WorldWideScience

Sample records for californium 243

  1. Historical review of californium-252 discovery and development

    Science.gov (United States)

    Stoddard, D. H.

    This paper discusses the discovery and history of californium 252. This isotope may be synthesized by irradiating plutonium 239, plutonium 242, americium 243, or curium 244 with neutrons in a nuclear reactor. Various experiments and inventions involving (252)Cf conducted at the Savannah River Plant are discussed. The evolution of radiotherapy using californium 252 is reviewed.

  2. Californium-252 progress, report No. 7, April 1971

    Energy Technology Data Exchange (ETDEWEB)

    1971-12-31

    This report contains discusses of the following topics on Californium-252: First sales of californium-252; encapsulation services discussed; three new participants in market evaluation program; summer training programs to use californium; Californium-252 shipping casks available; Californium-252 questions and answers, radiotherapy; neutron radiography; natural resources exploration; nuclear safeguards; process control; dosimetry; neutron radiography; neutron shielding; and nuclear safeguards.

  3. Californium-252: a remarkable versatile radioisotope

    Energy Technology Data Exchange (ETDEWEB)

    Osborne-Lee, I.W.; Alexander, C.W.

    1995-10-10

    A product of the nuclear age, Californium-252 ({sup 252}Cf) has found many applications in medicine, scientific research, industry, and nuclear science education. Californium-252 is unique as a neutron source in that it provides a highly concentrated flux and extremely reliable neutron spectrum from a very small assembly. During the past 40 years, {sup 252}Cf has been applied with great success to cancer therapy, neutron radiography of objects ranging from flowers to entire aircraft, startup sources for nuclear reactors, fission activation for quality analysis of all commercial nuclear fuel, and many other beneficial uses, some of which are now ready for further growth. Californium-252 is produced in the High Flux Isotope Reactor (HFIR) and processed in the Radiochemical Engineering Development Center (REDC), both of which are located at the Oak Ridge National Laboratory (ORNL) in Oak Ridge, Tennessee. The REDC/HFIR facility is virtually the sole supplier of {sup 252}Cf in the western world and is the major supplier worldwide. Extensive exploitation of this product was made possible through the {sup 252}Cf Market Evaluation Program, sponsored by the United States Department of Energy (DOE) [then the Atomic Energy Commission (AEC) and later the Energy Research and Development Administration (ERDA)]. This program included training series, demonstration centers, seminars, and a liberal loan policy for fabricated sources. The Market Evaluation Program was instituted, in part, to determine if large-quantity production capability was required at the Savannah River Laboratory (SRL). Because of the nature of the product and the means by which it is produced, {sup 252}Cf can be produced only in government-owned facilities. It is evident at this time that the Oak Ridge research facility can meet present and projected near-term requirements. The production, shipment, and sales history of {sup 252}Cf from ORNL is summarized herein.

  4. Production, Distribution, and Applications of Californium-252 Neutron Sources

    Energy Technology Data Exchange (ETDEWEB)

    Balo, P.A.; Knauer, J.B.; Martin, R.C.

    1999-10-03

    The radioisotope {sup 252}Cf is routinely encapsulated into compact, portable, intense neutron sources with a 2.6-year half-life. A source the size of a person's little finger can emit up to 10{sup 11} neutrons/s. Californium-252 is used commercially as a reliable, cost-effective neutron source for prompt gamma neutron activation analysis (PGNAA) of coal, cement, and minerals, as well as for detection and identification of explosives, laud mines, and unexploded military ordnance. Other uses are neutron radiography, nuclear waste assays, reactor start-up sources, calibration standards, and cancer therapy. The inherent safety of source encapsulations is demonstrated by 30 years of experience and by U.S. Bureau of Mines tests of source survivability during explosions. The production and distribution center for the U. S Department of Energy (DOE) Californium Program is the Radiochemical Engineering Development Center (REDC) at Oak Ridge National Laboratory (ORNL). DOE sells The radioisotope {sup 252}Cf is routinely encapsulated into compact, portable, intense neutron sources with a 2.6- year half-life. A source the size of a person's little finger can emit up to 10 neutrons/s. Californium-252 is used commercially as a reliable, cost-effective neutron source for prompt gamma neutron activation analysis (PGNAA) of coal, cement, and minerals, as well as for detection and identification of explosives, laud mines, and unexploded military ordnance. Other uses are neutron radiography, nuclear waste assays, reactor start-up sources, calibration standards, and cancer therapy. The inherent safety of source encapsulations is demonstrated by 30 years of experience and by U.S. Bureau of Mines tests of source survivability during explosions. The production and distribution center for the U. S Department of Energy (DOE) Californium Program is the Radiochemical Engineering Development Center (REDC) at Oak Ridge National Laboratory(ORNL). DOE sells {sup 252}Cf to commercial

  5. Geology of 243 Ida

    Science.gov (United States)

    Sullivan, R.; Greeley, R.; Pappalardo, R.; Asphaug, E.; Moore, Johnnie N.; Morrison, D.; Belton, M.J.S.; Carr, M.; Chapman, C.R.; Geissler, P.; Greenberg, R.; Granahan, J.; Head, J. W.; Kirk, R.; McEwen, A.; Lee, P.; Thomas, P.C.; Veverka, J.

    1996-01-01

    The surface of 243 Ida is dominated by the effects of impacts. No complex crater morphologies are observed. A complete range of crater degradation states is present, which also reveals optical maturation of the surface (darkening and reddening of materials with increasing exposure age). Regions of bright material associated with the freshest craters might be ballistically emplaced deposits or the result of seismic disturbance of loosely-bound surface materials. Diameter/depth ratios for fresh craters on Ida are ???1:6.5, similar to Gaspra results, but greater than the 1:5 ratios common on other rocky bodies. Contributing causes include rim degradation by whole-body "ringing," relatively thin ejecta blankets around crater rims, or an extended strength gradient in near-surface materials due to low gravitational self-packing. Grooves probably represent expressions in surface debris of reactivated fractures in the deeper interior. Isolated positive relief features as large as 150 m are probably ejecta blocks related to large impacts. Evidence for the presence of debris on the surface includes resolved ejecta blocks, mass-wasting scars, contrasts in color and albedo of fresh crater materials, and albedo streaks oriented down local slopes. Color data indicate relatively uniform calcium abundance in pyroxenes and constant pyroxene/olivine ratio. A large, relatively blue unit across the northern polar area is probably related to regolith processes involving ejecta from Azzurra rather than representing internal compositional heterogeneity. A small number of bluer, brighter craters are randomly distributed across the surface, unlike on Gaspra where these features are concentrated along ridges. This implies that debris on Ida is less mobile and/or consistently thicker than on Gaspra. Estimates of the average depth of mobile materials derived from chute depths (20-60 m), grooves (???30 m), and shallowing of the largest degraded craters (20-50 m minimum, ???100 m maximum

  6. Gclust Server: 243 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available 243 CEL_K07E3.3_17568735 Cluster Sequences Related Sequences(40) 303 dao-3: Dauer or Aging... sequences Related Sequences(40) Sequence length 303 Representative annotation dao-3: Dauer or Aging

  7. Unusual structure, bonding and properties in a californium borate

    Energy Technology Data Exchange (ETDEWEB)

    Polinski, Matthew J.; Garner, Edward B.; Maurice, Rémi; Planas, Nora; Stritzinger, Jared T.; Parker, T. Gannon; Cross, Justin N.; Green, Thomas D.; Alekseev, Evgeny V.; Van Cleve, Shelley M.; Depmeier, Wulf; Gagliardi, Laura; Shatruk, Michael; Knappenberger, Kenneth L.; Liu, Guokui; Skanthakumar, S.; Soderholm, Lynda; Dixon, David A.; Albrecht-Schmitt, Thomas E.

    2014-03-23

    The participation of the valence orbitals of actinides in bonding has been debated for decades. Recent experimental and computational investigations demonstrated the involvement of 6p, 6d and/or 5f orbitals in bonding. However, structural and spectroscopic data, as well as theory, indicate a decrease in covalency across the actinide series, and the evidence points to highly ionic, lanthanide-like bonding for late actinides. Here we show that chemical differentiation between californium and lanthanides can be achieved by using ligands that are both highly polarizable and substantially rearrange on complexation. A ligand that suits both of these desired properties is polyborate. We demonstrate that the 5f, 6d and 7p orbitals are all involved in bonding in a Cf(III) borate, and that large crystal-field effects are present. Synthetic, structural and spectroscopic data are complemented by quantum mechanical calculations to support these observations.

  8. Nuclear Data Sheets for A = 243

    Energy Technology Data Exchange (ETDEWEB)

    Nesaraja, C.D. [Physics Division, Oak Ridge National Laboratory, Oak Ridge, Tennessee 37831–6354 (United States); McCutchan, E.A. [National Nuclear Data Center, Brookhaven National Laboratory, Upton, New York 11973–5000 (United States)

    2014-09-15

    Available information pertaining to the nuclear structure of all nuclei with mass numbers A=243 is presented. Various decay and reaction data are evaluated and compared. Adopted data, levels, spin, parity and configuration assignments are given. When there are insufficient data, expected values from systematics of nuclear properties or/and theoretical calculations are quoted. Unexpected or discrepant experimental results are also noted. A summary and compilation of the discovery of various isotopes in this mass region is given in 2013Fr02 ({sup 243}Np, {sup 243}Pu, {sup 243}Am, {sup 243}Cm, {sup 243}Bk, and {sup 243}Cf), 2011Me01 ({sup 243}Es), and 2013Th02 ({sup 243}Fm)

  9. 40 CFR 243.204 - Collection management.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Collection management. 243.204 Section 243.204 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES GUIDELINES... and Recommended Procedures § 243.204 Collection management. ...

  10. 40 CFR 243.201 - Safety.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Safety. 243.201 Section 243.201 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES GUIDELINES FOR THE STORAGE... Procedures § 243.201 Safety. ...

  11. 37 CFR 2.43 - Service mark.

    Science.gov (United States)

    2010-07-01

    ... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Service mark. 2.43 Section 2.43 Patents, Trademarks, and Copyrights UNITED STATES PATENT AND TRADEMARK OFFICE, DEPARTMENT OF COMMERCE RULES OF PRACTICE IN TRADEMARK CASES The Written Application § 2.43 Service mark. In an...

  12. 48 CFR 243.204 - Administration.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Administration. 243.204... OF DEFENSE CONTRACT MANAGEMENT CONTRACT MODIFICATIONS Change Orders 243.204 Administration. Follow the procedures at PGI 243.204 for administration of change orders. ...

  13. 46 CFR 169.243 - Electrical.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Electrical. 169.243 Section 169.243 Shipping COAST GUARD... Certification Inspections § 169.243 Electrical. At each inspection for certification and periodic inspection... that they are in proper operating condition, in safe electrical condition, and fit for the service for...

  14. 40 CFR 243.203 - Collection frequency.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Collection frequency. 243.203 Section 243.203 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES GUIDELINES... and Recommended Procedures § 243.203 Collection frequency. ...

  15. Biomedical neutron research at the Californium User Facility for neutron science

    Energy Technology Data Exchange (ETDEWEB)

    Martin, R.C. [Oak Ridge National Lab., TN (United States); Byrne, T.E. [Roane State Community College, Harriman, TN (United States); Miller, L.F. [Univ. of Tennessee, Knoxville, TN (United States)

    1997-04-01

    The Californium User Facility for Neutron Science has been established at Oak Ridge National Laboratory (ORNL). The Californium User Facility (CUF) is a part of the larger Californium Facility, which fabricates and stores compact {sup 252}Cf neutron sources for worldwide distribution. The CUF can provide a cost-effective option for research with {sup 252}Cf sources. Three projects at the CUF that demonstrate the versatility of {sup 252}Cf for biological and biomedical neutron-based research are described: future establishment of a {sup 252}Cf-based neutron activation analysis system, ongoing work to produce miniature high-intensity, remotely afterloaded {sup 252}Cf sources for tumor therapy, and a recent experiment that irradiated living human lung cancer cells impregnated with experimental boron compounds to test their effectiveness for boron neutron capture therapy.

  16. Dicty_cDB: SLF243 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLF243 (Link to dictyBase) - - - Contig-U16358-1 SLF243Z (Link... to Original site) - - SLF243Z 448 - - - - Show SLF243 Library SL (Link to library) Clone ID SLF243 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLF2-B/SLF243Q.Seq.d/ Representative seq. ID SLF24...3Z (Link to Original site) Representative DNA sequence >SLF243 (SLF243Q) /CSM/SL/SLF2-B/SLF243Q.Seq.d/ XXXXX...5 Translated Amino Acid sequence ---EHDAPIVKTELFVPILYIMKFKNLDDAFAWNNEVPQGLSSSLFTNNQKNIFKWLGPT GSDCGIVNVNVATN

  17. Dicty_cDB: VHF243 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF243 (Link to dictyBase) - - - Contig-U16423-1 VHF243P (Link to Original site) VHF...243F 580 VHF243Z 334 VHF243P 894 - - Show VHF243 Library VH (Link to library) Clone ID VHF... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHF2-B/VHF243Q.Seq.d/ Representative seq. ID VHF...243P (Link to Original site) Representative DNA sequence >VHF243 (VHF243Q) /CSM/VH/VHF2-B/VHF2...AATCNAGATATTCCAGATTGGTTTGAAAAGATGG TACA sequence update 2002.10.25 Translated Amino Acid sequence ifihadkff*RISHF

  18. 27 CFR 24.243 - Filtering aids.

    Science.gov (United States)

    2010-04-01

    ... OF THE TREASURY LIQUORS WINE Storage, Treatment and Finishing of Wine § 24.243 Filtering aids. Inert fibers, pulps, earths, or similar materials, may be used as filtering aids in the cellar treatment and... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Filtering aids. 24.243...

  19. 7 CFR 1220.243 - Confidential treatment.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 10 2010-01-01 2010-01-01 false Confidential treatment. 1220.243 Section 1220.243 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (MARKETING... Confidential treatment. Except as otherwise provided in the Act, financial or commercial information that is...

  20. 40 CFR 86.243-94 - [Reserved

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 18 2010-07-01 2010-07-01 false 86.243-94 Section 86.243-94 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED) CONTROL OF... Year Gasoline-Fueled New Light-Duty Vehicles, New Light-Duty Trucks and New Medium-Duty Passenger...

  1. Dicty_cDB: SLJ243 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLJ243 (Link to dictyBase) - - - Contig-U16366-1 SLJ243Z (Link... to Original site) - - SLJ243Z 333 - - - - Show SLJ243 Library SL (Link to library) Clone ID SLJ243 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLJ2-B/SLJ243Q.Seq.d/ Representative seq. ID SLJ24...3Z (Link to Original site) Representative DNA sequence >SLJ243 (SLJ243Q) /CSM/SL/SLJ2-B/SLJ243Q.Seq.d/ XXXXX.../SLK513Q.Seq.d/ 547 e-155 SLJ243 (SLJ243Q) /CSM/SL/SLJ2-B/SLJ243Q.Seq.d/ 547 e-15

  2. Apparatus for the measurement of total body nitrogen using prompt neutron activation analysis with californium-252.

    Science.gov (United States)

    Mackie, A; Hannan, W J; Smith, M A; Tothill, P

    1988-01-01

    Details of clinical apparatus designed for the measurement of total body nitrogen (as an indicator of body protein), suitable for the critically ill, intensive-care patient are presented. Californium-252 radio-isotopic neutron sources are used, enabling a nitrogen measurement by prompt neutron activation analysis to be made in 40 min with a precision of +/- 3.2% for a whole body dose equivalent of 0.145 mSv. The advantages of Californium-252 over alternative neutron sources are discussed. A comparison between two irradiation/detection geometries is made, leading to an explanation of the geometry adopted for the apparatus. The choice of construction and shielding materials to reduce the count rate at the detectors and consequently to reduce the pile-up contribution to the nitrogen background is discussed. Salient features of the gamma ray spectroscopy system to reduce spectral distortion from pulse pile-up are presented.

  3. Safety Analysis Report for Packaging (SARP) of the Oak Ridge National Laboratory TRU Californium Shipping Container

    Energy Technology Data Exchange (ETDEWEB)

    Box, W.D.; Shappert, L.B.; Seagren, R.D.; Klima, B.B.; Jurgensen, M.C.; Hammond, C.R.; Watson, C.D.

    1980-01-01

    An analytical evaluation of the Oak Ridge National Laboratory TRU Californium Shipping Container was made in order to demonstrate its compliance with the regulations governing off-site shipment of packages that contain radioactive material. The evaluation encompassed five primary categories: structural integrity, thermal resistance, radiation shielding, nuclear criticality safety, and quality assurance. The results of this evaluation demonstrate that the container complies with the applicable regulations.

  4. Dicty_cDB: SLC243 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLC243 (Link to dictyBase) - G01919 DDB0204742 Contig-U13931-1 SLC...243P (Link to Original site) SLC243F 1119 SLC243Z 565 SLC243P 1674 - - Show SLC243 Library SL (Link to library) Clone ID SLC... Contig-U13931-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLC2-B/SLC...243Q.Seq.d/ Representative seq. ID SLC243P (Link to Original site) Representative DNA sequence >SLC243 (SLC243Q) /CSM/SL/SLC...2-B/SLC243Q.Seq.d/ ATAATTTTTTTTATTGTTGATCATTTGGTATATTAAGTGTTATTGTTTATATAATATATA TTTAAG

  5. Käibemaksu maksmine maksab 243 miljonit

    Index Scriptorium Estoniae

    2005-01-01

    Poliitikauuringute keskuse PRAXIS uurimus näitas, et Eesti ettevõtetel kulub käibemaksu administreerimisele ja seadustega kursis hoidmisele aastas kokku 243 miljonit krooni, mis võrdub 0,25% SKP-st. Tabel: Suurim kulu ettevõtetele on enda kursishoidmine käibemaksuküsimustes. Vt. samas: Kuidas PRAXIS halduskoormust hindas

  6. 48 CFR 243.204-70-2 - Price ceiling.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Price ceiling. 243.204-70-2 Section 243.204-70-2 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS SYSTEM, DEPARTMENT OF DEFENSE CONTRACT MANAGEMENT CONTRACT MODIFICATIONS Change Orders 243.204-70-2 Price ceiling...

  7. 12 CFR 303.243 - Brokered deposit waivers.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 4 2010-01-01 2010-01-01 false Brokered deposit waivers. 303.243 Section 303.243 Banks and Banking FEDERAL DEPOSIT INSURANCE CORPORATION PROCEDURE AND RULES OF PRACTICE FILING PROCEDURES Other Filings § 303.243 Brokered deposit waivers. (a) Scope. Pursuant to section 29 of the FDI Act...

  8. Dicty_cDB: VSE243 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VS (Link to library) VSE243 (Link to dictyBase) - - - Contig-U13893-1 VSE243E (Link... to Original site) - - - - - - VSE243E 548 Show VSE243 Library VS (Link to library) Clone ID VSE243 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U13893-1 Original site URL http://dict...no Acid sequence DLGSFNQALEQNSDIFKSDQTFTLVQRLRSNVIKAGLKKLNTAYSRISFNDICTKLKFDG TTQDIMFIIAKTIKDGVIDATINYEGGYLQ...ino Acid sequence (All Frames) Frame A: DLGSFNQALEQNSDIFKSDQTFTLVQRLRSNVIKAGLKKLNTAYSRISFNDICT

  9. First Galileo image of asteroid 243 Ida

    Science.gov (United States)

    Chapman, C. R.; Belton, M. J. S.; Veverka, J.; Neukum, G.; Head, J.; Greeley, Ronald; Klaasen, K.; Morrison, D.

    1994-01-01

    The second spacecraft encounter with an asteroid has yielded an unprecedentedly high resolution portrait of 243 Ida. On 28 Aug. 1993, Galileo obtained an extensive data set on this small member of the Koronis family. Most of the data recorded on the tape recorder will be returned to Earth in spring 1994. A five-frame mosaic of Ida was acquired with good illumination geometry a few minutes before closest approach; it has a resolution of 31 to 38 m/pixel amd was played back during Sept. 1993. Preliminary analyses of this single view of Ida are summarized.

  10. First images of asteroid 243 Ida

    Science.gov (United States)

    Belton, M.J.S.; Chapman, C.R.; Veverka, J.; Klaasen, K.P.; Harch, A.; Greeley, R.; Greenberg, R.; Head, J. W.; McEwen, A.; Morrison, D.; Thomas, P.C.; Davies, M.E.; Carr, M.H.; Neukum, G.; Fanale, F.P.; Davis, D.R.; Anger, C.; Gierasch, P.J.; Ingersoll, A.P.; Pilcher, C.B.

    1994-01-01

    The first images of the asteroid 243 Ida from Galileo show an irregular object measuring 56 kilometers by 24 kilometers by 21 kilometers. Its surface is rich in geologic features, including systems of grooves, blocks, chutes, albedo features, crater chains, and a full range of crater morphologies. The largest blocks may be distributed nonuniformly across the surface; lineaments and dark-floored craters also have preferential locations. Ida is interpreted to have a substantial regolith. The high crater density and size-frequency distribution (-3 differential power-law index) indicate a surface in equilibrium with saturated cratering. A minimum model crater age for Ida - and therefore for the Koronis family to which Ida belongs - is estimated at 1 billion years, older than expected.

  11. Dicty_cDB: VHP243 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHP243 (Link to dictyBase) - - - Contig-U16236-1 - (Link to Or...iginal site) VHP243F 134 - - - - - - Show VHP243 Library VH (Link to library) Clone ID VHP243 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16236-1 Original site URL http://dictycdb.b...AXXXXXXXXXX sequence update 2002.10.25 Translated Amino Acid sequence CWPTGIXKTTICT...kilsif*ynfkyyqqpkkk--- Frame B: llaywyxqnnnlyqyyyyfyl*kyflsfniilniinnpkk--- Frame C: CWPTGIXKTTICTNTTIISICKN

  12. 47 CFR 24.243 - The cost-sharing formula.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 2 2010-10-01 2010-10-01 false The cost-sharing formula. 24.243 Section 24.243... cost-sharing formula. A PCS relocator who relocates an interfering microwave link, i.e. one that is in...—antenna, necessary feed lines, MUX/Modems); towers and/or modifications; back-up power equipment...

  13. 5 CFR 531.243 - Promotion of a GM employee.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Promotion of a GM employee. 531.243... UNDER THE GENERAL SCHEDULE Determining Rate of Basic Pay Special Rules for Gm Employees § 531.243 Promotion of a GM employee. (a) Upon promotion, an employee's status as a GM employee ends, as provided in...

  14. Application of TSH bioindicator for studying the biological efficiency of neutrons from californium-252 source

    Energy Technology Data Exchange (ETDEWEB)

    Cebulska-Wasilewska, A.; Rekas, K. [Institute of Nuclear Physics, Cracow (Poland); Kim, J.K. [Korea Atomic Energy Research Inst., Taejon (Korea, Republic of)

    1997-12-31

    The effectiveness of neutrons from a Californium-252 source in the induction of various abnormalities in the Tradescantia clone 4430 stamen hair cells (TSH-assay) was studied. The special attention was paid to check whether any enhancement in effects caused by process of boron neutron capture is visible in the cells enriched with boron ions. Two chemicals (borax and BSH) were applied to introduce boron-10 ions into cells. Inflorescence, normal or pretreated with chemicals containing boron, were irradiated in the air with neutrons from a Cf-252 source at KAERI, Taejon, Korea. To estimate the relative biological effectiveness (RBE) in the induction of gene mutations of the neutron beam under the study, Tradescantia inflorescences, without any chemical pretreatment, were irradiated with various doses of X-rays. The ranges of radiation doses used were 0-0.1 Gy in neutrons and 0-0.5 Gy in X-rays. After the time needed to complete the postirradiation repair Tradescantia cuttings were transferred to Cracow, where screening of gene and lethal; mutations, cell cycle alterations in somatic cells have been done, and dose response relationships were figured. The maximal RBE values were estimated in the range of 4.6-6.8. Alterations of RBE value were observed; from 6.8 to 7.8 in the case of plants pretreated with 240 ppm of B-10 from borax, and 4.6 to 6.1 in the case of 400 ppm of B-10 from BSH. Results showed a slight, although statistically insignificant increase in biological efficacy of radiation from the Cf-252 source in samples pretreated with boron containing chemicals. (author)

  15. Study of the shielding for spontaneous fission sources of Californium-252; Estudio de blindaje para fuentes de fision espontanea de Californio-252

    Energy Technology Data Exchange (ETDEWEB)

    Davila R, I

    1991-06-15

    A shielding study is made to attenuate, until maximum permissible levels, the neutrons radiation and photons emitted by spontaneous fission coming from a source of Californium-252. The compound package by a database (Library DLC-23) and the ANISNW code is used, in it version for personal computer. (Author)

  16. Simulation and design of an electron beam ion source charge breeder for the californium rare isotope breeder upgrade

    Directory of Open Access Journals (Sweden)

    Clayton Dickerson

    2013-02-01

    Full Text Available An electron beam ion source (EBIS will be constructed and used to charge breed ions from the californium rare isotope breeder upgrade (CARIBU for postacceleration into the Argonne tandem linear accelerator system (ATLAS. Simulations of the EBIS charge breeder performance and the related ion transport systems are reported. Propagation of the electron beam through the EBIS was verified, and the anticipated incident power density within the electron collector was identified. The full normalized acceptance of the charge breeder with a 2 A electron beam, 0.024π  mm mrad for nominal operating parameters, was determined by simulating ion injection into the EBIS. The optics of the ion transport lines were carefully optimized to achieve well-matched ion injection, to minimize emittance growth of the injected and extracted ion beams, and to enable adequate testing of the charge bred ions prior to installation in ATLAS.

  17. Extraction of Trivalent Actinides and Lanthanides from Californium Campaign Rework Solution Using TODGA-based Solvent Extraction System

    Energy Technology Data Exchange (ETDEWEB)

    Benker, Dennis [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Delmau, Laetitia Helene [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Dryman, Joshua Cory [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States)

    2017-07-01

    This report presents the studies carried out to demonstrate the possibility of quantitatively extracting trivalent actinides and lanthanides from highly acidic solutions using a neutral ligand-based solvent extraction system. These studies stemmed from the perceived advantage of such systems over cationexchange- based solvent extraction systems that require an extensive feed adjustment to make a low-acid feed. The targeted feed solutions are highly acidic aqueous phases obtained after the dissolution of curium targets during a californium (Cf) campaign. Results obtained with actual Cf campaign solutions, but highly diluted to be manageable in a glove box, are presented, followed by results of tests run in the hot cells with Cf campaign rework solutions. It was demonstrated that a solvent extraction system based on the tetraoctyl diglycolamide molecule is capable of quantitatively extracting trivalent actinides from highly acidic solutions. This system was validated using actual feeds from a Cf campaign.

  18. Beyond Californium-A Neutron Generator Alternative for Dosimetry and Instrument Calibration in the U.S.

    Science.gov (United States)

    Piper, Roman K; Mozhayev, Andrey V; Murphy, Mark K; Thompson, Alan K

    2017-09-01

    Evaluations of neutron survey instruments, area monitors, and personal dosimeters rely on reference neutron radiations, which have evolved from the heavy reliance on (α,n) sources to a shared reliance on (α,n) and the spontaneous fission neutrons of californium-252 (Cf). Capable of producing high dose equivalent rates from an almost point source geometry, the characteristics of Cf are generally more favorable when compared to the use of (α,n) and (γ,n) sources or reactor-produced reference neutron radiations. Californium-252 is typically used in two standardized configurations: unmoderated, to yield a fission energy spectrum; or with the capsule placed within a heavy-water moderating sphere to produce a softened spectrum that is generally considered more appropriate for evaluating devices used in nuclear power plant work environments. The U.S. Department of Energy Cf Loan/Lease Program, a longtime origin of affordable Cf sources for research, testing and calibration, was terminated in 2009. Since then, high-activity sources have become increasingly cost-prohibitive for laboratories that formerly benefited from that program. Neutron generators, based on the D-T and D-D fusion reactions, have become economically competitive with Cf and are recognized internationally as important calibration and test standards. Researchers from the National Institute of Standards and Technology and the Pacific Northwest National Laboratory are jointly considering the practicality and technical challenges of implementing neutron generators as calibration standards in the U.S. This article reviews the characteristics of isotope-based neutron sources, possible isotope alternatives to Cf, and the rationale behind the increasing favor of electronically generated neutron options. The evaluation of a D-T system at PNNL has revealed characteristics that must be considered in adapting generators to the task of calibration and testing where accurate determination of a dosimetric quantity is

  19. Californium-252 Brachytherapy Combined With External-Beam Radiotherapy for Cervical Cancer: Long-Term Treatment Results

    Energy Technology Data Exchange (ETDEWEB)

    Lei Xin; Qian Chengyuan; Qing Yi; Zhao Kewei; Yang Zhengzhou; Dai Nan; Zhong Zhaoyang; Tang Cheng; Li Zheng; Gu Xianqing; Zhou Qian; Feng Yan; Xiong Yanli; Shan Jinlu [Cancer Center, Research Institute of Surgery and Daping Hospital, Third Military Medical University, Chongqing (China); Wang Dong, E-mail: dongwang64@hotmail.com [Cancer Center, Research Institute of Surgery and Daping Hospital, Third Military Medical University, Chongqing (China)

    2011-12-01

    Purpose: To observe, by retrospective analysis, the curative effects and complications due to californium-252 ({sup 252}Cf) neutron intracavitary brachytherapy (ICBT) combined with external-beam radiotherapy (EBRT) in the treatment of cervical cancer. Methods and Materials: From February 1999 to December 2007, 696 patients with cervical cancer (Stages IB to IIIB) were treated with {sup 252}Cf-ICBT in combination of EBRT. Of all, 31 patients were at Stage IB, 104 at IIA, 363 at IIB, 64 at IIIA, and 134 at IIIB. Californium-252 ICBT was delivered at 7-12 Gy per insertion per week, with a total dose of 29-45 Gy to reference point A in three to five insertions. The whole pelvic cavity was treated with 8-MV X-ray external irradiation at 2 Gy per fraction, four times per week. After 16-38 Gy of external irradiation, the center of the whole pelvic field was blocked with a 4-cm-wide lead shield, with a total external irradiation dose of 44-56 Gy. The total treatment course was 5 to 6 weeks. Results: Overall survival rate at 3 and 5 years for all patients was 76.0% and 64.9%, respectively. Disease-free 3- and 5-year survival rates of patients were 71.2% and 58.4%, respectively. Late complications included vaginal contracture and adhesion, radiation proctitis, radiation cystitis, and inflammatory bowel, which accounted for 5.8%, 7.1%, 6.2%, and 4.9%, respectively. Univariate analysis results showed significant correlation of stage, age, histopathologic grade, and lymph node status with overall survival. Cox multiple regression analysis showed that the independent variables were stage, histopathologic grade, tumor size, and lymphatic metastasis in all patients. Conclusion: Results of this series suggest that the combined use of {sup 252}Cf-ICBT with EBRT is an effective method for treatment of cervical cancer.

  20. 14 CFR 135.243 - Pilot in command qualifications.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Pilot in command qualifications. 135.243... (CONTINUED) AIR CARRIERS AND OPERATORS FOR COMPENSATION OR HIRE: CERTIFICATION AND OPERATIONS OPERATING REQUIREMENTS: COMMUTER AND ON DEMAND OPERATIONS AND RULES GOVERNING PERSONS ON BOARD SUCH AIRCRAFT Flight...

  1. 49 CFR 372.243 - Controlling distances and population data.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 5 2010-10-01 2010-10-01 false Controlling distances and population data. 372.243... population data. In the application of § 372.241: (a) Air-line distances or mileages about corporate limits of municipalities shall be used. (b) The population of any municipality shall be deemed to be the...

  2. 46 CFR 67.243 - Requirements for instruments subordinating mortgages.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 2 2010-10-01 2010-10-01 false Requirements for instruments subordinating mortgages. 67... MEASUREMENT OF VESSELS DOCUMENTATION OF VESSELS Filing and Recording of Instruments-Mortgages, Preferred Mortgages, and Related Instruments § 67.243 Requirements for instruments subordinating mortgages. An...

  3. 40 CFR 243.202-3 - Recommended procedures: Operations.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Recommended procedures: Operations... SOLID WASTE Requirements and Recommended Procedures § 243.202-3 Recommended procedures: Operations. (a... wipers, taillights, backup lights, audible reverse warning devices, tires, and hydraulic systems. Any...

  4. 48 CFR 52.243-2 - Changes-Cost-Reimbursement.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Changes-Cost-Reimbursement....243-2 Changes—Cost-Reimbursement. As prescribed in 43.205(b)(1), insert the following clause. The 30-day period may be varied according to agency procedures. Changes—Cost-Reimbursement (AUG 1987) (a) The...

  5. 48 CFR 52.243-6 - Change Order Accounting.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Change Order Accounting....243-6 Change Order Accounting. As prescribed in 43.205(f), the contracting officer may insert a clause, substantially the same as follows: Change Order Accounting (APR 1984) The Contracting Officer may require change...

  6. 40 CFR 60.243 - Monitoring of operations.

    Science.gov (United States)

    2010-07-01

    ... Fertilizer Industry: Granular Triple Superphosphate Storage Facilities § 60.243 Monitoring of operations. (a) The owner or operator of any granular triple superphosphate storage facility subject to the provisions... determination of the amount of equivalent P2O5 stored. (b) The owner or operator of any granular triple...

  7. 27 CFR 46.243 - Articles at multiple locations.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 2 2010-04-01 2010-04-01 false Articles at multiple... Cigarette Tubes Held for Sale on April 1, 2009 Records § 46.243 Articles at multiple locations. The dealer must maintain a list of all places where the dealer holds articles subject to the floor stocks tax...

  8. Phenotype abnormality: 243 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 243 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u1ria224u749i delayed in orga...n named cotyledon during process named organ development ... cotyledon ... delayed ... organ development ...

  9. 30 CFR 243.2 - What leases are subject to this part?

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false What leases are subject to this part? 243.2 Section 243.2 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR MINERALS REVENUE MANAGEMENT SUSPENSIONS PENDING APPEAL AND BONDING-MINERALS REVENUE MANAGEMENT General Provisions § 243.2 What...

  10. 30 CFR 243.1 - What is the purpose of this part?

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false What is the purpose of this part? 243.1 Section 243.1 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR MINERALS REVENUE MANAGEMENT SUSPENSIONS PENDING APPEAL AND BONDING-MINERALS REVENUE MANAGEMENT General Provisions § 243.1 What...

  11. 27 CFR 41.243 - Retention of permit and supporting documents.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 2 2010-04-01 2010-04-01 false Retention of permit and supporting documents. 41.243 Section 41.243 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX... Requirements for Importers of Processed Tobacco § 41.243 Retention of permit and supporting documents. The...

  12. Long-term effects of an intracavitary treatment with californium-252 on normal tissue. [Swine, /sup 226/Ra

    Energy Technology Data Exchange (ETDEWEB)

    Sullivan, M.F.; Beamer, J.L.; Mahony, T.D.; Cross, F.T.; Lund, J.E.; Endres, G.W.R.

    1976-01-01

    About one hundred fifty swine were exposed to either radium-226 or californium-252 sources in the uterine cervix to determine an RBE for both acute and long-term effects. That value for early changes in the tissues at risk in the treatment of cervical cancer was between 6.2 and 6.8. The incidence of complications increased with time after exposure, especially among animals treated with /sup 252/Cf. Analysis of rectal injury showed that ulceration occurred frequently within a year postexposure at doses between 1600 and 2400 rad calculated at 2 cm lateral to the source midline. Fat necrosis and smooth muscle atrophy, resulting in a local rectal stricture, were delayed changes observed in some animals. The lower ureter was the site for a greater frequency of complications than the GI tract. Ureteral stricture often occurred at doses of 1200 rad from /sup 252/Cf and 7000 rad from /sup 226/Ra. Observation of delayed effects in the uterine-cervix in animals held up to 4 years postexposure indicate that the RBE for /sup 252/Cf may be increased to a value as high as 18, while repair may have even decreased it to about 5.6 in the rectum. Fifty swine are still being observed for long-term effects after doses above 800 rad from /sup 252/Cf and 5000 rad from /sup 226/Ra.

