man; (3) metabolism and toxicity of radionuclides (radioiodine, strontium, rare gas released from nuclear power plants, ruthenium-activation metals, rare earths, tritium, carbon 14, plutonium, americium, curium and einsteinium, neptunium, californium, uranium) cancerogenous effects of radon 222 and of its danghter products; (4) comparison of the hazards of various types of energy; (5) human epidemiology of radionuclide toxicity (bone cancer induction by radium, lung cancer induction by radon daughter products, liver cancer and leukaemia following the use of Thorotrast, thyroid cancer; other site of cancer induction by radionuclides) [fr

  19. A survey of uses and users of 252Cf

    International Nuclear Information System (INIS)

    Bigelow, J.E.; Alexander, C.W.; King, L.J.; Knauer, J.B.; Notz, K.J.

    1989-01-01

    Californium-252, which is one of the transuranium-element isotopes being produced in the Radiochemical Engineering Development Center (REDC) at Oak Ridge National Laboratory (ORNL), has found many applications in service to industry and medicine. As a neutron source, 252 Cf is unique in providing a highly concentrated and extremely reliable neutron spectrum from a very small assembly. Over the past 22 years, 252 Cf has been applied with great success to cancer therapy, to neutron radiography of objects ranging from flowers to entire aircraft, to startup sources for nuclear reactors, to fission activation assay for quality control and safeguards of all commercial nuclear fuel, and to many other beneficial uses, some of which are now poised for further growth. The extensive exploitation of this highly specialized product has been made possible through 252 Sales/Loan programs sponsored by the US DOE Office of Nuclear Materials Production, initially at the Savannah River Laboratory and now at ORNL

  20. Off-line commissioning of EBIS and plans for its integration into ATLAS and CARIBU

    Energy Technology Data Exchange (ETDEWEB)

    Ostroumov, P. N., E-mail: ostroumov@anl.gov; Barcikowski, A.; Dickerson, C. A.; Mustapha, B.; Perry, A.; Sharamentov, S. I.; Vondrasek, R. C.; Zinkann, G. [Argonne National Laboratory, Argonne, Illinois 60439 (United States)

    2016-02-15

    An Electron Beam Ion Source Charge Breeder (EBIS-CB) has been developed at Argonne to breed radioactive beams from the CAlifornium Rare Isotope Breeder Upgrade (CARIBU) facility at Argonne Tandem Linac Accelerator System (ATLAS). The EBIS-CB will replace the existing ECR charge breeder to increase the intensity and significantly improve the purity of reaccelerated radioactive ion beams. The CARIBU EBIS-CB has been successfully commissioned offline with an external singly charged cesium ion source. The performance of the EBIS fully meets the specifications to breed rare isotope beams delivered from CARIBU. The EBIS is being relocated and integrated into ATLAS and CARIBU. A long electrostatic beam transport system including two 180° bends in the vertical plane has been designed. The commissioning of the EBIS and the beam transport system in their permanent location will start at the end of this year.

  1. Off-line commissioning of EBIS and plans for its integration into ATLAS and CARIBU

    Science.gov (United States)

    Ostroumov, P. N.; Barcikowski, A.; Dickerson, C. A.; Mustapha, B.; Perry, A.; Sharamentov, S. I.; Vondrasek, R. C.; Zinkann, G.

    2016-02-01

    An Electron Beam Ion Source Charge Breeder (EBIS-CB) has been developed at Argonne to breed radioactive beams from the CAlifornium Rare Isotope Breeder Upgrade (CARIBU) facility at Argonne Tandem Linac Accelerator System (ATLAS). The EBIS-CB will replace the existing ECR charge breeder to increase the intensity and significantly improve the purity of reaccelerated radioactive ion beams. The CARIBU EBIS-CB has been successfully commissioned offline with an external singly charged cesium ion source. The performance of the EBIS fully meets the specifications to breed rare isotope beams delivered from CARIBU. The EBIS is being relocated and integrated into ATLAS and CARIBU. A long electrostatic beam transport system including two 180° bends in the vertical plane has been designed. The commissioning of the EBIS and the beam transport system in their permanent location will start at the end of this year.

  2. Chemical consequences of radioactive decay. 1. Study of 249Cf ingrowth into crystalline 249BkBr3: a new crystalline phase of CfBr3

    International Nuclear Information System (INIS)

    Young, J.P.; Haire, R.G.; Peterson, J.R.; Ensor, D.D.; Fellows, R.L.

    1980-01-01

    Spectrophotometric and x-ray powder diffraction methods have been applied to a study of the ingrowth of californium-249 by β - decay of berkelium-249 in crystalline 249 BkBr 3 . It was found that the Cf daughter grows in with the same oxidation state and crystal structure as the parent. Thus, six-coordinate BkBr 3 (AlCl 3 -type monoclinic structure) generates six-coordinate CfBr 3 , and eight-coordinate BkBr 3 (PuBr 3 -type orthorhombic structure) generates eight-coordinate CfBr 3 , a previously unknown form of CfBr 3 . It was also found that the daughter Cf(III) in the BkBr 3 parent compound can be reduced to Cf(II) by treatment with H 2 , as it can in pure CfBr 3 . 5 figures

  3. Chelation and stabilization of berkelium in oxidation state +IV

    Science.gov (United States)

    Deblonde, Gauthier J.-P.; Sturzbecher-Hoehne, Manuel; Rupert, Peter B.; An, Dahlia D.; Illy, Marie-Claire; Ralston, Corie Y.; Brabec, Jiri; de Jong, Wibe A.; Strong, Roland K.; Abergel, Rebecca J.

    2017-09-01

    Berkelium (Bk) has been predicted to be the only transplutonium element able to exhibit both +III and +IV oxidation states in solution, but evidence of a stable oxidized Bk chelate has so far remained elusive. Here we describe the stabilization of the heaviest 4+ ion of the periodic table, under mild aqueous conditions, using a siderophore derivative. The resulting Bk(IV) complex exhibits luminescence via sensitization through an intramolecular antenna effect. This neutral Bk(IV) coordination compound is not sequestered by the protein siderocalin—a mammalian metal transporter—in contrast to the negatively charged species obtained with neighbouring trivalent actinides americium, curium and californium (Cf). The corresponding Cf(III)-ligand-protein ternary adduct was characterized by X-ray diffraction analysis. Combined with theoretical predictions, these data add significant insight to the field of transplutonium chemistry, and may lead to innovative Bk separation and purification processes.

  4. Reactor production of 252Cf and transcurium isotopes

    International Nuclear Information System (INIS)

    Alexander, C.W.; Halperin, J.; Walker, R.L.; Bigelow, J.E.

    1990-01-01

    Berkelium, californium, einsteinium, and fermium are currently produced in the High Flux Isotope Reactor (HFIR) and recovered in the Radiochemical Engineering Development Center (REDC) at the Oak Ridge National Laboratory (ORNL). All the isotopes are used for research. In addition, 252 Cf, 253 Es, and 255 Fm have been considered or are used for industrial or medical applications. ORNL is the sole producer of these transcurium isotopes in the western world. A wide range of actinide samples were irradiated in special test assemblies at the Fast Flux Test Facility (FFTF) at Hanford, Washington. The purpose of the experiments was to evaluate the usefulness of the two-group flux model for transmutations in the special assemblies with an eventual goal of determining the feasibility of producing macro amounts of transcurium isotopes in the FFTF. Preliminary results from the production of 254g Es from 252 Cf will be discussed. 14 refs., 5 tabs

  5. Robotics and remote systems applications

    International Nuclear Information System (INIS)

    Rabold, D.E.

    1996-01-01

    This article is a review of numerous remote inspection techniques in use at the Savannah River (and other) facilities. These include: (1) reactor tank inspection robot, (2) californium waste removal robot, (3) fuel rod lubrication robot, (4) cesium source manipulation robot, (5) tank 13 survey and decontamination robots, (6) hot gang valve corridor decontamination and junction box removal robots, (7) lead removal from deionizer vessels robot, (8) HB line cleanup robot, (9) remote operation of a front end loader at WIPP, (10) remote overhead video extendible robot, (11) semi-intelligent mobile observing navigator, (12) remote camera systems in the SRS canyons, (13) cameras and borescope for the DWPF, (14) Hanford waste tank camera system, (15) in-tank precipitation camera system, (16) F-area retention basin pipe crawler, (17) waste tank wall crawler and annulus camera, (18) duct inspection, and (19) deionizer resin sampling

  6. General purpose nuclear irradiation chamber

    International Nuclear Information System (INIS)

    Nurul Fadzlin Hasbullah; Nuurul Iffah Che Omar; Nahrul Khair Alang Md Rashid; Jaafar Abdullah

    2013-01-01

    Nuclear technology has found a great need for use in medicine, industry, and research. Smoke detectors in our homes, medical treatments and new varieties of plants by irradiating its seeds are just a few examples of the benefits of nuclear technology. Portable neutron source such as Californium-252, available at Industrial Technology Division (BTI/ PAT), Malaysian Nuclear Agency, has a 2.645 year half-life. However, 252 Cf is known to emit gamma radiation from the source. Thus, this chamber aims to provide a proper gamma shielding for samples to distinguish the use of mixed neutron with gamma-rays or pure neutron radiation. The chamber is compatible to be used with other portable neutron sources such as 241 Am-Be as well as the reactor TRIGA PUSPATI for higher neutron dose. This chamber was designed through a collaborative effort of Kulliyyah Engineering, IIUM with the Industrial Technology Division (BTI) team, Malaysian Nuclear Agency. (Author)

  7. Environmental assessment of the thermal neutron activation explosive detection system for concourse use at US airports

    International Nuclear Information System (INIS)

    Jones, C.G.

    1990-08-01

    This document is an environmental assessment of a system designed to detect the presence of explosives in checked airline baggage or cargo. The system is meant to be installed at the concourse or lobby ticketing areas of US commercial airports and uses a sealed radioactive source of californium-252 to irradiate baggage items. The major impact of the use of this system arises from direct exposure of the public to scattered or leakage radiation from the source and to induced radioactivity in baggage items. Under normal operation and the most likely accident scenarios, the environmental impacts that would be created by the proposed licensing action would not be significant. 44 refs., 19 figs., 18 tabs

  8. Test and evaluation results of the 252Cf shuffler at the Savannah River Plant

    International Nuclear Information System (INIS)

    Crane, T.W.

    1981-03-01

    The 252 Cf Shuffler, a nondestructive assay instrument employing californium neutron source irradiation and delayed-neutron counting, was developed for measuring 235 U content of scrap and waste items generated at the Savannah River Plant (SRP) reactor fuel fabrication facility. The scrap and waste items include high-purity uranium-aluminum alloy ingots as well as pieces of castings, saw and lathe chips from machining operations, low-purity items such as oxides of uranium or uranium intermixed with flux materials found in recovery operations, and materials not recoverable at SRP such as floor sweepings or residues from the uranium scrap recovery operation. The uranium contains about 60% 235 U with the remaining isotopes being 236 U, 238 U, and 234 U in descending order. The test and evaluation at SRP concluded that the accuracy, safety, reliability, and ease of use made the 252 Cf Shuffler a suitable instrument for routine use in an industrial, production-oriented plant

  9. Provenance and composition study on Terengganu inscribed stone using in-situ nuclear technology

    International Nuclear Information System (INIS)

    Jaafar Abdullah; Roslan Yahya; Hearie Hassan; Engku Mohd Fahmi Engku Chik; Mohamad Rabaie Shari; Airwan Affendi Mahmood; Abdul Quddoss Abu Bakar; Ainul Mardhiah Terry

    2012-01-01

    This paper focused on the analysis of trace elements and provenance study of the Inscribed Stone of Terengganu (BBPT) using Neutron-induced Prompt Gamma-Ray Techniques (NIPGAT). In this study, portable NIPGAT system was designed and developed by using volume-based measurement. It is a nondestructive testing technique for the samples. This system uses low activity of isotopic neutron radioactive source from californium-252 (Cf-252) as an irradiation source. Gamma ray spectroscopy as well as specialized computer software has been utilized to conduct the research. The study has determined that the stone was a dolerite stone based on the composition of the stone elements. Although most of the scientific data for this study have been collected, this project is still running to complete the scope of provenance study. (author)

  10. Measurements of the neutron capture cross sections and incineration potentials of minor-actinides in high thermal neutron fluxes: Impact on the transmutation of nuclear wastes

    International Nuclear Information System (INIS)

    Bringer, O.

    2007-10-01

    This thesis comes within the framework of minor-actinide nuclear transmutation studies. First of all, we have evaluated the impact of minor actinide nuclear data uncertainties within the cases of 241 Am and 237 Np incineration in three different reactor spectra: EFR (fast), GT-MHR (epithermal) and HI-HWR (thermal). The nuclear parameters which give the highest uncertainties were thus highlighted. As a result of fact, we have tried to reduce data uncertainties, in the thermal energy region, for one part of them through experimental campaigns in the moderated high intensity neutron fluxes of ILL reactor (Grenoble). These measurements were focused onto the incineration and transmutation of the americium-241, the curium-244 and the californium-249 isotopes. Finally, the values of 12 different cross sections and the 241 Am isomeric branching ratio were precisely measured at thermal energy point. (author)

  11. Nuclear fission and the transuranium elements

    International Nuclear Information System (INIS)

    Seaborg, G.T.

    1989-02-01

    Many of the transuranium elements are produced and isolated in large quantities through the use of neutrons furnished by nuclear fission reactions: plutonium (atomic number 94) in ton quantities; neptunium (93), americium (95), and curium (96) in kilogram quantities; berkelium (97) in 100 milligram quantities; californium (98) in gram quantities; and einsteinium (99) in milligram quantities. Transuranium isotopes have found many practical applications---as nuclear fuel for the large-scale generation of electricity, as compact, long-lived power sources for use in space exploration, as means for diagnosis and treatment in the medical area, and as tools in numerous industrial processes. Of particular interest is the unusual chemistry and impact of these heaviest elements on the periodic table. This account will feature these aspects. 9 refs., 5 figs

  12. Operational safety at the radiometallurgy laboratory of Fontenay-aux-Roses

    International Nuclear Information System (INIS)

    Hayet, Lucien; Petit, Pierre; Conche, Roger.

    1976-01-01

    Opened in 1967, the Radiometallurgy Laboratory is responsible for the examination of plutonium 239 based nuclear fuels of breeder reactors such as Rapsodie and Phenix. Part of the same laboratory is also responsible for the manufacture of californium 252 sources. These neutron sources can have a neutron fluency yield of 2,3 10 10 n/s/4π (i.e. 10mg of 252cf). This large laboratory includes a total area of 117m 2 of hot surfaces. It also includes 14 high activity cells with a capacity of 100000Ci at 1MeV. Located only 7km from the center of Paris, it must incorporate a special design and a particularly sure safety policy. Several statistics are given: irradiations, contaminations, incidents, quantity of fissile material, solid and liquid wastes etc... The principles of safety management are outlined and an analysis given of this basic nuclear facility [fr

  13. Review of microscopic integral cross section data in fundamental reactor dosimetry benchmark neutron fields

    International Nuclear Information System (INIS)

    Fabry, A.; McElroy, W.N.; Kellogg, L.S.; Lippincott, E.P.; Grundl, J.A.; Gilliam, D.M.; Hansen, G.E.

    1976-10-01

    The paper is intended to review and critically discuss microscopic integral cross section measurement and calculation data for fundamental reactor dosimetry benchmark neutron fields. Specifically the review covers the following fundamental benchmarks: (1) the spontaneous californium-252 fission neutron spectrum standard field; (2) the thermal-neutron induced uranium-235 fission neutron spectrum standard field; (3) the (secondary) intermediate-energy standard neutron field at the center of the Mol-ΣΣ, NISUS, and ITN--ΣΣ facilities; (4) the reference neutron field at the center of the Coupled Fast Reactor Measurement Facility (CFRMF); (5) the reference neutron field at the center of the 10 percent enriched uranium metal, cylindrical, fast critical; and (6) the (primary) Intermediate-Energy Standard Neutron Field

  14. Triton and alpha-particle contribution from LiF converter for neutron dosimeter

    CERN Document Server

    Camacho, M E; Balcazar, M

    1999-01-01

    A personnel neutron dosimeter prototype based on chemical and electrochemical etched CR-39 detector, combined with LiF converter, has been calibrated using an ICRP-like phantom, under a heavy-water moderated Californium source neutron spectra; A conversion factor of 1.052+-126 spots cm sup - sup 2 mSv sup - sup 1 was obtained. The sealing properties of the detector holder showed a ten-fold reduction in radon background when it was tested in a high radon atmosphere. A convenient mechanical shock resistance was achieved in LiF converters by sintering to 11 tons pressure LiF powder at 650 deg. C, during one hour.

  15. Fabrication of 50-mg 252Cf neutron sources for the FDA [Food and Drug Administration] activation analysis facility

    International Nuclear Information System (INIS)

    Bigelow, J.E.; Cagle, E.B.; Knauer, J.B.

    1987-01-01

    The Transuranium Processing Plant (TPP) at ORNL has been requested by the Food and Drug Administration (FDA) to furnish 200 mg of 252 Cf for use in their new activation analysis facility. This paper discusses the procedure to be employed in fabricating the californium into four neutron sources, each containing a nominal 50-mg of 252 Cf. The ORNL Model LSD (Large, Stainless steel, Doubly encapsulated) neutron source consists of a 6.33-mm-diam aluminum pellet doubly encapsulated in Type 304L stainless steel. The pellet is comprised of an aluminum tube holding Cf 2 O 2 SO 4 microspheres confined by pressed aluminum powder. The microspheres are prepared in a separate vessel and then transferred into the specially designed aluminum tube prior to pressing

  16. Nuclear fission and the transuranium elements

    Energy Technology Data Exchange (ETDEWEB)

    Seaborg, G.T.

    1989-02-01

    Many of the transuranium elements are produced and isolated in large quantities through the use of neutrons furnished by nuclear fission reactions: plutonium (atomic number 94) in ton quantities; neptunium (93), americium (95), and curium (96) in kilogram quantities; berkelium (97) in 100 milligram quantities; californium (98) in gram quantities; and einsteinium (99) in milligram quantities. Transuranium isotopes have found many practical applications---as nuclear fuel for the large-scale generation of electricity, as compact, long-lived power sources for use in space exploration, as means for diagnosis and treatment in the medical area, and as tools in numerous industrial processes. Of particular interest is the unusual chemistry and impact of these heaviest elements on the periodic table. This account will feature these aspects. 9 refs., 5 figs.

  17. Spectrum-averaged cross-section measurement of /sup 103/Rh(n,n)/sup 103m/Rh in the /sup 252/Cf fission neutron spectrum

    International Nuclear Information System (INIS)

    Lamaze, G.P.; Schima, F.J.; Eisenhauer, C.M.; Spiegel, V.

    1988-01-01

    Because of the similarity in energy dependence of the /sup 103/Rh(n,n') differential cross section to the kerma muscle response function for neutrons, rhodium may be useful as a neutron kerma monitor. In support of its use as a neutron monitor, the spectrum-averaged cross section σ-bar has been measured for a /sup 252/Cf fission neutron spectrum. Pairs of thin rhodium samples were irradiated on opposite sides of a thinly encapsulated /sup 252/Cf neutron source. The neutron emission rate of the /sup 252/Cf source was determined by the manganous sulfate (MnSO/sub 4/) bath technique. In this method, the californium source emission rate is determined by comparison to the known emission rate of NBS-I, a standard radium-beryllium neutron source. The neutron fluence incident on the rhodium samples is determined from the californium source strength, average sample-to-source distance, and the duration of the irradiation. Corrections are made for neutron scattering saturation of activity, and attenuation of the X rays by the sample during counting. The X rays were detected with an intrinsic germanium detector designed specifically for low-energy X-ray detection. The activity was not determined by absolute counting so that the final results depend on the value of P/sub Κx/, to total Κ X-ray emission probability. The results of five separate irradiations yield a value of σ-bar . P/sub Κx/ = 62.3 +- 1.9 mb. Using the most recently published value of P/sub Κx/ gives a value of σ-bar = 739 +- 22 mb. A discussion of systematic uncertainties is given

  18. Study of reproducibility of measurements with the spectrometer of Bonner multispheres

    International Nuclear Information System (INIS)

    Azevedo, G.A.; Pereira, W.W.; Patrao, K.C.S.; Fonseca, E.S.

    2013-01-01

    This work aims to study the metrological behavior of the Bonner Multisphere Spectrometer (BMS) of the LN / LNMRI / IRD - Laboratorio Metrologia de Neutrons / Laboratorio Nacional de Metrologia e Radiacao Ionizante / Instituto de Radioprotecao e Dosimetria, for measurements in repeatability and reproducibility conditions. Initially, a simulation was done by applying the Monte Carlo method, using the MCNP code and respecting the ISO 8529-1 (2001), using the sources of Californium ( 252 Cf), Americium-Beryllium ( 241 AmBe) and californium in heavy water (Cf + D 2 O), all located at a distance of 100 cm from the neutron detector ( 6 Li (Eu) - crystal scintillator). In this program, the counting of neutrons that are captured by the detector was made. The source is located in the center of a sphere of radius 300 cm. Analyzes the impact of these neutrons in a point of the sphere wall, which in this case acted as a neutron detector and from there, it is estimated the number of neutrons that collide in the whole sphere. The purpose is to obtain the neutron count for different energy bands in a solid field of neutrons, since they have a spectrum ranging from a low to a high energy that can also vary within a particular environment. Wishes to obtain new fields with different sources and moderators materials to be used as new reference fields. Measurements are being conducted for these fields, with the aim of analyzing the variability conditions of the measurement (repeatability and reproducibility) in LEN - Laboratorio de Espectrometria de Neutrons of the LN/LMNRI/IRD. Thus, the spectrometer will be used to improve both the knowledge of the spectrum as the standard of neutrons of the lab, proving that a spectrometry is essential for correct measurement

  19. 78 FR 3029 - Notice of Lodging of Proposed Amended Consent Decree Under the Comprehensive Environmental...

    Science.gov (United States)

    2013-01-15

    ... (represented by Kenneth Senser as the Executor the Estate of Saul Senser) will pay the United States $243,250... claim, the Estate of Saul Senser, together with Kenneth Senser in his capacity as Executor of the Estate...

  20. K některým otázkám etnochoreologického studia: tanec, gender a politika

    Czech Academy of Sciences Publication Activity Database

    Stavělová, Daniela

    2010-01-01

    Roč. 20, č. 4 (2010), s. 239-243 ISSN 0862-8351 Institutional research plan: CEZ:AV0Z90580513 Keywords : dance * gender * politics * national movement * identity Subject RIV: AC - Archeology, Anthropology, Ethnology

  1. Integration of the information problem-solving skill in an educational programme: The effects of learning with authentic tasks.

    NARCIS (Netherlands)

    Brand-Gruwel, Saskia; Wopereis, Iwan

    2008-01-01

    Brand-Gruwel, S., & Wopereis, I. (2006). Integration of the information problem-solving skill in an educational programme: The effects of learning with authentic tasks. Technology, Instruction, Cognition, and Learning, 4, 243-263.

  2. (obese) gene of mithun (Bos frontalis)

    African Journals Online (AJOL)

    Nishant-3

    2Division of Animal Genetics, Indian Veterinary Research Institute, Izatnagar, Bareilly-243 122, India. 3Department of Animal ... closely associated with social, cultural, religious and livelihood of the tribes .... Southeast Asia (Gupta et al., 1999).

  3. Large-scale evaluation of carnivore road mortality: the effect of landscape and local scale characteristics

    Czech Academy of Sciences Publication Activity Database

    Červinka, J.; Riegert, J.; Grill, S.; Šálek, Martin

    2015-01-01

    Roč. 60, č. 3 (2015), s. 233-243 ISSN 2199-2401 Institutional support: RVO:68081766 Keywords : Carnivores * Landscape characteristics * Linear structures * Local characteristics * Road mortality * Temporal pattern Subject RIV: EH - Ecology, Behaviour

  4. Potential emigration of Siberian cattle germplasm on Chirikof Island ...

    Indian Academy of Sciences (India)

    2USDA Agricultural Research Service, 243 Fort Keogh Road, Miles City, MT 59301, USA ... 4Department of Environmental and Biological Sciences, University of ..... Food and. Agriculture Organization of the United Nations, Rome, Italy.

  5. Cyclotella hinziae sp. nov. – a small Cyclotella (Bacillariophyceae) from subalpine lake Schliersee (Bavaria, Germany)

    Czech Academy of Sciences Publication Activity Database

    Houk, Václav; König, C.; Klee, R.

    2015-01-01

    Roč. 15, č. 2 (2015), s. 235-243 ISSN 1802-5439 Institutional support: RVO:67985939 Keywords : halassiosiraceae * taxonomy * valve ultrastructure Subject RIV: EF - Botanics Impact factor: 2.026, year: 2015

  6. Estimation of radioactive contaminants in Cm242 and Cm244 isotopic fuels

    International Nuclear Information System (INIS)

    Terent'ev, V.P.; Makarenko, A.I.

    1972-01-01

    The radiation properties of Cm 242 and Cm 244 preparations and the effect on them of possible contaminants are considered. One of the most important requirements for K alpha active fuels for radioisotope thermoelectric batteries is ensuring a low ionizing radiation background. In determining the effect of impurities on the radiation properties of a preparation, quantitative evaluation of certain factors is sufficient. In a Cm 242 preparation it is possible to show that Am 241 and Cm 243 are undesirable impurities. The presence of Am 241 increases the soft gamma output by 20%. The presence of Cm 243 may double the dose rate from an unshielded preparation and increase the hard gamma output 10-fold. The properties of Cm 242 preparations deteriorate when Am 243 and Cm 243 are present

  7. Nápěvy písní k tanci "do kolečka"– textová výstavba a deklamace

    Czech Academy of Sciences Publication Activity Database

    Vejvoda, Zdeněk

    2006-01-01

    Roč. 93, č. 3 (2006), s. 243-258 ISSN 0009-0794 Institutional research plan: CEZ:AV0Z90580513 Keywords : round and round * structural analysis * declamation Subject RIV: AC - Archeology, Anthropology, Ethnology

  8. The pink pigment prodigiosin: Vibrational spectroscopy and DFT calculations

    Czech Academy of Sciences Publication Activity Database

    Jehlička, J.; Němec, I.; Varnali, T.; Culka, A.; Svatoš, A.; Frank, Otakar; Oren, A.; Edwards, G.M.

    2016-01-01

    Roč. 134, NOV 2016 (2016), s. 234-243 ISSN 0143-7208 Institutional support: RVO:61388955 Keywords : prodigiosin * serratia marcescens * raman spectroscopy Subject RIV: CG - Electrochemistry Impact factor: 3.473, year: 2016

  9. delta-Thiolactones as Prodrugs of Thiol-Based Glutamate Carboxypeptidase II (GCPII) Inhibitors

    Czech Academy of Sciences Publication Activity Database

    Ferraris, D. V.; Majer, Pavel; Ni, C.; Slusher, C. E.; Rais, R.; Wu, Y.; Wozniak, K. M.; Alt, J.; Rojas, C.; Slusher, B. S.; Tsukamoto, T.

    2014-01-01

    Roč. 57, č. 1 (2014), s. 243-247 ISSN 0022-2623 Institutional support: RVO:61388963 Keywords : pharmacokinetics * discovery * disorders * diagnosis * pain Subject RIV: CC - Organic Chemistry Impact factor: 5.447, year: 2014

  10. Enforcement and Effectiveness of Consumer Law in the Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Pauknerová, Monika; Skalská, H.

    2017-01-01

    Roč. 7, č. 4 (2017), s. 243-254 ISSN 1805-8396 Institutional support: RVO:68378122 Keywords : consumer law * enforcement * alternative dispute resolution Subject RIV: AG - Legal Sciences OBOR OECD: Law

  11. Enhancement of the feeding value of wheat offal for broiler feeding ...

    African Journals Online (AJOL)

    Dr. &Mrs Tunde Lawal

    2012-08-14

    Aug 14, 2012 ... ... Ladoke Akintola University of Science and Technology, Ogbomosho, ... degraded the WTO, it was observed that there was improvement in crude protein value from 2.43 g/100 ..... Principles and Procedures of statistics.

  12. PRESUMPTIVE DIAGNOSIS OF SCHISTOSOMA HAEMATOBIUM ...

    African Journals Online (AJOL)

    boaz

    AFRICAN JOURNAL OF CLINICAL AND EXPERIMENTAL MICROBIOLOGY .... study. Sample Collection and Processing. Two specimen containers were given to each subject and the ... false positive results and 24.3% true negative results.

  13. S¯adhan¯a Vol. 32, 2007 Subject Index

    Indian Academy of Sciences (India)

    confined high strength concrete. 243. Control. Laminar separation bubbles: ... Hybrid LES-Review and assessment. 501 ... control. 103. Fatality risk. Prediction of traffic fatalities and prospects for ... treatment furnaces of steel casting industries.

  14. Arsenic mineralogy of near-neutral soils and mining waste at the Smolotely-Líšnice historical gold district, Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Drahota, P.; Kulakowski, O.; Culka, A.; Knappová, M.; Rohovec, Jan; Veselovský, F.; Racek, M.

    2018-01-01

    Roč. 89, February (2018), s. 243-254 ISSN 0883-2927 Institutional support: RVO:67985831 Keywords : soil * mining waste * pharmacosiderite * yukonite * arseniosiderite Subject RIV: DB - Geology ; Mineralogy OBOR OECD: Mineralogy Impact factor: 2.581, year: 2016

  15. Effect of low protein diets and lysine supplementation on growth ...

    African Journals Online (AJOL)

    Dr. Ajit

    2012-07-17

    Jul 17, 2012 ... 3Division of Livestock Product Technology, Indian Veterinary Research Institute, Izatnagar – 243 ... Key words: Carcass trait, low protein, lysine, meat quality, pigs. ... functional activities, reproduction and disease resistance.