  13. IMPS albedo and diameter for Asteroid 243 Ida

    Science.gov (United States)

    Veeder, G. J.; Tedesco, E. F.

    1993-01-01

    243 Ida is the second asteroid target of the Galileo mission. The Infrared Astronomical Satellite (IRAS) detected Ida several times during its 1983 sky survey. The IRAS Minor Planet Survey (IMPS) yields a total of 13 usable observations during 6 sightings of Ida. These data result in a geometric visual albedo of 0.24 and a mean diameter of 28 km for Ida. The IMPS catalog updates and extends the IRAS Asteroid and Comet Survey through asteroid number 4679. File versions of IMPS final products will be available from the National Space Science Data Center (NSSDC). The input for IMPS processing includes updated visual absolute magnitudes and orbital elements for each asteroid. H and G are 9.94 and 0.15 for Ida. IMPS also includes a correction for low flux densities (less than approximately 1 Jansky). In the case of Ida, 3 observations at 12 microns, 6 at 25 microns, and 4 at 60 microns were considered acceptable for analysis. Most of these do have flux densities less than 1 Jansky with a value of approximately 5 for their estimated SNR. The 25 microns observations as plotted in the figure are consistent with the variation expected for the cross section of Ida with rotation. Ida is a main belt asteroid with an S taxonomic classification. The spectra of S asteroids tend to be dominated by pyroxene with visual albedos from 0.1 to 0.3. The IMPS average albedo of 0.24 (plus or minus 0.07) for 243 Ida is in the upper range observed for S asteroids.

  14. Ab initio full-potential study of mechanical properties and magnetic phase stability of californium monopnictides (CfN and CfP)

    Energy Technology Data Exchange (ETDEWEB)

    Amari, S., E-mail: siham_amari@yahoo.fr [Faculté des Sciences de la Nature et de la Vie, Université Hassiba Benbouali, Chlef, 02000 (Algeria); Bouhafs, B. [Laboratoire de Modélisation et Simulation en Sciences des Matériaux, Université Djillali Liabès de Sidi Bel-Abbés, Sidi Bel-Abbés, 22000 (Algeria)

    2016-09-15

    Based on the first-principles methods, the structural, elastic, electronic, properties and magnetic ordering of californium monopnictides CfX (X = P) have been studied using the full-potential augmented plane wave plus local orbitals (FP-L/APW + lo) method within the framework of density functional theory (DFT). The electronic exchange correlation energy is described by generalized gradient approximation GGA and GGA+U (U is the Hubbard correction). The GGA+U method is applied to the rare-earth 5f states. We have calculated the lattice parameters, bulk modulii and the first pressure derivatives of the bulk modulii. The elastic properties of the studied compounds are only investigated in the most stable calculated phase. In order to gain further information, we have calculated Young’s modulus, shear modulus, anisotropy factor and Kleinman parameter by the aid of the calculated elastic constants. The results mainly show that californium monopnictides CfX (X = P) have an antiferromagnetic spin ordering. Density of states (DOS) and charge densities for both compounds are also computed in the NaCl (B1) structure.

  15. Low-Dose-Rate Californium-252 Neutron Intracavitary Afterloading Radiotherapy Combined With Conformal Radiotherapy for Treatment of Cervical Cancer

    Energy Technology Data Exchange (ETDEWEB)

    Zhang Min [Department of Oncology, Armed Police Hospital of Hangzhou, Hangzhou, Zhejiang Province (China); Xu Hongde [Cancer Center, Armed Police Hospital of Hangzhou, Hangzhou, Zhejiang Province (China); Pan Songdan; Lin Shan; Yue Jianhua [Department of Oncology, Armed Police Hospital of Hangzhou, Hangzhou, Zhejiang Province (China); Liu Jianren, E-mail: liujianren0571@hotmail.com [Second Affiliated Hospital, School of Medicine, Zhejiang University, Hangzhou, Zhejiang Province (China)

    2012-07-01

    Purpose: To study the efficacy of low-dose-rate californium-252 ({sup 252}Cf) neutron intracavitary afterloading radiotherapy (RT) combined with external pelvic RT for treatment of cervical cancer. Methods and Materials: The records of 96 patients treated for cervical cancer from 2006 to 2010 were retrospectively reviewed. For patients with tumors {<=}4 cm in diameter, external beam radiation was performed (1.8 Gy/day, five times/week) until the dose reached 20 Gy, and then {sup 252}Cf neutron intracavitary afterloading RT (once/week) was begun, and the frequency of external beam radiation was changed to four times/week. For patients with tumors >4 cm, {sup 252}Cf RT was performed one to two times before whole-pelvis external beam radiation. The tumor-eliminating dose was determined by using the depth limit of 5 mm below the mucosa as the reference point. In all patients, the total dose of the external beam radiation ranged from 46.8 to 50 Gy. For {sup 252}Cf RT, the dose delivered to point A was 6 Gy/fraction, once per week, for a total of seven times, and the total dose was 42 Gy. Results: The mean {+-} SD patient age was 54.7 {+-} 13.7 years. Six patients had disease assessed at stage IB, 13 patients had stage IIA, 49 patients had stage IIB, 3 patients had stage IIIA, 24 patients had stage IIIB, and 1 patient had stage IVA. All patients obtained complete tumor regression (CR). The mean {+-} SD time to CR was 23.5 {+-} 3.4 days. Vaginal bleeding was fully controlled in 80 patients within 1 to 8 days. The mean {+-} SD follow-up period was 27.6 {+-} 12.7 months (range, 6-48 months). Five patients died due to recurrence or metastasis. The 3-year survival and disease-free recurrence rates were 89.6% and 87.5 %, respectively. Nine patients experienced mild radiation proctitis, and 4 patients developed radiocystitis. Conclusions: Low-dose-rate {sup 252}Cf neutron RT combined with external pelvic RT is effective for treating cervical cancer, with a low incidence of

  16. 30 CFR 243.202 - When will MMS monitor my financial solvency?

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false When will MMS monitor my financial solvency? 243.202 Section 243.202 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR MINERALS REVENUE MANAGEMENT SUSPENSIONS PENDING APPEAL AND BONDING-MINERALS REVENUE MANAGEMENT Financial...

  17. 30 CFR 243.8 - When will MMS suspend my obligation to comply with an order?

    Science.gov (United States)

    2010-07-01

    ... with an order? 243.8 Section 243.8 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR MINERALS REVENUE MANAGEMENT SUSPENSIONS PENDING APPEAL AND BONDING-MINERALS REVENUE MANAGEMENT... with the Bureau of Land Management for onshore leases, and MMS for OCS leases, as collateral for the...

  18. 30 CFR 243.200 - How do I demonstrate financial solvency?

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false How do I demonstrate financial solvency? 243.200 Section 243.200 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR MINERALS REVENUE MANAGEMENT SUSPENSIONS PENDING APPEAL AND BONDING-MINERALS REVENUE MANAGEMENT Financial Solvency...

  19. 30 CFR 243.100 - What standards must my MMS-specified surety instrument meet?

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false What standards must my MMS-specified surety instrument meet? 243.100 Section 243.100 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR MINERALS REVENUE MANAGEMENT SUSPENSIONS PENDING APPEAL AND BONDING-MINERALS REVENUE MANAGEMENT...

  20. 30 CFR 243.201 - How will MMS determine if I am financially solvent?

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false How will MMS determine if I am financially solvent? 243.201 Section 243.201 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR MINERALS REVENUE MANAGEMENT SUSPENSIONS PENDING APPEAL AND BONDING-MINERALS REVENUE MANAGEMENT Financial...

  1. 30 CFR 243.4 - How do I suspend compliance with an order?

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false How do I suspend compliance with an order? 243.4 Section 243.4 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR MINERALS REVENUE MANAGEMENT SUSPENSIONS PENDING APPEAL AND BONDING-MINERALS REVENUE MANAGEMENT General Provisions...

  2. 30 CFR 243.3 - What definitions apply to this part?

    Science.gov (United States)

    2010-07-01

    ... Section 243.3 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR MINERALS REVENUE MANAGEMENT SUSPENSIONS PENDING APPEAL AND BONDING-MINERALS REVENUE MANAGEMENT General Provisions § 243.3 What... assigned. MMS bond-approving officer means the Associate Director for Minerals Revenue Management or an...

  3. 19 CFR 24.3a - CBP bills; interest assessment; delinquency; notice to principal and surety.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false CBP bills; interest assessment; delinquency; notice to principal and surety. 24.3a Section 24.3a Customs Duties U.S. CUSTOMS AND BORDER PROTECTION....3a CBP bills; interest assessment; delinquency; notice to principal and surety. (a) Due date of CBP...

  4. 49 CFR 234.243 - Wire on pole line and aerial cable.

    Science.gov (United States)

    2010-10-01

    ... Maintenance, Inspection, and Testing Maintenance Standards § 234.243 Wire on pole line and aerial cable. Wire... transmission line operating at voltage of 750 volts or more shall be placed not less than 4 feet above the... 49 Transportation 4 2010-10-01 2010-10-01 false Wire on pole line and aerial cable. 234.243...

  5. 42 CFR 456.243 - Content of medical care evaluation studies.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 4 2010-10-01 2010-10-01 false Content of medical care evaluation studies. 456.243... Ur Plan: Medical Care Evaluation Studies § 456.243 Content of medical care evaluation studies. Each medical care evaluation study must— (a) Identify and analyze medical or administrative factors related to...

  6. Motion of the moonlet in the binary system 243 Ida

    Science.gov (United States)

    Lan, L.; Ni, Y.; Jiang, Y.; Li, J.

    2017-11-01

    The motion of the moonlet Dactyl in the binary system 243 Ida is investigated in this paper. First, periodic orbits in the vicinity of the primary are calculated, including the orbits around the equilibrium points and large-scale orbits. The Floquet multipliers' topological cases of periodic orbits are calculated to study the orbits' stabilities. During the continuation of the retrograde near-circular orbits near the equatorial plane, two period-doubling bifurcations and one Neimark-Sacker bifurcation occur one by one, leading to two stable regions and two unstable regions. Bifurcations occur at the boundaries of these regions. Periodic orbits in the stable regions are all stable, but in the unstable regions are all unstable. Moreover, many quasi-periodic orbits exist near the equatorial plane. Long-term integration indicates that a particle in a quasi-periodic orbit runs in a space like a tire. Quasi-periodic orbits in different regions have different styles of motion indicated by the Poincare sections. There is the possibility that moonlet Dactyl is in a quasi-periodic orbit near the stable region I, which is enlightening for the stability of the binary system.

  7. Asteroid 243 IDA and its satellite. [Abstract only

    Science.gov (United States)

    Chapman, C. R.; Klaasen, K.; Belton, M. J. S.; Veverka, J.

    1994-01-01

    A high-resolution mosaic of Ida shows a highly irregular body (roughly 56 km long), heavily covered with craters, with many interesting geological features, including grooves, blocks, chutes, dark-floored craters, and crater chains. A satellite of Ida, with a preliminary designation of 1993 (243) 1, was discovered in orbit around Ida. It is approximately 1.5 km in diameter, has an albedo and spectral reflectance not grossly different from Ida, and orbits Ida in a prograde direction with a period of roughly 20 hr. No other comparable-sized satellites have been found near Ida. New pictures of the opposite side of Ida reveal an irregular, dog-bone shape, with a prominent gouge that seems to separate Ida into two chief components. A V-shaped valley, well shown in the highest-resolution view of Ida returned in April, may mark a modest expression on the September face of the more dramatic feature on the back side. Ida's dense population of craters shows a wide diversity of morphologies, consistent with the surface having been subjected to saturated bombardment by smaller projectiles. Assuming the same projectile flux applies to Ida was used in deriving Gaspra's cratering age of about 200 m.y., and assuming that Gaspra and Ida both have the same impact strength, then the age of Ida's surface is calculated to be 1-2 b.y. This is considerably older than expected from other evidence concerning the Koronis family. Our favored explanation of Ida's satellite is that it (or a precursor satellite from which the present satellite was derived) formed during the catastrophic disruption event that formed Ida itself and formed the Koronis family of asteroids. Perhaps, instead, the satellite is a block ejected from a cratering impact. In any case, smaller blocks visible on some parts of Ida are more certain to be crater ejecta, whether or not they were ever temporary satellites.

  8. Physicochemical and biopharmaceutical characterization of BTA-243, a diacidic drug with low oral bioavailability.

    Science.gov (United States)

    Brown, J R; Collett, J H; Attwood, D; Ley, R W; Sims, E E

    2001-02-01

    This investigation has examined possible causes of the poor bioavailability of the beta(3)-adrenoceptor agonist BTA-243. The aqueous solubility of BTA-243 is pH dependent with a solubility minimum at pH 1.5. However, the dissolution rate of the disodium salt of BTA-243 is similar at both pH 2.0 and 7.4 indicating that dissolution rate is unlikely to be the controlling factor in the absorption of BTA-243. The apparent permeability coefficient of BTA-243 across Caco-2 monolayers at pH 6 was lower than that of mannitol and therefore the epithelial permeability of the molecule in vivo is predicted to be very low and potentially bioavailability limiting. Apparent permeability coefficients were not dependent on BTA-243 concentration over the concentration range 0.5 to 12 mM, indicating that epithelial transport is unlikely to occur via a saturable mechanism. They were of similar magnitude in both directions across the monolayers, indicative of no significant effluxing of BTA-243 by components of the cell membrane. Apparent octanol/water distribution coefficients increased with decrease of pH between 2 and 6; the relatively low values at pH 4 and 6 suggest that the limited intestinal absorption predicted in vivo will occur predominantly via paracellular passive diffusion. Everted gut sac experiments performed at pH 2.0 and 6.8 suggest that at pH 2.0 a significant proportion of the BTA-243 transport occurs via the transcellular route confirming that the ionization state of the BTA-243 molecule influences the route and rate of epithelial permeability.

  9. 20 CFR 404.243 - Computation where you are eligible for a pension based on noncovered employment.

    Science.gov (United States)

    2010-04-01

    ... pension based on noncovered employment. 404.243 Section 404.243 Employees' Benefits SOCIAL SECURITY ADMINISTRATION FEDERAL OLD-AGE, SURVIVORS AND DISABILITY INSURANCE (1950- ) Computing Primary Insurance Amounts Old-Start Method of Computing Primary Insurance Amounts § 404.243 Computation where you are eligible...

  10. 30 CFR 243.101 - How will MMS determine the amount of my bond or other surety instrument?

    Science.gov (United States)

    2010-07-01

    ... other surety instrument? 243.101 Section 243.101 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR MINERALS REVENUE MANAGEMENT SUSPENSIONS PENDING APPEAL AND BONDING-MINERALS REVENUE MANAGEMENT Bonding Requirements § 243.101 How will MMS determine the amount of my bond or other...

  11. 20 CFR 243.5 - Assignment of a portion of an annuity paid under the social security overall minimum provision.

    Science.gov (United States)

    2010-04-01

    ... under the social security overall minimum provision. 243.5 Section 243.5 Employees' Benefits RAILROAD... § 243.5 Assignment of a portion of an annuity paid under the social security overall minimum provision. Section 3(f)(3) of the Railroad Retirement Act, the social security overall minimum provision, guarantees...

  12. 25 CFR 243.7 - How can a non-Native acquire live reindeer?

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false How can a non-Native acquire live reindeer? 243.7 Section... ALASKA § 243.7 How can a non-Native acquire live reindeer? If you are a non-Native who wants to acquire live Alaskan reindeer, you must apply to us in writing. We will either grant the request and issue a...

  13. 243 Caractérisation floristique et analyse des formes de pression ...

    African Journals Online (AJOL)

    Afrique Sciences

    Afrique SCIENCE 10(2) (2014) 243 - 257. 243. ISSN 1813-548X ... Aménagement du Territoire, Faculté des Lettres, Arts et Sciences humaines,. BP 677 Abomey-Calavi, Benin. 2Laboratoire ... dégradation généralisée des écosystèmes naturels, aggravé par des contextes socio-économique et pédoclimatique défavorables.

  14. Determination of the 243,246,248Cm thermal neutron induced fission cross sections

    Science.gov (United States)

    Serot, O.; Wagemans, C.; Vermote, S.; Heyse, J.; Soldner, T.; Geltenbort, P.

    2005-11-01

    The minor actinide waste produced in nuclear power plants contains various Cm-isotopes, and transmutation scenarios require improved fission cross section data. The available thermal neutron induced fission cross section data for 243Cm, 246Cm and 248Cm are not very accurate, so new cross section measurements have been performed at the high flux reactor of the ILL in Grenoble (France) under better experimental conditions (highly enriched samples, very intense and clean neutron beam). The measurements were performed at a neutron energy of 5.38 meV, yielding fission cross section values of (1240±28)b for 243Cm, (25±47)mb for 246Cm and (685±84)mb for 248Cm. From these results, thermal fission cross section values of (572±14)b; (12±25)mb and (316±43)mb have been deduced for 243Cm, 246Cm and 248Cm, respectively.

  15. Molecular Cloning and Production of Recombinant Phytase from Bacillus subtilis ASUIA243 in Pichia pastoris

    Directory of Open Access Journals (Sweden)

    Nor Soleha Mohd Dali

    2011-12-01

    Full Text Available Phytase gene obtained from Bacillus subtilis ASUIA243 was cloned into a medium vector and transformed into E. coli. Restriction enzyme digestion was conducted to get blunt-ended phytase gene and ligated into the Pichia expression vector, pPICZαA. The recombinant vector, pPICZαA-243HPp was then linearized with PmeI and transformed into P. pastoris strain X33. Screening for multi copy gene number of transformants was done by re-plating the selected colonies on increasing concentration of zeocin. One positive clone, X243HPp#2 was then grown in BMGY media as the starting culture, followed by induction in BMMY media for protein expression study. The supernatant was then analysed by SDS-PAGE and Western blot method to check the protein expression.ABSTRAK: Gen fitase yang didapati daripada Bacillus subtilis ASUIA243 diklonkan sebagai vektor perantara dan berubah menjadi E. coli. Sekatan pencernaan enzim dijalankan untuk mendapatkan gen fitase berhujung tumpul dan diligatkan dengan vektor ekspresi Pichia, pPICZαA. Vektor rekombinan, pPICZαA-243HPp kemudian dilinearkan dengan PmeI dan berubah menjadi P. pastoris strain X33. Penyaringan untuk nombor gen berbilang salinan yang menjalani transformasi genetik dijalankan dengan menyalur semula koloni terpilih dengan penambahan kepekatan zeocin. Satu klon positif, X243HPp#2 kemudian dibiarkan hidup dalam perantara BMGY sebagai kultur permulaan, diikuti dengan aruhan dalam perantara BMMY untuk kajian penglahiran protein. Supernatan kemudian dikaji dengan SDS-PAGE dan kaedah sap Western untuk menyemak penglahiran protein.KEYWORDS:  phytase, Bacillus subtilis, Pichia pastoris, gene cloning.

  16. Understanding the environment around the intermediate mass black hole candidate ESO 243-49 HLX-1

    Science.gov (United States)

    Webb, N. A.; Guérou, A.; Ciambur, B.; Detoeuf, A.; Coriat, M.; Godet, O.; Barret, D.; Combes, F.; Contini, T.; Graham, Alister W.; Maccarone, T. J.; Mrkalj, M.; Servillat, M.; Schroetter, I.; Wiersema, K.

    2017-06-01

    Aims: ESO 243-49 HLX-1, otherwise known as HLX-1, is an intermediate mass black hole (IMBH) candidate located 8'' (3.7 Kpc) from the centre of the edge-on S0 galaxy ESO 243-49. How the black hole came to be associated with this galaxy, and the nature of the environment in which it resides, remain unclear. Using multi-wavelength observations we aim to investigate the nature of the medium surrounding HLX-1, search for evidence of past mergers with ESO 243-49 and constrain parameters of the galaxy, including the mass of the expected central supermassive black hole, essential for future modelling of the interaction of the IMBH and ESO 243-49. Methods: We have reduced and analysed integral field unit observations of ESO 243-49 that were taken with the MUSE instrument on the VLT. Using complementary multi-wavelength data, including X-shooter, HST, Swift, Chandra and ATCA data, we have further examined the vicinity of HLX-1. We additionally examined the nature of the host galaxy and estimate the mass of the central supermassive black hole in ESO 243-49 using (black hole mass)-(host spheroid) scaling relations and the fundamental plane of black hole activity. Results: No evidence for a recent minor-merger that could result in the presence of the IMBH is discerned, but the data are compatible with a scenario in which minor mergers may have occurred in the history of ESO 243-49. The MUSE data reveal a rapidly rotating disc in the centre of the galaxy, around the supermassive black hole. The mass of the supermassive black hole at the centre of ESO 243-49 is estimated to be 0.5-23 × 107M⊙. Studying the spectra of HLX-1, that were taken in the low and hard state, we determine Hα flux variability to be at least a factor 6, compared to observations taken during the high and soft state. This Hα flux variability over one year indicates that the line originates close to the intermediate mass black hole, excluding the possibility that the line emanates from a surrounding nebula

  17. A one-pot synthesis of a 243-allyl dendrimer under ambient conditions.

    Science.gov (United States)

    Ornelas, Catia; Aranzaes, Jaime Ruiz; Cloutet, Eric; Astruc, Didier

    2006-06-22

    [reaction: see text] Hydrosilylation of a nonaallyl dendritic core using HSi(Me)(2)Cl followed by reaction with a phenolate dendronic brick bearing three allyl groups, followed by repetition of this sequence of reactions twice, allows a one-pot synthesis of a 243-allyl dendrimer under ambient conditions.

  18. 26 CFR 1.243-2 - Special rules for certain distributions.

    Science.gov (United States)

    2010-04-01

    ... section 243 in the case of dividends received from a real estate investment trust with respect to a... subject to the limitations provided in section 854. (c) Dividends received from real estate investment... considered as a dividend. (b) Dividends received from regulated investment companies. In determining the...

  19. Page 1 t i. 3. Chlorination of acetophenone 243 , , , , , 8O 1OO ...

    Indian Academy of Sciences (India)

    Chlorination of acetophenone 243. , , , , , 8O 1OO. 1ONoLS). Figure 1. Dependence of rate on detergent concentration. 2.3 Temperature influence. The temperature influence over the reaction rate has been studied in the range of 30 and 50°C; and from the plots of log k versus 1/T, the activation energies have been ...

  20. Alpha-particle emission probabilities in the decay of sup 243 Am

    Energy Technology Data Exchange (ETDEWEB)

    Garcia-Torano, E.; Acena, M.L. (CIEMAT, Investigacion Basica, Madrid (Spain)); Bortels, G.; Mouchel, D. (CEC-JRC, Central Bureau for Nuclear Measurements, Geel (Belgium))

    1992-02-01

    {alpha}-particle emission probabilities (P{sub {alpha}}) in the decay of {sup 243}Am have been measured using ion-implanted silicon detectors. Measurements and spectrum analyses were carried out at CIEMAT and CBNM. Values for the P{sub {alpha}} of nine branches are reported, with uncertainties below 1% for the major ones. (orig.).

  1. 18 CFR 367.101 - Accounts 231-243, Current and accrued liabilities.

    Science.gov (United States)

    2010-04-01

    ... obligations which must be classified as long-term debt until date of maturity; accrued taxes, such as income..., Current and accrued liabilities. 367.101 Section 367.101 Conservation of Power and Water Resources FEDERAL... NATURAL GAS ACT Special Instructions § 367.101 Accounts 231-243, Current and accrued liabilities. Current...

  2. 40 CFR 761.243 - Standard wipe sample method and size.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 30 2010-07-01 2010-07-01 false Standard wipe sample method and size... Natural Gas Pipeline: Selecting Sample Sites, Collecting Surface Samples, and Analyzing Standard PCB Wipe Samples § 761.243 Standard wipe sample method and size. (a) Collect a surface sample from a natural gas...

  3. The morquio A syndrome (mucopolysaccharidosis IVA) gene maps to 16q24.3.

    OpenAIRE

    Baker, E; Guo, X.H.; Orsborn, A M; Sutherland, G R; Callen, D F; Hopwood, J J; Morris, C. P.

    1993-01-01

    The gene for N-acetylgalactosamine-6-sulfatase, the deficiency of which results in Morquio A syndrome (mucopolysaccharidosis type IVA), was assigned to chromosome 16 at band q24.3 by fluorescence in situ hybridization. Localization of this band was confirmed by PCR analysis of a somatic cell hybrid panel used for fine mapping of chromosome 16.

  4. Pesticides: Benefaction or Pandora's Box? A synopsis of the environmental aspects of 243 pesticides

    NARCIS (Netherlands)

    Linders JBHJ; Jansma JW; Mensink BJWG; Otermann K; ACT

    1994-01-01

    The report provides an overview of physical, chemical and environmental data of 243 pesticides. The data mentioned are based on confidential information supplied by the manufacturers of the pesticides. For all pesticides mentioned a Final Environmental File, which is public, is derived. Tables with

  5. Californium-252 neutron intracavity brachytherapy alone for T1N0 low-lying rectal adenocarcinoma: A definitive anal sphincter-preserving radiotherapy

    Science.gov (United States)

    Xiong, Yanli; Shan, Jinlu; Liu, Jia; Zhao, Kewei; Chen, Shu; Xu, Wenjing; Zhou, Qian; Yang, Mei; Lei, Xin

    2017-01-01

    This study evaluated the 4-year results of 32 patients with T1N0 low-lying rectal adenocarcinoma treated solely with californium-252 (Cf-252) neutron intracavity brachytherapy (ICBT). Patients were solicited into the study from January 2008 to June 2011. All the patients had refused surgery or surgery was contraindicated. The patients were treated with Cf-252 neutron ICBT using a novel 3.5-cm diameter off-axis 4-channel intrarectal applicator designed by the authors. The dose reference point was defined on the mucosa surface, with a total dose of 55–62 Gy-eq/4 f (13–16 Gy-eq/f/wk). All the patients completed the radiotherapy in accordance with our protocol. The rectal lesions regressed completely, and the acute rectal toxicity was mild (≤G2). The 4-year local control, overall survival, disease-free survival, and late complication (≥G2) rates were 96.9%, 90.6%, 87.5% and 15.6%, respectively. No severe late complication (≥G3) occurred. The mean follow-up was 56.1 ± 16.0 months. At the end of last follow-up, 29 patients remained alive. The mean survival time was 82.1 ± 2.7 months. Cf-252 neutron ICBT administered as the sole treatment (without surgery) for patients with T1N0 low-lying rectal adenocarcinoma is effective with acceptable late complications. Our study and method offers a definitive anal sphincter-preserving radiotherapy for T1N0 low-lying rectal adenocarcinoma patients. PMID:28094790

  6. Direct high-precision mass measurements on Am241,243, Pu244, and Cf249

    Science.gov (United States)

    Eibach, M.; Beyer, T.; Blaum, K.; Block, M.; Düllmann, Ch. E.; Eberhardt, K.; Grund, J.; Nagy, Sz.; Nitsche, H.; Nörtershäuser, W.; Renisch, D.; Rykaczewski, K. P.; Schneider, F.; Smorra, C.; Vieten, J.; Wang, M.; Wendt, K.

    2014-06-01

    The absolute masses of four long-lived transuranium nuclides, Am241,243, Pu244, Pu244, and Cf249, in the vicinity of the deformed N =152 neutron shell closure have been measured directly with the Penning-trap mass spectrometer TRIGA-TRAP. Our measurements confirm the AME2012 mass values of Am241,243 and Pu244 within one standard deviation, which were indirectly determined, by decay spectroscopy studies. In the case of the Cf249 mass, a discrepancy of more than three standard deviations has been observed, affecting absolute masses even in the superheavy element region. The implementation of the mass values into the AME2012 network yields a reduced mass uncertainty for 84 nuclides, particularly for Pu244 and its strongly correlated α decay chains.

  7. Acetylation of Lysine 243 Inhibits the oriC Binding Ability of DnaA in Escherichia coli

    Directory of Open Access Journals (Sweden)

    Yu-Feng Yao

    2017-04-01

    Full Text Available DNA replication initiation is a central event in the cell cycle, and it is strictly controlled by multiple regulatory mechanisms. Our previous work showed that acetylation of residue lysine (K 178 prevents DnaA from binding to ATP, which leads to the inhibition of DNA replication initiation. Here, we show that another residue, K243, is critical for DnaA full activity in vivo. K243 can be acetylated, and its acetylation level varies with cell growth. A homogeneous, recombinant DnaA that contains N-acetyllysine at K243 (K243Ac retained its ATP/ADP binding ability, but showed decreased binding activity to the oriC region. A DNase I footprinting assay showed that DnaA K243Ac failed to recognize DnaA boxes I3, C1, and C3, and, thus, it formed an incomplete initiation complex with oriC. Finally, we found that acetyl phosphate and the deacetylase CobB can regulate the acetylation level of K243 in vivo. These findings suggest that DnaA K243 acetylation disturbs its binding to low-affinity DnaA boxes, and they provide new insights into the regulatory mechanisms of DNA replication initiation.

  8. 30 CFR 243.12 - May I substitute a demonstration of financial solvency for a bond posted before the effective...

    Science.gov (United States)

    2010-07-01

    ... MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR MINERALS REVENUE MANAGEMENT SUSPENSIONS PENDING APPEAL AND BONDING-MINERALS REVENUE MANAGEMENT General Provisions § 243.12 May I substitute a...

  9. 30 CFR 243.10 - When will MMS collect against a bond or other surety instrument or a person demonstrating...

    Science.gov (United States)

    2010-07-01

    ... MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR MINERALS REVENUE MANAGEMENT SUSPENSIONS PENDING APPEAL AND BONDING-MINERALS REVENUE MANAGEMENT General Provisions § 243.10 When will MMS collect against...

  10. Measurements of neutron cross section of the {sup 243}Am(n,{gamma}){sup 244}Am reaction

    Energy Technology Data Exchange (ETDEWEB)

    Hatsukawa, Yuichi; Shinohara, Nobuo; Hata, Kentaro [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment

    1998-03-01

    The effective thermal neutron cross section of {sup 243}Am(n,{gamma}){sup 244}Am reaction was measured by the activation method. Highly-purified {sup 243}Am target was irradiated in an aluminum capsule by using a research reactor JRR-3M. The tentative effective thermal neutron cross sections are 3.92 b, and 84.44 b for the production of {sup 244g}Am and {sup 244m}Am, respectively. (author)

  11. ESO 243-49 HLX-1: scaling of X-ray spectral properties and black hole mass determination

    Science.gov (United States)

    Titarchuk, Lev; Seifina, Elena

    2016-11-01

    We report the results of Swift/XRT observations (2008-2015) of a hyper-luminous X-ray source, ESO 243-49 HLX-1. We demonstrate a strong observational evidence that ESO 243-49 HLX-1 undergoes spectral transitions from the low/hard state to the high/soft state during these observations. The spectra of ESO 243-49 HLX-1 are well fitted by the so-called bulk motion Comptonization model for all spectral states. We have established the photon index (Γ) saturation level, Γsat = 3.0 ± 0.1, in the Γ versus mass accretion rate (Ṁ) correlation. This Γ-Ṁ correlation allows us to estimate black hole (BH) mass in ESO 243-49 HLX-1 to be MBH 7 × 104 M⊙ assuming the distance to ESO 243-49 of 95 Mpc. For the BH mass estimate we use the scaling method taking Galactic BHs XTE J1550-564, H 1743-322 and 4U 1630-472, and an extragalactic BH source, M101 ULX-1 as reference sources. The Γ versus Ṁ correlation revealed in ESO 243-49 HLX-1 is similar to those in a number of Galactic and extragalactic BHs and it clearly shows the correlation along with the strong Γ saturation at ≈3. This is a robust observational evidence for the presence of a BH in ESO 243-49 HLX-1. We also find that the seed (disk) photon temperatures are quite low, of order of 50-140 eV which are consistent with high BH mass in ESO 243-49 HLX-1.

  12. Quality control of the sheep bacterial artificial chromosome library, CHORI-243

    Directory of Open Access Journals (Sweden)

    Kirkness Ewen F

    2010-12-01

    Full Text Available Abstract Background The sheep CHORI-243 bacterial artificial chromosome (BAC library is being used in the construction of the virtual sheep genome, the sequencing and construction of the actual sheep genome assembly and as a source of DNA for regions of the genome of biological interest. The objective of our study is to assess the integrity of the clones and plates which make up the CHORI-243 library using the virtual sheep genome. Findings A series of analyses were undertaken based on the mapping the sheep BAC-end sequences (BESs to the virtual sheep genome. Overall, very few plate specific biases were identified, with only three of the 528 plates in the library significantly affected. The analysis of the number of tail-to-tail (concordant BACs on the plates identified a number of plates with lower than average numbers of such BACs. For plates 198 and 213 a partial swap of the BESs determined with one of the two primers appear to have occurred. A third plate, 341, also with a significant deficit in tail-to-tail BACs, appeared to contain a substantial number of sequences determined from contaminating eubacterial 16 S rRNA DNA. Additionally a small number of eubacterial 16 S rRNA DNA sequences were present on two other plates, 111 and 338, in the library. Conclusions The comparative genomic approach can be used to assess BAC library integrity in the absence of fingerprinting. The sequences of the sheep CHORI-243 library BACs have high integrity, especially with the corrections detailed above. The library represents a high quality resource for use by the sheep genomics community.

  13. The overlapping plates method applied to CCD observations of 243 Ida

    Science.gov (United States)

    Owen, W. M., Jr.; Yeomans, D. K.

    1994-01-01

    The overlapping plates method has been applied to crossing-point Charge Coupled Device (CCD) observations of minor planet 243 Ida to produce absolute position measurements precise to better than 0.1 sec and differential position measurements precise to better than 0.06 sec. Although these observations numbered only 17 out of the 520 that produced the final ground-based Ida ephemeris for the Galileo spacecraft flyby, their inclusion decreased Ida's downtrack error from 78 to 60 km and its out-of-plane error from 58 to 44 km.

  14. A gene for lymphedema-distichiasis maps to 16q24.3.

    OpenAIRE

    Mangion, J; Rahman, N.; Mansour, S; Brice, G; Rosbotham, J; Child, A H; Murday, V A; Mortimer, P S; Barfoot, R; Sigurdsson, A; Edkins, S.; Sarfarazi, M; Burnand, K; Evans, A. L.; Nunan, T O

    1999-01-01

    Lymphedema-distichiasis (LD) is a dominantly inherited syndrome with onset of lymphedema at or just after puberty. Most affected individuals have distichiasis-fine hairs arising inappropriately from the eyelid meibomian glands-which is evident from birth. A study of three families with LD has shown linkage to chromosome 16q24.3, and subsequent analysis of the region for recombinant genes places the locus between D16S422 and D16S3074, a distance of approximately 16 cM. Possible candidate genes...

  15. Statistical properties of $^{243}$Pu, and $^{242}$Pu(n,$\\gamma$) cross section calculation

    CERN Document Server

    Laplace, T A; Guttormsen, M; Larsen, A C; Bleuel, D L; Bernstein, L A; Goldblum, B L; Siem, S; Garotte, F L Bello; Brown, J A; Campo, L Crespo; Eriksen, T K; Giacoppo, F; Görgen, A; Hadyńska-Klȩk, K; Henderson, R A; Klintefjord, M; Lebois, M; Renstrøm, T; Rose, S J; Sahin, E; Tornyi, T G; Tveten, G M; Voinov, A; Wiedeking, M; Wilson, J N; Younes, W

    2015-01-01

    The level density and gamma-ray strength function (gammaSF) of 243Pu have been measured in the quasi-continuum using the Oslo method. Excited states in 243Pu were populated using the 242Pu(d,p) reaction. The level density closely follows the constant-temperature level density formula for excitation energies above the pairing gap. The gammaSF displays a double-humped resonance at low energy as also seen in previous investigations of actinide isotopes. The structure is interpreted as the scissors resonance and has a centroid of omega_{SR}=2.42(5)MeV and a total strength of B_{SR}=10.1(15)mu_N^2, which is in excellent agreement with sum-rule estimates. The measured level density and gammaSF were used to calculate the 242Pu(n,gamma) cross section in a neutron energy range for which there were previously no measured data.

  16. Oral administration of Lactobacillus plantarum CJLP133 and CJLP243 alleviates birch pollen-induced allergic rhinitis in mice.

    Science.gov (United States)

    Choi, S-P; Oh, H-N; Choi, C-Y; Ahn, H; Yun, H S; Chung, Y M; Kim, B; Lee, S J; Chun, T

    2018-03-01

    In this study, we evaluated the therapeutic efficacy of selected probiotics in a mouse model of birch pollen (BP)-induced allergic rhinitis. Oral administration of Lactobacillus plantarum CJLP133 and CJLP243 ameliorated the symptoms of BP-induced allergic rhinitis by reducing airway hyperresponsiveness, and both the histological scores and the number of infiltrated cells in the nasal cavities and lungs. Compared with those from vehicle-treated mice, bronchoalveolar lavage fluid and draining lymph node samples from CJLP133 and CJLP243-administrated mice showed diminished numbers of immune cells, increased secretion of a Th1-type cytokine (IFN-γ) and decreased production of Th2-type cytokines (IL-4, IL-5 and IL-13). Consistent with these results, levels of IL-4, IL-5, IL-13, serum IgE and BP-specific serum IgG1 were decreased, whereas secretion of IFN-γ and BP-specific serum IgG2a was augmented upon administration of CJLP133 and CJLP243 in mice. Oral administration of L. plantarum CJLP133 and CJLP243 alleviates symptoms of BP-induced allergic rhinitis in mice by recovering Th1/Th2 balance via enhancement of the Th1-type immune response. Lactobacillus plantarum CJLP133 and CJLP243 have therapeutic effects on BP-induced allergic rhinitis in an animal model. © 2017 The Society for Applied Microbiology.

  17. Californium-252 Program Equipment Evaluation

    Energy Technology Data Exchange (ETDEWEB)

    Chattin, Fred Rhea [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Wilson, Kenton [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Ezold, Julie G. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States)

    2017-12-01

    To successfully continue the 252Cf production and meet the needs of the customers, a comprehensive evaluation of the Building 7920 processing equipment was requested to identify equipment critical to the operational continuity of the program.

  18. Measurement of fission cross section with pure Am-243 sample using lead slowing-down spectrometer

    Energy Technology Data Exchange (ETDEWEB)

    Kobayashi, Katsuhei; Yamamoto, Shuji; Kai, T.; Fujita, Yoshiaki; Yamamoto, Hideki; Kimura, Itsuro [Kyoto Univ. (Japan); Shinohara, Nobuo

    1997-03-01

    By making use of back-to-back type double fission chambers and a lead slowing-down spectrometer coupled to an electron linear accelerator, the fission cross section for the {sup 243}Am(n,f) reaction has been measured relative to that for the {sup 235}U(n,f) reaction in the energy range from 0.1 eV to 10 keV. The measured result was compared with the evaluated nuclear data appeared in ENDF/B-VI and JENDL-3.2, whose evaluated data were broadened by the energy resolution function of the spectrometer. General agreement was seen between the evaluated data and the measurement except that the ENDF/B-VI data were lower in the range from 15 to 60 eV and that the JENDL-3.2 data seemed to be lower above 100 eV. (author)

  19. THE ICONOGRAPHIC CHOICES OF THE MINUCII AUGURINI: RE-READING RRC 242 AND 243

    Directory of Open Access Journals (Sweden)

    Liv Mariah Yarrow

    2017-03-01

    Full Text Available The coinage of the Minucii Augurini (RRC 242 and 243 has received extensive scholarly commentary (Crawford 1974, 273-6; Wiseman 1996; Evans 2011; Elkins 2015, 21-2, but a holistic comparative approach to the iconography of these two types leads to new conclusions regarding likely compositional prototypes in other media, the motivations behind the design choice, and the attributes and identification of the figures. All this helps explain compositional variations between the two coin types that previous scholars have found problematic. A wide range of comparative evidence is used including glass paste intaglios, Etruscan tomb decoration, relief depictions and archaeological finds of priestly implements, further coin imagery, and literary testimony, especially Plut. Mor. 89F.

  20. Measurement and analysis of the $^{243}$Am neutron capture cross section at the n_TOF facility at CERN

    CERN Document Server

    Mendoza, E; Guerrero, C; Berthoumieux, E; Abbondanno, U; Aerts, G; Alvarez-Velarde, F; Andriamonje, S; Andrzejewski, J; Assimakopoulos, P; Audouin, L; Badurek, G; Balibrea, J; Baumann, P; Becvar, F; Belloni, F; Calvino, F; Calviani, M; Capote, R; Carrapico, C; Carrillo de Albornoz, A; Cennini, P; Chepel, V; Chiaveri, E; Colonna, N; Cortes, G; Couture, A; Cox, J; Dahlfors, M; David, S; Dillmann, I; Dolfini, R; Domingo-Pardo, C; Dridi, W; Duran, I; Eleftheriadis, C; Ferrant†, L; Ferrari, A; Ferreira-Marques, R; Fitzpatrick, L; Frais-Koelbl, H; Fujii, K; Furman, W; Goncalves, I; Gonz alez-Romero, E; Goverdovski, A; Gramegna, F; Griesmayer, E; Gunsing, F; Haas, B; Haight, R; Heil, M; Herrera-Martinez, A; Igashira, M; Isaev, S; Jericha, E; Kappeler, F; Kadi, Y; Karadimos, D; Karamanis, D; Ketlerov, V; Kerveno, M; Koehler, P; Konovalov, V; Kossionides, E; Krticka, M; Lampoudis, C; Leeb, H; Lindote, A; Lopes, I; Lossito, R; Lozano, M; Lukic, S; Marganiec, J; Marques, L; Marrone, S; Martınez, T; Massimi, C; Mastinu, P; Mengoni, A; Milazzo, P M; Moreau, C; Mosconi, M; Neves, F; Oberhummer, H; O’Brien, S; Oshima, M; Pancin, J; Papachristodoulou, C; Papadopoulos, C; Paradela, C; Patronis, N; Pavlik, A; Pavlopoulos, P; Perrot, L; Pigni, M T; Plag, R; Plompen, A; Plukis, A; Poch, A; Praena, J; Pretel, C; Quesada, J; Rauscher, T; Reifarth, R; Rosetti, M; Rubbia, C; Rudolf, G; Rullhusen, P; Salgado, J; Santos, C; Sarchiapone, L; Savvidis, I; Stephan, C; Tagliente, G; Tain, J L; Tassan-Got, L; Tavora, L; Terlizzi, R; Vannini, G; Vaz, P; Ventura, A; Villamarin, D; Vicente, M C; Vlachoudis, V; Vlastou, R; Voss, F; Walter, S; Wendler, H; Wiescher, M; Wisshak, K

    2014-01-01

    Background:The design of new nuclear reactors and transmutation devices requires to reduce the present neutron cross section uncertainties of minor actinides. Purpose: Reduce the $^{243}$Am(n,$\\gamma$) cross section uncertainty. Method: The $^{243}$Am(n,$\\gamma$) cross section has been measured at the n_TOF facility at CERN with a BaF$_{2}$ Total Absorption Calorimeter, in the energy range between 0.7 eV and 2.5 keV. Results: The $^{243}$Am(n,$\\gamma$) cross section has been successfully measured in the mentioned energy range. The resolved resonance region has been extended from 250 eV up to 400 eV. In the unresolved resonance region our results are compatible with one of the two incompatible capture data sets available below 2.5 keV. The data available in EXFOR and in the literature has been used to perform a simple analysis above 2.5 keV. Conclusions: The results of this measurement contribute to reduce the $^{243}$Am(n,$\\gamma$) cross section uncertainty and suggest that this cross section is underestimate...

  1. Recoil-alpha-fission and recoil-alpha-alpha-fission events observed in the reaction Ca-48 + Am-243

    NARCIS (Netherlands)

    Forsberg, U.; Rudolph, D.; Andersson, L. -L.; Nitto, A. Di; Düllmann, Ch E.; Gates, J. M.; Golubev, P.; Gregorich, K. E.; Gross, C. J.; Herzberg, R. -D.; Hessberger, F. P.; Khuyagbaatar, J.; Kratz, J. V.; Rykaczewski, K.; Sarmiento, L. G.; Schädel, M.; Yakushev, A.; Åberg, S.; Ackermann, D.; Block, M.; Brand, H.; Carlsson, B. G.; Cox, D.; Derkx, X.; Dobaczewski, J.; Eberhardt, K.; Even, J.; Fahlander, C.; Gerl, J.; Jäger, E.; Kindler, B.; Krier, J.; Kojouharov, I.; Kurz, N.; Lommel, B.; Mistry, A.; Mokry, C.; Nazarewicz, W.; Nitsche, H.; Omtvedt, J. P.; Papadakis, P.; Ragnarsson, I.; Runke, J.; Schaffner, H.; Schausten, B.; Shi, Y.; Thörle-Pospiech, P.; Torres, T.; Traut, T.; Trautmann, N.; Türler, A.; Ward, A.; Ward, D. E.; Wiehl, N.

    2016-01-01

    Products of the fusion-evaporation reaction Ca-48 + Am-243 were studied with the TASISpec set-up at the gas-filled separator TASCA at the GSI Helmholtzzentrum f\\"ur Schwerionenforschung. Amongst the detected thirty correlated alpha-decay chains associated with the production of element Z=115, two

  2. A monolithic collapse origin for the thin and thick disc structure of the S0 galaxy ESO 243-49

    NARCIS (Netherlands)

    Comerón, S.; Salo, H.; Peletier, R. F.; Mentz, J.

    2016-01-01

    ESO 243-49 is a high-mass (circular velocity vc ≈ 200 km s-1), edge-on S0 galaxy in the Abell 2877 cluster at a distance of ~95 Mpc. To elucidate the origin of the thick disc of this S0 galaxy, we use Multi Unit Spectroscopic Explorer (MUSE) science verification data to study its kinematics and

  3. A new outburst of ESO 243-49 HLX-1 after being in quiescence for two years

    Science.gov (United States)

    Yan, Zhen; Yu, Wenfei

    2017-04-01

    We report on the most recent Swift observation of the hyper-luminous source ESO 243-49 HLX-1 taken on 2017-04-19 UT06:40:57. The XRT observation was taken in photon counting mode with an exposure time of 1753 seconds.

  4. Potentiation of reflex erectile responses in the anaesthetized rat by the selective melanocortin receptor 4 agonist MB243.

    Science.gov (United States)

    Allard, Julien; Reynolds, David S; Edmunds, Nicholas J

    2008-09-01

    To assess the potentiation of erectile responses induced by electrical stimulation (ES) of the dorsal penile nerve (DPN) in the urethane-anaesthetized rat by the selective melanocortin receptor 4 agonist MB243. Intracavernosal and blood pressures (ICP and BP, respectively) were monitored in urethane-anaesthetized rats after complete spinal cord transection at the thoracic level. Erectile responses were induced by ES of the DPN (train of square wave pulses of 1 ms and 6 V for 20 s at 1, 2 and 5 Hz) after i.v. injection of either saline or MB243, 3 mg/kg, in two groups of six rats. The maximal and mean ICP, and the area under the curve (AUC) of the ICP response, corrected for the corresponding BP, were measured and used as an index of erectile function (ICPmax/BP, ICPmean/BP and AUC/BP, respectively). MB243 increased the number of spontaneous erections between the injection and the first ES when compared with the vehicle group, but this difference was not statistically significant. ES of the DPN induced frequency-dependent erectile responses, the mean (sem) ICPmean/BP was 0.26 (0.02), 0.34 (0.04) and 0.39 (0.05) after administration of saline (vehicle) at 1, 2 and 5 Hz, respectively. All the variables, except the ICPmax/BP at 5 Hz, were significantly increased in the group injected with MB243 when compared with the vehicle group (P nerve stimulated model.

  5. Measurement of the 241Am and the 243Am Neutron Capture Cross Sections at the n_TOF Facility at CERN

    CERN Document Server

    Mendoza, E; Guerrero, C; Altstadt, S; Andrzejewski, J; Audouin, L; Barbagallo, M; Bécares, V; Bečvář, F; Belloni, F; Berthoumieux, E; Billowes, J; Boccone, V; Bosnar, D; Brugger, M; Calviani, M; Calviño, F; Carrapiço, C; Cerutti, F; Chiaveri, E; Chin, M; Colonna, N; Cortés, G; Cortés-Giraldo, M A; Diakaki, M; Domingo-Pardo, C; Duran, I; Dressler, R; Dzysiuk, N; Eleftheriadis, C; Ferrari, A; Fraval, K; Ganesan, S; García, A R; Giubrone, G; Gómez-Hornillos, M B; Gonçalves, I F; González-Romero, E; Griesmayer, E; Gunsing, F; Gurusamy, P; Jenkins, D G; Jericha, E; Kadi, Y; Käppeler, F; Karadimos, D; Kivel, N; Koehler, P; Kokkoris, M; Korschinek, G; Krtička, M; Kroll, J; Langer, C; Lederer, C; Leeb, H; Leong, L S; Losito, R; Manousos, A; Marganiec, J; Martínez, T; Mastinu, P F; Mastromarco, M; Massimi, C; Meaze, M; Mengoni, A; Milazzo, P M; Mingrone, F; Mirea, M; Mondelaers, W; Paradela, C; Pavlik, A; Perkowski, J; Pignatari, M; Plompen, A; Praena, J; Quesada, J M; Rauscher, T; Reifarth, R; Riego, A; Roman, F; Rubbia, C; Sarmento, R; Schillebeeckx, P; Schmidt, S; Schumann, D; Tagliente, G; Tain, J L; Tarrío, D; Tassan-Got, L; Tsinganis, A; Valenta, S; Vannini, G; Variale, V; Vaz, P; Ventura, A; Versaci, R; Vermeulen, M J; Vlachoudis, V; Vlastou, R; Wallner, A; Ware, T; Weigand, M; Weiß, C; Wright, T J; Žugec, P

    2014-01-01

    The capture cross sections of Am-241 and Am-243 were measured at the n\\_TOF facility at CERN in the epithermal energy range with a BaF2 Total Absorption Calorimeter. A preliminary analysis of the Am-241 and a complete analysis of the Am-243 measurement, including the data reduction and the resonance analysis, have been performed.

  6. 49 CFR 40.243 - What is the procedure for an alcohol screening test using an EBT or non-evidential breath ASD?

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 1 2010-10-01 2010-10-01 false What is the procedure for an alcohol screening test using an EBT or non-evidential breath ASD? 40.243 Section 40.243 Transportation Office of the...-evidential breath ASD? As the BAT or STT, you must take the following steps: (a) Select, or allow the...

  7. Measurement of the 241Am and the 243Am Neutron Capture Cross Sections at the n_TOF Facility at CERN

    Science.gov (United States)

    Mendoza, E.; Cano-Ott, D.; Guerrero, C.; Altstadt, S.; Andrzejewski, J.; Audouin, L.; Barbagallo, M.; Bécares, V.; Bečvář, F.; Belloni, F.; Berthoumieux, E.; Billowes, J.; Boccone, V.; Bosnar, D.; Brugger, M.; Calviani, M.; Calviño, F.; Carrapiço, C.; Cerutti, F.; Chiaveri, E.; Chin, M.; Colonna, N.; Cortés, G.; Cortés-Giraldo, M. A.; Diakaki, M.; Domingo-Pardo, C.; Duran, I.; Dressler, R.; Dzysiuk, N.; Eleftheriadis, C.; Ferrari, A.; Fraval, K.; Ganesan, S.; García, A. R.; Giubrone, G.; Gómez-Hornillos, M. B.; Gonçalves, I. F.; González-Romero, E.; Griesmayer, E.; Gunsing, F.; Gurusamy, P.; Jenkins, D. G.; Jericha, E.; Kadi, Y.; Käppeler, F.; Karadimos, D.; Kivel, N.; Koehler, P.; Kokkoris, M.; Korschinek, G.; Krtička, M.; Kroll, J.; Langer, C.; Lederer, C.; Leeb, H.; Leong, L. S.; Losito, R.; Manousos, A.; Marganiec, J.; Martínez, T.; Mastinu, P. F.; Mastromarco, M.; Massimi, C.; Meaze, M.; Mengoni, A.; Milazzo, P. M.; Mingrone, F.; Mirea, M.; Mondelaers, W.; Paradela, C.; Pavlik, A.; Perkowski, J.; Pignatari, M.; Plompen, A.; Praena, J.; Quesada, J. M.; Rauscher, T.; Reifarth, R.; Riego, A.; Roman, F.; Rubbia, C.; Sarmento, R.; Schillebeeckx, P.; Schmidt, S.; Schumann, D.; Tagliente, G.; Tain, J. L.; Tarrío, D.; Tassan-Got, L.; Tsinganis, A.; Valenta, S.; Vannini, G.; Variale, V.; Vaz, P.; Ventura, A.; Versaci, R.; Vermeulen, M. J.; Vlachoudis, V.; Vlastou, R.; Wallner, A.; Ware, T.; Weigand, M.; Weiß, C.; Wright, T. J.; Žugec, P.

    2014-05-01

    The capture cross sections of 241Am and 243Am were measured at the n_TOF facility at CERN in the epithermal energy range with a BaF2 Total Absorption Calorimeter. A preliminary analysis of the 241Am and a complete analysis of the 243Am measurement, including the data reduction and the resonance analysis, have been performed.

  8. Physiological roles for two periplasmic nitrate reductases in Rhodobacter sphaeroides 2.4.3 (ATCC 17025).

    Science.gov (United States)

    Hartsock, Angela; Shapleigh, James P

    2011-12-01

    The metabolically versatile purple bacterium Rhodobacter sphaeroides 2.4.3 is a denitrifier whose genome contains two periplasmic nitrate reductase-encoding gene clusters. This work demonstrates nonredundant physiological roles for these two enzymes. One cluster is expressed aerobically and repressed under low oxygen while the second is maximally expressed under low oxygen. Insertional inactivation of the aerobically expressed nitrate reductase eliminated aerobic nitrate reduction, but cells of this strain could still respire nitrate anaerobically. In contrast, when the anaerobic nitrate reductase was absent, aerobic nitrate reduction was detectable, but anaerobic nitrate reduction was impaired. The aerobic nitrate reductase was expressed but not utilized in liquid culture but was utilized during growth on solid medium. Growth on a variety of carbon sources, with the exception of malate, the most oxidized substrate used, resulted in nitrite production on solid medium. This is consistent with a role for the aerobic nitrate reductase in redox homeostasis. These results show that one of the nitrate reductases is specific for respiration and denitrification while the other likely plays a role in redox homeostasis during aerobic growth.

  9. Measurements of delayed neutron emission from Np-237, Am-241, and Am-243

    Energy Technology Data Exchange (ETDEWEB)

    Saleh, H.H.; Parish, T.A. [Texas A& M Univ., College Station, TX (United States); Raman, S. [Oak Ridge National Lab., TN (United States)

    1995-12-01

    Isotopes of transuranic elements are produced as a result of successive radiative capture reactions in the fuel of a nuclear reactor. Typically, these transuranic isotopes decay through long chains, have long half lives and dominate the long term toxicity of the spent reactor fuel. One of the options for waste management is to remove the transuranic from spent fuel by chemical processing, to load them into new special fuel elements, and to transmute them by neutron induced fission into shorter-lived fission fragments. Previous studies have shown the feasibility of actinide transmutation in either Light Water Reactors or Liquid Metal Fast Reactors. Due to the anticipated high transuranic loadings in the fuel of actinide burner reactors, the neutronic properties of the transuranic isotopes will have a significant effect on the operational and safety characteristics of such reactors. Experiments to determine delayed neutron group yields and decay constants for Np-237, Am-241, and Am-243 have been designed and carried out. The experiments were conducted at Texas A&M University TRIGA reactor using a very fast pneumatic transfer system.

  10. Manganese determination om minerals by activation analysis, using the californium-252 as a neutron source; Determinacao de manganes em minerios, por analise por ativacao, usando californio-252 como fonte de neutrons

    Energy Technology Data Exchange (ETDEWEB)

    Cardoso, Antonio

    1976-07-01

    Neutron Activation Analysis, using a Californium-252 neutron source, has been applied for the determination of manganese in ores such as pyrolusite, rodonite (manganese silicate)' and blending used in dry-batteries The favorable nuclear properties of manganese, such as high thermal neutron cross-section for the reaction {sup 55}Mn (n.gamma){sup 56} Mn, high concentration of manganese in the matrix and short half - life of {sup 56}Mn, are an ideal combination for non-destructive analysis of manganese in ores. Samples and standards of manganese dioxide were irradiated for about 20 minutes, followed by a 4 to 15 minutes decay and counted in a single channel pulse-height discrimination using a NaI(Tl) scintillation detector. Counting time was equal to 10 minutes. The interference of nuclear reactions {sup 56}Fe(n,p){sup 56}Mn and {sup 59} Co (n, {alpha}){sup 56} were studied, as well as problems in connection with neutron shadowing during irradiation, gamma-rays attenuation during counting and influence of granulometry of samples. One sample,was also analysed by wet-chemical method (sodium bismuthate) in order to compare results. As a whole, i t was shown that the analytical method of neutron activation for manganese in ores and blending, is a method simple, rapid and with good precision and accuracy. (author)

  11. Design of a homogeneous subcritical nuclear reactor based on thorium with a source of californium 252; Diseno de un reactor nuclear subcritico homogeneo a base de Torio con una fuente de Californio 252

    Energy Technology Data Exchange (ETDEWEB)

    Delgado H, C. E.; Vega C, H. R. [Universidad Autonoma de Zacatecas, Unidad Academica de Estudios Nucleares, Cipres No. 10, Fracc. La Penuela, 98068 Zacatecas, Zac. (Mexico); Sajo B, L., E-mail: ce_delgado89@hotmail.com [Universidad Simon Bolivar, Laboratorio de Fisica Nuclear, Apdo. 89000, 1080A Caracas (Venezuela, Bolivarian Republic of)

    2015-10-15

    Full text: One of the energy alternatives to fossil fuels which do not produce greenhouse gases is the nuclear energy. One of the drawbacks of this alternative is the generation of radioactive wastes of long half-life and its relation to the generation of nuclear materials to produce weapons of mass destruction. An option to these drawbacks of nuclear energy is to use Thorium as part of the nuclear fuel which it becomes in U{sup 233} when capturing neutrons, that is a fissile material. In this paper Monte Carlo methods were used to design a homogeneous subcritical reactor based on thorium. As neutron reflector graphite was used. The reactor core is homogeneous and is formed of 70% light water as moderator, 12% of enriched uranium UO{sub 2}(NO{sub 3}){sub 4} and 18% of thorium Th(NO{sub 3}){sub 4} as fuel. To start the nuclear fission chain reaction an isotopic source of californium 252 was used with an intensity of 4.6 x 10{sup 7} s{sup -1}. In the design the value of the effective multiplication factor, whose value turned out k{sub eff} <1 was calculated. Also, the neutron spectra at different distances from the source and the total fluence were calculated, as well as the values of the ambient dose equivalent in the periphery of the reactor. (Author)

  12. INVESTIGATING SLIM DISK SOLUTIONS FOR HLX-1 IN ESO 243-49

    Energy Technology Data Exchange (ETDEWEB)

    Godet, O.; Plazolles, B.; Barret, D.; Webb, N. [Institut de Recherche en Astrophysique and Planetologie (IRAP), Universite de Toulouse, UPS, 9 Avenue du colonel Roche, 31028 Toulouse Cedex 4 (France); Kawaguchi, T. [Center for Computational Sciences, University of Tsukuba, 1-1-1 Tennodai, Tsukuba, Ibaraki 305-8577 (Japan); Lasota, J.-P. [Institut d' Astrophysique de Paris, UMR 7095 CNRS, UPMC Universite Paris 06, 98bis Boulevard Arago, 75014 Paris (France); Farrell, S. A.; Braito, V. [Department of Physics and Astronomy, University of Leicester, University Road, Leicester LE1 7RH (United Kingdom); Servillat, M. [Harvard-Smithsonian Center for Astrophysics, 60 Garden Street, MS-67, Cambridge, MA 02138 (United States); Gehrels, N. [NASA/Goddard Space Flight Center, Greenbelt, MD 20771 (United States)

    2012-06-10

    The hyperluminous X-ray source HLX-1 in the galaxy ESO 243-49, currently the best intermediate-mass black hole (BH) candidate, displays spectral transitions similar to those observed in Galactic BH binaries, but with a luminosity 100-1000 times higher. We investigated the X-ray properties of this unique source by fitting multi-epoch data collected by Swift, XMM-Newton, and Chandra with a disk model computing spectra for a wide range of sub- and super-Eddington accretion rates assuming a non-spinning BH and a face-on disk (i = 0 Degree-Sign ). Under these assumptions we find that the BH in HLX-1 is in the intermediate-mass range ({approx}2 Multiplication-Sign 10{sup 4} M{sub Sun }) and the accretion flow is in the sub-Eddington regime. The disk radiation efficiency is {eta} = 0.11 {+-} 0.03. We also show that the source does follow the L{sub X} {proportional_to} T{sup 4} relation for our mass estimate. At the outburst peaks, the source radiates near the Eddington limit. The accretion rate then stays constant around 4 Multiplication-Sign 10{sup -4} M{sub Sun} yr{sup -1} for several days and then decreases exponentially. Such 'plateaus' in the accretion rate could be evidence that enhanced mass-transfer rate is the driving outburst mechanism in HLX-1. We also report on the new outburst observed in 2011 August by the Swift X-Ray Telescope. The time of this new outburst further strengthens the {approx}1 year recurrence timescale.

  13. Investigating SLIM Disk Solutions FOR HLX-1 IN ESO 243-49

    Science.gov (United States)

    Godet, O.; Plazolles, B.; Kawaguchi, T.; Lasota, J.-P; Barret, d.; Farrell, S. A.; Braito, V.; Servillat, M.; Webb, N.; Gehrels, N.

    2012-01-01

    The hyperluminous X-ray source HLX-1 in the galaxy ESO 243-49, currently the best intermediate-mass blackhole (BH) candidate, displays spectral transitions similar to those observed in Galactic BH binaries, but with aluminosity 100-1000 times higher. We investigated the X-ray properties of this unique source by fitting multiepochdata collected by Swift, XMM-Newton, and Chandra with a disk model computing spectra for a wide rangeof sub- and super-Eddington accretion rates assuming a non-spinning BH and a face-on disk (i=0 deg.). Under theseassumptions we find that the BH in HLX-1 is in the intermediate-mass range (approximately 2 x 10(exp 4) solar mass) and the accretionflow is in the sub-Eddington regime. The disk radiation efficiency is eta = 0.11 plus or minus 0.03. We also show that the source does follow the LX is proportional to T(exp 4) relation for our mass estimate. At the outburst peaks, the source radiates near the Eddington limit. The accretion rate then stays constant around 4 x 10(exp 4) solar mass yr (sup -1) for several days and then decreases exponentially. Such plateaus in the accretion rate could be evidence that enhanced mass-transfer rateis the driving outburst mechanism in HLX-1. We also report on the new outburst observed in 2011 August by theSwift X-Ray Telescope. The time of this new outburst further strengthens the approximately 1 year recurrence timescale.

  14. The influence of impurities for cross section measurement of {sup 241,243}Am(n,f) reactions

    Energy Technology Data Exchange (ETDEWEB)

    Kai, Tetsuya; Kobayashi, Katsuhei; Yamamoto, Shuji; Fujita, Yoshiaki; Kimura, Itsuro; Miyoshi, Mitsuharu; Yamamoto, Hideki [Kyoto Univ. (Japan); Shinohara, Nobuo

    1997-03-01

    The influence of the impurities on the fission cross section measurements for {sup 241}Am and {sup 243}Am has been investigated with the practical results. Following cases have been considered as the influence of impurities; (a) experiments with the {sup 241}Am sample that contains impurities originally, and (b) experiments with the {sup 243}Am sample that contains impurities produced by {alpha}, {beta} decays after the chemical purification. The present study has demonstrated the usefulness of pure samples by the comparison of the experiments using the sample on the market with those using the pure sample processed by the authors. Particularly on the case (b), the correction of the impurity through the periodical measurements was experimentally performed (about 18% around 0.3 eV in 4 weeks after the chemical purification). (author)

  15. Vector competence of Aedes albopictus and Aedes aegypti (Diptera: Culicidae) for DEN2-43 and New Guinea C virus strains of dengue 2 virus.

    Science.gov (United States)

    Guo, Xiao-Xia; Zhu, Xiao-Juan; Li, Chun-Xiao; Dong, Yan-De; Zhang, Ying-Mei; Xing, Dan; Xue, Rui-De; Qin, Cheng-Feng; Zhao, Tong-Yan

    2013-12-01

    The vector competence of Aedes albopictus and Aedes aegypti with regard to DEN2-43 and New Guinea C (NGC) virus strains of Dengue 2 viruses was assessed and compared. The infection and dissemination rate and distribution of DEN2-43 antigens in orally infected Ae. albopictus was investigated using the reverse transcription polymerase chain reaction and an indirect immunofluorescence assay. To better understand the initial infection, dissemination and transmission of these viral strains in vector mosquitoes, Ae. albopoictus and Ae. aegypti were fed an artificial blood meal containing either the DEN2-43 or NGC strain. There was no significant difference in the infection and dissemination rates of DEN2-43 and NGC virus strains in Ae. albopictus, however, Ae. aegypti was more susceptible to infection by NGC than DEN2-43 vrius strain. Ae. albopictus mosquitoes infected with the NGC strain developed a higher percentage of midgut infections than those infected with the DEN2-43 strain (t=2.893, df=7, P=0.024). Approximately 26.7% of midgut samples were positive for the NGC antigen 5 days after infection, and 80% of mosquitoes had infected midgets after 15 days. The NGC antigen first became evident in mosquito salivary glands on Day 5, and 40% of mosquitoes had infected salivary by Day 9. In contrast, the DEN2-43 antigen first became evident in salivary glands on Day 7. The infection rate of NGC and DEN2-43 virus strains in salivary glands were similar. These results indicate that Ae. albopictus and Ae. aegypti are moderately competent vectors for the DEN2-43 virus, which could provide basic data for the epidemiology study of dengue fever in China. Copyright © 2013 The Authors. Published by Elsevier B.V. All rights reserved.

  16. Implications of the delayed 2013 outburst of ESO 243-49 HLX-1

    Energy Technology Data Exchange (ETDEWEB)

    Godet, O.; Webb, N. A. [Institut de Recherche en Astrophysique and Planétologie (IRAP), Université de Toulouse, UPS, 9 Avenue du colonel Roche, F-31028 Toulouse Cedex 4 (France); Lombardi, J. C.; Vingless, J.; Thomas, M. [Department of Physics, Allegheny College, Meadville, PA 16335 (United States); Antonini, F.; Barret, D. [Canadian Institute for Theoretical Astrophysics, University of Toronto, 60 St. George Street, Toronto, Ontario M5S 3H8 (Canada)

    2014-10-01

    After showing four quasi-periodic outbursts spaced by ∼1 yr from 2009 to 2012, the hyper luminous X-ray source ESO 243-49 HLX-1, currently the best intermediate mass black hole (IMBH) candidate, showed an outburst in 2013 delayed by more than a month. In Lasota et al., we proposed that the X-ray light curve is the result of enhanced mass transfer episodes at periapsis from a donor star orbiting the IMBH in a highly eccentric orbit. In this scenario, the delay can be explained only if the orbital parameters can change suddenly from orbit to orbit. To investigate this, we ran Newtonian smooth particle hydrodynamical simulations starting with an incoming donor approaching an IMBH on a parabolic orbit. We survey a large parameter space by varying the star-to-black hole mass ratio (10{sup –5}-10{sup –3}) and the periapsis separation r{sub p} from 2.2 to 2.7r{sub t} with r{sub t} , the tidal radius. To model the donor, we choose several polytropes (Γ = 5/2, n = 3/2, Γ = 3/2, n = 2, Γ = 5/3, n = 2, and Γ = 5/3, n = 3). Once the system is formed, the orbital period decreases until reaching a minimum that may be shallow. Then, the period tends to increase over several periapsis passages due to tidal effects and increasing mass transfer, leading ultimately to the ejection of the donor. We show that the development of stochastic fluctuations inside the donor by adding or removing orbital energy from the system could lead to sudden changes in the orbital period from orbit to orbit with the appropriate order of magnitude to that which has been observed for HLX-1. We also show that given the constraints on the black hole (BH) mass (M {sub BH} > 10{sup 4} M {sub ☉}) and assuming that the HLX-1 system is currently near a minimum in period of ∼1 yr, the donor has to be a white dwarf or a stripped giant core. We predict that if HLX-1 is indeed emerging from a minimum in orbital period, then the period would generally increase with each passage, although substantial

  17. 30 CFR 243.9 - Will MMS continue to suspend my obligation to comply with an order if I seek judicial review in a...

    Science.gov (United States)

    2010-07-01

    ... MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR MINERALS REVENUE MANAGEMENT SUSPENSIONS PENDING APPEAL AND BONDING-MINERALS REVENUE MANAGEMENT General Provisions § 243.9 Will MMS continue to suspend my...

  18. 30 CFR 243.6 - When must I or another person meet the bonding or financial solvency requirements under this part?

    Science.gov (United States)

    2010-07-01

    ... MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR MINERALS REVENUE MANAGEMENT SUSPENSIONS PENDING APPEAL AND BONDING-MINERALS REVENUE MANAGEMENT General Provisions § 243.6 When must I or another person meet the...

  19. 30 CFR 243.5 - May another person post a bond or other surety instrument or demonstrate financial solvency on my...

    Science.gov (United States)

    2010-07-01

    ... MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR MINERALS REVENUE MANAGEMENT SUSPENSIONS PENDING APPEAL AND BONDING-MINERALS REVENUE MANAGEMENT General Provisions § 243.5 May another person post a bond or other...

  20. 30 CFR 243.11 - May I appeal the MMS bond-approving officer's determination of my surety amount or financial...

    Science.gov (United States)

    2010-07-01

    ... MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR MINERALS REVENUE MANAGEMENT SUSPENSIONS PENDING APPEAL AND BONDING-MINERALS REVENUE MANAGEMENT General Provisions § 243.11 May I appeal the MMS bond-approving...

  1. Chemical Identification of Dubnium as a Decay Product of Element 115 Produced in the Reaction $\\rm {^{48}Ca}+{^{243}Am}$

    CERN Document Server

    Dmitriev, S N; Utyonkov, V K; Shishkin, S V; Eremin, A V; Lobanov, Yu V; Chepigin, V I; Sokol, E A; Tsyganov, Yu S; Vostokin, G K; Aksenov, N V; Hussonnois, M; Itkis, M G; Aggeler, H W; Schumann, D; Bruchertseifer, H; Eichler, R; Shaughnessy, D A; Wilk, P A; Kenneally, J M; Stoyer, M A; Wild, J F

    2004-01-01

    The results of an experiment designed to identify $^{268}$Db as the terminal isotope in the $\\alpha $-decay chain of element 115 produced via the ${\\rm {^{243}Am}}({\\rm {^{48}Ca}},3n){\\rm {^{288}115}}$ reaction are presented. The $^{243}$Am target was bombarded with a beam dose of $3.4\\cdot 10^{18}$ $^{48}$Ca projectiles at an energy of 247 MeV at the center of the target. The reaction products were collected in the surface layer of a copper catcher block, which was removed with a lathe and then dissolved in concentrated HNO$_{3}$. The group-5 elements were separated by sorption onto Dowex $50{\\times} 8$ cation-exchange resin with subsequent desorption using 1 M HF, which forms anionic fluoride complexes of group-5 elements. The eluent was evaporated onto a 0.4 $\\mu$m thick polyethylene foil that was placed between a pair of semiconductor detectors surrounded by $^{3}$He neutron counters for measurement of $\\alpha$ particles, fission fragments, and neutrons. In the course of the experiment, we observed 15 spo...