  16. Report on progress of researches by common utilization of JAERI nuclear facilities, for fiscal 1993

    International Nuclear Information System (INIS)

    1994-07-01

    The results of the joint researches by utilizing the facilities of JAERI in 1993 fiscal year were summarized. The number of research themes in 1993 was 228 cases. In this book, 243 reports are collected. (J.P.N.)

  17. 46 CFR 391.0 - Statutory provisions; section 607, Merchant Marine Act, 1936, as amended.

    Science.gov (United States)

    2010-10-01

    ... under section 243 of the Internal Revenue Code of 1954, and (D) Interest income exempt from taxation... for research, development, and design expenses incident to new and advanced ship design, machinery and...

  18. Three new, seemingly-cryptic species in the lichen genus Caloplaca (Teloschistaceae) distinguished in two-phase phenotype evaluation

    Czech Academy of Sciences Publication Activity Database

    Frolov, I.; Vondrák, Jan; Fernández-Mendoza, F.; Wilk, K.; Khodosovtsev, A.; Halici, M.G.

    2016-01-01

    Roč. 53, 3-4 (2016), s. 243-262 ISSN 0003-3847 Institutional support: RVO:67985939 Keywords : phylogenetic analyses * partition schemes * forming ascomycota Subject RIV: EF - Botanics Impact factor: 0.600, year: 2016

  19. Cervical cancer in South Africa: An over- view of current status and ...

    African Journals Online (AJOL)

    Current estimates are that 493 243 women are diagnosed with cervical cancer per ... estimated that 78 897 women are diagnosed with cervical cancer annually and 61 671 ..... eye aided by a bright light source. ... References. 1. Ferly Bray F ...

  20. Rozhovor s prof. RNDr. Pavlem Zemánkem, Ph.D., zástupcem ředitelky Ústavu přístrojové techniky Akademie věd ČR v Brně.

    Czech Academy of Sciences Publication Activity Database

    Číp, Ondřej

    2017-01-01

    Roč. 62, č. 10 (2017), s. 243-244 ISSN 0447-6441 Institutional support: RVO:68081731 Keywords : CAS ISI * optics Subject RIV: BH - Optics, Masers, Lasers OBOR OECD: Optics (including laser optics and quantum optics)

  1. Dealing with food allergies in babies and children

    National Research Council Canada - National Science Library

    Joneja, Janice M. Vickerstaff

    2007-01-01

    ... . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 231 CHAPTER 14 CornAllergy ...243 CHAPTER 15 SeafoodAllergy ...253 CHAPTER 16 The Top Ten Allergens: Avoidance of Milk, Egg, Wheat, Corn, Peanuts, Soy, Tree Nuts...

  2. Improvement of the banana "Musa acuminata" reference sequence using NGS data and semi-automated bioinformatics methods

    Czech Academy of Sciences Publication Activity Database

    Martin, G.; Baurens, F.C.; Droc, G.; Rouard, M.; Cenci, A.; Kilian, A.; Hastie, A.; Doležel, Jaroslav; Aury, J. M.; Alberti, A.; Carreel, F.; D'Hont, A.

    2016-01-01

    Roč. 17, MAR 16 (2016), s. 243 ISSN 1471-2164 Institutional support: RVO:61389030 Keywords : Musa acuminata * Genome assembly * Bioinformatics tool Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.729, year: 2016

  3. Mohelno-Plevovce: Lokalita osídlená v průběhu posledního glaciálního maxima a pozdního glaciálu

    Czech Academy of Sciences Publication Activity Database

    Škrdla, Petr; Rychtaříková, Tereza; Eigner, J.; Bartík, J.; Nikolajev, P.; Vokáč, M.; Nývltová Fišáková, Miriam; Čerevková, A.; Knotková, J.

    2014-01-01

    Roč. 66, č. 2 (2014), s. 243-270 ISSN 0323-1267 Institutional support: RVO:68081758 Keywords : Moravia * Mohelno * MIS-2 * LGM * dwelling * pavement * Epigravettian * Epiaurignacian Subject RIV: AC - Archeology, Anthropology, Ethnology

  4. Tagasi Pariisis / Karl Rumor

    Index Scriptorium Estoniae

    Rumor, Karl, pseud., 1886-1971

    2008-01-01

    Prantsusmaa sisepoliitilisest olustikust. Poliitilistest oludest 1937. aasta Euroopas, sõjameeleoludest Vahemerel, Nyloni konverentsist. Varem ilmunud: Uus Eesti 21. juuni 1937, nr. 166; 8., 13. sept. 1937, nr. 243, 248

  5. Arthroscopic subacromial decompression results in normal shoulder function after two years in less than 50% of patients

    DEFF Research Database (Denmark)

    Konradsen, Lars Aage Glud; Jensen, Claus Hjorth

    2015-01-01

    additional resection of the acromioclavicular joint. RESULTS: WORC scores improved significantly from preoperatively (median: 1,392) to three months (median: 204) and two years post-operatively (median: 243) (p

  6. Mineralogy of halloysites and their interaction with porphyrine

    Czech Academy of Sciences Publication Activity Database

    Vašutová, V.; Bezdička, Petr; Lang, Kamil; Hradil, David

    2013-01-01

    Roč. 57, č. 3 (2013), s. 243-250 ISSN 0862-5468 Institutional support: RVO:61388980 Keywords : organoclays * mineralogy * porphyrine * CEC Subject RIV: CA - Inorganic Chemistry Impact factor: 0.434, year: 2013

  7. Optická tloušťka atmosféry jako parametr pro stanovení obyvatelných zón exoplanet

    Czech Academy of Sciences Publication Activity Database

    Pintr, Pavel

    2013-01-01

    Roč. 58, č. 9 (2013), s. 243-246 ISSN 0447-6441 Institutional support: RVO:61389021 Keywords : Habitable zones * exoplanets * stellar spectral classes Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering

  8. Database Description - ClEST | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available filiation: National Institute of Advanced Industrial Science and Technology Contact address Symbiotic Evolut...2012 Aug; 47(3):233-243. External Links: Original website information Database maintenance site Symbiotic Ev

  9. Potential Navy Force Structure and Shipbuilding Plans: Background and Issues for Congress

    National Research Council Canada - National Science Library

    O'Rourke, Ronald

    2005-01-01

    In February 2005, the Navy testified that the Navy in future years may require a total of 260 to 325 ships, or possibly 243 to 302 ships, depending on how much the Navy uses new technologies and a new...

  10. Ergot alkaloids as chiral selectors in capillary electrophoresis and other electromigration methods

    Czech Academy of Sciences Publication Activity Database

    Sinibaldi, M.; Messina, A.; Stodůlková, Eva; Flieger, Miroslav

    2010-01-01

    Roč. 1, č. 3 (2010), s. 233-243 ISSN 0976-5514 Institutional research plan: CEZ:AV0Z50200510 Keywords : capillary electrophoresis * capillary electrochromatography * chiral analysis Subject RIV: CB - Analytical Chemistry, Separation

  11. A small-molecule inhibitor of the ubiquitin activating enzyme for cancer treatment.

    Science.gov (United States)

    Hyer, Marc L; Milhollen, Michael A; Ciavarri, Jeff; Fleming, Paul; Traore, Tary; Sappal, Darshan; Huck, Jessica; Shi, Judy; Gavin, James; Brownell, Jim; Yang, Yu; Stringer, Bradley; Griffin, Robert; Bruzzese, Frank; Soucy, Teresa; Duffy, Jennifer; Rabino, Claudia; Riceberg, Jessica; Hoar, Kara; Lublinsky, Anya; Menon, Saurabh; Sintchak, Michael; Bump, Nancy; Pulukuri, Sai M; Langston, Steve; Tirrell, Stephen; Kuranda, Mike; Veiby, Petter; Newcomb, John; Li, Ping; Wu, Jing Tao; Powe, Josh; Dick, Lawrence R; Greenspan, Paul; Galvin, Katherine; Manfredi, Mark; Claiborne, Chris; Amidon, Benjamin S; Bence, Neil F

    2018-02-01

    The ubiquitin-proteasome system (UPS) comprises a network of enzymes that is responsible for maintaining cellular protein homeostasis. The therapeutic potential of this pathway has been validated by the clinical successes of a number of UPS modulators, including proteasome inhibitors and immunomodulatory imide drugs (IMiDs). Here we identified TAK-243 (formerly known as MLN7243) as a potent, mechanism-based small-molecule inhibitor of the ubiquitin activating enzyme (UAE), the primary mammalian E1 enzyme that regulates the ubiquitin conjugation cascade. TAK-243 treatment caused depletion of cellular ubiquitin conjugates, resulting in disruption of signaling events, induction of proteotoxic stress, and impairment of cell cycle progression and DNA damage repair pathways. TAK-243 treatment caused death of cancer cells and, in primary human xenograft studies, demonstrated antitumor activity at tolerated doses. Due to its specificity and potency, TAK-243 allows for interrogation of ubiquitin biology and for assessment of UAE inhibition as a new approach for cancer treatment.

  12. The Leucocytozoidae of South African birds. The Coliiformes and ...

    African Journals Online (AJOL)

    1991-12-03

    Dec 3, 1991 ... light staining parasite nucleus, typical of the apicomplexan parasites. In the ..... descriptions of blood parasites made by de Mello and others,. Bhatia took de Mello .... Newfoundland Occasional Papers in Biology No.5. 243 pp.

  13. Radioactivity studies. Progress report. Volume II

    International Nuclear Information System (INIS)

    Cohen, N.

    1981-09-01

    The metabolism of 243 244 Cm in nine adult female baboons following intravenous injection was studied. Curium-243,244 was administered as a single injection of curium citrate in dosages of 0.053 to 0.220 μCi/kg. The behavior of 243 244 Cm at these low dosages was quantitated by external whole-body and partial-body counting, bioassay of blood, urine and feces samples, liver biopsies, and post-mortem tissues analysis. Curium-243,244 rapidly passed from the blood to other tissues. At 1 and 24 h after injection, the amounts circulating were 10% and 1%, respectively. At 24 h after injection 70% of the 243 244 Cm was located within soft tissues, probably associated with extracellular fluid; the liver alone contained 32% of the injected activity. During the first weeks the content of 243 244 Cm in soft tissues decreased sharply. As time progressed, significant deposition was noted in the liver and the skeleton. Approximately 20% of the injected activity was in the liver at 1 month with a 40 day half-time. The skeleton reached a maximum burden of 57% by 100 days; the half-time observed in bone was 4 to 16 y. During the first 24 h, 10% of the injected activity appeared in the urine decreasing to 0.1%/day at 30 days and 0.01%/day at 200 days. Fecal excretion increased reaching a maximum level at four weeks. The amount of 243 244 Cm excreted in the feces during the initial 4 to 5 months (approx. 20%) and the rate of elimination in the feces after the first month paralleled the retention in the liver indicating an hepatic-biliary-fecal pathway. A model illustrating the interaction of seven internal compartments with respect to the translocation kinetics of 243 244 Cm was derived based upon this data. Solutions of the model were derived for two specific time-related exposures

  14. Carbohydrate-modified magnetic nanoparticles for radical scavenging

    Czech Academy of Sciences Publication Activity Database

    Moskvin, Maksym; Horák, Daniel

    2016-01-01

    Roč. 65, Suppl. 2 (2016), S243-S251 ISSN 0862-8408 R&D Projects: GA MŠk(CZ) LQ1604 Institutional support: RVO:61389013 Keywords : magnetic nanoparticles * silica * glucose Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 1.461, year: 2016 http://www.biomed.cas.cz/physiolres/pdf/65%20Suppl%202/65_S243.pdf

  15. Case report of newborn with de novo partial trisomy 2q31.2–37.3 ...

    Indian Academy of Sciences (India)

    Case report of newborn with de novo partial trisomy 2q31.2–37.3 and monosomy 9p24.3 ... This is the first report of molecular cytogenetic characterization of a partial trisomy 2q31.2–37.3 with monosomy 9p24.3. ... Manuscript received: 10 November 2016; Manuscript revised: 13 March 2017; Accepted: 21 March 2017 ...

  16. Obesity/Overweight in Persons With Early and Chronic SCI: A Randomized, Multicenter, Controlled Lifestyle Intervention

    Science.gov (United States)

    2014-10-01

    decrease in insulin resistance ( HOMA - IR ) (Table 3, Figure 3; appendix). The 2 tetraplegic participants have completed 6-month clinical...ISI   HOMA -­‐ IR   Page 1 of 2 Ph.: 305-243-3195 Fax: 305-243-3328 www.hsro.miami.edu University of Miami Human Subjects Research Office (M8089) P.O...training (CRT) on fasting and postprandial (PP) blood glucose (BG) and insulin, the homeostasis model assessment ( HOMA ) for insulin resistance ( IR

  17. Total and spontaneous fission half-lives of the americium and curium nuclides

    International Nuclear Information System (INIS)

    Holden, N.E.

    1984-01-01

    The total half-life and the half-life for spontaneous fission are evaluated for the various long-lived nuclides of interest. Recommended values are presented for 241 Am, /sup 242m/Am, 243 Am, 242 Cm, 243 Cm, 244 Cm, 245 Cm, 246 Cm, 247 Cm, 248 Cm, and 250 Cm. The uncertainties are provided at the 95% confidence limit for each of the recommended values

  18. Description of Three New α Variants and Four New β Variants: Hb Montluel [α110(G17)Ala → Val; HBA1: c.332C > T], Hb Cap d'Agde [α131(H14)Ser → Cys; HBA2: c.395C > G] and Hb Corsica [α100(G7)Leu → Pro; HBA1: 302T > C]; Hb Nîmes [β104(G6)Arg → Gly; HBB: c.313A > G], Hb Saint Marcellin [β112(G14)Cys → Gly; HBB: c.337T > G], Hb Saint Chamond [β80(EF4)Asn → 0; HBB: c.241_243delAAC] and Hb Dompierre [β29(B11)Gly → Arg; HBB: c.88G > C].

    Science.gov (United States)

    Renoux, Céline; Feray, Cécile; Joly, Philippe; Lacan, Philippe; Francina, Alain

    2015-01-01

    We present here seven new hemoglobin (Hb) variants identified during routine Hb analysis. All of them are caused by a missense mutation except Hb Saint Chamond, which results from an in-frame deletion of the asparagine residue at β80. All these variants are clinically silent in the heterozygous state but two of them (Hb Cap d'Agde and Hb Dompierre) may be unstable, whereas Hb Nîmes could present a very slightly elevated oxygen affinity. These data are to be confirmed by appropriate biochemical tests.

  19. A new type-B cask design for transporting 252Cf

    International Nuclear Information System (INIS)

    Simmons, C.M.

    2000-01-01

    A project to design, certify, and build a new US Department of Energy (DOE) Type B container for transporting >5 mg of 252 Cf is more than halfway to completion. This project was necessitated by the fact that the existing Oak Ridge National Laboratory (ORNL) Type B containers were designed and built many years ago and thus do not have the records and supporting data that current regulations require. Once the new cask is available, it will replace the existing Type B containers. The cask design is driven by the unique properties of 252 Cf, which is a very intense spontaneous fission neutron source and necessitates a large amount of neutron shielding. The cask is designed to contain up to 60 mg of 252 Cf in the form of californium oxide or californium oxysulfate, in pellet, wire, or sintered material forms that are sealed inside small special-form capsules. The new cask will be capable of all modes of transport (land, sea, and air). The ORNL team, composed of technical and purchasing personnel and using rigorous selection criteria, chose NAC, International (NAC), as the subcontractor for the project. In January 1997, NAC started work on developing the conceptual design and performing the analyses. The original design concept was for a tungsten alloy gamma shield surrounded by two concentric shells of NS-4-FR neutron shield material. A visit to US Nuclear Regulatory Commission (NRC) regulators in November 1997 to present the conceptual design for their comments resulted in a design modification when the question of potential straight-line cracking in the NS-4-FR neutron shield material arose. NAC's modified design includes offset, wedgelike segments of the neutron shield material. The new geometry eliminates concerns about straight-line cracking but increases the weight of the packaging and makes the fabrication more complex. NAC has now completed the cask design and performed the analyses (shielding, structural, thermal, etc.) necessary to certify the cask. The cask

  20. Functional Characterization of a Novel Truncating Mutation in Lamin A/C Gene in a Family with a Severe Cardiomyopathy with Conduction Defects

    Directory of Open Access Journals (Sweden)

    Andrea Gerbino

    2017-12-01

    Full Text Available Background/Aims: Truncating LMNA gene mutations occur in many inherited cardiomyopathy cases, but the molecular mechanisms involved in the disease they cause have not yet been systematically investigated. Here, we studied a novel frameshift LMNA variant (p.D243Gfs*4 identified in three members of an Italian family co-segregating with a severe form of cardiomyopathy with conduction defects. Methods: HEK293 cells and HL-1 cardiomyocytes were transiently transfected with either Lamin A or D243Gfs*4 tagged with GFP (or mCherry. D243Gfs*4 expression, cellular localization and its effects on diverse cellular mechanisms were evaluated with western blotting, laser-scanning confocal microscopy and video-imaging analysis in single cells. Results: When expressed in HEK293 cells, GFP- (or mCherry-tagged LMNA D243Gfs*4 colocalized with calnexin within the ER. ER mislocalization of LMNA D243Gfs*4 did not significantly induce ER stress response, abnormal Ca2+ handling and apoptosis when compared with HEK293 cells expressing another truncated mutant of LMNA (R321X which similarly accumulates within the ER. Of note, HEK293-LMNA D243Gfs*4 cells showed a significant reduction of connexin 43 (CX43 expression level, which was completely rescued by activation of the WNT/β-catenin signaling pathway. When expressed in HL-1 cardiomyocytes, D243Gfs*4 significantly impaired the spontaneous Ca2+ oscillations recorded in these cells as result of propagation of the depolarizing waves through the gap junctions between non-transfected cells surrounding a cell harboring the mutation. Furthermore, mCh-D243Gfs*4 HL-1 cardiomyocytes showed reduced CX43-dependent Lucifer Yellow (LY loading and propagation. Of note, activation of β-catenin rescued both LY loading and LMNA D243Gfs*4 -HL-1 cells spontaneous activity propagation. Conclusion: Overall, the present results clearly indicate the involvement of the aberrant CX43 expression/activity as a pathogenic mechanism for the

  1. Integrative analysis of copy number alteration and gene expression profiling in ovarian clear cell adenocarcinoma.

    Science.gov (United States)

    Sung, Chang Ohk; Choi, Chel Hun; Ko, Young-Hyeh; Ju, Hyunjeong; Choi, Yoon-La; Kim, Nyunsu; Kang, So Young; Ha, Sang Yun; Choi, Kyusam; Bae, Duk-Soo; Lee, Jeong-Won; Kim, Tae-Joong; Song, Sang Yong; Kim, Byoung-Gie

    2013-05-01

    Ovarian clear cell adenocarcinoma (Ov-CCA) is a distinctive subtype of ovarian epithelial carcinoma. In this study, we performed array comparative genomic hybridization (aCGH) and paired gene expression microarray of 19 fresh-frozen samples and conducted integrative analysis. For the copy number alterations, significantly amplified regions (false discovery rate [FDR] q genes demonstrating frequent copy number alterations (>25% of samples) that correlated with gene expression (FDR genes were mainly located on 8p11.21, 8p21.2-p21.3, 8q22.1, 8q24.3, 17q23.2-q23.3, 19p13.3, and 19p13.11. Among the regions, 8q24.3 was found to contain the most genes (30 of 94 genes) including PTK2. The 8q24.3 region was indicated as the most significant region, as supported by copy number, GISTIC, and integrative analysis. Pathway analysis using differentially expressed genes on 8q24.3 revealed several major nodes, including PTK2. In conclusion, we identified a set of 94 candidate genes with frequent copy number alterations that correlated with gene expression. Specific chromosomal alterations, such as the 8q24.3 gain containing PTK2, could be a therapeutic target in a subset of Ov-CCAs. Copyright © 2013. Published by Elsevier Inc.

  2. Off-line tuning of a PI speed controller for a permanent magnet brushless DC motor using DSP

    Energy Technology Data Exchange (ETDEWEB)

    Demirtas, Metin, E-mail: mdtas@balikesir.edu.t [Electrical and Electronics Engineering Department, Balikesir University, Balikesir (Turkey)

    2011-01-15

    In this paper, a new method of tuning Proportional Integral (PI) coefficients for a permanent magnet brushless DC (PMBLDC) motor drives is proposed. Artificial neural network is used to identify the whole system using maximum overshoot and settling time obtained from the application circuit for different K{sub p}-K{sub i} pairs. Optimal values of PI controller coefficients are obtained using genetic algorithm. Motion Control Kit (MCK243) is used to carry out digital motion control applications. The MCK243 kit includes a power module and a three-phase brushless motor. TMS320F243 programs are used for PMBLDC motor speed control. Experimental results are given to show the validity of this method.

  3. A high-sensitive and quantitative in-line monitoring method for transplutonium elements separation processes

    International Nuclear Information System (INIS)

    Zhu Rongbao; Wang Shiju; Xu Yingpu; Zhang Zengrui

    1986-04-01

    A high-sensitive monitoring device and a quantitative analys technigue for transplutonium elements separation processes are described. X-ray and low energy γ-ray are measured by means of a scintillation monitor with two NaI(Tl) thin crystals. The α spectra of the fluents of ion-exchange column is measured by means of Si(Au) surface barrier in-line monitor. The construction of the monitors, auxiliary electronics, investigation result for the α spectra character of thick source and the calibration method were described. The determination results for extracting process of 243 Am and 244 Cm by ion-exchange chromatography were given. The sensitivity of total adding amount for 243 Am using the 4π scintillation monitor is better than 0.1 μCi. The precision of 243 Am and 244 Cm concentration determination using Si(Au) monitor is +- 5%. The precision of the two metals contents in containers is about +- 10%

  4. Genetic and Hormonal Risk Factors for Cancer in African American Men

    Science.gov (United States)

    2006-05-01

    rs2740574 CYP3A4 7q21.1 5’ UTR (-293) G to A 49.6 46.8 rs700519 CYP19 15q21.1 Exon 6 (codon 264) C to T 30.1 30.8 rs9282858 SDR5A2 2p23 Exon 1...HSD17B2 Months 12-24 CYP19 CYP3A4 IGF1 We had initially planned to perform our SNP assays using either ABI PRISM® 7700 Sequence Detection...31.4 rs6163 CYP17 10q24.3 Exon 1 (Codon 65) G to T 57.9 66.4 rs6162 CYP17 10q24.3 Exon 1 (Codon 46) C to T 58.7 66.9 rs743572 CYP17 10q24.3 5’-UTR

  5. Modeling of Waves, Hydrodynamics and Sediment Transport for Protection of Wetlands at Braddock Bay, New York

    Science.gov (United States)

    2015-03-01

    contributing environmental forcings. 3.3 Metocean forcings The Lake Ontario IGLD85 Low Water Datum ( LWD ) is 243.3 ft (74.15 m). This datum is used as...in this study was the International Great Lakes Datum of 1985 (IGLD85). The Lake Ontario chart datum is 243.3 ft (74.15 m), which is the LWD . The...ft (65 m), and 230 ft (70 m). The breakwater crest elevation was 6 ft (1.83 m), LWD . Alternative S-2 was a dual-breakwater system, and it was

  6. Comparison of fission and capture cross sections of minor actinides

    International Nuclear Information System (INIS)

    Nakagawa, Tsuneo; Iwamoto, Osamu

    2003-01-01

    The fission and capture cross sections of minor actinides given in JENDL-3.3 are compared with other evaluated data and experimental data. The comparison was made for 32 nuclides of Th-227, 228, 229, 230, 233, 234, Pa-231, 232, 233, U-232, 234, 236, 237, Np-236, 237, 238, Pu-236, 237, 238, 242, 244, Am-241, 242, 242m, 243, Cm-242, 243, 244, 245, 246, 247 and 248. Given in the present report are figures of these cross sections and tables of cross sections at 0.0253 eV and resonance integrals. (author)

  7. Optical properties of X-ray stars. 3

    International Nuclear Information System (INIS)

    Hudec, R.

    1984-01-01

    822 observations of X-ray system HZ Her/Her X-1 on Sonneberg sky-patrol-camera plates are interpreted with the following main results: (i) altogether 3 (and possibly 4) active and 3 (possibly 4) inactive states were revealed during the time span 1928 to 1979, (ii) the comparison of individual active-state light curves shows no clear differences, (iii) a very quick transition between active and inactive state JD 243 1313.382-JD 243 1321.403 was observed. Some other studies of the optical data were carried out and are briefly described. (author)

  8. Treatment of cancer with heavy charged particles

    International Nuclear Information System (INIS)

    Castro, J.R.

    1981-01-01

    The clinical radiotherapy trial has accured 243 patients irradiated with particles and 13 patients irradiated as controls in randomized studies. Of the 243 particle patients, 194 have been treated with helium ions, either solely or in combination with photon irradiation, and 49 have received all or part of their irradiation with one of the heavier particles, either carbon, neon, or argon ions. The project thus can be divided into two general phases: (1) evaluation of improved dose distribution without significant biologic advantage by use of helium ion irradiation; and (2) evaluation of improved dose distribution and enhanced biologic effect by irradiation with heavy charged particles such as carbon, neon, and argon ions

  9. Photofissility of heavy nuclei at intermediate energies

    International Nuclear Information System (INIS)

    Deppman, A.; Arruda Neto, J.D.T.; Likhachev, V.P.; Goncalves, M.

    2002-10-01

    We use the recently developed MCMC/MCEF (Multi Collisional Monte Carlo plus Monte Carlo for Evaporation-Fission calculations) model to calculate the photo fissility and the photofission cross section at intermediate energies for the 243 Am and for 209 Bi, and compare them to results obtained for other actinides and to available experimental data. As expected, the results for 243 Am are close to those for 237 Np. The fissility for pre actinide nuclei is nearly one order of magnitude lower than that for the actinides. Both fissility and photofission cross section for 209 Bi are in good agreement with the experimental data. (author)

  10. Some notes on the butterflies (Lepidoptera: Papilionoidea of Tantirimale Archaeological Site, Anuradhapura District, Sri Lanka

    Directory of Open Access Journals (Sweden)

    M.D.C. Asela

    2009-07-01

    Full Text Available There are 243 species of butterflies which including 5 families in Sri Lanka and 20 of them are endemic. However out of the 243 species 37 butterfly species belonging to 4 families was discovered from Tanthirimale Archaeological Forest area. This forest is classified as a Tropical dry mixed evergreen forests and its situated dry zone in Anuradapura district of Sri Lanka. We select three habitat types such as: forests, Rock outcrops and scrublands for studding composition and structure of butterflies in Archaeological Forest area. However, this important forest is threatened by harmful human activities such as man made fire, illegal logging, chena cultivation and road kills.

  11. Estimation of the sub-criticality of the sodium-cooled fast reactor Monju using the modified neutron source multiplication method

    International Nuclear Information System (INIS)

    Truchet, G.; Van Rooijen, W. F. G.; Shimazu, Y.; Yamaguchi, K.

    2012-01-01

    The Modified Neutron Source Method (MNSM) is applied to the Monju reactor. This static method to estimate sub-criticality has already given good results on commercial Pressurized Water Reactors. The MNSM consists both in the extraction of the fundamental mode seen by a detector to avoid the effect of higher modes near sources, and the correction of flux distortion effects due to control rod movement. Among Monju's particularities that have a big influence on MNSM factors are: the presence of two californium sources and the position of the detector which is located far from the core outside of the reactor vessel. The importance of spontaneous fission and (α, n) reactions which have increased during the shutdown period of 15 years will also be discussed. The relative position of detectors and sources deeply affect the correction factors in some regions. In order to evaluate the detector count rate, an analytical propagation has been conducted from the reactor vessel. For two subcritical states, an estimation of the reactivity has been made and compared to experimental data obtained in the restart experiments at Monju (2010). (authors)

  12. Cleanex process: a versatile solvent extraction process for recovery and purification of lanthanides, americium, and curium

    International Nuclear Information System (INIS)

    Bigelow, J.E.; Collins, E.D.; King, L.J.

    1979-01-01

    At a concentration of 1 M in straight-chain hydrocarbon diluent, HDEHP will extract americium, curium, and other trivalent actinide and lanthanide elements from dilute acid or salt solutions. The solute is back-extracted with more concentrated acid, either nitric or hydrochloric. The process has been used in the continuous, countercurrent mode, but its greatest advantage arises in batch extractions where the excess acid can be titrated with NaOH to produce a final acidity of about 0.03 M. Under these conditions, 99% recovery can be achieved, usually in one stage. Cleanex was used on the 50-liter scale at the Transuranium Processing Plant at Oak Ridge for 12 years to provide a broad spectrum cleanup to transuranium elements before applying more sophisticated techniques for separating individual products. The process is also used routinely to recover excessive losses of curium and/or californium from plant waste streams. The solvent system is relatively resistant to radiation damage, being usable up to 200 W-h/liter

  13. Fission-fragment attachment to aerosols and their transport through capillary tubes

    International Nuclear Information System (INIS)

    Novick, V.J.; Alvarez, J.L.; Greenwood, R.C.

    1981-01-01

    The transport of radioactive aerosols was studied using equipment, collectively called the Helium jet, that has been constructed to provide basic nuclear physics data on fission product nuclides. The transport of the fission products in the system depends on their attachment to aerosol particles. The system consists of 1) a tube furnace which generates aerosols by the sublimation or evaporation of source material, 2) a helium stream used to transport the aerosols, 3) a 25 m settling tube to eliminate the larger aerosols and smaller aerosols that would deposit in the capillary, 4) a Californium-252 self-fissioning source of fission product nuclides, and 5) a small capillary to carry the radioactive aerosols from the hot cell to the laboratory. Different source materials were aerosolized but NaCl is generally used because it yielded the highest transport efficiencies through the capillary. Particle size measurments were made with NaCl aerosols by using a cascade impactor, an optical light scattering device, and the capillary itself as a diffusion battery by performing radiation measurements and/or electrical conductivity measurements. Both radioactive and nonradioactive aerosols were measured in order to investigate the possibility of a preferential size range for fission product attachment. The measured size distributions were then used to calculate attachment coefficients and finally an attachment time

  14. Monitoring taconite process streams with thermal neutron capture-gamma ray analysis. Report of investigations/1980

    International Nuclear Information System (INIS)

    Woodbury, F.B.W.