  2. Biological transport of curium-243 in dairy animals. [Comparison to /sup 241/Am kinetics in lactating cows and goats

    Energy Technology Data Exchange (ETDEWEB)

    Sutton, W.W.; Patzer, R.G.; Hahn, P.B.; Potter, G.D.

    1979-04-01

    Lactating cows and goats were used to examine the biological transport of curium-243 in dairy animals. After either single oral or intravenous nuclide doses were administered, samples of milk, urine, blood, and feces were taken over a 144-hr priod, and the curium concentrations were determined by gamma counting. Gastrointestinal uptake of curium was estimated to be 0.02 and 0.006% of the oral dose for cows and goats, respectively. The cumulative percentage of oral dose transported to milk and urine was 4.6 x 10/sup -4/ and 1.9 x 10/sup -3/, respectively, for a cow and 2.7 x 10/sup -4/ and 1.6 x 10/sup -4/, respectively, for goats. Plasma concentrations of curium decreased rapidly following all intravenous injections. The average percentage of injected curium transferred to milk, urine, and feces was 2, 8, and 1, respectively, for a cow and 2, 5, and 5, respectively, for goats. All animals were sacrificed one week after dosing. Bovine bone retained the greatest fraction of the administered dose and the next highest was the liver. However, in all three intravenously dosed goats the liver contained the greatest amount of curium. Nuclide deposition in bone and liver was essentially equal for two of the three orally dosed goats while the skeleton contained the most curium in the other animal. Comparisons are presented between curium-243 and americium-241 transport in dairy cows.

  3. The use of MOX caramel fuel mixed with241Am,242mAm and243Am as burnable absorber actinides for the MTR research reactors.

    Science.gov (United States)

    Shaaban, Ismail; Albarhoum, Mohamad

    2017-07-01

    The MOX (UO 2 &PuO 2 ) caramel fuel mixed with 241 Am, 242m Am and 243 Am as burnable absorber actinides was proposed as a fuel of the MTR-22MW reactor. The MCNP4C code was used to simulate the MTR-22MW reactor and estimate the criticality and the neutronic parameters, and the power peaking factors before and after replacing its original fuel (U 3 O 8 -Al) by the MOX caramel fuel mixed with 241 Am, 242m Am and 243 Am actinides. The obtained results of the criticality, the neutronic parameters, and the power peaking factors for the MOX caramel fuel mixed with 241 Am, 242m Am and 243 Am actinides were compared with the same parameters of the U 3 O 8 -Al original fuel and a maximum difference is -6.18% was found. Additionally, by recycling 2.65% and 2.71% plutonium and 241 Am, 242m Am and 243 Am actinides in the MTR-22MW reactor, the level of 235 U enrichment is reduced from 4.48% to 3% and 2.8%, respectively. This also results in the reduction of the 235 U loading by 32.75% and 37.22% for the 2.65%, the 2.71% plutonium and 241 Am, 242m Am and 243 Am actinides, respectively. Copyright © 2017 Elsevier Ltd. All rights reserved.

  4. Recoil-alpha-fission and recoil-alpha-alpha-fission events observed in the reaction Ca-48 + Am-243

    CERN Document Server

    Forsberg, U; Andersson, L -L; Di Nitto, A; Düllmann, Ch E; Gates, J M; Golubev, P; Gregorich, K E; Gross, C J; Herzberg, R -D; Hessberger, F P; Khuyagbaatar, J; Kratz, J V; Rykaczewski, K; Sarmiento, L G; Schädel, M; Yakushev, A; Åberg, S; Ackermann, D; Block, M; Brand, H; Carlsson, B G; Cox, D; Derkx, X; Dobaczewski, J; Eberhardt, K; Even, J; Fahlander, C; Gerl, J; Jäger, E; Kindler, B; Krier, J; Kojouharov, I; Kurz, N; Lommel, B; Mistry, A; Mokry, C; Nazarewicz, W; Nitsche, H; Omtvedt, J P; Papadakis, P; Ragnarsson, I; Runke, J; Schaffner, H; Schausten, B; Shi, Y; Thörle-Pospiech, P; Torres, T; Traut, T; Trautmann, N; Türler, A; Ward, A; Ward, D E; Wiehl, N

    2015-01-01

    Products of the fusion-evaporation reaction Ca-48 + Am-243 were studied with the TASISpec set-up at the gas-filled separator TASCA at the GSI Helmholtzzentrum f\\"ur Schwerionenforschung. Amongst the detected thirty correlated alpha-decay chains associated with the production of element Z=115, two recoil-alpha-fission and five recoil-alpha-alpha-fission events were observed. The latter are similar to four such events reported from experiments performed at the Dubna gas-filled separator. Contrary to their interpretation, we propose an alternative view, namely to assign eight of these eleven decay chains of recoil-alpha(-alpha)-fission type to start from the 3n-evaporation channel 115-288. The other three decay chains remain viable candidates for the 2n-evaporation channel 115-289.

  5. 76 FR 24832 - Airworthiness Directives; Airbus Model A330-201, -202, -203, -223, and -243 Airplanes, A330-300...

    Science.gov (United States)

    2011-05-03

    ...-201, -202, -203, - 223, and -243 Airplanes, A330-300 Series Airplanes, A340-200 Series Airplanes, and A340-300 Series Airplanes AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of... some rudders fitted on A330 and A340-200/-300 aeroplanes. An extended de-bonding, if not detected and...

  6. 30 CFR 243.7 - What must a person do when posting a bond or other surety instrument or demonstrating financial...

    Science.gov (United States)

    2010-07-01

    ....7 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR MINERALS REVENUE MANAGEMENT SUSPENSIONS PENDING APPEAL AND BONDING-MINERALS REVENUE MANAGEMENT General Provisions § 243.7 What...(a), or any other theory, as a defense if MMS calls your bond or requires you to pay based on your...

  7. Partial monosomy 8q and partial trisomy 9q due to the maternal translocation t(8;9(q24.3;q34.1)

    DEFF Research Database (Denmark)

    Tos, T; Alp, M Y; Eker, H K

    2014-01-01

    Partial trisomy 9q34-qter and partial monosomy 8q24.3-qter are very rare chromosomal abnormalities. Characteristic features of partial trisomy 9q34-qter are hypotonia, developmental delay, mild intellectual disability, dolichocephaly, distinct facial phenotype, long and thin fingers, and cardiac...

  8. Measurement of the 243Am capture cross section at the n{sub T}OF facility; Medida de la sección eficaz de captura del 243Am en la instalación n{sub T}OF

    Energy Technology Data Exchange (ETDEWEB)

    Mendoza Cembranos, E.

    2014-07-01

    Nuclear data for minor actinides are necessary for improving the design and performance of advanced reactors and transmutation devices for the incineration of radioactive nuclear waste [Sal08, Gon09, Ali04, Ali06]. In particular, the 243Am isotope is relevant since it is the minor actinide which contributes more to the radiotoxicity of the nuclear waste between s3 03 and s3 04 years. In addition, the neutron capture in 243Am is the main gate to the creation of 244Cm and higher mass isotopes. The purpose of the this work is to provide experimental data on the 243Am(n, ) for improving the current evaluations. At present, there is no published neutron capture measurement of 243Am below 250 eV, and all the existing evaluations of the elastic and capture cross sections are based essentially on a single transmission measurement [Sim74]. Above 250 eV there are only a few capture measurements available [Wes85, Wis83], which show discrepancies that make them incompatible. Due to the lack of experimental data on 243Am the standard ENDF-6 format libraries present sizeable di rences between each other...(Author)

  9. Identification of a susceptibility locus for severe adolescent idiopathic scoliosis on chromosome 17q24.3.

    Directory of Open Access Journals (Sweden)

    Atsushi Miyake

    Full Text Available Adolescent idiopathic scoliosis (AIS is the most common spinal deformity, affecting around 2% of adolescents worldwide. Genetic factors play an important role in its etiology. Using a genome-wide association study (GWAS, we recently identified novel AIS susceptibility loci on chromosomes 10q24.31 and 6q24.1. To identify more AIS susceptibility loci relating to its severity and progression, we performed GWAS by limiting the case subjects to those with severe AIS. Through a two-stage association study using a total of ∼12,000 Japanese subjects, we identified a common variant, rs12946942 that showed a significant association with severe AIS in the recessive model (P=4.00 × 10(-8, odds ratio [OR]=2.05. Its association was replicated in a Chinese population (combined P=6.43 × 10(-12, OR = 2.21. rs12946942 is on chromosome 17q24.3 near the genes SOX9 and KCNJ2, which when mutated cause scoliosis phenotypes. Our findings will offer new insight into the etiology and progression of AIS.

  10. Physiological Roles for Two Periplasmic Nitrate Reductases in Rhodobacter sphaeroides 2.4.3 (ATCC 17025)▿

    Science.gov (United States)

    Hartsock, Angela; Shapleigh, James P.

    2011-01-01

    The metabolically versatile purple bacterium Rhodobacter sphaeroides 2.4.3 is a denitrifier whose genome contains two periplasmic nitrate reductase-encoding gene clusters. This work demonstrates nonredundant physiological roles for these two enzymes. One cluster is expressed aerobically and repressed under low oxygen while the second is maximally expressed under low oxygen. Insertional inactivation of the aerobically expressed nitrate reductase eliminated aerobic nitrate reduction, but cells of this strain could still respire nitrate anaerobically. In contrast, when the anaerobic nitrate reductase was absent, aerobic nitrate reduction was detectable, but anaerobic nitrate reduction was impaired. The aerobic nitrate reductase was expressed but not utilized in liquid culture but was utilized during growth on solid medium. Growth on a variety of carbon sources, with the exception of malate, the most oxidized substrate used, resulted in nitrite production on solid medium. This is consistent with a role for the aerobic nitrate reductase in redox homeostasis. These results show that one of the nitrate reductases is specific for respiration and denitrification while the other likely plays a role in redox homeostasis during aerobic growth. PMID:21949073

  11. Autosomal recessive spastic paraplegia (SPG45) with mental retardation maps to 10q24.3-q25.1.

    Science.gov (United States)

    Dursun, Umut; Koroglu, Cigdem; Kocasoy Orhan, Elif; Ugur, Sibel Aylin; Tolun, Aslihan

    2009-10-01

    Hereditary spastic paraplegias (HSPs) are characterized by progressive spasticity in the lower limbs. They are clinically heterogeneous, and pure forms as well as complicated forms with other accompanying clinical findings are known. HSPs are also genetically heterogeneous. We performed clinical and genetic studies in a consanguineous family with five affected members. A genome scan using 405 microsatellite markers for eight members of the family identified candidate gene loci, and subsequent fine mapping in 16 members identified the gene locus responsible for the HSP. The clinical manifestations were very early onset spastic paraplegia (SPG) accompanied by mental retardation and ocular signs. The gene locus was identified as the interval 102.05-106.64 Mbp on chromosome 10. Gene MRPL43 was analyzed in the patients. No mutation but high levels of mRNA were detected. We have mapped a novel autosomal recessive complicated form of HSP (SPG45) to a 4.6-Mbp region at 10q24.3-q25.1 with multipoint logarithm of odds scores >4.5.

  12. Neutron capture cross section measurements of $^{238}$U, $^{241}$Am and $^{243}$Am at n_TOF

    CERN Multimedia

    Koehler, P E; Plag, R

    The increase of the world energy demand and the need of low carbon energy sources have triggered the renaissance and/or enhancement of nuclear energy in many countries. Fundamental nuclear physics can contribute in a practical way to the sustainability and safety of the nuclear energy production and the management of the nuclear waste. There exists a series of recent studies which address the most relevant isotopes, decay data, nuclear reaction channels and energy ranges which have to be investigated in more detail for improving the design of different advanced nuclear systems [1] and nuclear fuel cycles [2]. In this proposal, we aim at the measurement of the neutron capture cross sections of $^{238}$U, $^{241}$Am and $^{243}$Am. All three isotopes are listed in the NEA High Priority Request List [37], are recommended for measurements [1] and play an important role in the nuclear energy production and fuel cycle scenarios. The measurements will provide as well valuable nuclear structure data necessary for the...

  13. A YOUNG MASSIVE STELLAR POPULATION AROUND THE INTERMEDIATE-MASS BLACK HOLE ESO 243-49 HLX-1

    Energy Technology Data Exchange (ETDEWEB)

    Farrell, S. A. [Sydney Institute for Astronomy (SIfA), School of Physics, University of Sydney, NSW 2006 (Australia); Servillat, M. [Harvard-Smithsonian Center for Astrophysics, 60 Garden Street, MS-67, Cambridge, MA 02138 (United States); Pforr, J.; Maraston, C. [Institute of Cosmology and Gravitation, University of Portsmouth, Dennis Sciama Building, Burnaby Road, Portsmouth PO1 3FX (United Kingdom); Maccarone, T. J.; Knigge, C. [School of Physics and Astronomy, University of Southampton, Hampshire SO17 1BJ (United Kingdom); Godet, O.; Webb, N. A.; Barret, D.; Belmont, R. [Universite de Toulouse, UPS-OMP, Institut de Recherche en Astrophysique et Planetologie (IRAP), Toulouse (France); Gosling, A. J. [University of Oxford, Department of Physics, Keble Road, Oxford OX1 3RH (United Kingdom); Wiersema, K., E-mail: sean.farrell@sydney.edu.au [Department of Physics and Astronomy, University of Leicester, University Road, LE1 7RH Leicester (United Kingdom)

    2012-03-15

    We present Hubble Space Telescope and simultaneous Swift X-ray Telescope observations of the strongest candidate intermediate-mass black hole (IMBH) ESO 243-49 HLX-1. Fitting the spectral energy distribution from X-ray to near-infrared wavelengths showed that the broadband spectrum is not consistent with simple and irradiated disk models, but is well described by a model comprised of an irradiated accretion disk plus a {approx}10{sup 6} M{sub Sun} stellar population. The age of the population cannot be uniquely constrained, with both young and old stellar populations allowed. However, the old solution requires excessive disk reprocessing and an extremely small disk, so we favor the young solution ({approx}13 Myr). In addition, the presence of dust lanes and the lack of any nuclear activity from X-ray observations of the host galaxy suggest that a gas-rich minor merger may have taken place less than {approx}200 Myr ago. Such a merger event would explain the presence of the IMBH and the young stellar population.

  14. Experiments on the Synthesis of Element 115 in the Reaction ^{243}Am (^{48}Ca, xn)^{291-x}115

    CERN Document Server

    Oganessian, Yu T; Lobanov, Yu V; Abdullin, F S; Polyakov, A N; Shirokovsky, I V; Tsyganov, Yu S; Gulbekyan, G G; Bogomolov, S L; Mezentsev, A N; Iliev, S; Subbotin, V G; Sukhov, A M; Voinov, A A; Buklanov, G V; Subotic, K M; Zagrebaev, V I; Itkis, M G; Patin, J B; Moody, K J; Wild, J F; Stoyer, M A; Stoyer, N J; Shaughnessy, D A; Kenneally, J M; Lougheed, R W

    2003-01-01

    The results of experiments designed to synthesize element 115 isotopes in the ^{243}Am(^{48}Ca,xn)^{291-x}115 reaction are presented. With a beam dose of 4.3\\cdot 10^{18} 248-Mev ^{48}Ca projectiles, we observed three similar decay chains consisting of five consecutive alpha-decays, all detected in time intervals of about 20 s and terminated at a later time by a spontaneous fission with a high energy release (TKE \\sim 220 MeV). At a higher bombarding energy of 253 MeV, with an equal ^{48}Ca beam dose, we registered a different decay chain of four consecutive alpha-decays detected in a time interval of about 0.5 s, also terminated by spontaneous fission. The alpha-decay energies and half-lives for nine new alpha-decaying nuclei were determined. The decay properties of these synthesized nuclei are consistent with consecutive alpha-decays originating from the parent isotopes of the new element 115, ^{288}115 and ^{287}115, produced in the 3n- and 4n-evaporation channels with cross sections of about 3 and 1 pb, r...

  15. 243 ORIGINAL ARTICLE

    African Journals Online (AJOL)

    boaz

    ICU admission, longer ICU stay, exposure to emergent surgery, the presence of central venous catheter and previous carbapenem use were significant risk factors for IRAB infection. Rationale use of carbapenems in ICUs should be considered. Key words: Imipenem-resistant, Acinetobacter baumannii, Intensive care units.

  16. 243 ORIGINAL ARTICLE

    African Journals Online (AJOL)

    boaz

    Beceiro A, Llinares P, Canle D, Molina F, Villanueva R,. Cisneros JM, Bou G. Hospital outbreak caused by a carbapenem-resistant strain of Acinetobacterbaumannii: patient prognosis and risk-factors for colonization and infection. Clin. Microbiol. Infect., 2005; 11(7):540-546. 31-. Ellis D, Cohen B, Liu J, Larson E. Risk factors.

  17. Apparent histological changes of adipocytes after treatment with CL 316,243, a β-3-adrenergic receptor agonist.

    Science.gov (United States)

    Ghorbani, Masoud; Teimourian, Shahram; Farzad, Reza; Asl, Nabiollah Namvar

    2015-01-01

    The objective of this experiment was to study the effect of CL 316,243 (CL) (a highly selective β3-adrenergic receptor agonist) on cellular changes occurring in retroperitoneal white adipose tissue (RWAT) of lean and obese rats. Ten-month-old lean and obese Zucker rats were implanted subcutaneously with osmotic mini-pumps, infusing either saline or CL (1 mg/kg body weight/day) for 4 weeks. There was no effect of CL on food intake. However, the resting metabolic rate in lean and obese rats increased by 55% and 96% per rat, respectively. Total RWAT weight decreased in both lean and obese rats under influence of CL treatment by 65% and 38%, respectively. Total body weight and body fat were lower in CL treated rats. Detection of uncoupling protein 1 (UCP1) in RWAT was confirmed qualitatively by both immunohistochemistry and immunofluorescence using a rabbit anti rat UCP1 antibody which showed the appearance of a marked increase of this protein in the adipose tissue. Stained semi-thin sections (0.5 μm) also demonstrated abundant nuclei in multilocular adipocytes, in endothelial cells associated with the vasculature, and in interstitial cells. In CL-treated obese rats, a clustering of several multilocular cells around the periphery of a white adipocyte was seen. These results indicate that treatment of both lean and obese Zucker rats with CL induces extensive remodeling of RWAT that includes shrinkage of white adipose tissue, appearance of abundant multilocular cells in RWAT together with the appearance of a marked increase of UCP, preferentially in lean rats.

  18. Combating non-Hodgkin lymphoma by targeting both CD20 and HLA-DR through CD20-243 CrossMab.

    Science.gov (United States)

    Zhao, Lei; Xie, Feiyue; Tong, Xin; Li, Huafei; Chen, Yaling; Qian, Weizhu; Duan, Shuyan; Zheng, Juan; Zhao, Ziye; Li, Bohua; Zhang, Dapeng; Zhao, Jian; Dai, Jianxin; Wang, Hao; Hou, Sheng; Guo, Yajun

    2014-01-01

    Although rituximab has revolutionized the treatment of hematological malignancies, the acquired resistance is one of the prime obstacles for cancer treatment, and development of novel CD20-targeting antibodies with potent anti-tumor activities and specificities is urgently needed. Emerging evidence has indicated that lysosomes can be considered as an "Achilles heel" for cancer cells, and might serve as an effective way to kill resistant cancer cells. HLA-DR antibody L243 has been recently reported to elicit potent lysosome-mediated cell death in lymphoma and leukemia cells, suggesting that HLA-DR could be used as a potential target against lymphoma. In this study, we generated a bispecific immunoglobulin G-like antibody targeting both CD20 and HLA-DR (CD20-243 CrossMab) through CrossMab technology. We found that the CrossMab could induce remarkably high levels of complement-dependent cytotoxicity, antibody-dependent cell-mediated cytotoxicity and anti-proliferative activity. Notably, although HLA-DR is expressed on normal and malignant cells, the CrossMab exhibited highly anti-tumor specificity, showing efficient eradication of hematological malignancies both in vitro and in vivo. Our data indicated that combined targeting of CD20 and HLA-DR could be an effective approach against malignancies, suggesting that CD20-243 CrossMab would be a promising therapeutic agent against lymphoma.

  19. Apparent histological changes of adipocytes after treatment with CL 316,243, a ß-3-adrenergic receptor agonist

    Directory of Open Access Journals (Sweden)

    Ghorbani M

    2015-02-01

    Full Text Available Masoud Ghorbani,1,2,* Shahram Teimourian,3,* Reza Farzad,4 Nabiollah Namvar Asl4 1Research and Development Department, Pasteur Institute of Iran, Tehran, Iran; 2Department of Biochemistry, University of Ottawa, Ottawa, ON, Canada; 3Department of Medical Genetics, Iran University of Medical Sciences, Tehran, Iran; 4Department of Animal Science, Pasteur Institute of Iran, Research and Production Complex, Karaj, Iran*These authors contributed equally to this work Background and objectives: The objective of this experiment was to study the effect of CL 316,243 (CL (a highly selective ß3-adrenergic receptor agonist on cellular changes occurring in retroperitoneal white adipose tissue (RWAT of lean and obese rats. Methods: Ten-month-old lean and obese Zucker rats were implanted subcutaneously with osmotic mini-pumps, infusing either saline or CL (1 mg/kg body weight/day for 4 weeks. Results: There was no effect of CL on food intake. However, the resting metabolic rate in lean and obese rats increased by 55% and 96% per rat, respectively. Total RWAT weight decreased in both lean and obese rats under influence of CL treatment by 65% and 38%, respectively. Total body weight and body fat were lower in CL treated rats. Detection of uncoupling protein 1(UCP1 in RWAT was confirmed qualitatively by both immunohistochemistry and immunofluorescence using a rabbit anti rat UCP1 antibody which showed the appearance of a marked increase of this protein in the adipose tissue. Stained semi-thin sections (0.5 µm also demonstrated abundant nuclei in multilocular adipocytes, in endothelial cells associated with the vasculature, and in interstitial cells. In CL-treated obese rats, a clustering of several multilocular cells around the periphery of a white adipocyte was seen. Conclusion: These results indicate that treatment of both lean and obese Zucker rats with CL induces extensive remodeling of RWAT that includes shrinkage of white adipose tissue, appearance of

  20. X-RAY VARIABILITY AND HARDNESS OF ESO 243-49 HLX-1: CLEAR EVIDENCE FOR SPECTRAL STATE TRANSITIONS

    Energy Technology Data Exchange (ETDEWEB)

    Servillat, Mathieu [Harvard-Smithsonian Center for Astrophysics, 60 Garden Street, MS-67, Cambridge, MA 02138 (United States); Farrell, Sean A. [Department of Physics and Astronomy, University of Leicester, University Road, Leicester LE1 7RH (United Kingdom); Lin Dacheng; Godet, Olivier; Barret, Didier; Webb, Natalie A., E-mail: mservillat@cfa.harvard.edu [Universite de Toulouse, Universite Paul Sabatier-Observatoire Midi-Pyrenees, Institut de Recherche en Astrophysique et Planetologie (IRAP), Toulouse (France)

    2011-12-10

    The ultraluminous X-ray (ULX) source ESO 243-49 HLX-1, which reaches a maximum luminosity of 10{sup 42} erg s{sup -1} (0.2-10 keV), currently provides the strongest evidence for the existence of intermediate-mass black holes (IMBHs). To study the spectral variability of the source, we conduct an ongoing monitoring campaign with the Swift X-ray Telescope (XRT), which now spans more than two years. We found that HLX-1 showed two fast rise and exponential decay type outbursts in the Swift XRT light curve with increases in the count rate of a factor {approx}40 separated by 375 {+-} 13 days. We obtained new XMM-Newton and Chandra dedicated pointings that were triggered at the lowest and highest luminosities, respectively. From spectral fitting, the unabsorbed luminosities ranged from 1.9 Multiplication-Sign 10{sup 40} to 1.25 Multiplication-Sign 10{sup 42} erg s{sup -1}. We confirm here the detection of spectral state transitions from HLX-1 reminiscent of Galactic black hole binaries (GBHBs): at high luminosities, the X-ray spectrum showed a thermal state dominated by a disk component with temperatures of 0.26 keV at most, and at low luminosities the spectrum is dominated by a hard power law with a photon index in the range 1.4-2.1, consistent with a hard state. The source was also observed in a state consistent with the steep power-law state, with a photon index of {approx}3.5. In the thermal state, the luminosity of the disk component appears to scale with the fourth power of the inner disk temperature, which supports the presence of an optically thick, geometrically thin accretion disk. The low fractional variability (rms of 9% {+-} 9%) in this state also suggests the presence of a dominant disk. The spectral changes and long-term variability of the source cannot be explained by variations of the beaming angle and are not consistent with the source being in a super-Eddington accretion state as is proposed for most ULX sources with lower luminosities. All this

  1. Neutron-induced fission cross sections of 233U and 243Am in the energy range 0.5 Mev En 20 MeV @ n_TOF

    CERN Document Server

    Belloni, F; Milazzo, P M; Calviani, M; Colonna, N; Mastinu, P; Abbondanno, U; Aerts, G; Álvarez, H; Álvarez-Velarde, F; Andriamonje, S; Andrzejewski, J; Assimakopoulos, P; Audouin, L; Badurek, G; Baumann, P; Becvár, F; Berthoumieux, E; Calviño, F; Cano-Ott, D; Capote, R; Carrapiço, C; Cennini, P; Chepel, V; Chiaveri, E; Cortes, G; Couture, A; Cox, J; Dahlfors, M; David, S; Dillmann, I; Domingo-Pardo, C; Dridi, W; Duran, I; Eleftheriadis, C; Embid-Segura, M; Ferrant, L; Ferrari, A; Ferreira-Marques, R; Fujii, K; Furman, W; Goncalves, I; González-Romero, E; Gramegna, F; Guerrero, C; Gunsing, F; Haas, B; Haight, R; Heil, M; Herrera-Martinez, A; Igashira, M; Jericha, E; Käppeler, F; Kadi, Y; Karadimos, D; Karamanis, D; Kerveno, M; Koehler, P; Kossionides, E; Krticka, M; Lampoudis, C; Leeb, H; Lindote, A; Lopes, I; Lozano, M; Lukic, S; Marganiec, J; Marrone, S; Martínez, T; Massimi, C; Mengoni, A; Moreau, C; Mosconi, M; Neves, F; Oberhummer, H; O'Brien, S; Pancin, J; Papachristodoulou, C; Papadopoulos, C; Paradela, C; Patronis, N; Pavlik, A; Pavlopoulos, P; Perrot, L; Pigni, M T; Plag, R; Plompen, A; Plukis, A; Poch, A; Praena, J; Pretel, C; Quesada, J; Rauscher, T; Reifarth, R; Rubbia, C; Rudolf, G; Rullhusen, P; Salgado, J; Santos, C; Sarchiapone, L; Savvidis, I; Stephan, C; Tagliente, G; Tain, J L; Tassan-Got, L; Tavora, L; Terlizzi, R; Vannini, G; Vazl, P; Ventura, A; Villamarin, D; Vincente, M C; Vlachoudis, V; Vlastou, R; Voss, F; Walter, S; Wiescher, M; Wisshak, K

    2011-01-01

    Neutron-induced fission cross-sections of actinides have been recently measured at the neutron time of flight facility n_TOF at CERN in the frame of a research project involving isotopes relevant for nuclear astrophysics and nuclear technologies. Fission fragments are detected by a gas counter with good discrimination between nuclear fission products and background events. Neutron-induced fission cross-sections of 233U and 243Am were determined relative to 235U. The present paper reports the results obtained at neutron energies between 0.5 and 20 MeV.

  2. Measurement of the neutron-induced fission cross-section of {sup 243}Am relative to {sup 235}U from 0.5 to 20 MeV

    Energy Technology Data Exchange (ETDEWEB)

    Belloni, F.; Milazzo, P.M.; Abbondanno, U.; Fujii, K.; Moreau, C. [Istituto Nazionale di Fisica Nucleare, Trieste (Italy); Calviani, M. [Laboratori Nazionali di Legnaro, Istituto Nazionale di Fisica Nucleare, Legnaro (Italy); CERN, Geneva (Switzerland); Colonna, N.; Barbagallo, M.; Marrone, S.; Meaze, M.H.; Tagliente, G.; Terlizzi, R. [Istituto Nazionale di Fisica Nucleare, Bari (Italy); Mastinu, P.; Gramegna, F. [Lab. Nazionali di Legnaro, Istituto Nazionale di Fisica Nucleare, Legnaro (Italy); Aerts, G.; Andriamonje, S.; Berthoumieux, E.; Dridi, W.; Gunsing, F.; Pancin, J.; Perrot, L.; Plukis, A. [Irfu, CEA, Gif-sur-Yvette (France); Alvarez, H.; Cano-Ott, D.; Duran, I.; Embid-Segura, M.; Gonzalez-Romero, E.; Paradela, C.; Tarrio, D. [Univ. de Santiago de Compostela, Galicia (Spain); Alvarez-Velarde, F.; Guerrero, C.; Martinez, T.; Villamarin, D.; Vincente, M.C. [Centro de Investigaciones Energeticas Medioambientales y Technologicas, Madrid (Spain); Andrzejewski, J.; Marganiec, J. [Univ. of Lodz (Poland); Audouin, L.; Dillmann, I.; Heil, M.; Kaeppeler, F.; Mosconi, M.; Plag, R.; Voss, F.; Walter, S.; Wisshak, K. [Karlsruhe Inst. of Technology, Eggenstein-Leopoldshafen (Germany). Inst. fuer Kernphysik; Badurek, G.; Jericha, E.; Leeb, H.; Oberhummer, H. [Technische Univ. Wien, Atominstitut der Oesterreichischen Universitaeten, Wien (Austria); Baumann, P.; David, S.; Kerveno, M.; Lukic, S.; Rudolf, G. [IReS, Centre National de la Recherche Scientifique/IN2P3, Strasbourg (France); Becvar, F.; Krticka, M. [Charles Univ., Faculty of Mathematics and Physics, Prague (Czech Republic); Calvino, F.; Cortes, G.; Poch, A.; Pretel, C. [Univ. Politecnica de Catalunya, Barcelona (Spain); Capote, R. [NAPC/Nuclear Data Section, International Atomic Energy Agency, Vienna (Austria); Univ. de Sevilla (Spain); Carrapico, C.; Goncalves, I.; Salgado, J.; Santos, C.; Tavora, L.; Vaz, P. [Inst. Tecnologico e Nuclear, Lisbon (Portugal)] [and others

    2011-12-15

    The ratio of the neutron-induced fission cross-sections of {sup 243}Am and {sup 235}U was measured in the energy range from 0.5 to 20 MeV with uncertainties of {approx} 4%. The experiment was performed at the CERN n{sub T}OF facility using a fast ionization chamber. With the good counting statistics that could be achieved thanks to the high instantaneous flux and the low backgrounds, the present results are useful for resolving discrepancies in previous data sets and are important for future reactors with improved fuel burn-up. (orig.)

  3. Anti diabetic effect of CL 316,243 (a β3-adrenergic agonist by down regulation of tumour necrosis factor (TNF-α expression.

    Directory of Open Access Journals (Sweden)

    Masoud Ghorbani

    Full Text Available OBJECTIVE: Obesity is a risk factor for the development of insulin resistance and is one of the most important contributors to the pathogenesis of type 2 diabetes, which acts mainly through the secretion of adipokines such as TNF-α that may influence insulin sensitivity. TNF-α affects many aspects of adipocyte function, such as adipocyte development and lipid metabolism. MATERIAL AND METHODS: We demonstrated that there is a correlation between the expressions of TNF-α in retroperitoneal WAT and insulin-resistance in 8 genetically obese fa/fa rats. Treatment of animals with CL 316,243, a β3-adrenergic agonist, showed an improvement of insulin-resistance that was linked with the suppression of TNF-α mRNA expression in WAT. RESULTS: These results confirm the association between TNF-α expression and the insulin-resistant condition in rats. Our finding indicates that the hyperglycaemia and hyperinsulinemia induced by insulin-resistance correlated positively with the expression of TNF-α mRNA in an abdominal WAT depot. CONCLUSION: We conclude that CL 316,243 possesses both anti-diabetic effects and anti-obesity effects in rodents.

  4. [Lymph node mapping and axillary sentinel lymph node biopsy in 243 invasive breast cancers with no palpable nodes. The south Lyon hospital center experience].

    Science.gov (United States)

    Bobin, J Y; Spirito, C; Isaac, S; Zinzindohoue, C; Joualee, A; Khaled, M; Perrin-Fayolle, O

    2000-11-01

    To evaluate the effect of intraoperative lymph node mapping and sentinel lymph node dissection (SLND) on the axillary staging of patients with N0 breast carcinoma. Two techniques were used: blue dye alone (Evans Blue and Patent Blue) and combined technique (blue dye and isotope). The incidence of axillary node metastasis in axillary lymph node dissection (ALND) and SLND was compared prospectively. Multiple sections of each SLN were examined by HPS staining and immunohistochemical techniques. Two sections of each non sentinel node in ALND specimens were examined by routine HPS staining. 243 patients underwent ALND after SLN biopsy. The SLN detection rate was 225/243 cases (92.59%): 89.94% with blue dye alone and 100% with the combined technique. The false-negative rate was less than 2%. SN biopsy is an accurate staging technique for N0 breast cancer. SLN biopsy with multiple sections and immunohistochemical staining of the SLN can identify significantly more patients with lymph node metastases than ALND with routine HPS staining.

  5. Ad E1A 243R oncoprotein promotes association of proto-oncogene product MYC with the NuA4/Tip60 complex via the E1A N-terminal repression domain.

    Science.gov (United States)

    Zhao, Ling-Jun; Loewenstein, Paul M; Green, Maurice

    2016-12-01

    The adenovirus E1A 243R oncoprotein targets TRRAP, a scaffold protein that assembles histone acetyltransferase (HAT) complexes, such as the NuA4/Tip60 complex which mediates transcriptional activity of the proto-oncogene MYC and helps determine the cancer cell phenotype. How E1A transforms cells through TRRAP remains obscure. We performed proteomic analysis with the N-terminal transcriptional repression domain of E1A 243R (E1A 1-80) and showed that E1A 1-80 interacts with TRRAP, p400, and three other members of the NuA4 complex - DMAP1, RUVBL1 and RUVBL2 - not previously shown to associate with E1A 243R. E1A 1-80 interacts with these NuA4 components and MYC through the E1A TRRAP-targeting domain. E1A 243R association with the NuA4 complex was demonstrated by co-immunoprecipitation and analysis with DMAP1, Tip60, and MYC. Significantly, E1A 243R promotes association of MYC/MAX with the NuA4/Tip60 complex, implicating the importance of the MYC/NuA4 pathway in cellular transformation by both MYC and E1A. Copyright © 2016 Elsevier Inc. All rights reserved.

  6. On the participle ἐττημένα (Pherecr., fr. 243 K.‑A., its etymology and its placing in the lexica

    Directory of Open Access Journals (Sweden)

    Lucía Rodríguez-Noriega Guillén

    2010-12-01

    Full Text Available The participle ἐττημένα (Pherecr., fr. 243 K.‑A. has not been correctly assigned to any verb in the Greek Lexica so far. In this paper the question is faced taking into account 1 the other words of the family, their sources, and their textual problems, 2 the Indo-European etymology of the verb, and 3 its phonetic evolution in Greek. If, as it seems very likely, the verb comes from IE *ky(eH2‑ (according to the etymology put forward by Puhvel, ἐττημένα should be assigned to the present τάω, Attic equivalent to Ionic σάω, known through Philoxenus and the Etymologica, which follow the former on this point.

  7. Standardization of (166m)Ho and 243Am/239Np by live-timed anti-coincidence counting with extending dead time.

    Science.gov (United States)

    da Silva, C J; Loureiro, J S; Delgado, J U; Poledna, R; Moreira, D S; Iwahara, A; Tauhata, L; da Silva, R L; Lopes, R T

    2012-09-01

    The National Laboratory for Metrology of Ionizing Radiation (LNMRI)/Brazil acquired (166m)Ho and (243)Am/(239)Np solutions from commercial suppliers in order to realize primary standardization and therefore reducing the associated uncertainties. The method used in the standardization was the live-timed 4πβ(LS)-γ(ΝaI(Tl)) anticoincidence counting. The live-timed anticoincidence system is operated since 2006 in LNMRI and is composed of two MTR2 modules donated by Laboratoire National Henri Becquerel (LNE-LNHB)/France. The data acquisition system uses a homemade LabView program and an Excel file for calculus. These systems have been used for primary standardization at LNMRI for many radionuclides and recently took part in the (124)Sb and (177)Lu International Key Comparisons with good performance. Copyright © 2012 Elsevier Ltd. All rights reserved.

  8. Synthesis, characterisation and antimicrobial-activity of 3-thio-1,5-dihydro-2,4,3-benzodioxaphosphepin-3-amino acid esters

    Directory of Open Access Journals (Sweden)

    Chinthaparthi Radha Rani

    2011-01-01

    Full Text Available A new series of 3-thio-1,5-dihydro-2,4,3-benzodioxaphosphepin-3-amino acid esters (4a-k were synthesized by treating different amino acid ester hydrochlorides (3a-k with phosphorus monochloride intermediate (2 which was previously formed in situ from 1,2-phenylenedimethanol (1 and thiophosphoryl chloride in the presence of triethylamine in dry tetrahydrofuran (THF at 0-5 ºC to room temperature. The structures of the title compounds (4a-k were established by analytical, IR, NMR (1H, 13C and 31P and mass spectra, and they have been screened for their antimicrobial activity. They exhibited significant antibacterial, and antifungal activity.

  9. Fission Cross-section Measurements of (233)U, (245)Cm and (241,243)Am at CERN n_TOF Facility

    CERN Document Server

    Calviani, M; Andriamonje, S; Chiaveri, E; Vlachoudis, V; Colonna, N; Meaze, M H; Marrone, S; Tagliente, G; Terlizzi, R; Belloni, F; Abbondanno, U; Fujii, K; Milazzo, P M; Moreau, C; Aerts, G; Berthoumieux, E; Dridi, W; Gunsing, F; Pancin, J; Perrot, L; Plukis, A; Alvarez, H; Duran, I; Paradela, C; Alvarez-Velarde, F; Cano-Ott, D; Gonzalez-Romero, E; Guerrero, C; Martinez, T; Villamarin, D; Vicente, M C; Andrzejewski, J; Marganiec, J; Assimakopoulos, P; Karadimos, D; Karamanis, D; Papachristodoulou, C; Patronis, N; Audouin, L; David, S; Ferrant, L; Isaev, S; Stephan, C; Tassan-Got, L; Badurek, G; Jericha, E; Leeb, H; Oberhummer, H; Pigni, M T; Baumann, P; Kerveno, M; Lukic, S; Rudolf, G; Becvar, F; Krticka, M; Calvino, F; Capote, R; Carrillo De Albornoz, A; Marques, L; Salgado, J; Tavora, L; Vaz, P; Cennini, P; Dahlfors, M; Ferrari, A; Gramegna, F; Herrera-Martinez, A; Kadi, Y; Mastinu, P; Praena, J; Sarchiapone, L; Wendler, H; Chepel, V; Ferreira-Marques, R; Goncalves, I; Lindote, A; Lopes, I; Neves, F; Cortes, G; Poch, A; Pretel, C; Couture, A; Cox, J; O'brien, S; Wiescher, M; Dillman, I; Heil, M; Kappeler, F; Mosconi, M; Plag, R; Voss, F; Walter, S; Wisshak, K; Dolfini, R; Rubbia, C; Domingo-Pardo, C; Tain, J L; Eleftheriadis, C; Savvidis, I; Frais-Koelbl, H; Griesmayer, E; Furman, W; Konovalov, V; Goverdovski, A; Ketlerov, V; Haas, B; Haight, R; Reifarth, R; Igashira, M; Koehler, P; Kossionides, E; Lampoudis, C; Lozano, M; Quesada, J; Massimi, C; Vannini, G; Mengoni, A; Oshima, M; Papadopoulos, C; Vlastou, R; Pavlik, A; Pavlopoulos, P; Plompen, A; Rullhusen, P; Rauscher, T; Rosetti, M; Ventura, A

    2011-01-01

    Neutron-induced fission cross-sections of minor actinides have been measured using the n_TOF white neutron source at CERN, Geneva, as part of a large experimental program aiming at collecting new data relevant for nuclear astrophysics and for the design of advanced reactor systems. The measurements at n_TOF take advantage of the innovative features of the n_TOF facility, namely the wide energy range, high instantaneous neutron flux and good energy resolution. Final results on the fission cross-section of 233U, 245Cm and 243Am from thermal to 20 MeV are here reported, together with preliminary results for 241Am. The measurement have been performed with a dedicated Fast Ionization Chamber (FIC), a fission fragment detector with a very high efficiency, relative to the very well known cross-section of 235U, measured simultaneously with the same detector.

  10. The equilibrium constant for N2O5 = NO2 + NO3 - Absolute determination by direct measurement from 243 to 397 K

    Science.gov (United States)

    Cantrell, C. A.; Davidson, J. A.; Mcdaniel, A. H.; Shetter, R. E.; Calvert, J. G.

    1988-01-01

    Direct determinations of the equilibrium constant for the reaction N2O5 = NO2 + NO3 were carried out by measuring NO2, NO3, and N2O5 using long-path visible and infrared absorption spectroscopy as a function of temperature from 243 to 397 K. The first-order decay rate constant of N2O5 was experimentally measured as a function of temperature. These results are in turn used to derive a value for the rate coefficient for the NO-forming channel in the reaction of NO3 with NO2. The implications of the results for atmospheric chemistry, the thermodynamics of NO3, and for laboratory kinetics studies are discussed.

  11. Paternal deletion 6q24.3: a new congenital anomaly syndrome associated with intrauterine growth failure, early developmental delay and characteristic facial appearance.

    Science.gov (United States)

    Nowaczyk, Małgorzata J M; Carter, Melissa T; Xu, Jie; Huggins, Marlene; Raca, Gordana; Das, Soma; Martin, Christa Lese; Schwartz, Stuart; Rosenfield, Robert; Waggoner, Darrel J

    2008-02-01

    Deletions of the long arm of chromosome 6 are relatively uncommon and to date minimal genotype-phenotype correlations have been observed. We report on three unrelated patients with de novo paternal interstitial deletions of 6q24.3. FISH mapping was used to delineate the minimal region of overlap between these three patients. Although all three patients had different size deletions and different breakpoints, two of the patients shared a 2.5 Mb region of overlap and strikingly similar facial features including a triangular face, frontal bossing with metopic prominence, short and upward-slanting palpebral fissures, asymmetry of upper eyelids, hooded eyelids, shallow orbits, prominent inferior orbital crease, wide mouth, and long and flat philtrum. They also had redundant skin, joint laxity, a small thorax, and early developmental delay. The smallest region of overlap between all three patients was a region of deletion less than 1 Mb; all had a history of IUGR and postnatal short stature without overt radiologic skeletal anomalies. The dysmorphic features, early developmental and growth delay may be due to the hemizygous state for one of the genes in the deleted region of two of the patients or to a long range effect of the deletion on expression of other genes. In addition, since imprinted genes have been reported in this region, paternal deletion of an imprinted gene in all three patients may contribute to the growth phenotype. We propose that this is a new congenital malformation syndrome associated with a paternal deletion of 6q24.3.

  12. Human glutamate pyruvate transaminase (GPT): Localization to 8q24.3, cDNA and genomic sequences, and polymorphic sites

    Energy Technology Data Exchange (ETDEWEB)

    Sohocki, M.M.; Sullivan, L.S.; Daiger, S.P. [Univ. of Texas Health Science Center, Houston, TX (United States)] [and others

    1997-03-01

    Two frequent protein variants of glutamate pyruvate transaminase (GPT) (E.C.2.6.1.2) have been used as genetic markers in humans for more than two decades, although chromosomal mapping of the GPT locus in the 1980s produced conflicting results. To resolve this conflict and develop useful DNA markers for this gene, we isolated and characterized cDNA and genomic clones of GPT. We have definitively mapped human GPT to the terminus of 8q using several methods. First, two cosmids shown to contain the GPT sequence were derived from a chromosome 8-specific library. Second, by fluorescence in situ hybridization, we mapped the cosmid containing the human GPT gene to chromosome band 8q24.3. Third, we mapped the rat gpt cDNA to the syntenic region of rat chromosome 7. Finally, PCR primers specific to human GPT amplify sequences contained within a {open_quotes}half-YAC{close_quotes} from the long arm of chromosome 8, that is, a YAC containing the 8q telomere. The human GPT genomic sequence spans 2.7 kb and consists of 11 exons, ranging in size from 79 to 243 bp. The exonic sequence encodes a protein of 495 amino acids that is nearly identical to the previously reported protein sequence of human GPT-1. The two polymorphic GPT isozymes are the result of a nucleotide substitution in codon 14. In addition, a cosmid containing the GPT sequence also contains a previously unmapped, polymorphic microsatellite sequence, D8S421. The cloned GPT gene and associated polymorphisms will be useful for linkage and physical mapping of disease loci that map to the terminus of 8q, including atypical vitelliform macular dystrophy (VMD1) and epidermolysis bullosa simplex, type Ogna (EBS1). In addition, this will be a useful system for characterizing the telomeric region of 8q. Finally, determination of the molecular basis of the GPT isozyme variants will permit PCR-based detection of this world-wide polymorphism. 22 refs., 3 figs.

  13. Interaction of NF-κB and IκBα, IκBαM, IκBα243N or IκBα244C studied with fluorescent fusion proteins by FRET in living cells

    Science.gov (United States)

    Li, Xian; Chen, Xiaojia; Tang, Yonghong

    2006-09-01

    In this paper, the location and interaction of NF-κB and IκBα (IκBαM, IκBα243N, or IκBα244C) in vivo is investigated by fluorescence resonance energy transfer (FRET). Co-transfection of a YFP-p65 construct with CFP- IκBα, C.FP-lid3aM (S32,36A), or CFP-IκBα243N(i-243) resulted in cytosolic localization of both proteins in almost all of the transfected cells. Co-transfection of YFP-p65 construct with CFP-Iw.Ba244C showed a predominant nuclear fluorescence of the proteins. The interaction between YFP-p65 and CFP-IκBα, CFP-IκBαM, CFP-IκBα243N or CFP-IκBα244C were further studied by acceptor bleaching experiments. When YFP-p65 were bleached, the fluorescence of CFP-IκBα, CFP-IκBm, CFP-IκBα243N increased. However, YFP-p65 and CFP-IκBα244C didn't have FRET and the fluorescence of CFP-IκBα244C were not influenced when YFP-p65 were bleached. This observation suggests that NF-κB interacted with the ankyrin repeat domain of IκBα, and our study domonstrates that the application of fluorescent fusion protein, FRET and acceptor bleaching technique to investigate protein-protein interactions in living cells might expand our understanding of these interactions considerably.

  14. New insights into the 243Am + 48Ca reaction products previously observed in the experiments on elements 113, 115, and 117.

    Science.gov (United States)

    Oganessian, Yu Ts; Abdullin, F Sh; Dmitriev, S N; Gostic, J M; Hamilton, J H; Henderson, R A; Itkis, M G; Moody, K J; Polyakov, A N; Ramayya, A V; Roberto, J B; Rykaczewski, K P; Sagaidak, R N; Shaughnessy, D A; Shirokovsky, I V; Stoyer, M A; Subbotin, V G; Sukhov, A M; Tsyganov, Yu S; Utyonkov, V K; Voinov, A A; Vostokin, G K

    2012-01-13

    Results of a new series of experiments on the study of production cross sections and decay properties of the isotopes of element 115 in the reaction (243)Am+(48)Ca are presented. Twenty-one new decay chains originating from (288)115 were established as the product of the 3n-evaporation channel by measuring the excitation function at three excitation energies of the compound nucleus (291)115. The decay properties of all newly observed nuclei are in full agreement with those we measured in 2003. At the lowest excitation energy E*=33 MeV, for the first time we registered the product of the 2n-evaporation channel, (289)115, which was also observed previously in the reaction (249)Bk+(48)Ca as the daughter nucleus of the decay of (293)117. The maximum cross section for the production of (288)115 is found to be 8.5 pb at E*≈36 MeV.

  15. Gitonga 243-251.pmd

    African Journals Online (AJOL)

    Prof. Adipala Ekwamu

    vermiculite and glass beads) (SMM). Support matrices (cotton wool, glass beads and vermiculite) were considered as low cost materials (Table 1D). Different sources of water, namely tap, rain and distilled, were used to prepare the media for shoot multiplication. For rooting, MS basal salts was supplemented with 3% sugar ...

  16. Detection of structural abnormalities in spermatozoa of a translocation carrier t(3;11)(q27.3;q24.3) by triple FISH.

    Science.gov (United States)

    Martini, E; von Bergh, A R; Coonen, E; de Die-Smulders, C E; Hopman, A H; Ramaekers, F C; Geraedts, J P

    1998-02-01

    Structural chromosome abnormalities in spermatozoa represent an important category of paternally transmittable genetic damage. A couple was referred to our centre because of repetitive abortions and the man was found to be a carrier of a reciprocal translocation t(3;11)(q27.3;q24.3). A tailored fluorescence in situ hybridisation (FISH) approach was developed to study the meiotic segregation patterns in spermatozoa from this translocation carrier. A combination of three DNA probes was used, a centromeric probe for chromosome 11, a cosmid probe for chromosome 11q and a YAC probe for chromosome 3q. The frequency of spermatozoa carrying an abnormal chromosome constitution was compared with baseline frequencies in control semen specimens and it was found that a significantly higher percentage of spermatozoa carried an abnormal constitution for the chromosomes involved in the translocation. A normal or balanced chromosome constitution was found in 44.3% of the analysed spermatozoa, while the remainder exhibited an abnormal chromosome constitution reflecting different modes of segregation (15.9% adjacent I segregation, 6.5% adjacent II segregation, 28.9% 3:1 segregation, 0.8% 4:0 segregation, 3.6% aberrant segregation). The frequency of aneuploidy for chromosomes X, Y, 13 and 21 was assessed using specific probes but there was no evidence of interchromosomal effects or variations in the sex ratio in spermatozoa from the translocation carrier. In conclusion, structural aberrations can be reliably assessed in interphase spermatozoa using unique DNA probe cocktails, and this method provides insight into the genetic constitution of germ cells and enables evaluation of potential risks for the offspring.

  17. Microcephaly, Intellectual Impairment, Bilateral Vesicoureteral Reflux, Distichiasis and Glomuvenous Malformations Associated with a 16q24.3 Contiguous Gene Deletion and a Glomulin Mutation

    Science.gov (United States)

    Butler, Matthew G.; Dagenais, Susan L.; Garcia-Perez, José L.; Brouillard, Pascal; Vikkula, Miikka; Strouse, Peter; Innis, Jeffrey W.; Glover, Thomas W.

    2012-01-01

    Two hereditary syndromes, lymphedema-distichiasis syndrome (LD) and blepharo-chelio-dontic (BCD) syndrome include the aberrant growth of eyelashes from the meibomian glands, known as distichiasis. LD is an autosomal dominant syndrome primarily characterized by distichiasis and the onset of lymphedema usually during puberty. Mutations in the forkhead transcription factor FOXC2 are the only known cause of LD. BCD syndrome consists of autosomal dominant abnormalities of the eyelid, lip, and teeth, and the etiology remains unknown. In this report, we describe a proband that presented with distichiasis, microcephaly, bilateral grade IV vesicoureteral reflux requiring ureteral re-implantation, mild intellectual impairment and apparent glomuvenous malformations. Distichiasis was present in three generations of the proband’s maternal side of the family. The glomuvenous malformations were severe in the proband, and maternal family members exhibited lower extremity varicosities of variable degree. A GLMN (glomulin) gene mutation was identified in the proband that accounts for the observed glomuvenous malformations; no other family member could be tested. TIE2 sequencing revealed no mutations. In the proband, an additional submicroscopic 265 kb contiguous gene deletion was identified in 16q24.3, located 609 kb distal to the FOXC2 locus, which was inherited from the proband’s mother. The deletion includes the C16ORF95, FBXO31, MAP1LC3B, and ZCCHC14 loci and 115 kb of a gene desert distal to FOXC2 and FOXL1. Thus, it is likely that the microcephaly, distichiasis, vesicoureteral and intellectual impairment in this family may be caused by the deletion of one or more of these genes and/or deletion of distant cis-regulatory elements of FOXC2 expression. PMID:22407726

  18. A DETAILED GRAVITATIONAL LENS MODEL BASED ON SUBMILLIMETER ARRAY AND KECK ADAPTIVE OPTICS IMAGING OF A HERSCHEL-ATLAS SUBMILLIMETER GALAXY AT z = 4.243 {sup ,} {sup ,}

    Energy Technology Data Exchange (ETDEWEB)

    Bussmann, R. S.; Gurwell, M. A. [Harvard-Smithsonian Center for Astrophysics, 60 Garden Street, Cambridge, MA 02138 (United States); Fu Hai; Cooray, A. [Department of Physics and Astronomy, University of California, Irvine, CA 92697 (United States); Smith, D. J. B.; Bonfield, D.; Dunne, L. [Centre for Astrophysics, Science and Technology Research Institute, University of Hertfordshire, Hatfield, Herts AL10 9AB (United Kingdom); Dye, S.; Eales, S. [School of Physics and Astronomy, University of Nottingham, University Park, Nottingham NG7 2RD (United Kingdom); Auld, R. [Cardiff University, School of Physics and Astronomy, Queens Buildings, The Parade, Cardiff CF24 3AA (United Kingdom); Baes, M.; Fritz, J. [Sterrenkundig Observatorium, Universiteit Gent, Krijgslaan 281 S9, B-9000 Gent (Belgium); Baker, A. J. [Department of Physics and Astronomy, Rutgers, the State University of New Jersey, 136 Frelinghuysen Road, Piscataway, NJ 08854-8019 (United States); Cava, A. [Departamento de Astrofisica, Facultad de CC. Fisicas, Universidad Complutense de Madrid, E-28040 Madrid (Spain); Clements, D. L.; Dariush, A. [Imperial College London, Blackett Laboratory, Prince Consort Road, London SW7 2AZ (United Kingdom); Coppin, K. [Department of Physics, McGill University, Ernest Rutherford Building, 3600 Rue University, Montreal, Quebec, H3A 2T8 (Canada); Dannerbauer, H. [Universitaet Wien, Institut fuer Astronomie, Tuerkenschanzstrasse 17, 1180 Wien, Oesterreich (Austria); De Zotti, G. [Universita di Padova, Dipto di Astronomia, Vicolo dell' Osservatorio 2, IT 35122, Padova (Italy); Hopwood, R., E-mail: rbussmann@cfa.harvard.edu [Department of Physics and Astronomy, Open University, Walton Hall, Milton Keynes, MK7 6AA (United Kingdom); and others

    2012-09-10

    We present high-spatial resolution imaging obtained with the Submillimeter Array (SMA) at 880 {mu}m and the Keck adaptive optics (AO) system at the K{sub S}-band of a gravitationally lensed submillimeter galaxy (SMG) at z = 4.243 discovered in the Herschel Astrophysical Terahertz Large Area Survey. The SMA data (angular resolution Almost-Equal-To 0.''6) resolve the dust emission into multiple lensed images, while the Keck AO K{sub S}-band data (angular resolution Almost-Equal-To 0.''1) resolve the lens into a pair of galaxies separated by 0.''3. We present an optical spectrum of the foreground lens obtained with the Gemini-South telescope that provides a lens redshift of z{sub lens} = 0.595 {+-} 0.005. We develop and apply a new lens modeling technique in the visibility plane that shows that the SMG is magnified by a factor of {mu} = 4.1 {+-} 0.2 and has an intrinsic infrared (IR) luminosity of L{sub IR} = (2.1 {+-} 0.2) Multiplication-Sign 10{sup 13} L{sub Sun }. We measure a half-light radius of the background source of r{sub s} = 4.4 {+-} 0.5 kpc which implies an IR luminosity surface density of {Sigma}{sub IR} (3.4 {+-} 0.9) Multiplication-Sign 10{sup 11} L{sub Sun} kpc{sup -2}, a value that is typical of z > 2 SMGs but significantly lower than IR luminous galaxies at z {approx} 0. The two lens galaxies are compact (r{sub lens} Almost-Equal-To 0.9 kpc) early-types with Einstein radii of {theta}{sub E1} 0.57 {+-} 0.01 and {theta}{sub E2} = 0.40 {+-} 0.01 that imply masses of M{sub lens1} = (7.4 {+-} 0.5) Multiplication-Sign 10{sup 10} M{sub Sun} and M{sub lens2} = (3.7 {+-} 0.3) Multiplication-Sign 10{sup 10} M{sub Sun }. The two lensing galaxies are likely about to undergo a dissipationless merger, and the mass and size of the resultant system should be similar to other early-type galaxies at z {approx} 0.6. This work highlights the importance of high spatial resolution imaging in developing models of strongly lensed galaxies

  19. Automated absolute activation analysis with californium-252 sources

    Energy Technology Data Exchange (ETDEWEB)

    MacMurdo, K.W.; Bowman, W.W.

    1978-09-01

    A 100-mg /sup 252/Cf neutron activation analysis facility is used routinely at the Savannah River Laboratory for multielement analysis of many solid and liquid samples. An absolute analysis technique converts counting data directly to elemental concentration without the use of classical comparative standards and flux monitors. With the totally automated pneumatic sample transfer system, cyclic irradiation-decay-count regimes can be pre-selected for up to 40 samples, and samples can be analyzed with the facility unattended. An automatic data control system starts and stops a high-resolution gamma-ray spectrometer and/or a delayed-neutron detector; the system also stores data and controls output modes. Gamma ray data are reduced by three main programs in the IBM 360/195 computer: the 4096-channel spectrum and pertinent experimental timing, counting, and sample data are stored on magnetic tape; the spectrum is then reduced to a list of significant photopeak energies, integrated areas, and their associated statistical errors; and the third program assigns gamma ray photopeaks to the appropriate neutron activation product(s) by comparing photopeak energies to tabulated gamma ray energies. Photopeak areas are then converted to elemental concentration by using experimental timing and sample data, calculated elemental neutron capture rates, absolute detector efficiencies, and absolute spectroscopic decay data. Calculational procedures have been developed so that fissile material can be analyzed by cyclic neutron activation and delayed-neutron counting procedures. These calculations are based on a 6 half-life group model of delayed neutron emission; calculations include corrections for delayed neutron interference from /sup 17/O. Detection sensitivities of < or = 400 ppB for natural uranium and 8 ppB (< or = 0.5 (nCi/g)) for /sup 239/Pu were demonstrated with 15-g samples at a throughput of up to 140 per day. Over 40 elements can be detected at the sub-ppM level.

  20. Metastable charge-transfer state of californium(iii) compounds.

    Science.gov (United States)

    Liu, Guokui; Cary, Samantha K; Albrecht-Schmitt, Thomas E

    2015-06-28

    Among a series of anomalous physical and chemical properties of Cf(iii) compounds revealed by recent investigations, the present work addresses the characteristics of the optical spectra of An(HDPA)3·H2O (An = Am, Cm, and Cf), especially the broadband photoluminescence from Cf(HDPA)3·H2O induced by ligand-to-metal charge transfer (CT). As a result of strong ion-ligand interactions and the relative ease of reducing Cf(iii) to Cf(ii), a CT transition occurs at low energy (transfer state undergoes radiative and non-radiative relaxations. Broadening of the CT transition arises from strong vibronic coupling and hole-charge interactions in the valence band. The non-radiative relaxation of the metastable CT state results from a competition between phonon-relaxation and thermal tunneling that populates the excited states of Cf(iii).

  1. Impaction grafting in the femur in cementless modular revision total hip arthroplasty: a descriptive outcome analysis of 243 cases with the MRP-TITAN revision implant

    Directory of Open Access Journals (Sweden)

    Wimmer Matthias D

    2013-01-01

    Full Text Available Abstract Background We present a descriptive and retrospective analysis of revision total hip arthroplasties (THA using the MRP-TITAN stem (Peter Brehm, Weisendorf, GER with distal diaphyseal fixation and metaphyseal defect augmentation. Our hypothesis was that the metaphyseal defect augmentation (Impaction Bone Grafting improves the stem survival. Methods We retrospectively analyzed the aggregated and anonymized data of 243 femoral stem revisions. 68 patients with 70 implants (28.8% received an allograft augmentation for metaphyseal defects; 165 patients with 173 implants (71.2% did not, and served as controls. The mean follow-up was 4.4 ± 1.8 years (range, 2.1–9.6 years. There were no significant differences (p > 0.05 between the study and control group regarding age, body mass index (BMI, femoral defects (types I-III as described by Paprosky, and preoperative Harris Hip Score (HHS. Postoperative clinical function was evaluated using the HHS. Postoperative radiologic examination evaluated implant stability, axial implant migration, signs of implant loosening, periprosthetic radiolucencies, as well as bone regeneration and resorption. Results There were comparable rates of intraoperative and postoperative complications in the study and control groups (p > 0.05. Clinical function, expressed as the increase in the postoperative HHS over the preoperative score, showed significantly greater improvement in the group with Impaction Bone Grafting (35.6 ± 14.3 vs. 30.8 ± 15.8; p ≤ 0.05. The study group showed better outcome especially for larger defects (types II C and III as described by Paprosky and stem diameters ≥ 17 mm. The two groups did not show significant differences in the rate of aseptic loosening (1.4% vs. 2.9% and the rate of revisions (8.6% vs. 11%. The Kaplan-Meier survival for the MRP-TITAN stem in both groups together was 93.8% after 8.8 years. [Study group 95.7% after 8.54 years ; control group 93

  2. The ancient mammalian KRAB zinc finger gene cluster on human chromosome 8q24.3 illustrates principles of C2H2 zinc finger evolution associated with unique expression profiles in human tissues

    Directory of Open Access Journals (Sweden)

    Ding Guohui

    2010-03-01

    Full Text Available Abstract Background Expansion of multi-C2H2 domain zinc finger (ZNF genes, including the Krüppel-associated box (KRAB subfamily, paralleled the evolution of tetrapodes, particularly in mammalian lineages. Advances in their cataloging and characterization suggest that the functions of the KRAB-ZNF gene family contributed to mammalian speciation. Results Here, we characterized the human 8q24.3 ZNF cluster on the genomic, the phylogenetic, the structural and the transcriptome level. Six (ZNF7, ZNF34, ZNF250, ZNF251, ZNF252, ZNF517 of the seven locus members contain exons encoding KRAB domains, one (ZNF16 does not. They form a paralog group in which the encoded KRAB and ZNF protein domains generally share more similarities with each other than with other members of the human ZNF superfamily. The closest relatives with respect to their DNA-binding domain were ZNF7 and ZNF251. The analysis of orthologs in therian mammalian species revealed strong conservation and purifying selection of the KRAB-A and zinc finger domains. These findings underscore structural/functional constraints during evolution. Gene losses in the murine lineage (ZNF16, ZNF34, ZNF252, ZNF517 and potential protein truncations in primates (ZNF252 illustrate ongoing speciation processes. Tissue expression profiling by quantitative real-time PCR showed similar but distinct patterns for all tested ZNF genes with the most prominent expression in fetal brain. Based on accompanying expression signatures in twenty-six other human tissues ZNF34 and ZNF250 revealed the closest expression profiles. Together, the 8q24.3 ZNF genes can be assigned to a cerebellum, a testis or a prostate/thyroid subgroup. These results are consistent with potential functions of the ZNF genes in morphogenesis and differentiation. Promoter regions of the seven 8q24.3 ZNF genes display common characteristics like missing TATA-box, CpG island-association and transcription factor binding site (TFBS modules. Common TFBS

  3. Soja transgênica BRS 243 RR: determinação de macronutrientes e das isoflavonas daidzeína e genisteína por Cromatografia Líquida de Alta Eficiência (CLAE Transgenic soybean BRS 243 RR: determination of macronutrients and isoflavones daidzein and genistein by High Performance Liquid Chromatography (HPLC

    Directory of Open Access Journals (Sweden)

    Marcela Roquim Alezandro

    2008-09-01

    Full Text Available Este trabalho teve por objetivo determinar a composição centesimal e o conteúdo de Daidzeína (D e Genisteína (G da cultivar BRS 243 RR por CLAE. O preparo da amostra para cromatografia envolveu a remoção da gordura com hexano . Os analitos foram extraídos com etanol 70% acrescido de 0,1% de ácido acético. As condições cromatográficas otimizadas foram: coluna C18, fase móvel metanol: ácido acético 5% (1:1 v/v, vazão 0,5 mL/minuto, temperatura da coluna 30 °C, volume de injeção 40 µL e leitura em 254 nm. Os parâmetros de validação avaliados foram: linearidade y = 11242 x -37433, r = 0,9976 (D e y = 18510 x -66761, r = 0,9980 (G; coeficientes de variação dos estudos de precisão intradia CV = 5,3% (D, CV = 6,7% (G e interdias CV = 8,7% (D, CV = 9,7% (G; limite de quantificação 10 µg.g-1; limite de detecção 5 µg.g-1 e recuperação 95,7%. Portanto, o método desenvolvido foi adequado para a determinação de daidzeína e genisteína em soja. Os níveis de carboidratos (31,4%, proteínas (35,9%, lipídios (20,9%, umidade (6,9%, cinzas (4,9%, daidzeína (44,1 µg.g-1 e genisteína (37,4 µg.g-1 determinados na soja transgênica foram similares aos de outros estudos com soja convencional.The objective of this work was to evaluate the proximate composition, as well as Daidzein (D and Genistein (G contents by HPLC, of BRS 243 RR soybean. Sample preparation for the chromatographic analysis involved the use of hexane to remove lipids. Isoflavones were extracted with 70% ethanol containing 0.1% acetic acid. The optimized chromatographic conditions were: C18 column, mobile phase methanol:5% acetic acid (1:1 v/v, flow rate 0.5 mL/minute, column temperature 30 °C, UV absorbance at 254 nm and volume injected 40 µL. The validation parameters were: linearity of daidzein (y = 11242 x -37433, r = 0.9976 and genistein (y = 18510 x -66761, r = 0.9980; variation coefficients obtained in intra-day precision assays [CV = 5.3% (D, CV = 6

  4. Measurement of the Neutron Capture Cross Sections of $^{233}$U, $^{237}$Np, $^{240,242}$Pu, $^{241,243}$Am and $^{245}$Cm with a Total Absorption Calorimeter at n_TOF

    CERN Multimedia

    Beer, H; Wiescher, M; Cox, J; Rapp, W; Embid, M; Dababneh, S

    2002-01-01

    Accurate and reliable neutron capture cross section data for actinides are necessary for the poper design, safety regulation and precise performance assessment of transmutation devices such as Fast Critical Reactors or Accelerator Driven Systems (ADS). The goal of this proposal is the measurement of the neutron capture cross sections of $^{233}$U, $^{237}$Np, $^{240,242}$Pu, $^{241,243}$Am and $^{245}$Cm at n_TOF with an accuracy of 5~\\%. $^{233}$U plays an essential role in the Th fuel cycle, which has been proposed as a safer and cleaner alternative to the U fuel cycle. The capture cross sections of $^{237}$Np,$^{240,242}$Pu, $^{241,243}$Am and $^{245}$Cm play a key role in the design and optimization of a strategy for the Nuclear Waste Transmutation. A high accuracy can be achieved at n_TOF in such measurements due to a combination of features unique in the world: high instantaneous neutron fluence and excellent energy resolution of the facility, innovative Data Acquisition System based on flash ADCs and t...

  5. Production of {sup 256}Lr in the {sup 249,250,251}Cf + {sup 11}B, {sup 243}Am + {sup 18}O, and {sup 248}Cm + {sup 14}N reactions

    Energy Technology Data Exchange (ETDEWEB)

    Sato, N.; Sato, T.K.; Asai, M. [Japan Atomic Energy Agency, Ibaraki (Japan). Advanced Science Research Center; and others

    2014-04-01

    Production cross-sections of the isotope {sup 256}Lr in the {sup 249,250,251}Cf + {sup 11}B, {sup 243}Am + {sup 18}O, and {sup 248}Cm + {sup 14}N reactions were measured using a He/KCl gas-jet transport system and a rotating wheel a-particle detection apparatus. The α-particle energy of {sup 256}Lr was distributed from 8.3 to 8.7 MeV and its half-life, T{sub 1/2}, was measured to be 28 ± 1 s. The maximum cross sections in the {sup 249}Cf({sup 11}B, 4n){sup 256}Lr and {sup 243}Am({sup 18}O, 5n){sup 256}Lr reactions were determined to be 122 ± 36 nb at the beam energy of 63 MeV and 26 ± 7 nb at 96 MeV, respectively. In the {sup 248}Cm({sup 14}N, 6n){sup 256}Lr reaction, the cross section was measured to be 27 ± 10 nb at 91 MeV. (orig.)

  6. Soja transgênica BRS 243 RR: determinação de macronutrientes e das isoflavonas daidzeína e genisteína por Cromatografia Líquida de Alta Eficiência (CLAE)

    OpenAIRE

    Alezandro, Marcela Roquim; de Almeida, Sandra Aparecida; Maia, Patrícia Penido; Carvalho, Helenice Aparecida de; Azevedo, Luciana; Vieira,Elisabeth Pizzamiglio

    2008-01-01

    Este trabalho teve por objetivo determinar a composição centesimal e o conteúdo de Daidzeína (D) e Genisteína (G) da cultivar BRS 243 RR por CLAE. O preparo da amostra para cromatografia envolveu a remoção da gordura com hexano . Os analitos foram extraídos com etanol 70% acrescido de 0,1% de ácido acético. As condições cromatográficas otimizadas foram: coluna C18, fase móvel metanol: ácido acético 5% (1:1 v/v), vazão 0,5 mL/minuto, temperatura da coluna 30 °C, volume de injeção 40 µL e leitu...

  7. CRISPR/Cas9-mediated simultaneous knockout of Dmrt1 and Dmrt3 does not recapitulate the 46,XY gonadal dysgenesis observed in 9p24.3 deletion patients

    Directory of Open Access Journals (Sweden)

    Masafumi Inui

    2017-03-01

    Full Text Available DM domain transcription factors play important roles in sexual development in a wide variety of species from invertebrate to humans. Among seven mammalian family members of DM domain transcription factors, DMRT1 has been studied in mouse and human for its conserved role in male gonadal identity. Chromosomal deletion of 9p24.3, the region in which DMRT1 is located, is associated with 46,XY gonadal dysgenesis. Dmrt1 knockout (KO mice also showed male-to-female gonadal reprogramming. However, the phenotype of Dmrt1 KO mouse appears only after birth while 46,XY gonadal dysgenesis occurs during the developmental phase, and the cause behind this difference remained unknown. We hypothesized that in human the function of other DMRT genes clustered with DMRT1, namely DMRT3, might also be impaired by the chromosomal deletion, which leads to the gonadal dysgenesis phenotype. Thus, simultaneous loss of multiple DM domain genes in mice could have a more severe impact on gonadal development. To address this issue, we generated double KO mice for Dmrt1 and Dmrt3 via the CRISPR/Cas9 system. Comparing adult and neonatal testes of single and double KO mice, we found that loss of Dmrt1 or Dmrt3, or both, does not have apparent effect on male gonadal formation during embryonic development. Our study demonstrated that the discrepancy between human with 9p24.3 deletion and Dmrt1 KO mouse could not be explained by the simultaneous loss of Dmrt3 gene. CRISPR/Cas9 is a versatile and straightforward approach to elucidate the questions that were otherwise difficult to address with conventional methods.