    1980-12-01

    The Bureau of Mines is evaluating alternative technologies to treat oxidized taconites. Since process control is an essential element in the application of these process technologies, research was performed on a prototype monitoring system utilizing a californium-252 (252-Cf) neutron source and a thermal neutron capture-gamma ray spectra analysis method to measure the amount of iron and percent solids in process slurries. The prototype system was used to monitor the concentrate and tailing streams in a 900-lb/hr flotation pilot plant during continuous around-the-clock tests. The iron content of the process slurries was determined by measuring the total peak areas under the capture spectrum peaks at 7.626-7.632 MeV, the associated escape peaks at 7.136-7.122 and 6.626-6.612 MeV, and the iron doublets at 4.900 and 4.998 MeV. A potential method for determining the percent solids in process slurries using the 2.22 MeV hydrogen capture peak is discussed

  15. The significance of chromosome deletions in atomic-bomb survivors

    International Nuclear Information System (INIS)

    Tanaka, Kimio; Shigeta, Chiharu; Oguma, Nobuo; Kamada, Nanao; Deng, Z.; Niimi, Masanobu; Aisaka, Tadaichi.

    1986-01-01

    In 39 A-bomb survivors 40 years after exposure at ≤ 1,000 m from ground zero, the frequency and features of chromosome deletions in peripheral lymphocytes were examined using a differential staining technique. Simultaneously, in vitro irradiation experiment with Cf-252 was made to infer chromosome aberrations occuring immediately after exposure. Californium-252 with 100 rad induced dicentric and ring chromosomes in 40 % of the cells and acentric fragments in 44 %. Among the A-bomb survivors, chromosome aberrations were observed in 651 (21 %) of the total 3,136 cells. There were 146 cells with deletions (22 % of abnormal cells; 5 % of the total cells), and 10 cells with acentric fragment (0.3 % of the total cells). The figure for deletions was far higher than that reported in the literature. A large number of deletions were seen in chromosomes no.4, no.21, and no.22, and a few deletions in chromosomes no.7 and no.20. Significance of chromosome deletions is discussed. (Namekawa, K.)

  16. Time-of-flight mass spectrometry with desorption-ionization multiprobes (UV photons and KeV and MeV particles). Cluster atoms are used as projectiles

    International Nuclear Information System (INIS)

    Brunelle, A.

    1990-09-01

    A new time-of-flight mass spectrometer, Super-Depil, is used to study secondary ion emission from solid surfaces bombarded by various kinds of primary particles. Three different desorption probes were set up on this machine: a 252 californium source, providing by spontaneous fission about 1 MeV/u energy heavy ions, a 5 to 30 keV energy pulsed caesium ion gun and a pulsed nitrogen laser, which wavelength is 337 mm. A two stages electrostatic mirror was added to the spectrometer. The time spread due to the initial kinetic energy of secondary ions leaving the surface was minimized. The mass resolution is greater than 5000. The analysis of glycosidic terpenes showed the complementarity of the three probes. The study of such metastable ions, with the electrostatic mirror, showed that some fragment ions may conserve the memory of the stereochemistry of the neutral lost. Clusters ions were used as projectiles in the energy range 5-60 keV. A strong non linear enhancement was observed in the secondary ion yield from various targets [fr

  17. Measurement of neutron dose and spectra at light-water reactors

    International Nuclear Information System (INIS)

    Soldat, K.L.; Endres, G.W.R.; Cummings, F.M.

    1982-08-01

    In choosing one dosimeter over another, both sensitivity and precision must be addressed. It has been determined that dosimeters employing NTA film lack adequate sensitivity for use inside containment of nuclear plants. From this study, it is apparent that CR-39 and polycarbonate track etch films used without radiators are also inadequate. The rest of the dosimeters tested displayed adequate sensitivity. The two general types of dosimeters which comprise that group are: (1) TLDs and (2) the polycarbonate track etch which was used in conjunction with (n, α) radiators. The precision of the TLD dosimeter depends on the calibration technique and response correction technique. TLD dosimeters calibrated to D 2 O-moderated californium-252 or corrected based on 9- to 3-in. sphere response rates seemed to function best inside reactor containment. Polycarbonate track etch film with (n, α) radiators was found to be sensitive enough for use inside reactor containment; however, the standard deviation for the results was roughly twice the value of the most precise TLD albedo dosimeters. Also, several of the polycarbonate dosimeters saturated, rendering any evaluation impossible

  18. Robotics at Savannah River site: activity report

    International Nuclear Information System (INIS)

    Byrd, J.S.

    1984-09-01

    The objectives of the Robotics Technology Group at the Savannah River Laboratory are to employ modern industrial robots and to develop unique automation and robotic systems to enhance process operations at the Savannah River site (SRP and SRL). The incentives are to improve safety, reduce personnel radiation exposure, improve product quality and productivity, and to reduce operating costs. During the past year robotic systems have been installed to fill chemical dilution vials in a SRP laboratory at 772-F and remove radioactive waste materials in the SRL Californium Production Facility at 773-A. A robotic system to lubricate an extrusion press has been developed and demonstrated in the SRL robotics laboratory and is scheduled for installation at the 321-M fuel fabrication area. A mobile robot was employed by SRP for a radiation monitoring task at a waste tank top in H-Area. Several other robots are installed in the SRL robotics laboratories and application development programs are underway. The status of these applications is presented in this report

  19. Production of medical radioisotopes in the ORNL High Flux Isotope Reactor (HFIR) for cancer treatment and arterial restenosis therapy after PTCA

    International Nuclear Information System (INIS)

    Knapp, F.F. Jr.; Beets, A.L.; Mirzadeh, S.; Alexander, C.W.; Hobbs, R.L.

    1998-01-01

    The High Flux Isotope Reactor (HFIR) at the Oak Ridge National Laboratory (ORNL) represents an important resource for the production of a wide variety of medical radioisotopes. In addition to serving as a key production site for californium-252 and other transuranic elements, important examples of therapeutic radioisotopes which are currently routinely produced in the HFIR for distribution include dysprosium-166 (parent of holmium-166), rhenium-186, tin-117m and tungsten-188 (parent of rhenium-188). The nine hydraulic tube (HT) positions in the central high flux region permit the insertion and removal of targets at any time during the operating cycle and have traditionally represented a major site for production of medical radioisotopes. To increase the irradiation capabilities of the HFIR, special target holders have recently been designed and fabricated which will be installed in the six Peripheral Target Positions (PTP), which are also located in the high flux region. These positions are only accessible during reactor refueling and will be used for long-term irradiations, such as required for the production of tin-117m and tungsten-188. Each of the PTP tubes will be capable of housing a maximum of eight HT targets, thus increasing the total maximum number of HT targets from the current nine, to a total of 57. In this paper the therapeutic use of reactor-produced radioisotopes for bone pain palliation and vascular brachytherapy and the therapeutic medical radioisotope production capabilities of the ORNL HFIR are briefly discussed

  20. Fast neutron tomography with real-time pulse-shape discrimination in organic scintillation detectors

    Energy Technology Data Exchange (ETDEWEB)

    Joyce, Malcolm J., E-mail: m.joyce@lancaster.ac.uk [Department of Engineering, Lancaster University, Lancaster, Lancashire LA1 4YW (United Kingdom); Agar, Stewart [Department of Engineering, Lancaster University, Lancaster, Lancashire LA1 4YW (United Kingdom); Aspinall, Michael D. [Hybrid Instruments Ltd., Gordon Manley Building, Lancaster Environment Centre, Lancaster University, Lancaster LA1 4YW (United Kingdom); Beaumont, Jonathan S.; Colley, Edmund; Colling, Miriam; Dykes, Joseph; Kardasopoulos, Phoevos; Mitton, Katie [Department of Engineering, Lancaster University, Lancaster, Lancashire LA1 4YW (United Kingdom)

    2016-10-21

    A fast neutron tomography system based on the use of real-time pulse-shape discrimination in 7 organic liquid scintillation detectors is described. The system has been tested with a californium-252 source of dose rate 163 μSv/h at 1 m and neutron emission rate of 1.5×10{sup 7} per second into 4π and a maximum acquisition time of 2 h, to characterize two 100×100×100 mm{sup 3} concrete samples. The first of these was a solid sample and the second has a vertical, cylindrical void. The experimental data, supported by simulations with both Monte Carlo methods and MATLAB®, indicate that the presence of the internal cylindrical void, corners and inhomogeneities in the samples can be discerned. The potential for fast neutron assay of this type with the capability to probe hydrogenous features in large low-Z samples is discussed. Neutron tomography of bulk porous samples is achieved that combines effective penetration not possible with thermal neutrons in the absence of beam hardening.

  1. [Fast neutron cross section measurements]: Progress report

    International Nuclear Information System (INIS)

    1988-01-01

    As projected in our previous proposal, the past year on the cross section project at the University of Michigan has been one primarily of construction and assembly of our 14 MeV pulsed Neutron Facility. All the components of the system have now been either purchased or fabricated in our shop facilities and have been assembled in their final configuration. We are now in the process of testing the rf components that have been designed to deliver voltage to both the pulser and buncher stages. We expect that the system will be operational by the end of the current contract year. We have also accomplished the design and construction of several other major pieces of equipment that are needed to begin fast neutron time-of-flight measurements. These include the primary proton recoil detector, and a californium fission chamber needed in the efficiency calibration of the primary detector. We have also added considerable concrete shielding designed to lower the neutron background in the experimental area. 10 figs., 5 tabs

  2. A review of neutron scattering correction for the calibration of neutron survey meters using the shadow cone method

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Sang In; Kim, Bong Hwan; Kim, Jang Lyul; Lee, Jung Il [Health Physics Team, Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of)

    2015-12-15

    The calibration methods of neutron-measuring devices such as the neutron survey meter have advantages and disadvantages. To compare the calibration factors obtained by the shadow cone method and semi-empirical method, 10 neutron survey meters of five different types were used in this study. This experiment was performed at the Korea Atomic Energy Research Institute (KAERI; Daejeon, South Korea), and the calibration neutron fields were constructed using a {sup 252}Californium ({sup 252}Cf) neutron source, which was positioned in the center of the neutron irradiation room. The neutron spectra of the calibration neutron fields were measured by a europium-activated lithium iodide scintillator in combination with KAERI's Bonner sphere system. When the shadow cone method was used, 10 single moderator-based survey meters exhibited a smaller calibration factor by as much as 3.1 - 9.3% than that of the semi-empirical method. This finding indicates that neutron survey meters underestimated the scattered neutrons and attenuated neutrons (i.e., the total scatter corrections). This underestimation of the calibration factor was attributed to the fact that single moderator-based survey meters have an under-ambient dose equivalent response in the thermal or thermal-dominant neutron field. As a result, when the shadow cone method is used for a single moderator-based survey meter, an additional correction and the International Organization for Standardization standard 8529-2 for room-scattered neutrons should be considered.

  3. Branching ratios of α-decay to ground and excited states of Fm, Cf, Cm and Pu

    Science.gov (United States)

    Hassanabadi, H.; Hosseini, S. S.

    2018-06-01

    We use the well-known Wentzel-Kramers-Brillouin (WKB) barrier penetration probability to calculate α-decay branching ratios for ground and excited states of heavy even-even nuclei of Fermium (248-254Fm), Californium (244-252Cf), Curium (238-248Cm) and Plutonium (234-244Pu) with 94 ≤Zp ≤100. We obtained the branching ratios for the excited states of daughter nucleus by the α-decay energy (Qα), the angular momentum of α-particle (ℓα), and the excitation probability of the daughter nucleus with the excitation energy of state ℓ in the daughter nucleus (i.e. Eℓ*). α-Decay half-lives have been evaluated by using the proximity potential model for the heavy even-even nuclei. We have reported the half-lives and compared the results with the experimental data. The theoretical branching ratios of α-transitions in our calculation are found to agree with the available experimental data well for 0+→ 0+, 0+→ 2+, 0+→ 4+, 0+→ 6+ and 0+ → 8+α-transitions.

  4. Nuclear Chemistry Institute, Mainz University. Annual Report 1995

    International Nuclear Information System (INIS)

    Denschlag, H.O.

    1996-03-01

    The annual report of the Institut fuer Kernchemie addresses inter alia three main research activities. The first belongs to the area of basic research, covering studies in the fields of nuclear fission, chemistry of the super-heavy elements and of heavy-ion reactions extending from the Coulomb barrier to relativistic energies, and nuclear astrophysics in connection with the ''r process''. By means of laser technology, high-precision data could be measured of the ionization energies of berkelium and californium. Studies of atomic clusters in the vacuum of an ionization trap revealed interesting aspects. The second major activity was devoted to the analysis of environmental media, applying inter alia neutron activation analysis and resonance ionization mass spectroscopy (RIMS). The third activity resulted in the development of novel processes, or the enhancement of existing processes or methods, for applications in basic research work and in environmental analytics. Another item of interest is the summarizing report on the operation of the TRIGA research reactor. (orig./SR) [de

  5. An Account of Oak Ridge National Laboratory's Thirteen Research Reactors

    International Nuclear Information System (INIS)

    Rosenthal, Murray Wilford

    2009-01-01

    The Oak Ridge National Laboratory has built and operated 13 nuclear reactors in its 66-year history. The first was the graphite reactor, the world's first operational nuclear reactor, which served as a plutonium production pilot plant during World War II. It was followed by two aqueous-homogeneous reactors and two red-hot molten-salt reactors that were parts of power-reactor development programs and by eight others designed for research and radioisotope production. One of the eight was an all-metal fast burst reactor used for health physics studies. All of the others were light-water cooled and moderated, including the famous swimming-pool reactor that was copied dozens of times around the world. Two of the reactors were hoisted 200 feet into the air to study the shielding needs of proposed nuclear-powered aircraft. The final reactor, and the only one still operating today, is the High Flux Isotope Reactor (HFIR) that was built particularly for the production of californium and other heavy elements. With the world's highest flux and recent upgrades that include the addition of a cold neutron source, the 44-year-old HFIR continues to be a valuable tool for research and isotope production, attracting some 500 scientific visitors and guests to Oak Ridge each year. This report describes all of the reactors and their histories.

  6. Peculiarities of extraction of carbonate complexes of trivalent transplutonium elements by alkylpyrocatechins

    International Nuclear Information System (INIS)

    Karalova, Z.K.; Bukina, T.I.; Myasoedov, B.F.; Fedorov, L.A.; Sokolovskij, S.A.