  8. Optimization of multi-residue method for targeted screening and quantitation of 243 pesticide residues in cardamom (Elettaria cardamomum) by gas chromatography tandem mass spectrometry (GC-MS/MS) analysis.

    Science.gov (United States)

    Ahammed Shabeer, T P; Girame, Rushali; Utture, Sagar; Oulkar, Dasharath; Banerjee, Kaushik; Ajay, D; Arimboor, Ranjith; Menon, K R K

    2018-02-01

    Higher matrix interference makes the multi-residue pesticide analysis in spices more challenging. A simple, sensitive, and robust large-scale multi-residue method was developed for the rapid analysis of 243 pesticides in cardamom matrix by gas chromatography tandem mass spectrometry (GC-MS/MS). Prehydration of cardamom in 1:4 sample:water for 30 min improved the homogeneity and extractability. QuEChERS extraction followed by cleanup with 25 mg primary secondary amine, 100 mg C18, and 10 mg graphitized carbon black to 1 ml supernatant was used for sample preparation. Reconstitution of final extract in ethyl acetate reduced matrix co-extract up to 60%. The method was validated according to the SANTE/11,945/2015 guidelines. The limit of quantification was ≤0.01 mg kg-1, and the recovery was within 70.0-120.0%, with ≤20% RSD for the majority of pesticides. The method was used for screening market samples, and the detected residues were devoid of any risk of acute toxicity related to dietary exposure. Copyright © 2017 Elsevier Ltd. All rights reserved.

  9. Rare hemoglobin variants: Hb G-Szuhu (HBB: c.243C>G), Hb G-Coushatta (HBB: c.68A>C) and Hb Mizuho (HBB: c.206T>C) in Sri Lankan families.

    Science.gov (United States)

    Perera, P Shiromi; Silva, Ishari; Hapugoda, Menaka; Wickramarathne, Merita N; Wijesiriwardena, Indira; Efremov, Dimitar G; Fisher, Christopher A; Weatherall, David J; Premawardhena, Anuja

    2015-01-01

    In this short communication, we describe the clinical presentation of unusual hemoglobin (Hb), variants in three Sri Lankan cases under study for β-thalassemia intermedia (β-TI). We believe this is the first report on their occurrence in Sri Lanka as well as from the Indian subcontinent. During a molecular study performed on β-TI patients, we identified three unusual Hb variants as Hb G-Szuhu (HBB: c.243C>G), Hb G-Coushatta (HBB: c.68A>C) and Hb Mizuho (HBB: c.206T>C) in three unrelated families. Hb G-Szuhu and Hb G-Coushatta were found in combination with the common β-thalassemia (β-thal) mutation, IVS-I-5 (G>C). Both probands had mild anemia with greatly reduced red cell indices and had non palpable livers and spleens, however, by ultrasound, both were observed to be enlarged. The final Hb variant, Hb Mizuho, was identified as a heterozygous mutation found in both proband and his mother. Both family members had severe anemia and were regularly transfused and had increased red cell parameters.

  10. Publications | Page 243 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Coral reefs in Thailand: planning for the future in a fragile paradise. Until the late 1960s, underwater ecosystems remained the exclusive domain of scientists such as Jacques Cousteau. But then technical improvements and safety regulations helped turn scuba diving into a recreational sport — and marine life has never ...

  11. Galileo photometry of asteroid 243 Ida

    Science.gov (United States)

    Helfenstein, P.; Veverka, J.; Thomas, P.C.; Simonelli, D.P.; Klaasen, K.; Johnson, T.V.; Fanale, F.; Granahan, J.; McEwen, A.S.; Belton, M.; Chapman, C.

    1996-01-01

    Galileo imaging observations over phase angles 19.5?? to 109.8?? are combined with near-opposition Earth-based data to derive the photometric properties of Ida. To first order these properties are uniform over the surface and well modeled at ?? = 0.55 ??m by Hapke parameters ????0 = 0.22, h = 0.020, B0 = 1.5, g = -0.33, and ?? = 18?? with corresponding geometric albedo p = 0.21??0.030.01 and Bond albedo AB = 0.081??0.0170.008. Ida's photometric properties are more similar to those of "average S-asteroids" (P. Helfenstein and J. Veverka 1989, Asteroids II, Univ. of Arizona Press, Tucson) than are those of 951 Gaspra. Two primary color units are identified on Ida: Terrain A exhibits a spectrum with relatively shallower 1-??m absorption and a relatively steeper red spectral slope than average Ida, while Terrain B has a deeper 1-??m absorption and a less steep red slope. The average photometric properties of Ida and Terrain A are similar while those of Terrain B differ mostly in having a slightly higher value of ????0 (0.22 versus 0.21), suggesting that Terrain B consists of slightly brighter, more transparent regolith particles. Galileo observations of Ida's satellite Dactyl over phase angles 19.5?? to 47.6?? suggest photometric characteristics similar to those of Ida, the major difference being Dactyl's slightly lower albedo (0.20 compared to 0.21). ?? 1990 Academic Press, Inc.

  12. 7 CFR 58.243 - Checking quality.

    Science.gov (United States)

    2010-01-01

    ... Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Standards, Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE (CONTINUED) REGULATIONS AND STANDARDS UNDER THE AGRICULTURAL MARKETING ACT OF 1946 AND THE EGG PRODUCTS INSPECTION ACT (CONTINUED) GRADING AND INSPECTION...

  13. Publications | Page 243 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    In the countries of the Northern Andes, there is a unique ecosystem that starts at 5,000, at the edge of the glaciers that cap the mountains, and runs down to about 3,600 m. The landscape of these high, treeless, plateaus — known as the... Protecting Mongolia's grassland steppes. Overgrazing and global climate changes, ...

  14. 15 CFR 24.3 - Definitions.

    Science.gov (United States)

    2010-01-01

    ..., insurance claims, and other benefit payments. Accrued income means the sum of: (1) Earnings during a given... this part: Accrued expenditures mean the charges incurred by the grantee during a given period... on an accrued expenditure basis, outlays are the sum of actual cash disbursements, the amount of...

  15. 243 MORPHOMETRIC CHARACTERISTICS OF THE FIBULAR ...

    African Journals Online (AJOL)

    Misiani

    In this regard, the FI and the distal fibula form an anatomical unit whose stability depends largely on the FI's morphometry. (Taser et al.,, 2009). Pertinent to this is thepopulational, inter-individual and sexual variability of osteometric dimensions. (Igbigbi, 2003). It would therefore be important to avail data on the morphometry.

  16. TMFunction data: 243 [TMFunction[Archive

    Lifescience Database Archive (English)

    Full Text Available istensen LL, Christensen PA, S?rensen ES, Jacobsen C, Moestrup SK, Etzerodt M, Thog... D958N ... YES Ligand binding(Ca binding) ... Low density lipoprotein receptor Homo sapiens Human Andersen OM, Chr

  17. 48 CFR 2152.243-70 - Changes.

    Science.gov (United States)

    2010-10-01

    ... be performed; (2) Time of performance (i.e., hours of the day, days of the week, etc.); (3) Place of performance of the services. (b) If any such change causes an increase or decrease in the cost of, or the time... EMPLOYEES GROUP LIFE INSURANCE FEDERAL ACQUISITION REGULATION CLAUSES AND FORMS PRECONTRACT PROVISIONS AND...

  18. 40 CFR 243.101 - Definitions.

    Science.gov (United States)

    2010-07-01

    ..., structure, land, or public work owned by or leased to the Federal Government. Ships at sea, aircraft in the... waste means solid wastes generated by educational, health care, correctional, and other institutional... significant pollutants in water resources, such as silt, dissolved materials in irrigation return flows or...

  19. Sialidosis type I carrying V217M/G243R mutations in lysosomal sialidase: an autopsy study demonstrating terminal sialic acid in lysosomal lamellar inclusions and cerebellar dysplasia.

    Science.gov (United States)

    Uchihara, Toshiki; Ohashi, Ken-ichi; Kitagawa, Masanobu; Kurata, Morito; Nakamura, Ayako; Hirokawa, Katsuiku; Kasuga, Tsutomu; Kobayashi, Takayoshi

    2010-01-01

    Autopsy findings of a patient, with sialidosis type I phenotype carrying V217M/G243R mutations in the lysosomal sialidase gene and biochemically defined isolated sialidase deficiency, who died of intractable lymphoma at the age of 32 years, are described. Perikaryal expansion of cytoplasm was evident, mostly in motor neurons (in the anterior horn and the brain stem), dorsal root ganglia, cerebellar dentate neurons and some neurons in the thalamus and nucleus basalis of Meynert. The stored material was lamellar in lysosomes and exhibited a specific affinity to wheat germ agglutinin at light and electron microscopy, which indicates the accumulation of terminal sialic acid at the non-reducing end of the sugar chain in this pathological structure. Neuronal loss in these nuclei, however, was not frequent in spite of frequent and massive cytoplasmic expansion. Neocortex exhibited a mild spongiosis with some swelling of neurons, which contained lipofuscin-like granules and small amount of lamellar structures in lysosomes. This contrast suggests a discrepancy between the storage process and vulnerability of neurons, both variable according to areas examined. In the cerebellar vermis, dysplastic features, such as abnormal layering of Purkinje cells, thinning and rarefaction of the granule cell layer, incomplete formation of synapse and disordered proliferation of Bergmann's glia, were focally accentuated, suggesting some developmental abnormality not secondary to the storage process. This is the first autopsy demonstration of sialic acid in the lamellar materials and of a developmental abnormality in isolated sialidase deficiency. Additional studies are needed to clarify how this molecular abnormality leads to these morphological and clinical manifestations.

  20. The gene for spinal cerebellar ataxia 3 (SCA3) is located in a region of {approximately} 3 cM on chromosome 14q24.3-q32.2

    Energy Technology Data Exchange (ETDEWEB)

    Stevanin, G.; Cancel, G.; Duerr, A.; Dubourg, O.; Agid, Y.; Brice, A. [Hopital de la Salpetriere, Paris (France); Chneiweiss, H.; Weissenbach, J.; Cann, H.M.

    1995-01-01

    SCA3, the gene for spinal cerebellar ataxia 3, was recently mapped to a 15-cM interval between D14S67 and D14S81 on chromosome 14q, by linkage analysis in two families of French ancestry. The SCA3 candidate region has now been refined by linkage analysis with four new microsatellite markers (D14S256, D14S291, D14S280, and AFM343vf1) in the same two families, in which 19 additional individuals were genotyped, and in a third French family. Combined two-point linkage analyses show that the new markers, D14S280 and AFM343vf1, are tightly linked to the SCA3 locus, with maximal lod scores, at recombination fraction, ({theta}) = .00, of 7.05 and 13.70, respectively. Combined multipoint and recombinant haplotype analyses localize the SCA3 locus to a 3-cM interval flanked by D14S291 and D14S81. The same allele for D14S280 segregates with the disease locus in the three kindreds. This allele is frequent in the French population, however, and linkage disequilibrium is not clearly established. The SCA3 locus remains within the 29-cM region on 14q24.3-q32.2 containing the gene for the Machado-Joseph disease, which is clinically related to the phenotype determined by SCA3, but it cannot yet be concluded that both diseases result from alterations of the same gene. 30 refs., 3 figs., 3 tabs.

  1. Neutron-induced fission cross section measurement of 233U, 241Am and 243Am in the energy range 0.5 MeV En 20 MeV at nTOF at CERN

    Energy Technology Data Exchange (ETDEWEB)

    Belloni, F. [Instituto Nazionale de Fisica Nucleare-Italy and CEA-France; Milazzo, P. M. [Instituto Nazionale de Fisica Nucleare, Trieste, Italy; Calviani, M. [Laboratori Nazionali di Legnaro, Italy and CERN, Geneva, Switzerland; Colonna, N. [Instituto Nazionale di Fisica Nucleare, Bari, Italy; Mastinu, P. F. [INFN, Laboratori Nazionali di Legnaro, Italy; Abbondanno, U. [Instituto Nazionale de Fisica Nucleare, Trieste, Italy; Aerts, G. [French Atomic Energy Commission (CEA), Centre de Saclay, Gif sur Yvette; Alvarez, H. [University of Santiago de Compostela, Spain; Alvarez-Velarde, F. [Centro de Investigaciones Energeticas Medioambientales y Technol., Madrid, Spain; Andriamonje, S. [French Atomic Energy Commission (CEA), Centre de Saclay, Gif sur Yvette; Andrzejewski, J. [University of Lodz, Lodz, Poland; Assimakopoulos, P. A. [University of Ioannina, Greece; Audouin, L. [Centre National de la Recherche Scidntifique/IN2P3-IPN, Orsay, France; Badurek, G. [Vienna University of Technology, Austria; Barbagallo, M. [Instituto Nazionale di Fisica Nucleare, Bari, Italy; Baumann, P. [CNRS, Strasbourg, France; Becvar, F. [Charles University, Prague, Czech Republic; Berthoumieux, E. [French Atomic Energy Commission (CEA), Centre de Saclay, Gif sur Yvette; Calvino, F. [Universidad Politecnica de Madrid, Spain; Cerutti, F. [CERN, Geneva, Switzerland; Cano-Ott, D. [CIEMAT, Spain; Capote, R. [IAEA-Vienna, Austria and Universidad de Sevilla, Spain; Carrapico, C. [Instituto Tecnológico e Nuclear (ITN), Lisbon, Portugal; Carrillo de Albornoz, A. [Instituto Tecnológico e Nuclear (ITN), Lisbon, Portugal; Cennini, P. [CERN, Geneva, Switzerland; Chepel, V. [University of Ciombra, Portugal; Chiaveri, E. [CERN, Geneva, Switzerland; Cortes, G. [Universitat Politecnica de Catalunya, Barcelona, Spain; Couture, A. [University of Notre Dame, IN; Cox, J. [University of Notre Dame, IN; Dahlfors, M. [CERN, Geneva, Switzerland; David, S. [CNRS, Orsay, France; Dillmann, I. [Institut fur Kernphysik, Karlsruhe, Germany; Dolfini, R. [Universita di Pavia, Italy; Domingo-Pardo, C. [CSIC-Universidad de Valencia; Koehler, Paul [ORNL; The n_TOF Collaboration, [CERN, Geneva, Switzerland

    2012-01-01

    Neutron-induced fission cross section measurements of 233U, 243Am and 241Am relative to 235U have been carried out at the neutron time-of-flight facility n TOF at CERN. A fast ionization chamber has been employed. All samples were located in the same detector; therefore the studied elements and the reference 235U target are subject to the same neutron beam.

  2. Comparative effects of oleoyl-estrone and a specific β3-adrenergic agonist (CL316, 243 on the expression of genes involved in energy metabolism of rat white adipose tissue

    Directory of Open Access Journals (Sweden)

    Alemany Marià

    2010-02-01

    Full Text Available Abstract Background The combination of oleoyl-estrone (OE and a selective β3-adrenergic agonist (B3A; CL316,243 treatment in rats results in a profound and rapid wasting of body reserves (lipid. Methods In the present study we investigated the effect of OE (oral gavage and/or B3A (subcutaneous constant infusion administration for 10 days to overweight male rats, compared with controls, on three distinct white adipose tissue (WAT sites: subcutaneous inguinal, retroperitoneal and epididymal. Tissue weight, DNA (and, from these values cellularity, cAMP content and the expression of several key energy handling metabolism and control genes were analyzed and computed in relation to the whole site mass. Results Both OE and B3A significantly decreased WAT mass, with no loss of DNA (cell numbers. OE decreased and B3A increased cAMP. Gene expression patterns were markedly different for OE and B3A. OE tended to decrease expression of most genes studied, with no changes (versus controls of lipolytic but decrease of lipogenic enzyme genes. The effects of B3A were widely different, with a generalized increase in the expression of most genes, including the adrenergic receptors, and, especially the uncoupling protein UCP1. Discussion OE and B3A, elicit widely different responses in WAT gene expression, end producing similar effects, such as shrinking of WAT, loss of fat, maintenance of cell numbers. OE acted essentially on the balance of lipolysis-lipogenesis and the blocking of the uptake of substrates; its decrease of synthesis favouring lipolysis. B3A induced a shotgun increase in the expression of most regulatory systems in the adipocyte, an effect that in the end favoured again the loss of lipid; this barely selective increase probably produces inefficiency, which coupled with the increase in UCP1 expression may help WAT to waste energy through thermogenesis. Conclusions There were considerable differences in the responses of the three WAT sites. OE in

  3. Crystal structure of Δ(185-243)ApoA-I suggests a mechanistic framework for the protein adaptation to the changing lipid load in good cholesterol: from flatland to sphereland via double belt, belt buckle, double hairpin and trefoil/tetrafoil.

    Science.gov (United States)

    Gursky, Olga

    2013-01-09

    Apolipoprotein A-I (apoA-I) is the major protein of plasma high-density lipoproteins (HDLs), macromolecular assemblies of proteins and lipids that remove cell cholesterol and protect against atherosclerosis. HDL heterogeneity, large size (7.7-12 nm), and ability to exchange proteins have prevented high-resolution structural analysis. Low-resolution studies showed that two apoA-I molecules form an antiparallel α-helical "double belt" around an HDL particle. The atomic-resolution structure of the C-terminal truncated lipid-free Δ(185-243)apoA-I, determined recently by Mei and Atkinson, provides unprecedented new insights into HDL structure-function. It allows us to propose a molecular mechanism for the adaptation of the full-length protein to increasing lipid load during cholesterol transport. ApoA-I conformations on small, midsize, and large HDLs are proposed based on the tandem α-helical repeats and the crystal structure of Δ(185-243)apoA-I and are validated by comparison with extensive biophysical data reported by many groups. In our models, the central half of the double belt ("constant" segment 66-184) is structurally conserved while the N- and C-terminal half ("variable" segments 1-65 and 185-243) rearranges upon HDL growth. This includes incremental unhinging of the N-terminal bundle around two flexible regions containing G39 and G65 to elongate the belt, along with concerted swing motion of the double belt around G65-P66 and G185-G186 hinges that are aligned on various-size particles, to confer two-dimensional surface curvature to spherical HDLs. The proposed conformational ensemble integrates and improves several existing HDL models. It helps provide a structural framework necessary to understand functional interactions with over 60 other HDL-associated proteins and, ultimately, improve the cardioprotective function of HDL. Copyright © 2012 Elsevier Ltd. All rights reserved.

  4. Crystal Structure of Δ(185–243)apoA-I Suggests a Mechanistic Framework for the Protein Adaptation to the Changing Lipid Load in Good Cholesterol: From Flatland to Sphereland via Double Belt, Belt-Buckle, Double Hairpin and Trefoil/Tetrafoil

    Science.gov (United States)

    Gursky, Olga

    2012-01-01

    ApoA-I is the major protein of plasma high-density lipoproteins (HDL), macromolecular assemblies of proteins and lipids that remove cell cholesterol and protect against atherosclerosis. HDL heterogeneity, large size (7.7–12 nm) and ability to exchange proteins have prevented high-resolution structural analysis. Low-resolution studies showed that two apoA-I molecules form an antiparallel α-helical “double belt” around an HDL particle. Atomic-resolution structure of the C-terminal truncated lipid-free Δ(185–243)apoA-I, determined recently by Mei and Atkinson, provides unprecedented new insights into HDL structure-function. It allows us to propose a molecular mechanism for the adaptation of the full-length protein to increasing lipid load during cholesterol transport. ApoA-I conformations on the small, mid-size and large HDL are proposed based on the tandem α-helical repeats and the crystal structure of Δ(185–243)apoA-I, and are validated by comparison with extensive biophysical data reported by many groups. In our models, the central half of the double belt (“constant” segment 66–184) is structurally conserved while the N- and C-terminal half (“variable” segments 1–65 and 185–243) re-arranges upon HDL growth. This includes incremental unhinging of the N-terminal bundle around two flexible regions containing G39 and G65 to elongate the belt, along with concerted swing motion of the double belt around G65-P66 and G185–G186 hinges that are aligned on various-size particles, to confer 2D surface curvature to spherical HDL. The proposed conformational ensemble integrates and improves several existing HDL models. It helps provide a structural framework necessary to understand functional interactions with over 60 other HDL-associated proteins and, ultimately, improve cardioprotective function of HDL. PMID:23041415

  5. Metal-ligand interaction of lanthanides with coumarin derivatives. Part I. Complexation of 3-(1-aminoethylidene)-2H-chromene-2,4(3H)-dione with La(III), Ce(III), Nd(III) and Ho(III).

    Science.gov (United States)

    Swiatek, Mirosława; Kufelnicki, Aleksander

    2012-01-01

    Solutions of lanthanum(III), cerium(III), neodymium(III) and holmium(III) nitrates with 3-(1-aminoethylidene)-2H-chromene-2,4(3H)-dione (1) in 10% v/v dioxane-water medium were used. Coordination modes of 1 with the selected lanthanides have been examined. Hydroxo-complexes with deprotonated water molecules from the inner coordination sphere have been stated in basic medium. Stability constants of the forming complex species were determined by potentiometric titrations using Superquad and Hyperquad2003 programs. The most stable complexes are formed with La(III). The UV-Vis spectra of the Nd(III)-1 system confirmed the L:M = 1:1 stoichiometry evaluated potentiometrically.

  6. Neutron Protection Factor Determination and Validation for a Vehicle Surrogate Using a Californium Fission Source

    Science.gov (United States)

    2017-06-01

    a 4 mm x 4 mm (0.157" x 0.157") LiI(Eu) crystal with 96% enrichment of lithium -6. The crystal is connected to a photomultiplier tube (PMT) which...32 Figure 17. Lithium -6 Iodide, Europium Doped Scintillation Detector. Source: [27...Alamos National Laboratory LiI(Eu) Lithium Iodide Europium Doped LLD Low Level Discriminator LLNL Lawrence Livermore National Laboratory MASH Monte

  7. Quality Circles: Implications for Training. Information Series No. 243.

    Science.gov (United States)

    Harshman, Carl L.

    This paper explores the background to and process of quality circles as well as the implications of circles for training. In the first section, the emergence and growth of quality circles in Japan and the United States are traced. Next, the theoretical and conceptual bases of quality circles are examined, while section 3 looks at implementation in…

  8. pmker 24(3)\\KIMULUNGUI BS.xps

    African Journals Online (AJOL)

    HP Pro 2000

    province sheds some light on both form of rot, with high prevalence of dry rot. The inventory of microorganisms found on the affected plants and tubers revealed the presence of ... lement il est considéré comme un des aliments hydrocarbonés de base de la plupart des peuplades des zones forestières (Best et Henry,. 1992).

  9. Dicty_cDB: SSD243 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available TRGGE STINEYPSAGVKIGNSLNLRKDGEFDLRIPIEANYSKNYSNHFENGVLTLTFKEEIEGLP DESCK*kky*knkk**innnlkk Translated...TRGGE STINEYPSAGVKIGNSLNLRKDGEFDLRIPIEANYSKNYSNHFENGVLTLTFKEEIEGLP DESCK*kky*knkk**innnlkk Homology vs

  10. Dicty_cDB: VFK243 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available YCESMTCIANKK*psn*iryc*trisrskcigsh*kdiql lw*mhynl*gsngictsfmlmwycfllqnysccckcrlrnwipr*gcc*ncrpncqrcch hviek*...TPIVRAMPNTAIQYCESMTCIANKK*psn*iryc*trisrskcigsh*kdiql lw*mhynl*gsngictsfmlmwycfllqnysccckcrlrnwipr*gcc*ncrpn

  11. Page 1 Modern computer assisted methods in metallurgy 243 Image ...

    Indian Academy of Sciences (India)

    - tion. Aspect ratio K1 luster index K2. Sulphides. Oxide types. Globular ... even for mixed oxide fields. Clearly this is a much more demanding protocol to implement and reproduction of human classification cannot be perfect. However, the.

  12. Dicty_cDB: AFO243 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available |AE008995.1 Agrobacterium tumefaciens strain C58 circular chromosome, section 21 of 256 of the complete...|AE007962.1 Agrobacterium tumefaciens strain C58 circular chromosome, section 20 of 254 of the complete

  13. 7 CFR 2.43 - Administrator, Foreign Agricultural Service.

    Science.gov (United States)

    2010-01-01

    ... other trade barriers. (3) Conduct studies of worldwide production, trade, marketing, prices, consumption... policies and administer programs and activities authorized by the Agricultural Trade Act of 1978, as... functions involving foreign agriculture policies and programs and their operations and activities in foreign...

  14. Dicty_cDB: CHL243 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 98286 |X98286.1 D.discoideum mRNA for P-type ATPase. 1489 0.0 1 CB980117 |CB980117.1 CAB70001_IaR_H03 Caberne...3 3', mRNA sequence. 44 0.009 2 CB979848 |CB979848.1 CAB70001_IIcF_H03 Cabernet Sauvignon Berry Post-Veraiso...n - CAB7 Vitis vinifera cDNA clone CAB70001_IIcF_H03 5', mRNA sequence. 44 0.011 2 CB980047 |CB980047.1 CAB70001_IaF_H03 Caberne

  15. 40 CFR Appendix to Part 243 - Recommended Bibliography

    Science.gov (United States)

    2010-07-01

    ... guide in solid waste management. Environmental Protection Publication SW-127. Washington, U.S. Government Printing Office, 1974. 3. Grupenhoff, B. L., and K. A. Shuster. Paper and plastic solid waste... Management Programs.) Analysis of fuel consumption for solid waste management. Unpublished data, January 1974...

  16. 49 CFR 199.243 - Referral, evaluation, and treatment.

    Science.gov (United States)

    2010-10-01

    ... affiliated with the operator. The choice of substance abuse professional and assignment of costs shall be... professional's private practice or to a person or organization from which the substance abuse professional... through— (1) A public agency, such as a State, county, or municipality; (2) The operator or a person under...

  17. G:\\PDF 24(3)\\MOKOSSESSE.xps

    African Journals Online (AJOL)

    HP Pro 2000

    2000. Soil-feeding biology, microbial association and digestive mechanisms. In Termites : Evolution, Sociality, Symbiose. Ecology. Eds. T. Abe, D. E. Bignell, M. Higashi. Kluwer. Academic Publishers, Dordrecht, pp 233 - 259. Date R. A., Grundon N. J., Rayment G. E. and M. E.. Probert. 1995. Plant-soil interactions at low.

  18. pmker 24(3)\\KIMULUNGUI BS.xps

    African Journals Online (AJOL)

    HP Pro 2000

    , le manioc a été rapidement connu et apprécié par les populations. Il a pris progressivement la place des divers féculents de cueillette ou de culture, à tel point qu'actuel- lement il est considéré comme un des aliments hydrocarbonés de base ...

  19. 25 CFR 700.243 - Action on initial requests.

    Science.gov (United States)

    2010-04-01

    ... sound grounds. (b) Form of grant. (1) When a requested record has been determined to be available, the... Executive order or supported by sound grounds. (2) A request to inspect or copy a record shall be denied only by the Freedom of Information Act Officer or by an official whom the Executive Director has in...

  20. Page 1 Intrinsic control of anaerobic digestion 243 Occasional ...

    Indian Academy of Sciences (India)

    Occasional measurements of gas chromatography were conducted to determine methane level. Gas was burnt in a gas burner regularly to determine the earliest time of gas burning. The temperature of the bioliquid (spot measurements) was also determined. 2.4a No special seeding measures were necessary: The run ...

  1. Dicty_cDB: CHE243 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ae genes during infection and propagation_sML Phytophthora sojae cDNA clone sML00...jae genes during infection and propagation_sZG Phytophthora sojae cDNA clone sZG001H24 5, mRNA sequence. 64 ...ojae genes during infection and propagation_sZS Phytophthora sojae cDNA clone sZS009J21 5, mRNA sequence. 64

  2. Dicty_cDB: SHB243 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available R103667 |CR103667.1 Forward strand read from insert in 3'HPRT insertion targeting and chromosome engineering... in 3'HPRT insertion targeting and chromosome engineering clone MHPP186g09. 50 0.13 1 dna update 2005.12.21

  3. Dicty_cDB: AFI243 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VEIFSEEKYPITKNKIDLK SNPTVETIYKFIRDIFKAEKLDSECAIMCLAYIERIITYTGITLSSINWRRIVLSALILA SKVWEDQSVWNVDFLPVFD...VEIFSEEKYPITKNKIDLK SNPTVETIYKFIRDIFKAEKLDSECAIMCLAYIERIITYTGITLSSINWRRIVLSALILA SKVWEDQSVWNVDFLPVFD

  4. Dicty_cDB: VSF243 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 4 2e-08 2 CB909775 |CB909775.1 USDA-FP_101518 Adult Alate Brown Citrus Aphid Toxo...786 |CD450786.1 USDA-FP_102764 Adult Alate Brown Citrus Aphid Toxoptera citricida cDNA clone WHWTC-38_B02 5'..., mRNA sequence. 54 4e-08 3 CD451804 |CD451804.1 USDA-FP_104110 Adult Alate Brown Citrus Aphid... USDA-FP_100421 Adult Alate Brown Citrus Aphid Toxoptera citricida cDNA clone WHWTC-06_E11 5', mRNA sequence... cds. 66 7e-07 1 CB909815 |CB909815.1 USDA-FP_101558 Adult Alate Brown Citrus Aphid Toxoptera citricida cDNA

  5. 26 CFR 1.243-5 - Effect of election.

    Science.gov (United States)

    2010-04-01

    ... not the amounts determined pursuant to the regulations under section 1502. (b) Multiple surtax... to consent) to an election under section 1562(a)(1), relating to election of multiple surtax...) of this paragraph apply with respect to the taxable year of an insurance company subject to taxation...

  6. 26 CFR 1.243-4 - Qualifying dividends.

    Science.gov (United States)

    2010-04-01

    ... (iii) An election under section 1562 (relating to the election of multiple surtax exmptions) was never... company subject to taxation under section 802 or 821 distributes a dividend out of earnings and profits of... of P and S. A multiple surtax exemption election under section 1562 is not effective for their 1965...

  7. Dicty_cDB: SLG243 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ... 48 0.40 1 ( EX969119 ) CAGO4353.rev CAGO Karenia brevis Karbr Stressed (... 4...8 0.40 1 ( EX968438 ) CAGO3969.fwd CAGO Karenia brevis Karbr Stressed (... 48 0.40 1 ( EX968437 ) CAGO3969.rev CAGO Karen...ia brevis Karbr Stressed (... 48 0.40 1 ( EX965930 ) CAGO2586.rev CAGO Karenia brevis Karbr Str

  8. 40 CFR 243.204-2 - Recommended procedures: Operations.

    Science.gov (United States)

    2010-07-01

    ... achieve the most efficient compaction. (3) Compactor trucks should be used to reduce the number of trips... commercial wastes which do not contain food wastes, storage capacity should be increased in lieu of more...

  9. All projects related to | Page 243 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    2013-05-31

    Tobacco Taxation, Smuggling, and Street Tobacco Vendors in Eritrea. Project. Eritrea has taken steps to control tobacco use. Start Date: May 31, 2013. End Date: March 31, 2015. Topic: SOCIAL PROBLEMS, SMOKING, CONTRABAND, WOMEN, CHILDREN, CONSUMER DEMAND, FINANCIAL POLICY, COST ANALYSIS.

  10. Page 1 Optimal irrigation planning 243 Table 16. Solution for ...

    Indian Academy of Sciences (India)

    October I 572.0. Pulses/Vegetables November–February I 108.7 CI = 1.73. Soybeans November–February I 463-3 II = 1.73. Diversion from Kabini reservoir. Rice June–November I 260-6. Ragi/jowar June–October I 617.4 CI = 2-0. Vegetables and.

  11. 48 CFR 52.243-7 - Notification of Changes.

    Science.gov (United States)

    2010-10-01

    ... conduct causes an increase or decrease in the Contractor's cost of, or the time required for, performance... employee involved in or knowledgeable about such conduct; (3) The identification of any documents and the... scheduled performance or delivery, the basis upon which it arose; (5) The particular elements of contract...

  12. 1935 15' Quad #243 Aerial Photo Mosaic Index

    Data.gov (United States)

    Earth Data Analysis Center, University of New Mexico — Aerial Photo Reference Mosaics contain aerial photographs that are retrievable on a frame by frame basis. The inventory contains imagery from various sources that...

  13. 243-IJBCS-Article-Dr Amadji Guillaume Lucien

    African Journals Online (AJOL)

    Dr Gatsing

    Recycling of organic residues in compost to improve coastal sandy soil properties and cabbage shoot ... Recycling of municipal organic waste in compost is a potential approach to addressing waste disposal problems and soil fertility management. .... metallic objects, battery and plastic were removed from the pile of the ...

  14. 14 CFR 243.15 - Conflict with foreign laws.

    Science.gov (United States)

    2010-01-01

    ... include copies of the pertinent foreign law, as well as a certified translation, and shall include opinions of appropriate legal experts setting forth the basis for the conclusion that collection would...

  15. 29 CFR 1910.243 - Guarding of portable powered tools.

    Science.gov (United States)

    2010-07-01

    ... than 2 inches, electric, hydraulic or pneumatic chain saws, and percussion tools without positive..., powered tampers, jack hammers, rock drills, garden appliances, household and kitchen appliances, personal...

  16. 48 CFR 1852.243-71 - Shared savings.

    Science.gov (United States)

    2010-10-01

    ... contractually related functions such as testing, operations, maintenance and logistics support. These costs also... Contractor and Government is encouraged. The communication may be in the form of a concept paper or...

  17. 19 CFR 10.243 - Articles eligible for preferential treatment.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Articles eligible for preferential treatment. 10...; DEPARTMENT OF THE TREASURY ARTICLES CONDITIONALLY FREE, SUBJECT TO A REDUCED RATE, ETC. Andean Trade Promotion and Drug Eradication Act Apparel and Other Textile Articles Under the Andean Trade Promotion and...

  18. Editorial: phys. stat. sol. (b) 243/1

    Science.gov (United States)

    Stutzmann, Martin

    2006-01-01

    Dear Colleagues and Friends,on behalf of the Publishers, the Editorial Office, and the Editors of physica status solidi we wish you all the best for the coming year 2006! It is our sincere hope that your personal and professional experience with our journal has been a positive one and that you will continue to choose physica status solidi for the publication of your scientific findings in solid state physics also in the future.In doing so, you will be in increasingly good company! As a matter of fact, 2005 has been a year of exceptional growth in the number of manuscripts submitted to physica status solidi . Thus, the number of Original Papers which have reached our Editorial Office in Berlin has increased by as much as 30% compared to the long term average over the last ten years. For the Rapid Research Letter section, the corresponding increase has been even more impressive: more than +100% just in the last two years. We view this development as a confirmation of our longstanding efforts to ensure a timely publication service of high scientific quality. One relevant indicator for the high scientific standards expected from articles which are submitted for publication in physica status solidi is the average acceptance rate, which currently is less than 40%. This rate has continuously decreased from a value of about 60% ten years ago and bears witness to our efforts to strive for quality rather than quantity.Also, physica status solidi has been able to continue its long tradition as a truly international journal, despite of the strong competition in an established field such as solid state physics. In 2005, submitted papers have originated almost equally from the Americas, Europe, and Asia, with a clearly growing contribution from China, India, and Japan. We are actively working together with our international Editorial Boards and the Regional Editors to maintain a reasonable balance among papers from different parts of the world. The increasing international visibility of physica status solidi is impressively documented by the ever rising numbers of article downloads via the internet: on the average, each of the 2000 articles published annually in physica status solidi is presently accessed about 100 times via the www.Finally, let me mention some other recent developments, which are not so directly visible from the outside. Thus, a new all electronic publishing system has become operative in our Berlin Editorial Office in 2005, which allows a more efficient and timely handling of manuscripts from submission to publication (www.manuscriptXpress.com) and is particularly valuable for the editing of conference proceedings (conferences.wiley-vch.de). In addition, the functionality of the journal within the Wiley InterScience website has been enhanced by new features such as Citation Tracking. Together with the ongoing digitization of all physica status solidi issues since the 1960s, which is expected to be complete in 2006, this makes the physica status solidi homepage at Wiley InterScience a very valuable tool for literature search in solid state physics, past and present. Try it out at www.interscience.wiley.com!All of us from physica status solidi would like to convey to you our very best wishes for good health and success in the coming year 2006!