    1987-01-01

    Extraction of trivalent americium, curium, californium and europium by technical mixture of mono- and didecylpyrocatechin (TAP) in various diluents from carbonate solutions is investigated. Effect of many factors (pH, K 2 CO 3 concentration, TAP, metal; the time of phase contact) on the completeness of element isolation and separation is clarified. It is ascertained that the elements listed are quantitatively extracted by TAP solution in toluene and cyclohexane in the range of K 2 CO 3 concentrations from 0.25 to 1.5 mol/l. The difference in americium and curium distribution coefficient during their extraction by TAP from 0.25 mol/l of K 2 CO 3 solution is detected. Separation coefficients of the pair increase with the increase of carbonate solution pH. The separation can be improved at the stage of element reextraction by the mixture of K 2 CO 3 and DTPA or EDTA from alkylpyrocatechin, sunce rate constants of americium and curium reextraction differ greatly. Using 13 C NMR the composition of compounds in organic phase on the basis of 4-(α, α-dioctylethyl)pyrocatechin is investigated

  7. The creation of new nuclei

    International Nuclear Information System (INIS)

    Armbruster, P.; Hessberger, F.P.

    1998-01-01

    In the last 60 years physicists have created 20 artificial elements beyond uranium. In 1934 Enrico Fermi predicted the creation of new elements by bombarding atoms with neutrons. This method led to the discovery of neptunium (Z=93), plutonium, americium, curium, berkelium, californium, einsteinium and fermium (Z=100). In fact the capture of a neutron is followed by a beta-decay which increases the atomic number (Z) by one unit. Beyond Z=100 beta-decay no more occurs so a new approach was necessary. Between the American Lawrence Berkeley Laboratory and the Russian Dubna Institute a fierce competition broke out to produce new elements by bombarding transuranium nuclei with light elements such as helium, carbon, nitrogen. This new method required heavy equipment: ion accelerator and detectors but led to the creation of all the elements from Z=101 to Z=106. A new idea was to provoke the fusion of heavy nuclei such as lead and bismuth with colliding argon, nickel or zinc ion beams. This method called 'cold fusion' opened the way to reach the nuclei beyond Z=107. In 1996 the element Z=112 was the last discovered. The next step could be the element Z=114 for which a particular stability is expected. (A.C.)

  8. In-situ elemental analysis of coal by neutron activation

    International Nuclear Information System (INIS)

    Mikesell, J.L.; Senftle, F.E.; Tanner, A.B.

    1986-01-01

    The U.S. Geological Survey (USGS) has worked to develop neutron techniques for the borehole measurement of the elemental composition of ores since 1969, and first demonstrated a borehole ultimate analysis of coal in 1977. Borehole measurements such as these permit real-time evaluation of coal quality without the expense of coring or the delays associated with laboratory analyses. Two technological innovations make such measurements possible: the availability, from Savannah River Operations Office, DOE, of small californium-252 (/sup 252/Cf) fission neutron sources, and the development, by USGS and Princeton Gamma-Techn, of the melting-cryogen-cooled high-purity germanium borehole gamma-ray detector. A technique of relating mass fractions to measured gamma-ray intensities, which eliminates the need for detailed knowledge of the geometry of the neutron distribution, is used to calculate elemental compositions without resorting to the test pits or computer borehole modeling. In coal, all of the major constituents (C, H, N, S, Si, Al, Fe, Ti) except oxygen can be determined quantitatively by thermal neutron capture gamma-ray spectroscopy

  9. Evolution of the Argonne Tandem Linear Accelerator System (ATLAS) control system

    International Nuclear Information System (INIS)

    Power, M.; Munson, F.

    2012-01-01

    Given that the Argonne Tandem Linear Accelerator System (ATLAS) recently celebrated its 25. anniversary, this paper will explore the past, present, and future of the ATLAS Control System, and how it has evolved along with the accelerator and control system technology. ATLAS as we know it today, originated with a Tandem Van de Graff in the sixties. With the addition of the Booster section in the late seventies, came the first computerized control. ATLAS itself was placed into service on June 25, 1985, and was the world's first superconducting linear accelerator for ions. Since its dedication as a National User Facility, more than a thousand experiments by more than 2,000 users worldwide, have taken advantage of the unique capabilities it provides. Today, ATLAS continues to be a user facility for physicists who study the particles that form the heart of atoms. Its most recent addition, CARIBU (Californium Rare Isotope Breeder Upgrade), creates special beams that feed into ATLAS. ATLAS is similar to a living organism, changing and responding to new technological challenges and research needs. As it continues to evolve, so does the control system: from the original days using a DEC PDP-11/34 computer and two CAMAC crates, to a DEC Alpha computer running Vsystem software and more than twenty CAMAC crates, to distributed computers and VME systems. Future upgrades are also in the planning stages that will continue to evolve the control system. (authors)

  10. Report on the workshop "Decay spectroscopy at CARIBU: advanced fuel cycle applications, nuclear structure and astrophysics". 14-16 April 2011, Argonne National Laboratory, USA.

    Energy Technology Data Exchange (ETDEWEB)

    Kondev, F.; Carpenter, M.P.; Chowdhury, P.; Clark, J.A.; Lister, C.J.; Nichols, A.L.; Swewryniak, D. (Nuclear Engineering Division); (Univ. of Massachusetts); (Univ. of Surrey)

    2011-10-06

    A workshop on 'Decay Spectroscopy at CARIBU: Advanced Fuel Cycle Applications, Nuclear Structure and Astrophysics' will be held at Argonne National Laboratory on April 14-16, 2011. The aim of the workshop is to discuss opportunities for decay studies at the Californium Rare Isotope Breeder Upgrade (CARIBU) of the ATLAS facility with emphasis on advanced fuel cycle (AFC) applications, nuclear structure and astrophysics research. The workshop will consist of review and contributed talks. Presentations by members of the local groups, outlining the status of relevant in-house projects and availabile equipment, will also be organized. time will also be set aside to discuss and develop working collaborations for future decay studies at CARIBU. Topics of interest include: (1) Decay data of relevance to AFC applications with emphasis on reactor decay heat; (2) Discrete high-resolution gamma-ray spectroscopy following radioactive decya and related topics; (3) Calorimetric studies of neutron-rich fission framgents using Total ABsorption Gamma-Ray Spectrometry (TAGS) technique; (4) Beta-delayed neutron emissions and related topics; and (5) Decay data needs for nuclear astrophysics.

  11. Actinide metals

    Energy Technology Data Exchange (ETDEWEB)

    Brown, Paul L. [Geochem Australia, Kiama, NSW (Australia); Ekberg, Christian [Chalmers Univ. of Technology, Goeteborg (Sweden). Nuclear Chemistry/Industrial Materials Recycling

    2016-07-01

    All isotopes of actinium are radioactive and exist in aqueous solution only in the trivalent state. There have been very few studies on the hydrolytic reactions of actinium(III). The hydrolysis reactions for uranium would only be important in alkaline pH conditions. Thermodynamic parameters for the hydrolysis species of uranium(VI) and its oxide and hydroxide phases can be determined from the stability and solubility constants. The hydrolytic behaviour of neptunium(VI) is quite similar to that of uranium(VI). The solubility constant of NpO{sub 2}OH(am) has been reported a number of times for both zero ionic strength and in fixed ionic strength media. Americium can form four oxidation states in aqueous solution, namely trivalent, tetravalent, pentavalent and hexavalent. Desire, Hussonnois and Guillaumont determined stability constants for the species AmOH{sup 2+} for the actinides, plutonium(III), americium(III), curium(III), berkelium(III) and californium(III) using a solvent extraction technique.

  12. Test and evaluation of infrared detectors and arrays; Proceedings of the Meeting, Orlando, FL, Mar. 27-29, 1989

    Science.gov (United States)

    Hoke, Forney M.

    Papers on the testing and evaluation of IR detectors and arrays are presented, covering topics such as a short wavelength IR test system, pulse height analysis, the use of an expert system for IR detector testing, low-background IR focal plane testing, electron beam testing, high performance silicide Schottky photodiodes, the SDI organization focal plane test program, the absorption cross section of arsenic in silicon, and long wavelength IR hybrids. Other topics include low background radiometric detector measurements, an ultralow background dewar for IR detector characterization studies, a computer assisted mosaic array test station, a configurable detector array test station, automated detector material characterization capabilities, and a test system for mercury cadmium telluride photoconductor arrays. Additional topics include ionization dosimetry measurements inside a dewar for linac electron and californium-252 neutron environments, a radiation test facility using a variable-flux electron beam source, automated visual inspection of IR focal plane arrays, a titanium cryostat for low temperature radiation effects studies, a low dose rate gamma test facility, and the test and evaluation of stability in IR staring focal plane arrays after nonuniformity correction.

  13. The cross sections of fusion-evaporation reactions: the most promising route to superheavy elements beyond Z=118

    Directory of Open Access Journals (Sweden)

    Jadambaa Khuyagbaatar

    2017-01-01

    Full Text Available The synthesis of superheavy elements beyond oganesson (Og, which has atomic number Z = 118, is currently one of the main topics in nuclear physics. An absence of sufficient amounts of target material with atomic numbers heavier than californium (Z = 98 forces the use of projectiles heavier than 48Ca (Z = 20, which has been successfully used for the discoveries of elements with Z = 114 - 118 in complete fusion reactions. Experimental cross sections of 48Ca with actinide targets behave very differently to “cold” and “hot” fusion-evaporation reactions, where doubly-magic lead and deformed actinides are used as targets, respectively. The known cross sections of these reactions have been analysed compared to calculated fission barriers. It has been suggested that observed discrepancies between the cross sections of 48Ca-induced and other fusionevaporation reactions originate from the shell structure of the compound nucleus, which lies in the island of the stability. Besides scarcely known data on other reactions involving heavier projectiles, the most promising projectile for the synthesis of the elements beyond Og seems to be 50Ti. However, detailed studies of 50Ti, 54Cr, 58Fe and 64Ni-induced reactions are necessary to be performed in order to fully understand the complexities of superheavy element formation.

  14. Activation analysis of stainless steel flux monitors using 252Cf neutron sources

    International Nuclear Information System (INIS)

    Williams, J.G.; Newton, T.H. Jr.; Cogburn, C.O.

    1984-01-01

    Activation analysis was performed on stainless steel beads from a chain which is used in reactor pressure vessel surveillance experiments at the Arkansas Power and Light Company reactors. The beads allow monitoring of two fast and three thermal neutron induced reactions: 58 Ni(n,p) 58 Co, 54 Fe(n,p) 54 Mn, 58 Fe(n,γ) 59 Fe, 59 Co(n,γ) 60 Co and 50 Cr(n,γ) 51 Cr. The analysis was performed using 12 beads from various positions along 5 different batches of chain and standard materials in an H 2 O moderator tank using two intense californium sources which had a total neutron emission rate of 3.97 x 10 10 /s. Semiconductor gamma spectrometers were used to count the products of the above reactions in the specimens. The percentage by weight of the iron, chromium and cobalt in the beads were found to be 62.1%, 20.2% and 0.120%, respectively. The excellent uniformity found in the bead compositions demonstrates the reproducibility of the experimental techniques and enhances considerably the value of the beads as neutron flux montitors

  15. Development of an analytical theory to describe the PNAR and CIPN nondestructive assay techniques

    International Nuclear Information System (INIS)

    Bolind, Alan Michael

    2014-01-01

    Highlights: • Neutron albedo is modeled by a discrete and iterative reflection process. • The theory enables the PNAR and CIPN NDA techniques to be compared quantitatively. • Improvements to the data analysis and to the CIPN instrument design are suggested. • A correction to translate real no-reflection PNAR data into ideal data is provided. - Abstract: This paper develops an analytical theory to describe how neutron albedo (reflection) increases the multiplication of neutrons by a used fuel assembly. With this theory, the two nondestructive assay (NDA) techniques of Passive Neutron Albedo Reactivity (PNAR) and Californium-252 Interrogation with Prompt Neutron Detection (CIPN) can be compared directly. Specifically, the theory derives expressions for the PNAR and CIPN metrics in terms of the physical properties of the used fuel assembly, such as the neutron multiplications and fate probabilities. The theory thus clarifies the interpretation of these two NDA techniques and suggests ways to improve both the design of the NDA instruments and the algorithms for analyzing the measurement results

  16. Design of the low energy beam transport line between CARIBU and the EBIS charge breeder

    Energy Technology Data Exchange (ETDEWEB)

    Perry, A., E-mail: aperry4@hawk.iit.edu [Argonne National Laboratory, Argonne, IL 60439, USA and Illinois Institute of Technology, Chicago, IL 60616 (United States); Ostroumov, P. N.; Barcikowski, A.; Dickerson, C.; Kondrashev, S. A.; Mustapha, B.; Savard, G. [Argonne National Laboratory, Argonne, IL 60439 (United States)

    2015-01-09

    An Electron Beam Ion Source Charge Breeder (EBIS-CB) has been developed to breed radioactive beams from the CAlifornium Rare Isotope Breeder Upgrade (CARIBU) facility at ATLAS. The EBIS-CB will replace the existing ECR charge breeder to increase the intensity and improve the purity of reaccelerated radioactive ion beams. The EBIS-CB is in the final stage of off-line commissioning. Currently, we are developing a low energy beam transport (LEBT) system to transfer CARIBU beams to the EBIS-CB. As was originally planned, an RFQ cooler-buncher will precede the EBIS-CB. Recently, it was decided to include a multi-reflection time-of-flight (MR-TOF) mass-spectrometer following the RFQ. MR-TOF is a relatively new technology used to purify beams with a mass-resolving power up to 3×10{sup 5} as was demonstrated in experiments at CERN/ISOLDE. Very high purity singly-charged radioactive ion beams will be injected into the EBIS for charge breeding and due to its inherent properties, the EBIS-CB will maintain the purity of the charge bred beams. Possible contamination of residual gas ions will be greatly suppressed by achieving ultra-high vacuum in the EBIS trap. This paper will present and discuss the design of the LEBT and the overall integration of the EBIS-CB into ATLAS.

  17. Neutron Detector Signal Processing to Calculate the Effective Neutron Multiplication Factor of Subcritical Assemblies

    Energy Technology Data Exchange (ETDEWEB)

    Talamo, Alberto [Argonne National Lab. (ANL), Argonne, IL (United States). Nuclear Engineering Division; Gohar, Yousry [Argonne National Lab. (ANL), Argonne, IL (United States). Nuclear Engineering Division

    2016-06-01

    This report describes different methodologies to calculate the effective neutron multiplication factor of subcritical assemblies by processing the neutron detector signals using MATLAB scripts. The subcritical assembly can be driven either by a spontaneous fission neutron source (e.g. californium) or by a neutron source generated from the interactions of accelerated particles with target materials. In the latter case, when the particle accelerator operates in a pulsed mode, the signals are typically stored into two files. One file contains the time when neutron reactions occur and the other contains the times when the neutron pulses start. In both files, the time is given by an integer representing the number of time bins since the start of the counting. These signal files are used to construct the neutron count distribution from a single neutron pulse. The built-in functions of MATLAB are used to calculate the effective neutron multiplication factor through the application of the prompt decay fitting or the area method to the neutron count distribution. If the subcritical assembly is driven by a spontaneous fission neutron source, then the effective multiplication factor can be evaluated either using the prompt neutron decay constant obtained from Rossi or Feynman distributions or the Modified Source Multiplication (MSM) method.

  18. MCNPX, MONK, and ERANOS analyses of the YALINA Booster subcritical assembly

    Energy Technology Data Exchange (ETDEWEB)

    Talamo, Alberto, E-mail: alby@anl.go [Argonne National Laboratory, 9700 S. Cass Avenue, Argonne, IL 60439 (United States); Gohar, Y.; Aliberti, G.; Cao, Y.; Smith, D.; Zhong, Z. [Argonne National Laboratory, 9700 S. Cass Avenue, Argonne, IL 60439 (United States); Kiyavitskaya, H.; Bournos, V.; Fokov, Y.; Routkovskaya, C.; Serafimovich, I. [Joint Institute for Power and Nuclear Research - Sosny, National Academy of Sciences of Belarus, 99 Acad. Krasin Str., Minsk 220109 (Belarus)

    2011-05-15

    This paper compares the numerical results obtained from various nuclear codes and nuclear data libraries with the YALINA Booster subcritical assembly (Minsk, Belarus) experimental results. This subcritical assembly was constructed to study the physics and the operation of accelerator-driven subcritical systems (ADS) for transmuting the light water reactors (LWR) spent nuclear fuel. The YALINA Booster facility has been accurately modeled, with no material homogenization, by the Monte Carlo codes MCNPX (MCNP/MCB) and MONK. The MONK geometrical model matches that of MCNPX. The assembly has also been analyzed by the deterministic code ERANOS. In addition, the differences between the effective neutron multiplication factor and the source multiplication factors have been examined by alternative calculational methodologies. The analyses include the delayed neutron fraction, prompt neutron lifetime, generation time, neutron flux profiles, and spectra in various experimental channels. The accuracy of the numerical models has been enhanced by accounting for all material impurities and the actual density of the polyethylene material used in the assembly (the latter value was obtained by dividing the total weight of the polyethylene by its volume in the numerical model). There is good agreement between the results from MONK, MCNPX, and ERANOS. The ERANOS results show small differences relative to the other results because of material homogenization and the energy and angle discretizations.The MCNPX results match the experimental measurements of the {sup 3}He(n,p) reaction rates obtained with the californium neutron source.

  19. Importance of (n,xn) reactions in evaluating kinetic parameters of subcritical assemblies: from classic to modern formalism

    Energy Technology Data Exchange (ETDEWEB)

    Talamo, Alberto; Gohar, Yousry, E-mail: alby@anl.gov [Argonne National Laboratory, Lemont, IL (United States); Dulla, Sandra; Ravetto, Piero [Politecnico di Torino (Italy)

    2011-07-01

    The importance of (n,xn) reactions must be taken into consideration while calculating the kinetic parameters of subcritical assemblies driven by an external neutron source. This study is divided into two parts, the first part is dedicated to the classic definition of the neutron source multiplication factor and two alternative calculation methodologies are compared. The second part considers a new definition of the kinetic parameters for subcritical assemblies, with particular emphasis on the delayed neutron fraction and generation time. This new definition has been modified to take into account the external neutron source and (n,xn) reactions, which increase the fraction of prompt neutrons. The developed theoretical framework has been applied by Monte Carlo and deterministic calculations to the YALINA Thermal subcritical assembly in Belarus. This facility can be driven by californium, deuterium-deuterium (D-D), or deuterium-tritium (D-T) external neutron sources. For the D-T neutron source, (n,xn) reactions must be taken into account in order to produce accurate results because the average energy of D-T source neutrons is 14.1 MeV, a value much higher than the threshold energy of the (n,2n) cross section of uranium isotopes. (author)

  20. Neutron Detector Signal Processing to Calculate the Effective Neutron Multiplication Factor of Subcritical Assemblies

    International Nuclear Information System (INIS)

    Talamo, Alberto; Gohar, Yousry

    2016-01-01

    This report describes different methodologies to calculate the effective neutron multiplication factor of subcritical assemblies by processing the neutron detector signals using MATLAB scripts. The subcritical assembly can be driven either by a spontaneous fission neutron source (e.g. californium) or by a neutron source generated from the interactions of accelerated particles with target materials. In the latter case, when the particle accelerator operates in a pulsed mode, the signals are typically stored into two files. One file contains the time when neutron reactions occur and the other contains the times when the neutron pulses start. In both files, the time is given by an integer representing the number of time bins since the start of the counting. These signal files are used to construct the neutron count distribution from a single neutron pulse. The built-in functions of MATLAB are used to calculate the effective neutron multiplication factor through the application of the prompt decay fitting or the area method to the neutron count distribution. If the subcritical assembly is driven by a spontaneous fission neutron source, then the effective multiplication factor can be evaluated either using the prompt neutron decay constant obtained from Rossi or Feynman distributions or the Modified Source Multiplication (MSM) method.

  1. MCNPX, MONK, and ERANOS analyses of the YALINA Booster subcritical assembly

    International Nuclear Information System (INIS)

    Talamo, Alberto; Gohar, Y.; Aliberti, G.; Cao, Y.; Smith, D.; Zhong, Z.; Kiyavitskaya, H.; Bournos, V.; Fokov, Y.; Routkovskaya, C.; Serafimovich, I.

    2011-01-01

    This paper compares the numerical results obtained from various nuclear codes and nuclear data libraries with the YALINA Booster subcritical assembly (Minsk, Belarus) experimental results. This subcritical assembly was constructed to study the physics and the operation of accelerator-driven subcritical systems (ADS) for transmuting the light water reactors (LWR) spent nuclear fuel. The YALINA Booster facility has been accurately modeled, with no material homogenization, by the Monte Carlo codes MCNPX (MCNP/MCB) and MONK. The MONK geometrical model matches that of MCNPX. The assembly has also been analyzed by the deterministic code ERANOS. In addition, the differences between the effective neutron multiplication factor and the source multiplication factors have been examined by alternative calculational methodologies. The analyses include the delayed neutron fraction, prompt neutron lifetime, generation time, neutron flux profiles, and spectra in various experimental channels. The accuracy of the numerical models has been enhanced by accounting for all material impurities and the actual density of the polyethylene material used in the assembly (the latter value was obtained by dividing the total weight of the polyethylene by its volume in the numerical model). There is good agreement between the results from MONK, MCNPX, and ERANOS. The ERANOS results show small differences relative to the other results because of material homogenization and the energy and angle discretizations.The MCNPX results match the experimental measurements of the 3 He(n,p) reaction rates obtained with the californium neutron source.

  2. Importance of (n,xn) reactions in evaluating kinetic parameters of subcritical assemblies: from classic to modern formalism

    International Nuclear Information System (INIS)

    Talamo, Alberto; Gohar, Yousry; Dulla, Sandra; Ravetto, Piero

    2011-01-01

    The importance of (n,xn) reactions must be taken into consideration while calculating the kinetic parameters of subcritical assemblies driven by an external neutron source. This study is divided into two parts, the first part is dedicated to the classic definition of the neutron source multiplication factor and two alternative calculation methodologies are compared. The second part considers a new definition of the kinetic parameters for subcritical assemblies, with particular emphasis on the delayed neutron fraction and generation time. This new definition has been modified to take into account the external neutron source and (n,xn) reactions, which increase the fraction of prompt neutrons. The developed theoretical framework has been applied by Monte Carlo and deterministic calculations to the YALINA Thermal subcritical assembly in Belarus. This facility can be driven by californium, deuterium-deuterium (D-D), or deuterium-tritium (D-T) external neutron sources. For the D-T neutron source, (n,xn) reactions must be taken into account in order to produce accurate results because the average energy of D-T source neutrons is 14.1 MeV, a value much higher than the threshold energy of the (n,2n) cross section of uranium isotopes. (author)

  3. Interface detection by neutron scattering

    International Nuclear Information System (INIS)

    De Monchy, A.R.; Kok, C.A.; Dorrepaal, J.

    1979-01-01

    A method and apparatus for detecting an interface of materials having different hydrogen content present in a metal vessel or pipe eg. made of steel, are described. Steel walls of columns, reactors, pipelines etc can be monitored. It is very suitable for detection of liquid water or hydrocarbons present in gas pipelines and also for the detection of a liquid hydrocarbon in a vessel or column. A series of measurements of the hydrogen density of the contents of a vessel or pipe are made using at least one californium-252 neutron source located near the outer side of the pipe. Neutrons are emitted and are scattered by the contents of the pipe. At least one neutron detector is located near the outer side of the metal wall. The detectors have a higher sensitivity for scattered neutrons (from the light hydrogen nuclei present in water or hydrocarbons). A source of 0.1 - 1 micrograms produces enough neutrons for most technical applications so the handling is relatively safe although shielding is advocated. The detectors contain helium-3 at a pressure of about 10 bar. Current pulses from the detector are counted. (U.K.)

  4. Toward achieving flexible and high sensitivity hexagonal boron nitride neutron detectors

    Science.gov (United States)

    Maity, A.; Grenadier, S. J.; Li, J.; Lin, J. Y.; Jiang, H. X.

    2017-07-01

    Hexagonal boron nitride (h-BN) detectors have demonstrated the highest thermal neutron detection efficiency to date among solid-state neutron detectors at about 51%. We report here the realization of h-BN neutron detectors possessing one order of magnitude enhancement in the detection area but maintaining an equal level of detection efficiency of previous achievement. These 3 mm × 3 mm detectors were fabricated from 50 μm thick freestanding and flexible 10B enriched h-BN (h-10BN) films, grown by metal organic chemical vapor deposition followed by mechanical separation from sapphire substrates. Mobility-lifetime results suggested that holes are the majority carriers in unintentionally doped h-BN. The detectors were tested under thermal neutron irradiation from californium-252 (252Cf) moderated by a high density polyethylene moderator. A thermal neutron detection efficiency of ˜53% was achieved at a bias voltage of 200 V. Conforming to traditional solid-state detectors, the realization of h-BN epilayers with enhanced electrical transport properties is the key to enable scaling up the device sizes. More specifically, the present results revealed that achieving an electrical resistivity of greater than 1014 Ωṡcm and a leakage current density of below 3 × 10-10 A/cm2 is needed to fabricate large area h-BN detectors and provided guidance for achieving high sensitivity solid state neutron detectors based on h-BN.

  5. Neutron activation determination of gold in technogenic raw materials with different mineral composition

    Directory of Open Access Journals (Sweden)

    Yudakov Aleksandr A.

    2015-01-01

    Full Text Available The methods used to determine the gold content in the technogenic objects of gold mining were analyzed regarding their non-homogeneity and complexity of chemical and mineral compositions. A possible application of the neutron activation analysis with the use of the californium source of neutrons for determining the content of fine-grained and extra-fine-grained gold in the technogenic objects, including the bottom-ash waste of energy providers, is considered. It was demonstrated that the chemical composition of the sample affects the neuron flux distribution in the sample, which can essentially distort the results of the neutron activation analysis. In order to eliminate possible systematic errors investigations of the effect of the sample mineral composition on the results of the gold determination using the neutron activation analysis were carried out. Namely, a large mass of rock (3-5 kg was loaded into an activation zone using four matrix types such as silicate, carbon-containing, iron-containing, and titanium magnetite. It was shown that there wereno significant difference between the dispersal of the fluxes of thermal and resonance neutrons emitted from 252Cf during activation of the gold-containing technogenic samples with different mineral compositions.

  6. Actinide metals

    International Nuclear Information System (INIS)

    Brown, Paul L.; Ekberg, Christian

    2016-01-01

    All isotopes of actinium are radioactive and exist in aqueous solution only in the trivalent state. There have been very few studies on the hydrolytic reactions of actinium(III). The hydrolysis reactions for uranium would only be important in alkaline pH conditions. Thermodynamic parameters for the hydrolysis species of uranium(VI) and its oxide and hydroxide phases can be determined from the stability and solubility constants. The hydrolytic behaviour of neptunium(VI) is quite similar to that of uranium(VI). The solubility constant of NpO 2 OH(am) has been reported a number of times for both zero ionic strength and in fixed ionic strength media. Americium can form four oxidation states in aqueous solution, namely trivalent, tetravalent, pentavalent and hexavalent. Desire, Hussonnois and Guillaumont determined stability constants for the species AmOH 2+ for the actinides, plutonium(III), americium(III), curium(III), berkelium(III) and californium(III) using a solvent extraction technique.

  7. Development and demonstration of a new SANEX Partitioning Process for selective actinide(III)/lanthanide(III) separation using a mixture of CyMe{sub 4}BTBP and TODGA

    Energy Technology Data Exchange (ETDEWEB)

    Modolo, G.; Wilden, A.; Daniels, H. [Forschungszentrum Juelich GmbH (Germany). Institute for Energy and Climate Research, IEK-6, Nuclear Waste Management and Reactor Safety; Geist, A.; Magnusson, D. [Karlsruher Institut fuer Technologie, Karlsruhe (Germany). Inst. fuer Nukleare Entsorgung; Malmbeck, R. [European Commission, JRC, Karlsruhe (Germany). Inst. for Transuranium Elements (ITU)

    2013-05-01

    Within the framework of the European collaborative project ACSEPT, a new SANEX partitioning process was developed at Forschungszentrum Juelich for the separation of the trivalent minor actinides americium, curium and californium from lanthanide fission products in spent nuclear fuels. The development is based on batch solvent extraction studies, single-centrifugal contactor tests and on flow-sheet design by computer code calculations. The used solvent is composed of 6,6{sup '}-bis(5,5,8,8-tetramethyl-5,6,7,8-tetrahydrobenzo-[1,2-4]trizazin-3-yl)-[2,2{sup '}]-bipyridine (CyMe{sub 4}BTBP) and N,N,N{sup '},N{sup '}-tetraoctyldiglycolamide (TODGA) dissolved in n-octanol. A spiked continuous counter-current test was carried out in miniature centrifugal contactors with the aid of a 20-stage flow-sheet consisting of 12 extraction, 4 scrubbing and 4 stripping stages. A product fraction containing more than 99.9% of the trivalent actinides Am(III), Cm(III) and Cf(III) was obtained. High product/feed decontamination factors >1000 were achieved for these actinides. The trivalent lanthanides were directed to the raffinate of the process with the actinide (III) product stream being contaminated with less than 0.5 mass-% in the initial lanthanides. (orig.)

  8. Fundamental aspects of Am and Cm in zirconia-based materials. Investigations using X-ray diffraction and Raman spectroscopy

    International Nuclear Information System (INIS)

    Raison, P.E.; Haire, R.G.; Assefa, Z.

    2002-01-01

    We have investigated incorporation of americium and curium in selected zirconia-based materials. Fundamental aspects were explored via X-ray diffraction and Raman spectroscopy. First explored was the pseudo ternary system, AmO 2 -ZrO 2 -Y 2 O 3 . It was found that stable, cubic solid solutions (Am x Zr 1-x Y y )O 2-2/y can be obtained for selected compositions. The cell parameters of the cubic phases were established as being linear with the AmO 2 content. For the Cm 2 O 3 -ZrO 2 system, it was determined that diphasic materials are produced, except for two compositions: 25 mol% and 50 mol% of CmO 1.5 . For these compositions a single-phase cubic fluorite type solid solution (a=5.21A±0.01) and a pyrochlore oxide Cm 2 Zr 2 O 7 (a=10.63A±0.02) are formed, respectively. The stability of pyrochlore oxides is also being investigated as a function of self-irradiation, using shorter-lived isotopes, one being the californium pyrochlore 249 Cf 2 Zr 2 O 7 . We obtained evidence that after six months of storage the pyrochlore oxide is undergoing structural change. Additional studies are in progress. (author)

  9. Review of the accomplishments and promise of US transplutonium research, 1940-1981

    International Nuclear Information System (INIS)

    Keller, O.L.; Wymer, R.G.