  19. 29 CFR 1952.243 - Final approval determination.

    Science.gov (United States)

    2010-07-01

    ... Lisburne Long Range Missile Base, Point Lay Short Range Missile Base, Eareckson Air Station on Shemya Island, Fort Greeley Missile Defense in Delta Junction, the U.S. Coast Guard Integrated Support Commands...

  20. 9 CFR 354.243 - Operations and procedures.

    Science.gov (United States)

    2010-01-01

    ... handling equipment shall wear clean garments and should wear caps or hair nets, and shall keep their hands... accord with clean and sanitary methods. (a) There shall be no handling or storing of materials which... carcass shall be passed through a system of sprays providing an abundant supply of fresh clean water. (d...

  1. 40 CFR 243.200-2 - Recommended procedures: Design.

    Science.gov (United States)

    2010-07-01

    ... projections or rough seams which would make it difficult to clean or interfere with its emptying. The exterior... absorb water, grease, or oil. The containers should be leakproof, including sides, seams, and bottoms... containers and which is maintained in a clean, spillage-free condition. (1) Reusable waste containers which...

  2. Dicty_cDB: SHF243 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Roco11 (roco11) gene, complete cds. 62 2e-09 3 DT250713 |DT250713.1 JGI_CAAU4411.rev CAAU Pimephales promelas... brain 7-8 month adults, males and females pooled (L) Pimephales promelas cDNA

  3. Preface: phys. stat. sol. (b) 243/5

    Science.gov (United States)

    Artacho, Emilio; Beck, Thomas L.; Hernández, Eduardo

    Between 20 and 24 June 2005 the Centre Européen de Calcul Atomique et Moléculaire - or CECAM, as it is more widely known - hosted a workshop entitled State-of-the-art, developments and perspectives of real-space electronic structure methods in condensed-matter and chemical physics, organized with the support of CECAM itself and the ?k network. The workshop was attended by some forty participants coming from fifteen countries, and about thirty presentations were given. The workshop provided a lively forum for the discussion of recent methodological developments in electronic structure calculations, ranging from linear-scaling methods, mesh techniques, time-dependent density functional methods, and a long etcetera, which had been our ultimate objective when undertaking its organization.The first-principles simulation of solids, liquids and complex matter in general has jumped in the last few years from the relatively confined niches in condensed matter and materials physics and in quantum chemistry, to cover most of the sciences, including nano, bio, geo, environmental sciences and engineering. This effect has been propitiated by the ability of simulation techniques to deal with an ever larger degree of complexity. Although this is partially to be attributed to the steady increase in computer power, the main factor behind this change has been the coming of age of the main theoretical framework for most of the simulations performed today, together with an extremely active development of the basic algorithms for its computer implementation. It is this latter aspect that is the topic of this special issue of physica status solidi.There is a relentless effort in the scientific community seeking to achieve not only higher accuracy, but also more efficient, cost-effective and if possible simpler computational methods in electronic structure calculations [1]. From the early 1990s onwards there has been a keen interest in the computational condensed matter and chemical physics communities in methods that had the potential to overcome the unfavourable scaling of the computational cost with the system size, implicit in the momentum-space formalism familiar to solid-state physicists and the quantum chemistry approaches more common in chemical physics and physical chemistry. This interest was sparkled by the famous paper in which Weitao Yang [2] introduced the Divide and Conquer method. Soon afterwards several practical schemes aiming to achieve linear-scaling calculations, by exploiting what Walter Kohn called most aptly the near-sightedness of quantum mechanics [3], were proposed and explored (for a review on linear-scaling methods, see [4]). This search for novel, more efficient and better scaling algorithms proved to be fruitful in more than one way. Not only was it the start of several packages which are well-known today (such as Siesta, Conquest, etc.), but it also leads to new ways of representing electronic states and orbitals, such as grids [5, 6], wavelets [7], finite elements, etc. Also, the drive to exploit near-sightedness attracted computational solid state physicists to the type of atomic-like basis functions traditionally used in the quantum chemistry community. At the same time computational chemists learnt about plane waves and density functional theory, and thus a fruitful dialogue was started between two communities that hitherto had not had much contact.Another interesting development that has begun to take place over the last decade or so is the convergence of several branches of science, notably physics, chemistry and biology, at the nanoscale. Experimentalists in all these different fields are now performing highly sophisticated measurements on systems of nanometer size, the kind of systems that us theoreticians can address with our computational methods, and this convergence of experiment and theory at this scale has also been very fruitful, particularly in the fields of electronic transport and STM image simulation. It is now quite common to find papers at the cutting edge of nanoscience and nanotechnology co-authored by experimentalists and theorists, and it can only be expected that this fruitful interplay between theory and experiment will increase in the future.It was considerations such as these that moved us to propose to CECAM and ?k the celebration of a workshop devoted to the discussion of recent developments in electronic structure techniques, a proposal that was enthusiastically received, not just by CECAM and ?k, but also by our invited speakers and participants. Interest in novel electronic structure methods is now as high as ever, and we are therefore very happy that physica status solidi has given us the opportunity to devote a special issue to the topics covered in the workshop. This special issue of physica status solidi gathers invited contributions from several attendants to the workshop, contributions that are representative of the range of topics and issues discussed then, including progress in linear scaling methods, electronic transport, simulation of STM images, time-dependent DFT methods, etc. It rests for us to thank all the contributors to this special issue for their efforts, CECAM and ?k for funding the workshop, physica status solidi for agreeing to devote this special issue to the workshop, and last but not least Emmanuelle and Emilie, the CECAM secretaries, for their invaluable practical help in putting this workshop together

  4. 75 FR 68698 - Airworthiness Directives; Airbus Model A330-201, -202, -203, -223, -223F, -243, and -243F...

    Science.gov (United States)

    2010-11-09

    ... aviation product. The MCAI describes the unsafe condition as: * * * * * Investigation conducted by Thales... conducted by Thales on the removed probes revealed oil residue between the stator and the rotor parts of the... inspection of the Thales Avionics AoA probe P/N [part number] C16291AA in order to identify the suspect parts...

  5. A retrospective study of californium-252 neutron brachytherapy combined with EBRT versus 3D-CRT in the treatment of esophageal squamous cell cancer.

    Science.gov (United States)

    Wang, Qifeng; Li, Tao; Lang, Jinyi; Wang, Jie; Wang, Jian; Liu, Huiming; Jia, Xitang; Liu, Bo; Wang, C-K Chris

    2015-10-24

    We conducted a retrospective analysis on 884 patients who were diagnosed with esophageal squamous cell carcinoma (ESCC) and treated with either the neutron brachytherapy in combination with external beam radiotherapy (NBT + EBRT) or 3-dimensional conformal radiation therapy (3D-CRT) to determine the differences in efficacy and morbidity between the two treatment groups. The 884 ESCC patients treated with either NBT + EBRT or 3D-CRT between 2002 and 2012 were retrospectively reviewed and analyzed. Multivariable Cox regression was used to compare oncologic outcomes of the two groups of patients in the context of other clinically relevant variables. The acute and chronic toxicities associated with the two groups were compared using Fisher exact and log-rank tests, respectively. Among the 884 patients, 545 received NBT + EBRT and 339 received 3D-CRT (i.e. EBRT-only). The age range is 39-95 years (median 66). The follow-up time range is 3-145 months (median 32). The analysis shows that the NBT + EBRT group has higher overall survival rate and local control rate than that of the 3D-CRT group. The acute toxicity effects were acceptable for both groups of patients with the NBT + EBRT group showing higher rates of leukopenia and thrombocytopenia and the 3D-CRT group showing higher rates on fistula and massive bleeding. The patients treated with NBT + EBRT showed better oncologic outcomes than those treated with 3D-CRT. The toxicity effects were acceptable for both groups with the NBT + EBRT group showing higher rates on the acute effects and the 3D-CRT group showing higher rates on the late effects.

  6. Accurate determination of Curium and Californium isotopic ratios by inductively coupled plasma quadrupole mass spectrometry (ICP-QMS) in 248Cm samples for transmutation studies

    Energy Technology Data Exchange (ETDEWEB)

    Gourgiotis, A.; Isnard, H.; Aubert, M.; Dupont, E.; AlMahamid, I.; Cassette, P.; Panebianco, S.; Letourneau, A.; Chartier, F.; Tian, G.; Rao, L.; Lukens, W.

    2011-02-01

    The French Atomic Energy Commission has carried out several experiments including the mini-INCA (INcineration of Actinides) project for the study of minor-actinide transmutation processes in high intensity thermal neutron fluxes, in view of proposing solutions to reduce the radiotoxicity of long-lived nuclear wastes. In this context, a Cm sample enriched in {sup 248}Cm ({approx}97 %) was irradiated in thermal neutron flux at the High Flux Reactor (HFR) of the Laue-Langevin Institute (ILL). This work describes a quadrupole ICP-MS (ICP-QMS) analytical procedure for precise and accurate isotopic composition determination of Cm before sample irradiation and of Cm and Cf after sample irradiation. The factors that affect the accuracy and reproducibility of isotopic ratio measurements by ICP-QMS, such as peak centre correction, detector dead time, mass bias, abundance sensitivity and hydrides formation, instrumental background, and memory blank were carefully evaluated and corrected. Uncertainties of the isotopic ratios, taking into account internal precision of isotope ratio measurements, peak tailing, and hydrides formations ranged from 0.3% to 1.3%. This uncertainties range is quite acceptable for the nuclear data to be used in transmutation studies.

  7. Radiological Characterization Technical Report on Californium-252 Sealed Source Transuranic Debris Waste for the Off-Site Source Recovery Project at Los Alamos National Laboratory

    Energy Technology Data Exchange (ETDEWEB)

    Feldman, Alexander [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2014-04-24

    This document describes the development and approach for the radiological characterization of Cf-252 sealed sources for shipment to the Waste Isolation Pilot Plant. The report combines information on the nuclear material content of each individual source (mass or activity and date of manufacture) with information and data on the radionuclide distributions within the originating nuclear material. This approach allows for complete and accurate characterization of the waste container without the need to take additional measurements. The radionuclide uncertainties, developed from acceptable knowledge (AK) information regarding the source material, are applied to the summed activities in the drum. The AK information used in the characterization of Cf-252 sealed sources has been qualified by the peer review process, which has been reviewed and accepted by the Environmental Protection Agency.

  8. Archaeological Investigations at Sites 45-DO-242 and 45-DO-243, Chief Joseph Dam Project, Washington.

    Science.gov (United States)

    1984-01-01

    242 - NISP=2) Ranidae/ Bufonidae (frogs and toads) 45-D0-242 -- 2 elements. Both frogs and toads Inhabit the project area (Stebbins 1966). Inadequate...Chelydridae Chrysemys pJa Zone 11: 1 shell fragment. Zone 13: 53 shell fragments. Fmllly Ranldae/ Bufonidae Zone 14: 1 skull fragment, I tibia. Failly

  9. 77 FR 49822 - Agency Information Collection Activities: Application for Removal, Form I-243; Revision of a...

    Science.gov (United States)

    2012-08-17

    ... via the Federal eRulemaking Portal Web site at http://www.Regulations.gov under e-Docket ID number... Portal site at: http://www.regulations.gov. We may also be contacted at: USCIS, Office of Policy and... Federal eRulemaking Portal at http://www.regulations.gov, and will include any personal information you...

  10. The Direction of the North Pole and the Control Network of Asteroid 243 Ida

    Science.gov (United States)

    Davies, Merton E.; Colvin, Tim R.; Belton, Michael J. S.; Veverka, Joseph; Thomas, Peter C.

    1996-03-01

    A control network containing 64 points identified on Galileo images obtained during the August 1993 flyby was used to determine the direction of Ida's north pole. We find the right ascension and declination (in J2000 coordinates) to be α0= 348.76° ± 7.5°, δ0= 87.10° ± 0.4°. This result agrees reasonably well with earlier determinations from groundbased observations of Ida's lightcurve. We confirm that the rotation is retrograde, but we lack the time base to improve the rotation period of 0.1930680 days determined from lightcurve analysis (Binzel, R. P., S. M. Sivan, P. Magnusson, W. Z. Wisniewski, J. Drummond, K. Lumme, M. A. Barucci, E. Dotto, C. Angeli, D. Lazzaro, S. Mottola, M. Gonano-Beurer, T. Michalowski, G. De Angelis, D. J. Tholen, M. Di Martino, M. Hoffmann, E. H. Geyer, and F. Velichko 1993.Icarus105, 310-325).

  11. 243 The Challenges of Theatre Workshop in Katsina-Ala and Oju ...

    African Journals Online (AJOL)

    USER

    who are expected to teach drama, music and creative art courses at the primary and post primary school level is ... integrated manipulation of various forms of art such as music, mime, poetry, dance, painting and symbols which are .... concentration and keeping the body fit for any action. In carrying out theatre workshop for ...

  12. SU-F-T-243: Major Risks in Radiotherapy. A Review Based On Risk Analysis Literature

    Energy Technology Data Exchange (ETDEWEB)

    López-Tarjuelo, J; Guasp-Tortajada, M; Iglesias-Montenegro, N; Monasor-Denia, P [Servicio de Radiofísica y Protección Radiológica, Consorcio Hospitalario Provincial de Castellón, Castellón de la Plana, España/Spain (Spain); Bouché-Babiloni, A; Morillo-Macías, V; Ferrer-Albiach, C [Servicio de Oncología Radioterápica, Consorcio Hospitalario Provincial de Castellón, Castellón de la Plana, España/Spain (Spain)

    2016-06-15

    Purpose: We present a literature review of risk analyses in radiotherapy to highlight the most reported risks and facilitate the spread of this valuable information so that professionals can be aware of these major threats before performing their own studies. Methods: We considered studies with at least an estimation of the probability of occurrence of an adverse event (O) and its associated severity (S). They cover external beam radiotherapy, brachytherapy, intraoperative radiotherapy, and stereotactic techniques. We selected only the works containing a detailed ranked series of elements or failure modes and focused on the first fully reported quartile as much. Afterward, we sorted the risk elements according to a regular radiotherapy procedure so that the resulting groups were cited in several works and be ranked in this way. Results: 29 references published between 2007 and February 2016 were studied. Publication trend has been generally rising. The most employed analysis has been the Failure mode and effect analysis (FMEA). Among references, we selected 20 works listing 258 ranked risk elements. They were sorted into 31 groups appearing at least in two different works. 11 groups appeared in at least 5 references and 5 groups did it in 7 or more papers. These last sets of risks where choosing another set of images or plan for planning or treating, errors related with contours, errors in patient positioning for treatment, human mistakes when programming treatments, and planning errors. Conclusion: There is a sufficient amount and variety of references for identifying which failure modes or elements should be addressed in a radiotherapy department before attempting a specific analysis. FMEA prevailed, but other studies such as “risk matrix” or “occurrence × severity” analyses can also lead professionals’ efforts. Risk associated with human actions ranks very high; therefore, they should be automated or at least peer-reviewed.

  13. Electrochemical oxidation of 243Am(III) in nitric acid by a terpyridyl-derivatized electrode

    Energy Technology Data Exchange (ETDEWEB)

    Dares, C. J.; Lapides, A. M.; Mincher, B. J.; Meyer, T. J.

    2015-11-05

    A high surface area, tin-doped indium oxide electrode surface-derivatized with a terpyridine ligand has been applied to the oxidation of trivalent americium to Am(V) and Am(VI) in nitric acid. Potentials as low as 1.8 V vs. the saturated calomel electrode are used, 0.7 V lower than the 2.6 V potential for one-electron oxidation of Am(III) to Am(IV) in 1 M acid. This simple electrochemical procedure provides, for the first time, a method for accessing the higher oxidation states of Am in non-complexing media for developing the coordination chemistries of Am(V) and Am(VI) and, more importantly, for separation of americium from nuclear waste streams.

  14. 20 CFR 702.243 - Settlement application; how submitted, how approved, how disapproved, criteria.

    Science.gov (United States)

    2010-04-01

    ... yield equivalent (as determined by the Secretary of the Treasury) of the average accepted auction price... limited to: (1) The claimant's age, education and work history; (2) The degree of the claimant's...

  15. 243 The Challenges of Theatre Workshop in Katsina-Ala and Oju ...

    African Journals Online (AJOL)

    USER

    our contemporary society since it mirrors human emotions, ... people working together in order to communicate ideas and also explore social issues to help people respond to various situations affecting them. Be that as it may, it demands discipline and ... who are expected to teach drama, music and creative art courses at.

  16. : tous les projets | Page 243 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Des normes de propriété intellectuelle strictes et leur application plus musclée poussent les fournisseurs de produits médiatiques et les fabricants de médicaments à fixer des prix hors de la portée de presque tous les segments de la population, mis à part les plus riches. Date de début : 12 mai 2011. End Date: 12 mai 2012.

  17. 25 CFR 243.2 - What terms do I need to know?

    Science.gov (United States)

    2010-04-01

    ... the Treaty of Cession of Alaska to the United States and their descendants currently living in Alaska... organization, by any method. We, us and our mean the Regional Director or the Director's designee. ...

  18. Options in Education. Paying for College, Parts One and Two, Program Nos. 242-243.

    Science.gov (United States)

    George Washington Univ., Washington, DC. Inst. for Educational Leadership.

    Scripts of public radio programs on the subject of paying for college are presented. They deal with various kinds of students and student financial aid, including work-study programs, state aid, Basic Grants, etc. The scripts are as follows: "Students Who Work and Go To College;""Student (Myra Burns) Describes Struggle to Pay for College;""Student…

  19. 40 CFR 158.243 - Experimental use permit data requirements for terrestrial and aquatic nontarget organisms.

    Science.gov (United States)

    2010-07-01

    ... either one waterfowl species or one upland game bird species for terrestrial, aquatic, forestry, and... greenhouse uses. 4. Data are required on waterfowl and upland game bird species. 5. Data are required on one... indoor and greenhouse uses, testing with only one of either fish species is required. 6. EP or TEP...

  20. Modified Berlekamp—Massey algorithm 243 of examples illustrate ...

    Indian Academy of Sciences (India)

    white noise' sequence. 2. Modified recursive form of the Berlekamp-Massey algorithm. We are here interested in modelling data as the impulse response of a discrete linear. filter, the objective being to obtain a minimal representation by such a ...

  1. Page 1 Anthraquinone and Anthrome Series—V/ 243 unless the ...

    Indian Academy of Sciences (India)

    therefore forms an alkali-soluble leuco compound on reduction, and when a benzamido group is present in the molecule, the affinity of the leuco compound for cellulose becomes adequate for dyeing purposes.” Strong absorption in the region 3600–4000 A has been considered to be concerned in the photochemical activity ...

  2. 76 FR 13075 - Airworthiness Directives; Airbus Model A330-243F Airplanes

    Science.gov (United States)

    2011-03-10

    ... not been performed in production through the modification 200801, and --Prohibit the dispatch with... dispatch prohibition. You may obtain further information by examining the MCAI in the AD docket. FAA's... regulatory, economic, ] environmental, and energy aspects of this AD. We will consider all comments received...

  3. 48 CFR 1652.243-70 - Changes-Negotiated benefits contracts.

    Science.gov (United States)

    2010-10-01

    ... increase or decrease in the cost of, or the time required for, performance of any part of the work under... MANAGEMENT FEDERAL EMPLOYEES HEALTH BENEFITS ACQUISITION REGULATION CLAUSES AND FORMS CONTRACT CLAUSES Texts... following: (1) Description of services to be performed. (2) Time of performance (i.e., hours of the day...

  4. U.S.-Mexico Defense Relations: An Incompatible Interface. (Strategic Forum, Number 243, July 2009)

    Science.gov (United States)

    2009-07-01

    funding and/or train- ing for the Mexican military would generate uproar among constituencies of labor , bor- der protection, human rights, and others...obsole- tos, advierte el general Galván,” La Jornada , October 10, 2007. 20 There are almost as many models as countries in the region, with four led

  5. 243 Caractérisation floristique et analyse des formes de pression ...

    African Journals Online (AJOL)

    Afrique Sciences

    ménages et les personnes ont été choisis sur la base des critères de proximité avec les forêts sacrées ou communautaires, utilisation des ressources de la forêt, quant aux critères de choix des chefs coutuniers et autorités ..... Les techniques de prélèvement d'organe sont rudimentaires et n'assurent pas une durabilité pour.

  6. Paul Newman. A Hausa–English Dictionary. 2007, x + 243 pp. ISBN ...

    African Journals Online (AJOL)

    rbr

    Hausa has also had the benefit of more than a dozen other dictionaries, including Abraham (1962), Newman ... misms, often Arabic-based, to speak about sex and related bodily functions, so it is useful that these are .... number of native speakers do not seem to be familiar with them, let alone use them. The following is an ...

  7. Support for a bipolar affective disorder susceptibility locus on chromosome 12q24.3

    DEFF Research Database (Denmark)

    Buttenschøn, Henriette Nørmølle; Foldager, Leslie; Zacharov, Tracey Flint

    2010-01-01

    Linkage and association studies of bipolar affective disorder (BAD) point out chromosome 12q24 as a region of interest.......Linkage and association studies of bipolar affective disorder (BAD) point out chromosome 12q24 as a region of interest....

  8. Fission Meter Information Barrier Attribute Measurement System - NA-243 FNI/UKC FY2017 Task 1-2 Report

    Energy Technology Data Exchange (ETDEWEB)

    Kerr, P. L. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Decman, D. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Prasad, M. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Castro, P. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

    2018-01-03

    An SNM attribute Information Barrier (IB) system was developed for a 2011 US/UK Exercise. The system was modified and extensively tested in a 2013-2014 US-UK Measurement Campaign. This work demonstrated rapid deployment of an IB system for potential treaty use. The system utilizes an Ortec Fission Meter neutron multiplicity counter and custom computer code. The system demonstrates a proof-of-principle automated Pu-240 mass determination with an information barrier. After a software start command is issued, the system automatically acquires and downloads data, performs an analysis, and displays the results. This system conveys the results of a Pu mass threshold measurements in a way the does not reveal sensitive information. In full IB mode, only the pass/fail result is displayed as a “Mass <= Threshold Amount” or “Mass >= Threshold Amount” as shown in Figure 4. This can easily be adapted to a red/green “lights” display similar to the Detective IB system for Pu isotopics as shown in Figure 6. In test mode, more detailed information is displayed. The code can also read in, analyze, and display results from previously acquired or simulated data. Because the equipment is commercial-off-the-shelf (COTS), the system demonstrates a low-cost short-lead-time technology for treaty SNM attribute measurements. A deployed system will likely require integration of additional authentication and tamper-indicating technologies. This will be discussed for the project in this and future progress reports.

  9. Angelman syndrome associated with an inversion of chromosome 15q11.2q24.3

    Energy Technology Data Exchange (ETDEWEB)

    Greger, V.; Knoll, J.H.M.; Wagstaff, J.; Lalande, M. [and others

    1997-03-01

    Angelman syndrome (AS) most frequently results from large ({ge}5 Mb) de novo deletions of chromosome 15q11-q13. The deletions are exclusively of maternal origin, and a few cases of paternal uniparental disomy of chromosome 15 have been reported. The latter finding indicates that AS is caused by the absence of a maternal contribution to the imprinted 15q11-q13 region. Failure to inherit a paternal 15q11-q13 contribution results in the clinically distinct disorder of Prader-Willi syndrome. Cases of AS resulting from translocations or pericentric inversions have been observed to be associated with deletions, and there have been no confirmed reports of balanced rearrangements in AS. We report the first such case involving a paracentric inversion with a breakpoint located {approximately}25 kb proximal to the reference marker D15S10. This inversion has been inherited from a phenotypically normal mother. No deletion is evident by molecular analysis in this case, by use of cloned fragments mapped to within {approximately}1 kb of the inversion breakpoint. Several hypotheses are discussed to explain the relationship between the inversion and the AS phenotype. 47 refs., 3 figs.

  10. Treatment of cryptorchidism with human chorionic gonadotropin or gonadotropin releasing hormone. A double-blind controlled study of 243 boys

    DEFF Research Database (Denmark)

    Christiansen, P; Müller, J; Buhl, S

    1988-01-01

    We have conducted a modified double-blind study on the effect of human chorionic gonadotropin (hCG), gonadotropin releasing hormone (GnRH) and placebo on bilateral and unilateral maldescended testes. One hundred and fifty-five boys with bilateral and 88 boys with unilateral cryptorchidism fulfilled...... the inclusion criteria and completed the treatment protocol. The boys were between 1 and 13 years of age. hCG was administered as intramuscular injections twice weekly for 3 weeks. GnRH and placebo were given intranasally. hCG was superior to GnRH and placebo in the treatment of bilateral maldescended testes (p...... = 0.0009). Both testes descended in 25% of the boys following treatment with hCG, and improvement in the position of the testes was obtained in a further 25% of the cases. hCG administration resulted in complete testicular descent in 14% of boys with unilateral cryptorchidism compared with 3 and 0...

  11. 75 FR 4477 - Airworthiness Directives; Airbus Model A330-201, -202, -203, -223, -243, -301, -302, -303, -321...

    Science.gov (United States)

    2010-01-28

    ... and, in case deformation or damage is detected, to apply the associated repair. The one-time...-time detailed inspections of both main landing gear bogie beams in the region of the bogie stop pad for...], the bogie stop pad was found deformed and cracked. Upon removal of the bogie stop pad for replacement...

  12. 75 FR 60655 - Airworthiness Directives; Airbus Model A330-201, -202, -203, -223, and -243 Airplanes; Airbus...

    Science.gov (United States)

    2010-10-01

    ... National Aviation Authorities (NAA) the application of a similar regulation. The aim of this regulation is to require * * * a definition review against explosion hazards. * * * * * Failure of the auxiliary... explosion and consequent loss of the airplane. The proposed AD would require actions that are intended to...

  13. 76 FR 432 - Airworthiness Directives; Airbus Model A330-201, -202, -203, -223, and -243 Airplanes; Airbus...

    Science.gov (United States)

    2011-01-05

    ... Authorities (NAA) the application of a similar regulation. The aim of this regulation is to require * * * a definition review against explosion hazards. * * * * * Failure of the auxiliary power unit (APU) bleed leak... of the fuel vapors in that tank, which could result in a fuel tank explosion and consequent loss of...

  14. 75 FR 9809 - Airworthiness Directives; Airbus Model A330-243, -341, -342, and -343 Airplanes; and Model A340...

    Science.gov (United States)

    2010-03-04

    ... (FWD) and aft (AFT) engine mount link pin retention bolts have always been higher than the design value. These bolts retain the washers that maintain the engine mount vertical load pins in position. If bolts, as a consequence of the over-torque, fail and move away, it would lead to loss of the vertical load...

  15. SU-E-T-243: Design of a Novel Testing Port for Radiation Protection and Shielding Measurements

    Energy Technology Data Exchange (ETDEWEB)

    Tanny, S; Parsai, E [University of Toledo Medical Center, Toledo, OH (United States); Harrell, D; Noller, J [Shielding Construction Solutions, Inc, Tuscon, AZ (United States); Chopra, M [Unviersal Minerals International, Inc, Tuscon, AZ (United States)

    2015-06-15

    Purpose: The majority of radiation shielding research utilizes Monte Carlo simulation because of the difficulty in eliminating secondary radiations from measurements. We have designed a test port into a primary barrier of our newest vault to allow for shielding measurements while ensuring adequate protection to the public and staff during normal machine operation. This port allows for measurement of attenuation values of shielding materials, differential dose albedos, and radiation scatter fractions. Methods: The vault design utilized the maze as part of a compound primary barrier. The test port is contained within the maze and is centered along isocenter. The inner 30 cm has a 20×20 cm{sup 2} opening, while the remaining length has a 30×30 cm{sup 2} opening. The block that contains the port has a density of 200 pcf to minimize internal scatter. The 30×30 cm{sup 2} opening is occupied by removable 215 pcf concrete blocks. The innermost and outermost blocks activate an interlock wired into the beam-enable loop. This disallows beam-on in treatment mode if the interlock isn’t closed. The interlock can be overridden in service mode, or by-passed via an override switch in case of circuit failure. Results: The test port was installed in August. The beam is disabled when the interlock is tripped. Measurements taken when the primary beam is not incident on the port are indistinguishable from background. Ambient dose levels surrounding the vault with the designed shielding blocks in place are all within allowable limits for occupational workers. Conclusions: We have designed and installed a unique testing port for radiation protection and shielding measurements. This port is appropriately interlocked and designed to mitigate any risks of incidental exposure to staff or members of the public. The test port design allows measurements with “good geometry” and efficient removal of contaminating sources of radiation present in many shielding measurements. Daniel Harrell and Jim Noller are employees of Shielding Construction Solutions, Inc, the shielding construction company that built the vault discussed in this abstract. Manjit Chopra is an employee of Universal Minerals International, Inc, the company that provided the aggregates for the high density concretes used in the vault construction.

  16. A new locus for autosomal recessive hereditary spastic paraplegia maps to chromosome 16q24.3.

    OpenAIRE

    De Michele, Giuseppe; De Fusco, Maurizio; Cavalcanti, Francesca; Filla, Alessandro; Marconi, Roberto; Volpe, Giampiero; Monticelli, Antonella; Ballabio, Andrea; Casari, Giorgio; Cocozza, Sergio

    1998-01-01

    Hereditary spastic paraplegia is a genetically and phenotypically heterogeneous disorder. Both pure and complicated forms have been described, with autosomal dominant, autosomal recessive, and X-linked inheritance. Various loci (SPG1-SPG6) associated with this disorder have been mapped. Here, we report linkage analysis of a large consanguineous family affected with autosomal recessive spastic paraplegia with age at onset of 25-42 years. Linkage analysis of this family excluded all previously ...

  17. 76 FR 42602 - Airworthiness Directives; Airbus Model A330-201, -202, -203, -223, -243, -301, -302, -303, -321...

    Science.gov (United States)

    2011-07-19

    ...: During A330 and A340 aeroplanes fatigue tests, cracks appeared on the right (RH) and left (LH) sides between the crossing area of the keel beam fitting and the front spar of the Centre Wing Box (CWB). This condition, if not corrected, could lead to keel beam rupture which would affect the area structural...

  18. Alvesson, M. (2013). The Triumph of Empatiness. Oxford: Oxford Univedrsity Press. 243 p. ISBN: 978-0-19-966094-0

    OpenAIRE

    Kos Kecojević, Živa

    2015-01-01

    The book is based on critically challenging some of the predominant ideas – many of which are often taken for granted – about management, organisational structure, working life, consumption and education. The basic idea is that economic growth and higher consumption are key sources of increased satisfaction. In line with this idea, education (especially higher education) is something positive, and leads to higher qualification; it is therefore a growing need of individuals a...

  19. Homeopathy and Isopathy in the periodontal maintenance therapy of aggressive periodontitis patients - doi:10.5020/18061230.2007.p243

    Directory of Open Access Journals (Sweden)

    Edivaldo Barbosa da Silva

    2012-01-01

    Full Text Available Periodontal maintenance care is an essential part of periodontal therapy for patients diagnosed with Aggressive Periodontitis, being, however, hard to instruct and to motivate these patients to follow a careful and effective program of maintenance for all their lives. A literature review was done, by means of relevant papers published on the last four decades, pointing out the importance of individual susceptibility for the appearance of aggressive periodontitis and to discuss the importance of a maintenance therapy on its treatment, applying Homeopathy and Isopathy. Homeopathy consists on a complex therapeutic system mainly based on the “Law of Similarity”, that is, the illness may be healed by drugs that produce similar symptoms in a healthy organism and, in this conception, the disease is understood as an energetic unbalance, in which internal and external factors acting on the subject’s susceptibility are considered and can be expressed by an individual symptomathology that goes from the rational sphere to the somatic sphere. On the other hand, Isopathy is the method of treatment with therapeutic agent, which actions on a healthy subject consist on pharmacodynamic manifestations similar to those observed in a sick person. Based on these concepts, the authors establish a hypothesis of the effectiveness of Homeopathy and Isopathy, the latter through auto-medications or auto-biotherapies, that are products which the active principal is obtained from the patient himself (gingival tissue and secretions, and that may be used as auxiliary treatments in the maintenance therapy of Aggressive Periodontitis.

  20. Benjamin Fondane notebooks. Benjamin Fondane facing the History. About the Existential Monday. The Poem time, no. 14/2011, Editions Kedem, Tel Aviv, 243 p.

    Directory of Open Access Journals (Sweden)

    Speranţa Sofia MILANCOVICI

    2011-01-01

    Full Text Available Luna august reprezintă, pentru membrii sau colaboratorii Socièté d’Etudes Benjamin Fondane, momentul întâlnirii ştiinţifice anuale sub genericul Rencontres de Peyresq. Fiecare astfel de reuniune este succedată de apariţia unui volum critic realizat cu sprijinul Centre National du Livre – France. Este vorba despre seria deja cunoscutelor, în bibliografia de specialitate, Cahiers Benjamin Fondane.Volumul recent apărut poartă titlul Benjamin Fondane devant l’Histoire. Autour du Lundi existentiel. Au temps du Poème şi este cel de al paisprezecelea număr din seria caietelor.În îngrijirea energicei şi competentei preşedinte a Société d’Etudes Benjamin Fondane, prof. dr. Monique Jutrin, volumul propune spre lectură cercetătorilor de specialitate un corpus de eseuri critice grupate pe secţiuni: editorial, filosofie, poezie, opera în limba română a lui Benjamin Fundoianu, bibliografie de specialitate etc.

  1. 3-Hexadecyl-1,5-dimethyl-1H-1,5-benzodiazepine-2,4(3H,5H-dione

    Directory of Open Access Journals (Sweden)

    Rachida Dardouri

    2011-05-01

    Full Text Available In the title molecule, C27H44N2O2, the seven-membered ring adopts a boat-shaped conformation, with two C atoms of the fused benzene ring forming the stern and the methine C atom forming the prow. The hexadecyl substituent occupies an equatorial position, with the aliphatic chain exhibibiting an extended zigzag conformation.

  2. A Rare Interstitial Duplication of 8q22.1–8q24.3 Associated with Syndromic Bilateral Cleft Lip/Palate

    Directory of Open Access Journals (Sweden)

    Regina Ferreira Rezek

    2014-01-01

    Full Text Available We present a rare case of 8q interstitial duplication derived from maternal balanced translocations in a patient with bilateral cleft lip and palate in syndromic form associated with other congenital malformations. G-banding cytogenetic analysis revealed a chromosomal abnormality in the form of the karyotype 46,XX der(22t(8;22(q22.1;p11.1mat. Chromosome microarray analysis evidenced a 49 Mb duplicated segment of chromosome 8q with no pathogenic imbalances on chromosome 22. Two siblings also carry the balanced translocation. We have compared this case with other “pure” trisomies of 8q patients reported in the literature and with genome wide association studies recently published. This work highlights the involvement of chromosome 8q in orofacial clefts.