    1982-01-01

    It has been just over 40 years since the identification of plutonium by Seaborg, McMillan, Kennedy, and Wahl at the University of California, Berkeley. This discovery, and the isolation of plutonium-239 a year later by Kennedy, Seaborg, Segre, and Wahl, laid the cornerstone of one of the most exciting and productive eras of research in American history - research on the transplutonium elements. This research was to span all fields of natural science, and indeed was to have many implications and applications in the biological sciences. In this brief document, we have attempted to touch on only some of the many achievements of the US heavy element program. Many of those whose work has been at the heart of this research have contributed to this report. They have summarized some of what was scientifically important and exciting and they have suggested some of the topics of important research remaining to be done. The following topics are covered in this review: historical account; plutonium; synthesis of transplutonium isotopes; nuclear fission and stability, heavy ion reactions and nuclear structure; chemistry of the transplutonium elements; optical and magnetic properties; electronic structure and solid state properties; environmental and biological behavior of transplutonium elements; heavy element production; application of californium-252

  10. Efficiency of interaction between various radiation and chemicals

    International Nuclear Information System (INIS)

    Kim, Jin Kyu; Song, H. S.; Kim, J. S.; Chun, K. J.; Lee, Y. K.; Lee, B. H.; Shin, H. S.; Lee, K. H.; Petin, Vladislav G.

    2002-01-01

    KAERI and INP (Poland) have been carried out parallel study and joint experiments on the major topics according to MOU about their cooperative project. Major experimental techniques were TSH assay, comet assay, and synergism assay. The research consisted of the following workscopes. 1) Application of TSH bioindicator for studying the biological efficiency of radiation, 2) Relative biological efficiency of californium-252 neutrons in the induction of gene and lethal mutations in TSH cells normal and enriched with boron compound, 3) Effect of pesticide on radiation-induced mutations in TSH cells, 4) Interaction of radiation with pesticide on DNA damage in human peripheral blood lymphocytes, 5) Radiomodifying effect of boron and gadolinium compounds in human peripheral blood lymphocytes, 6) Mathematical description of synergistic interactions, 7) General regularities of synergistic interactions, and 8) Determinant of synergistic interaction between radiation, heat and chemicals in cell killing. Both institutes have established wide variety of research techniques applicable to various radiation research through the cooperation. The results of research can make the role of fundamental basis for the better relationship between Korea and Poland

  11. Separation of Am-Cm from Al(NO3)3 waste solutions by in-canyon-tank precipitation as oxalates

    International Nuclear Information System (INIS)

    Gray, L.W.; Burney, G.A.; Wilson, T.W.; McKibben, J.M.; Bibler, N.E.; Holtzscheiter, E.W.; Campbell, T.G.

    1982-04-01

    A process for recovery of Am-Cm residues from high-activity waste concentrates has been developed specifically for application in Savannah River Plant (SRP) canyon tanks. The Am-Cm residues were collected from a campaign to produce plutonium containing high isotopic concentrations of 242 Pu. The separation of Am-Cm from the high-activity waste stream, containing about 2M Al(NO 3 ) 3 , is necessary to produce an acceptable feed solution for a later pressurized cation exchange chromatography separation and purification step. The new process includes formic acid denitration, adjustment of contaminating cations by evaporation and water dilution, and oxalate precipitation of the actinides and lanthanides. After washing, the precipitate was dissolved in 8M nitric acid and the oxalate was destroyed by nitric acid oxidation that was catalyzed by manganous ions. This new process generates about one-fourth the waste of the californium solvent extraction process, which it replaced. The new process also produces a cleaner feed solution for the pressurized cation exchange chromatography separation and purification step

  12. On-line charge breeding using ECRIS and EBIS

    Energy Technology Data Exchange (ETDEWEB)

    Vondrasek, Richard, E-mail: Vondrasek@anl.gov

    2016-06-01

    The efficient and rapid production of a high-quality, pure beam of highly charged ions is at the heart of any radioactive ion beam facility. Whether an electron cyclotron resonance (ECR) ion source or an electron beam ion source (EBIS) is used to produce these highly charged ions, their operating characteristics will set the boundaries on the range of experiments which can be performed. In addition, time structure and duty cycle have to be considered when defining the operating parameters of the accelerator system as a whole. At Argonne National Laboratory (ANL), an ECR charge breeder was developed as part of the Californium Rare Ion Breeder Upgrade (CARIBU) program. The charge breeding efficiency and high charge state production of the source is at the forefront of ECR charge breeders, but its overall performance as part of the accelerator system is limited by pervasive background and relatively long breeding times. As such, an EBIS charge breeder has been developed and is running in an off-line configuration. It has already demonstrated good breeding efficiencies, shorter residence times, and reduced background and is scheduled to replace the ECR charge breeder in late 2015. The resultant change in duty cycle and time structure necessitates changes to the overall operation of the facility. The experiences with these breeders, as well as from several other facilities which already utilize an ECR or EBIS for charge breeding, help to define the operational characteristics of each technology – their strengths, their weaknesses, and the possible paths to improvement.

  13. B(E2) ↑ (01+ -> 21+) predictions for even–even nuclei in the differential equation model

    International Nuclear Information System (INIS)

    Nayak, R.C.; Pattnaik, S.

    2015-01-01

    We use the recently developed differential equation model (DEM) for the reduced electric quadrupole transition probability B(E2)↑ for the transition from the ground to the first 2 + state for predicting its values for a wide range of even–even nuclides almost throughout the nuclear landscape from Neon to Californium. This is made possible as the principal equation in the model, namely, the differential equation connecting the B(E2)↑ value of a given even–even nucleus with its derivatives with respect to the neutron and proton numbers, provides two different recursion relations, each connecting three different neighboring even–even nuclei from lower- to higher-mass numbers and vice versa. These relations are primarily responsible in extrapolating from known to unknown terrain of the B(E2)↑-landscape and thereby facilitate the predictions throughout. As a result, we have succeeded in predicting its hitherto unknown value for the adjacent 251 isotopes lying on either side of the known B(E2)↑ database. (author)

  14. A technique for combining neutron and gamma-ray data into a single assay value

    International Nuclear Information System (INIS)

    Pickrell, M.M.; Mercer, D.; Sharpe, T.J.

    1998-01-01

    The authors explored the potentials of using both neutron and gamma-ray measurements on a single item and combining these data into a single assay value. The purpose was to improve assay capability for sample matrices that are difficult to measure. They chose an empirical approach because they wanted to address difficult-to-measure items for which the assay problem is complex. They used the tomographic gamma scanner; a passive, high-efficiency neutron counter with add-a-source and multiplicity; and an active neutron, californium shuffler to obtain measurements. Twenty-four 200-L drums were measured with various matrices using all three machines. The matrices were chosen specifically to spain the difficult-to-measure assay problems for some or all of the instruments. For example, the authors measured a drum filled with concrete and another filled with metal. The data from these measurements were analyzed using the alternating conditional expectation algorithm, which is one of a class of generalized additive models. Other data fusion algorithms are also possible and are being explored. The intent was to find ways to combine the data that would reduce the matrix-induced measurement error

  15. Reprocessing of nuclear fuels at the Savannah River Plant

    International Nuclear Information System (INIS)

    Gray, L.W.

    1986-01-01

    For more than 30 years, the Savannah River Plant (SRP) has been a major supplier of nuclear materials such as plutonium-239 and tritium-3 for nuclear and thermonuclear weapons, plutonium-238 for space exploration, and isotopes of americium, curium, and californium for use in the nuclear research community. SRP is a complete nuclear park, providing most of the processes in the nuclear fuel cycle. Key processes involve fabrication and cladding of the nuclear fuel, target, and control assemblies; rework of heavy water for use as reactor moderator; reactor loading, operation, and unloading; chemical recovery of the reactor transmutation products and spent fuels; and management of the gaseous, liquid, and solid nuclear and chemical wastes; plus a host of support operations. The site's history and the key processes from fabrication of reactor fuels and targets to finishing of virgin plutonium for use in the nuclear weapons complex are reviewed. Emphasis has been given to the chemistry of the recovery and purification of weapons grade plutonium from irradiated reactor targets

  16. Testing for moisture content in foods by neutron gaging

    International Nuclear Information System (INIS)

    Helf, S.

    1976-01-01

    Neutron gaging was applied to the testing for moisture content in bulk powdered foods and in canned Army field rations. The technique is based on the moderation or thermalization of fast neutrons by hydrogenous matter and the measurement of thermal neutron intensity as a function of moisture content. A small californium-252 capsule, of approximate output 10 7 neutrons per second, was used as the source of fast neutrons. It is concluded that a fast neutron moderation technique is feasible for the nondestructive measurement or control of moisture or both in near-dry bulk powdered foods. Samples must be measured under identical geometric conditions, that is, uniform bulk density and volume using a standard metal container or cell. For canned or otherwise prepacked rations, measurement of moisture is interfered with by variations in fill weight among cans or packages of the same product. A gamma-ray attenuation gaging method proved to be of insufficient sensitivity to correct for fill weight variation and was further complicated by nonuniformity in can wall dimensions. Neutron gaging, however, appears to be quite useful for monitoring a standard packaged item for fill weight since the neutron signal is virtually unaffected by variations in container dimensions. The radiation dose imparted to a sample or package of food subjected to such a test is judged to pose no threat to humans from subsequent consumption of the food. An estimate is given for the cost range of a commercial neutron gage and of encapsulated radioisotopic neutron sources

  17. About possibilities of obtaining focused beams of thermal neutrons of radionuclide source

    International Nuclear Information System (INIS)

    Aripov, G.A.; Kurbanov, B.I.; Sulaymanov, N.T.; Ergashev, A.

    2004-01-01

    Full text: In the last years significant progress is achieved in development of neutron focusing methods (concentrating neutrons in a given direction and a small area). In this, main attention is given to focusing of neutron beams of reactor, particularly cold neutrons and their applications. [1,2]. However, isotope sources also let obtain intensive neutron beams and solve quite important (tasks) problems (e.g. neutron capture therapy for malignant tumors) [3], and an actual problems is focusing of neutrons. We developed a device on the basis of californium source of neutrons, allowing to obtain focused (preliminarily) beam of thermal neutrons with the aid of respective choice of moderators, reflectors and geometry of their disposition. Here, fast neutrons and gamma rays in the beam are minimized. With the aid of the model we developed on the basis of Monte-Carlo method, it is possible to modify aforementioned device and dynamics of output neutrons in wide energy range and analyze ways of optimization of neutron beams of isotope sources with different neutron outputs. Device of preliminary focusing of thermal neutrons can serve as a basis for further focus of neutrons using micro- and nano-capillar systems. It is known that, capillary systems performed with certain technology can form beam of thermal neutrons increasing its density by more than two orders of magnitude and effectively divert beams up to 20 o with length of system 15 cm

  18. About possibilities of obtaining focused beams of thermal neutrons of radionuclide source

    International Nuclear Information System (INIS)

    Aripov, G.A.; Kurbanov, B.I.; Sulaymanov, N.T.; Ergashev, A.

    2004-01-01

    In the last years significant progress is achieved in development of neutron focusing methods (concentrating neutrons in a given direction and a small area). In this, main attention is given to focusing of neutron beams of reactor, particularly cold neutrons and their applications. [1,2]. However, isotope sources also let obtain intensive neutron beams and solve quite important (tasks) problems (e.g. neutron capture therapy for malignant tumors) [3], and an actual problems is focusing of neutrons. We developed a device on the basis of californium source of neutrons, allowing to obtain focused (preliminarily) beam of thermal neutrons with the aid of respective choice of moderators, reflectors and geometry of their disposition. Here, fast neutrons and gamma rays in the beam are minimized. With the aid of the model we developed on the basis of Monte-Carlo method, it is possible to modify aforementioned device and dynamics of output neutrons in wide energy range and analyze ways of optimization of neutron beams of isotope sources with different neutron outputs. Device of preliminary focusing of thermal neutrons can serve as a basis for further focus of neutrons using micro- and nano-capillary systems. It is known that, capillary systems performed with certain technology can form beam of thermal neutrons increasing its density by more than two orders of magnitude and effectively divert beams up to 20 o with length of system 15 cm. (author)

  19. Investigation of Workplace-like Calibration Fields via a Deuterium-Tritium (D-T) Neutron Generator.

    Science.gov (United States)

    Mozhayev, Andrey V; Piper, Roman K; Rathbone, Bruce A; McDonald, Joseph C

    2017-04-01

    Radiation survey meters and personal dosimeters are typically calibrated in reference neutron fields based on conventional radionuclide sources, such as americium-beryllium (Am-Be) or californium-252 (Cf), either unmodified or heavy-water moderated. However, these calibration neutron fields differ significantly from the workplace fields in which most of these survey meters and dosimeters are being used. Although some detectors are designed to yield an approximately dose-equivalent response over a particular neutron energy range, the response of other detectors is highly dependent upon neutron energy. This, in turn, can result in significant over- or underestimation of the intensity of neutron radiation and/or personal dose equivalent determined in the work environment. The use of simulated workplace neutron calibration fields that more closely match those present at the workplace could improve the accuracy of worker, and workplace, neutron dose assessment. This work provides an overview of the neutron fields found around nuclear power reactors and interim spent fuel storage installations based on available data. The feasibility of producing workplace-like calibration fields in an existing calibration facility has been investigated via Monte Carlo simulations. Several moderating assembly configurations, paired with a neutron generator using the deuterium tritium (D-T) fusion reaction, were explored.

  20. Calculated NWIS signatures for enriched uranium metal

    International Nuclear Information System (INIS)

    Valentine, T.E.; Mihalczo, J.T.; Koehler, P.E.

    1995-01-01

    Nuclear Weapons Identification System (NWIS) signatures have been calculated using a Monte Carlo transport code for measurement configurations of a 252 Cf source, detectors, and a uranium metal casting. NWIS signatures consist of a wide variety of time-and frequency-analysis signatures such as the time distribution of neutrons after californium fission, the time distribution of counts in a detector after a previous count, the number of times n pulses occur in a time interval, and various frequency-analysis signatures, such as auto-power and cross-power spectral densities, coherences, and a ratio of spectral densities. This ratio is independent of detection efficiency. The analysis presented here, using the MCNP-DSP code, evaluates the applicability of this method for measurement of the 235 U content of 19-kg castings of depleted uranium and uranium with enrichments of 20, 40, 60, 80, 90, and 93.2 wt % 235 U. The dependence of the wide variety of NWIS signatures on 235 U content and possible configurations of a measurement system are presented. These preliminary calculations indicate short measurement times. Additional calculations are being performed to optimize the source-detector-moderator-casting configuration for the shortest measurement time. Although the NWIS method was developed for nuclear weapons identification, the development of a small processor now allows it to be also applied in a practical way to subcriticality measurements, nuclear fuel process monitoring and qualitative nondestructive assay of special nuclear material