  3. OPTICAL VARIABILITY OF THE ACCRETION DISK AROUND THE INTERMEDIATE-MASS BLACK HOLE ESO 243-49 HLX-1 DURING THE 2012 OUTBURST

    Energy Technology Data Exchange (ETDEWEB)

    Webb, N. A.; Godet, O.; Barret, D. [Université de Toulouse, UPS-OMP, IRAP, Toulouse (France); Wiersema, K. [University of Leicester, University Road, Leicester LE1 7RH (United Kingdom); Lasota, J.-P. [Institut d' Astrophysique de Paris, UMR 7095, CNRS, UPMC Université Paris 06, 98bis Boulevard Arago, F-75014 Paris (France); Farrell, S. A. [Sydney Institute for Astronomy, School of Physics, The University of Sydney, NSW 2006 (Australia); Maccarone, T. J. [Department of Physics, Box 41051, Texas Tech University, Lubbock TX 79409-1051 (United States); Servillat, M., E-mail: natalie.webb@irap.omp.eu [Laboratoire AIM (CEA/DSM/IRFU/SAp, CNRS, Université Paris Diderot), CEA Saclay, Bat. 709, F-91191 Gif-sur-Yvette (France)

    2014-01-01

    We present dedicated quasi-simultaneous X-ray (Swift) and optical (Very Large Telescope, V-, and R-band) observations of the intermediate-mass black hole candidate HLX-1 before and during the 2012 outburst. We show that the V-band magnitudes vary with time, thus proving that a portion of the observed emission originates in the accretion disk. Using the first quiescent optical observations of HLX-1, we show that the stellar population surrounding HLX-1 is fainter than V ∼ 25.1 and R ∼ 24.2. We show that the optical emission may increase before the X-ray emission consistent with the scenario proposed by Lasota et al. in which the regular outbursts could be related to the passage at periastron of a star circling the intermediate-mass black hole in an eccentric orbit, which triggers mass transfer into a quasi-permanent accretion disk around the black hole. Further, if there is indeed a delay in the X-ray emission we estimate the mass-transfer delivery radius to be ∼10{sup 11} cm.

  4. SU-E-J-243: Reproducibility of Radiomics Features Through Different Voxel Discretization Levels in F18-FDG PET Images of Cervical Cancer

    Energy Technology Data Exchange (ETDEWEB)

    Altazi, B; Fernandez, D; Zhang, G; Biagioli, M; Moros, E; Moffitt, H. Lee [Cancer Center, Tampa, FL, University of South Florida, Tampa, FL (United States)

    2015-06-15

    Purpose: Site-specific investigations of the role of Radiomics in cancer diagnosis and therapy are needed. We report of the reproducibility of quantitative image features over different discrete voxel levels in PET/CT images of cervical cancer. Methods: Our dataset consisted of the pretreatment PET/CT scans from a cohort of 76 patients diagnosed with cervical cancer, FIGO stage IB-IVA, age range 31–76 years, treated with external beam radiation therapy to a dose range between 45–50.4 Gy (median dose: 45 Gy), concurrent cisplatin chemotherapy and MRI-based Brachytherapy to a dose of 20–30 Gy (median total dose: 28 Gy). Two board certified radiation oncologists delineated Metabolic Tumor volume (MTV) for each patient. Radiomics features were extracted based on 32, 64, 128 and 256 discretization levels (DL). The 64 level was chosen to be the reference DL. Features were calculated based on Co-occurrence (COM), Gray Level Size Zone (GLSZM) and Run-Length (RLM) matrices. Mean Percentage Differences (Δ) of features for discrete levels were determined. Normality distribution of Δ was tested using Kolomogorov - Smirnov test. Bland-Altman test was used to investigate differences between feature values measured on different DL. The mean, standard deviation and upper/lower value limits for each pair of DL were calculated. Interclass Correlation Coefficient (ICC) analysis was performed to examine the reliability of repeated measures within the context of the test re-test format. Results: 3 global and 5 regional features out of 48 features showed distribution not significantly different from a normal one. The reproducible features passed the normality test. Only 5 reproducible results were reliable, ICC range 0.7 – 0.99. Conclusion: Most of the radiomics features tested showed sensitivity to voxel level discretization between (32 – 256). Only 4 GLSZM, 3 COM and 1 RLM showed insensitivity towards mentioned discrete levels.

  5. Determinant factors of cardiorespiratory fitness in Portuguese adolescents of different ethnicities. DOI: 10.5007/1980-0037.2011v13n4p243

    Directory of Open Access Journals (Sweden)

    Diana Aguiar Santos

    2011-06-01

    Full Text Available Cardiorespiratory fitness is an important health indicator in young people. The aim of this study was to investigate the effects of age, gender, body adiposity, and ethnicity on cardiorespiratory fitness in a sample of Portuguese adolescents. The sample consisted of 266 adolescents aged 12-18 years [112 boys (80 Caucasians and 32 African-Portuguese, AP and 154 girls (109 Caucasians and 45 AP]. Percent body fat was estimated with a hand-to-hand bioelectrical impedance device (BF300, OMROM. Cardiorespiratory fitness was assessed by a shuttle run test (Fitnessgram battery. Multiple regression models were used for statistical analysis. The results showed that girls presented lower maximal oxygen consumption and higher percent body fat than boys. Cardiorespiratory fitness was lower in Caucasian than in AP girls. Multiple regression analysis showed that percent body fat, age and the interaction of age with being Caucasian and age with female gender were significant determinants that were negatively associated with cardiorespiratory fitness. The results suggest that maximal oxygen consumption is lower in adolescents with higher adiposity and in older adolescents. The findings highlight the importance of promoting physical fitness in schools across ages, especially in older adolescents, adjusting for determinant factors such as gender and ethnicity

  6. Determinant factors of cardiorespiratory fitness in Portuguese adolescents of different ethnicities. DOI: 10.5007/1980-0037.2011v13n4p243

    Directory of Open Access Journals (Sweden)

    Diana Aguiar Santos

    2011-08-01

    Full Text Available Cardiorespiratory fitness is an important health indicator in young people. The aim of this study was to investigate the effects of age, gender, body adiposity, and ethnicity on cardiorespiratory fitness in a sample of Portuguese adolescents. The sample consisted of 266 adolescents aged 12-18 years [112 boys (80 Caucasians and 32 African-Portuguese, AP and 154 girls (109 Caucasians and 45 AP]. Percent body fat was estimated with a hand-to-hand bioelectrical impedance device (BF300, OMROM. Cardiorespiratory fitness was assessed by a shuttle run test (Fitnessgram battery. Multiple regression models were used for statistical analysis. The results showed that girls presented lower maximal oxygen consumption and higher percent body fat than boys. Cardiorespiratory fitness was lower in Caucasian than in AP girls. Multiple regression analysis showed that percent body fat, age and the interaction of age with being Caucasian and age with female gender were significant determinants that were negatively associated with cardiorespiratory fitness. The results suggest that maximal oxygen consumption is lower in adolescents with higher adiposity and in older adolescents. The findings highlight the importance of promoting physical fitness in schools across ages, especially in older adolescents, adjusting for determinant factors such as gender and ethnicity

  7. Interstitial deletion of 14q24.3-q32.2 in a male patient with plagiocephaly, BPES features, developmental delay, and congenital heart defects

    DEFF Research Database (Denmark)

    Cingöz, Sultan; Bache, Iben; Bjerglund, Lise

    2011-01-01

    with developmental delay, language impairment, plagiocephaly, BPES features (blepharophimosis, ptosis, epicanthus), and congenital heart defect. The deletion breakpoints were fine mapped using fluorescence in situ hybridization (FISH) and the size of the deletion is estimated to be approximately 23¿Mb. Based...... on genotype-phenotype comparisons of the 10 previously published patients and the present case, we suggest that the shortest regions for deletion overlap may include candidate genes for speech impairment, mental retardation, and hypotonia....

  8. Haploinsufficiency for ANKRD11-flanking genes makes the difference between KBG and 16q24.3 microdeletion syndromes: 12 new cases

    NARCIS (Netherlands)

    Novara, Francesca; Rinaldi, Berardo; Sisodiya, Sanjay M.; Coppola, Antonietta; Giglio, Sabrina; Stanzial, Franco; Benedicenti, Francesco; Donaldson, Alan; Andrieux, Joris; Stapleton, Rachel; Weber, Astrid; Reho, Paolo; van Ravenswaaij-Arts, Conny; Kerstjens-Frederikse, Wilhelmina S.; Vermeesch, Joris Robert; Devriendt, Koenraad; Bacino, Carlos A.; Delahaye, Andrée; maas, S. M.; Iolascon, Achille; Zuffardi, Orsetta

    2017-01-01

    16q24 deletion involving the ANKRD11 gene, ranging from 137 kb to 2 Mb, have been associated with a microdeletion syndrome characterized by variable cognitive impairment, autism spectrum disorder, facial dysmorphisms with dental anomalies, brain abnormalities essentially affecting the corpus

  9. Haploinsufficiency for ANKRD11-flanking genes makes the difference between KBG and 16q24.3 microdeletion syndromes : 12 new cases

    NARCIS (Netherlands)

    Novara, Francesca; Rinaldi, Berardo; Sisodiya, Sanjay M.; Coppola, Antonietta; Giglio, Sabrina; Stanzial, Franco; Benedicenti, Francesco; Donaldson, Alan; Andrieux, Joris; Stapleton, Rachel; Weber, Astrid; Reho, Paolo; van Ravenswaaij-Arts, Conny; Kerstjens-Frederikse, Wilhelmina S.; Vermeesch, Joris Robert; Devriendt, Koenraad; Bacino, Carlos A.; Delahaye, Andree; Maas, S. M.; Iolascon, Achille; Zuffardi, Orsetta

    16q24 deletion involving the ANKRD11 gene, ranging from 137 kb to 2 Mb, have been associated with a microdeletion syndrome characterized by variable cognitive impairment, autism spectrum disorder, facial dysmorphisms with dental anomalies, brain abnormalities essentially affecting the corpus

  10. Clinical and molecular-cytogenetic evaluation of a family with partial Jacobsen syndrome without thrombocytopenia caused by an approximately 5 Mb deletion del(11)(q24.3).

    Science.gov (United States)

    Bernaciak, Joanna; Szczałuba, Krzysztof; Derwińska, Katarzyna; Wiśniowiecka-Kowalnik, Barbara; Bocian, Ewa; Sasiadek, Maria Małgorzata; Makowska, Izabela; Stankiewicz, Paweł; Smigiel, Robert

    2008-10-01

    Clinical manifestations of Jacobsen syndrome (JBS) depend on the size of the 11qter deletion, which usually varies between approximately 7 and 20 Mb. Typical JBS features include developmental delay/mental retardation, short stature, congenital heart defects, thrombocytopenia, and characteristic dysmorphic facial features. We report on a family in which a 4-year-old girl as well as her mother and maternal uncle present with subtle features of JBS. Notably, neither thrombocytopenia nor congenital anomalies were detected in this family. Cytogenetic analyses revealed normal karyotypes. Using fluorescence in situ hybridization (FISH) and whole-genome oligonucleotide array CGH analyses, we identified an approximately 5 Mb deletion of the terminal part of chromosome 11q in all the three affected family members. The deletion breakpoint was mapped between 129,511,419 and 129,519,794 bp. This is the smallest deletion reported in a JBS patient. Interestingly, the FLI1 (friend leukemia virus integration 1) hematopoiesis factor gene located approximately 6.5 Mb from 11qter and usually deleted in patients with JBS, is intact. Our data support previous hypotheses that FLI1 haploinsufficiency is responsible for thrombocytopenia in patients with JBS. Copyright 2008 Wiley-Liss, Inc.

  11. De novo 14q24.2q24.3 microdeletion including IFT43 is associated with intellectual disability, skeletal anomalies, cardiac anomalies, and myopia

    NARCIS (Netherlands)

    Stokman, M.F.; Oud, M.M.; Binsbergen, E. van; Slaats, G.G.; Nicolaou, N.; Renkema, K.Y.; Nijman, IJ; Roepman, R.; Giles, R.H.; Arts, H.H.; Knoers, N.V.A.M.; Haelst, M.M. van

    2016-01-01

    We report an 11-year-old girl with mild intellectual disability, skeletal anomalies, congenital heart defect, myopia, and facial dysmorphisms including an extra incisor, cup-shaped ears, and a preauricular skin tag. Array comparative genomic hybridization analysis identified a de novo 4.5-Mb

  12. Comment on ”John’s stone: A possible fragment of the 1908 Tunguska meteorite” (Anfinogenov et al., 2014, Icarus 243, 139-147)

    DEFF Research Database (Denmark)

    Haack, Henning; Greenwood, Richard; Busemann, Henner

    2016-01-01

    of terrestrial quartz-bearing sedimentary and metamorphic rocks. John’s stone has an oxygen isotope composition and mineralogy that is unlike any known group of meteorites. If John’s stone is extraterrestrial this would imply that it represents a previously unknown type of meteorite, as suggested by Anfinogenov...... gas composition of John’s stone, which is clearly distinct from martian meteorites. Consistent with the O study, the noble gases do not provide any evidence for an extraterrestrial origin of the samples. The lack of any cosmogenic noble gases (particularly striking in 3He, 21Ne, 38Ar) is consistent...... with a terrestrial origin or an extraterrestrial origin under large shielding. Based on the combined evidence obtained in this study we infer that John’s stone is a terrestrial rock unrelated to the Tunguska impactor....

  13. Crystal structures of ethyl {2-[4-(4-isopropylphenylthiazol-2-yl]phenyl}carbamate and ethyl {2-[4-(3-nitrophenylthiazol-2-yl]phenyl}carbamate

    Directory of Open Access Journals (Sweden)

    Elena V. Sukhonosova

    2016-09-01

    Full Text Available The title compounds, C21H22N2O2S (I and C18H15N3O4S (II, are structural analogs of the alkaloid Thiosporine B. Both molecules adopt a near-planar V-shaped conformation, which is consolidated by intramolecular N—H...N and C—H...O hydrogen bonds. The crystal structure of (I consists of mlecular stacks along the a axis, in which the molecules are linked to each other by π(S...π(C interactions. In the crystal of (II, molecules are linked into chains by C—H...O hydrogen bonds and the chains are cross-linked into (100 sheets by π–π stacking interactions.

  14. SCRIB and PUF60 are primary drivers of the multisystemic phenotypes of the 8q24.3 copy-number variant

    DEFF Research Database (Denmark)

    Dauber, Andrew; Golzio, Christelle; Guenot, Cécile

    2013-01-01

    phenotype, and the combinatorial suppression of both genes exacerbated some, but not all, phenotypic components. Consistent with these findings, we identified an individual with microcephaly, short stature, intellectual disability, and heart defects with a de novo c.505C>T variant leading to a p.His169Tyr...

  15. Aspectos retóricos da ária Quia respexit humilitatem, do Magnificat em Ré maior de J. S. Bach BWV 243 Rhetorical aspects of the aria Quia respexit humilitatem, from Magnificat in D major by J. S. Bach BWV 243

    Directory of Open Access Journals (Sweden)

    Isabela de Figueiredo Santos

    2008-12-01

    Full Text Available A Retórica teve um papel essencial na produção artística do século XVI ao século XVIII ao ditar sistematicamente a estruturação formal e a utilização de elementos figurativos em um discurso para fortalecer sua eloqüência. No caso da música se dá através da estruturação e divisão da música e da utilização de figuras retórico-musicais como, por exemplo, as catabasis (movimento melódico descendente e anaphoras (repetição geral, entre outras. Este artigo pretende analisar alguns elementos da retórica contidos na ária Quia respexit humilitatem, composta por J. S. Bach.Rhetoric had an essential role in artistic production from the sixteenth to the eighteenth century by systematically dictating the formal structure and utilizing figurative elements in discourse to strengthen its eloquence. In the case of music, it occurs through structure and division of the music and the use of rhetorical-musical figures such as catabasis (descending melodic movement or anaphora (general repetition among others. This article aims to analyze some of the rhetorical elements contained in the aria Quia respexit humilitatem, composed by J. S. Bach.

  16. Frequency band analysis of muscle activation during cycling to exhaustion.DOI: http://dx.doi.org/10.5007/1980-0037.2012v14n3p243

    Directory of Open Access Journals (Sweden)

    Marco Aurélio Vaz

    2012-05-01

    Full Text Available Lower limb muscles activation was assessed during cycling to exhaustion using frequency band analysis. Nine cyclists were evaluated in two days. On the first day, cyclists performed a maximal incremental cycling exercise to measure peak power output, which was used on the second day to define the workload for a constant load time to exhaustion cycling exercise (maximal aerobic power output from day 1. Muscle activation of vastus lateralis (VL, long head of biceps femoris (BF, lateral head of gastrocnemius (GL, and tibialis anterior (TA from the right lower limb was recorded during the time to exhaustion cycling exercise. A series of nine band-pass Butterworth digital filters was used to analyze muscle activity amplitude for each band. The overall amplitude of activation and the high and low frequency components were defined to assess the magnitude of fatigue effects on muscle activity via effect sizes. The profile of the overall muscle activation during the test was analyzed using a second order polynomial, and the variability of the overall bands was analyzed by the coefficient of variation for each muscle in each instant of the test. Substantial reduction in the high frequency components of VL and BF activation was observed. The overall and low frequency bands presented trivial to small changes for all muscles. High relationship between the second order polynomial fitting and muscle activity was found (R2 > 0.89 for all muscles. High variability (~25% was found for muscle activation at the four instants of the fatigue test. Changes in the spectral properties of the EMG signal were only substantial when extreme changes in fatigue state were induced.

  17. Minerals and Trace Elements in Milk, Milk Products, Infant Formula, and Adult/Pediatric Nutritional Formula, ICP-MS Method: Collaborative Study, AOAC Final Action 2015.06, ISO/DIS 21424, IDF 243.

    Science.gov (United States)

    Pacquette, Lawrence H; Thompson, Joseph J

    2017-11-20

    AOAC Final Action Official MethodSM2015.06 "Minerals and Trace Elements in Milk, Milk Products, Infant Formula and Adult/Pediatric Nutritional Formula, ICP-MS Method" was collaboratively studied. Note that "milk, milk products" has now been added to the title of the Final Action method because whole milk and several dairy ingredients were successfully incorporated into the collaborative study for the purpose of developing an International Organization for Standardization/International Dairy Federation standard (ISO/DIS 21424; in progress). The method determines sodium, magnesium, phosphorus, potassium, calcium, iron, manganese, zinc, copper, chromium, molybdenum, and selenium by inductively coupled plasma (ICP)-MS after microwave digestion. Ten laboratories participated in the study, and data from five different model ICP-MS units were represented. Thirteen products, five placebo products, and six dairy samples were tested as blind duplicates in this study, along with a standard reference material, for a total 50 samples. The overall repeatability and reproducibility for all samples met Standard Method Performance Requirements put forth by the AOAC Stakeholder Panel on Infant Formula and Adult Nutritionals, with a few exceptions. Comparisons are made to ICP-atomic emission data from a collaborative study of AOAC Official Method2011.14 carried out concurrently on these same samples.

  18. Hsa-miR-24-3p Increases Nasopharyngeal Carcinoma Radiosensitivity by Targeting Both the 3’UTR and 5’UTR of Jab1/CSN5

    Science.gov (United States)

    Wang, Sumei; Pan, Yunbao; Zhang, Rong; Xu, Tao; Wu, Wanyin; Wang, Chunhua; Huang, Hecheng; Calin, George A.; Yang, Huiling; Claret, Francois X.

    2016-01-01

    Radiotherapy is the standard therapy for nasopharyngeal carcinoma (NPC); however, radioresistance can hinder successful treatment. Here, we report that miR-24 acts as a tumor suppressor and radiosensitizer in NPC cells and xenografts by targeting Jab1/CSN5. Although accumulating evidence has shown that Jab1/CSN5 functions as an oncoprotein in human cancers, its regulation through miRs has not been described. In this study, we found that Jab1/CSN5 functioned in a manner opposite that of miR-24 in NPC tumorigenesis and radioresistance. We demonstrated that miR-24 inhibits Jab1/CSN5 translation via direct binding to its 3’UTR and 5’UTR, leading to tumor growth inhibition, and sensitizes NPC tumors to radiation in vivo. Furthermore, silencing Jab1/CSN5 phenocopied the function of miR-24 in NPC cells after ionizing radiation treatment, resulting in increased apoptosis. Finally, we analyzed 50 paired samples of primary and matched recurrent NPC tissues from 25 NPC patients and subjected them to high-throughput genomic quantitative nuclease protection assay for quantifying simultaneously miR and mRNA levels. Our results showed that miR-24 levels were significantly decreased in recurrent NPC and that levels of Jab1/CSN5, as its target, were higher than those in primary NPC. Together, our findings indicate that miR-24 inhibits NPC tumor growth and increases NPC radiosensitivity by directly regulating Jab1/CSN5 and that both miR-24 and Jab1/CSN5 can serve as prognostic markers for NPC recurrence; this, in turn, may provide a promising therapeutic strategy for reversing NPC radioresistance. PMID:27157611

  19. Monozygotic twins with a de novo 0.32 Mb 16q24.3 deletion, including TUBB3 presenting with developmental delay and mild facial dysmorphism but without overt brain malformation

    DEFF Research Database (Denmark)

    Grønborg, Sabine; Kjaergaard, Susanne; Hove, Hanne

    2015-01-01

    , and mild spastic diplegia. Cerebral magnetic resonance imaging of the patients did not reveal cortical malformations, malformations of the corticospinal tracts, basal ganglia, corpus callosum, or optic nerves. This observation is in contrast to the group of neurological disorders that are associated...

  20. Multibeam collection for TN243: Multibeam data collected aboard Thomas G. Thompson from 2009-11-07 to 2009-11-09, departing from Seattle, WA and returning to Seattle, WA

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set is part of a larger set of data called the Multibeam Bathymetry Database (MBBDB) where other similar data can be found at...

  1. ORF Alignment: NC_006624 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available 23 YLERDKVLGIKHPKASGDVYGHLLKDNITGTSTIMVKRECFKKAGLFREDFVTCEDWDMW 182 ... YLERDKVLGIKHPKASGDVYGHLLKDNIT...GTSTIMVKRECFKKAGLFREDFVTCEDWDMW Sbjct: 121 YLERDKVLGIKHPKASGDVYGHLLKDNITGTSTIMVKRECFKKAGLFREDFVTCEDWDMW 180 ... Query: 243 V 243 ... V Sbjct: 241 V 241

  2. ORF Alignment: NC_000961 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ISVIIPTYNREELLRRAIESVLDQTFDDFEILVIDGAKSESTRELVRSFGDGRIRYIP 60 ... Query: 123 YLEKDKVLGIKHPRASGDVYKHLLKDNITGTSTIMVKRECFKKVGLFREDFVTCEDWDM...W 182 ... YLEKDKVLGIKHPRASGDVYKHLLKDNITGTSTIMVKRECFKKVGLFREDFVTCEDWDM...W Sbjct: 121 YLEKDKVLGIKHPRASGDVYKHLLKDNITGTSTIMVKRECFKKVGLFREDFVTCEDWDMW 180 ... Query: 243 V 243 ... V Sbjct: 241 V 241

  3. Discovery of isotopes of the transuranium elements with 93≤Z≤98

    Energy Technology Data Exchange (ETDEWEB)

    Fry, C.; Thoennessen, M., E-mail: thoennessen@nscl.msu.edu

    2013-01-15

    One hundred and five isotopes of the transuranium elements neptunium, plutonium, americium, curium, berkelium, and californium have been observed so far; the discovery of these isotopes is described. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  4. Separation of Transplutonium Elements from Neutron Irradiated Americium-241

    National Research Council Canada - National Science Library

    UENO, Kaoru; WATANABE, Kenju; SAGAWA, Chiaki; ISHIMORI, Tomitaro

    1974-01-01

    .... The ratios of the amounts present of these isotopes were determined by mass spectrometry. It was not possible to identify 249Bk in the berkelium fraction owing to the interference from other β-ray emitting nuclides. In the californium fraction, both spontaneous fission and a-activities due to 250, 252 were observed.

  5. Neutron-Activated Gamma-Emission: Technology Review

    Science.gov (United States)

    2012-01-01

    flux sources developed for boron neutron capture therapy ( BNCT ), found to be an experimental success in cancer treatment (26). 30 Improved flux on...achievable Am americium API associated particle imaging B boron Be beryllium BNCT boron neutron capture therapy C carbon Cf californium Cl

  6. Solid-State Neutron Multiplicity Counting System Using Commercial Off-the-Shelf Semiconductor Detectors

    Energy Technology Data Exchange (ETDEWEB)

    Rozhdestvenskyy, S. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

    2017-08-09

    This work iterates on the first demonstration of a solid-state neutron multiplicity counting system developed at Lawrence Livermore National Laboratory by using commercial off-the-shelf detectors. The system was demonstrated to determine the mass of a californium-252 neutron source within 20% error requiring only one-hour measurement time with 20 cm2 of active detector area.

  7. Cold valleys in the radioactive decay of 248−254Cf isotopes

    Indian Academy of Sciences (India)

    Geiger–Nuttal plots of log10(T1/2) vs. Q−1/2 for 48−52Ca emitting from various californium isotopes. Acknowledgement. One of the authors (KPS) would like to thank University Grants Commis- sion, Govt. of India for the financial support under project No. MRP(S)-. 352/2005(X Plan)/KLKA 002/UGC-SWRO. References.

  8. Directed evolution of the periodic table: probing the electronic structure of late actinides.

    Science.gov (United States)

    Marsh, M L; Albrecht-Schmitt, T E

    2017-07-25

    Recent investigations of the coordination chemistry and physical properties of berkelium (Z = 97) and californium (Z = 98) have revealed fundamental differences between post-curium elements and lighter members of the actinide series. This review highlights these developments and chronicles key findings and concepts from the last half-century that have helped usher in a new understanding of the evolution of electronic structure in the periodic table.

  9. Open Source: Potential in Latin America for Radiological Weapons

    Science.gov (United States)

    2010-03-01

    terrorist group would need to acquire a radioactive isotope with a relatively short half-life. 36,37 As an aside, the IAEA verified that depleted...cns.miis.edu/npr/pdfs/123salama.pdf (accessed March 3, 2010), Useful RDD isotopes include cobalt-60, strontium-90, yttrium-90, iridium-192, cesium-137...plutonium-238, radium -226, americium-241, and californium-252. 37 Hansell and Salama, “Does intent equal capability?,” 640-641. 38 Internation Atomic

  10. [Dimitri Steinke: Die Zivilrechtsordnungen des Baltikums unter dem Einfluss ausländischer, insbesondere deutscher Rechtsquellen. (Osnabrücker Schriften zur Rechtsgeschichte, Bd. 16.) V&R unipress. Göttingen 2009. 243 S. ISBN 978-3-89971-573-6] / M

    Index Scriptorium Estoniae

    Luts-Sootak, Marju, 1966-

    2011-01-01

    Arvustus: Dimitri Steinke. Die Zivilrechtsordnungen des Baltikums unter dem Einfluss ausländischer, insbesondere deutscher Rechtsquellen. (Osnabrücker Schriften zur Rechtsgeschichte ; 16). Göttingen, 2009

  11. University Students Are Unaware of the Role of Academic Librarians. A Review of: Bickley, R. & Corral, S. (2011. Student perceptions of staff in the information commons: A survey at the University of Sheffield. Reference Services Review, 39(2, 223-243. doi:10.1108/00907321111135466

    Directory of Open Access Journals (Sweden)

    Kirsty Thomson

    2012-06-01

    Full Text Available Objective – To discover students’ perceptionsof information commons staff, and todetermine how these perceptions influence theuse of library resources.Design – Post-experience survey with onefollow-up interview.Setting – The University of Sheffield, a postsecondaryinstitution in England.Subjects – All undergraduate andpostgraduate students were invited to takepart. Just over 1% of the student population, or250 students, completed the survey.Methods – Information about the survey wassent to students’ institutional email addresses.One follow up interview was carried out viaemail using the critical incident technique.Main Results – Students do not understandthe academic roles of librarians. They areunlikely to approach library staff for academicsupport, preferring to turn to instructors, otherstudents, friends, and family. Most studentshad positive opinions about assistancereceived in the Information Commons, but asmall number reflected on previous badexperiences with staff, or on a fear of beingmade to feel foolish. The vast majority ofstudents who did not seek help in theInformation Commons stated that this wasbecause they did not require assistance. Most students do not perceive a difference between Information Commons staff and library staff.Conclusion – Students have positive views of Information Commons staff at the University of Sheffield, but have low awareness of the roles of professional librarians. Librarians need to develop partnerships with academic staff and strengthen their presence in both physical and online learning environments to promote their academic roles.

  12. El servicio público de las telecomunicaciones: un reto para la regulación económica OECD (2014, Estudio de la OCDE sobre políticas y regulación de telecomunicaciones en Colombia, OECD, Publishing, 184 pp. 243

    Directory of Open Access Journals (Sweden)

    María Carolina Espitia Becerra

    2014-12-01

    Full Text Available The study, about the Organization for Economic Co-operation and Development (OECD, analyzes the socioeconomic role upon Colombia’s telecommunications (TIC. Colombia has profited from the importance of this new public service, therefore the country has orientated its legal framework to ensure the access and universal service of these technologies. This analysis is centered on the telecommunication sector; it studies the markets, the regulation structure and their amendments. Given the relevance of regulations to the administrative law, this paper will center on three fundamental axes: (i the TIC as a public service that is guided towards the universal access and service, (ii The need for an independent regulatory body (iii the adequacy or otherwise of the Telecommunications Regulatory Commission to Colombian reality, other institutions and the regulatory framework. Even though Colombia has strived to create regulatory institutions in this sector, there’s still the questionable matter of the independence of some administrative entities such as the TIC Regulation Commission (crc, for its Spanish initials. This independence would be of extreme importance for the effectiveness of the regulations they are to impose.

  13. Marcos Fernández L., Prisión común, imaginario social e identidad, Chile, 1870-1920, Santiago de Chile, Ed. Andrés Bello y DIBAM, Colección Sociedad y Cultura XXXIII, 2004, 243 páginas.

    OpenAIRE

    Palma, Daniel

    2005-01-01

    En los últimos años hemos presenciado un interés creciente en actores tradicionalmente despreciados o ignorados por la historiografía chilena. Prostitutas, locos, delincuentes, trabajadoras sociales, presos, mapuche, la ‘gente en la calle’, están siendo objeto de estudios que develan los aspectos cotidianos de la dominación social e ideológica en nuestra historia y la persistencia de micromundos y microhistorias en permanente tensión con los resortes del poder. El libro de Fernández se inscri...

  14. Pseudorca crassidens (Owen), ein Beitrag zur vergleichenden Anatomie der Cetaceen

    NARCIS (Netherlands)

    Slijper, E.J.

    1939-01-01

    INHALTSÜ BERSICHT Abschnitt 1 Einleitung; Material .... 243 I Strandung .... 243 II Material .... 244 Abschnitt 2 Nomenklatur; Geographische Verbreitung; Lebensweise .... 245 I Nomenklatur .... 245 II Geographische Verbreitung .... 246 III Lebensweise .... 249 Abschnitt 3 Äussere Form; Wachstum ....

  15. ORF Alignment: NC_004917 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available MGAKWLHIVDLDGAFAGI Sbjct: 1 ... MALDIYPAIDLKEGKAVRLFKGDMQSATIYGEALEFAKMFEDMGAKWLHIVDLDGAFAGI 60 ... Query: 121 YPIAVGIDARE...GKVAVQGWAKESDICSSVLAEKFAGSEVQAIICTDINRDGALSGINVSF 180 ... YPIAVGIDARE...GKVAVQGWAKESDICSSVLAEKFAGSEVQAIICTDINRDGALSGINVSF Sbjct: 121 YPIAVGIDAREGKVAVQGWAKESDICSSVLAEKFAGSEVQAIICTDINRDGALSGINVSF 180 ... Query: 241 VKI 243 ... VKI Sbjct: 241 VKI 243

  16. Protein (Cyanobacteria): 661290033 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available :898 ... sulfite reductase, partial Prochlorococcus sp. scB243_496M6 MIKVEKVKKKKDSAKDETVCLANGLEVSKFENFKKSSQFLKEPLATELVNESDHFTNDAVQLLKFHGSYQQDNRENRRPGKSKDWQMMLRLRNPGGEVPGKLFLALDELSD

  17. PROCEEDINGS OF THE SYMPOSIUM COMMEMORATING THE 25th ANNIVERSARY OF ELEMENTS 97 and 98 HELD ON JAN. 20, 1975

    Energy Technology Data Exchange (ETDEWEB)

    Seaborg, Glenn T.; Street Jr., Kenneth; Thompson, Stanley G.; Ghiorso, Albert

    1976-07-01

    This volume includes the talks given on January 20, 1975, at a symposium in Berkeley on the occasion of the celebration of the 25th anniversary of the discovery of berkelium and californium. Talks were given at this symposium by the four people involved in the discovery of these elements and by a number of people who have made significant contributions in the intervening years to the investigation of their nuclear and chemical properties. The papers are being published here, without editing, in the form in which they were submitted by the authors in the months following the anniversary symposium, and they reflect rather faithfully the remarks made on that occasion.

  18. Composition containing transuranic elements for use in the homeopathic treatment of aids

    Energy Technology Data Exchange (ETDEWEB)

    Lustig, D.

    1996-04-18

    A homeopathic remedy consisting of a composition containing one or more transuranic elements, particularly plutonium, for preventing and treating acquired immunodeficiency syndrome (AIDS) in humans, as well as seropositivity for human immunodeficiency virus (HIV). Said composition is characterized in that it uses any chemical or isotopic form of one or more transuranic elements (neptunium, plutonium, americium, curium, berkelium, californium or einsteinium), particularly plutonium, said form being diluted and dynamized according to conventional homeopathic methods, particularly the so-called Hahnemann and Korsakov methods, and provided preferably but not exclusively in the form of lactose and/or saccharose globules or granules impregnated with the active principle of said composition. (author).

  19. Advanced development of the spectrum sciences Model 5005-TF, single-event test fixture

    Energy Technology Data Exchange (ETDEWEB)

    Ackermann, M.R.; Browning, J.S. (Sandia National Labs., Albuquerque, NM (USA)); Hughlock, B.W. (Boeing Aerospace and Electronics Co., Seattle, WA (USA)); Lum, G.K. (Lockheed Missiles and Space Co., Sunnyvale, CA (USA)); Tsacoyeanes, W.C. (Draper (Charles Stark) Lab., Inc., Cambridge, MA (USA)); Weeks, M.D. (Spectrum Sciences, Inc., Santa Clara, CA (USA))

    1990-09-01

    This report summarizes the advanced development of the Spectrum Sciences Model 5005-TF, Single-Event Test Fixture. The Model 5005-TF uses a Californium-252 (Cf-252) fission-fragment source to test integrated circuits and other devices for the effects of single-event phenomena. Particle identification methods commonly used in high-energy physics research and nuclear engineering have been incorporated into the Model 5005-TF for estimating the particle charge, mass, and energy parameters. All single-event phenomena observed in a device under test (DUT) are correlated with an identified fission fragment, and its linear energy transfer (LET) and range in the semiconductor material of the DUT.

  20. TOWARD AN IMPROVED UNDERSTANDING OF STRUCTURE AND MAGNETISM IN NEPTUNIUM AND PLUTONIUM PHOSPHONATES AND SULFONATES

    Energy Technology Data Exchange (ETDEWEB)

    Albrecht-Schmitt, Thomas

    2012-03-01

    This grant supported the exploratory synthesis of new actinide materials with all of the actinides from thorium to californium with the exceptions of protactinium and berkelium. We developed detailed structure-property relationships that allowed for the identification of novel materials with selective ion-exchange, selective oxidation, and long-range magnetic ordering. We found novel bonding motifs and identified periodic trends across the actinide series. We identified structural building units that would lead to desired structural features and novel topologies. We also characterized many different spectroscopic trends across the actinide series. The grant support the preparation of approximately 1200 new compounds all of which were structurally characterized.

  1. Detection of rare earth elements in Powder River Basin sub-bituminous coal ash using laser-induced breakdown spectroscopy (LIBS)

    Energy Technology Data Exchange (ETDEWEB)

    Tran, Phuoc [National Energy Technology Lab. (NETL), Pittsburgh, PA, (United State; Mcintyre, Dustin [National Energy Technology Lab. (NETL), Pittsburgh, PA, (United State

    2015-10-01

    We reported our preliminary results on the use of laser-induced breakdown spectroscopy to analyze the rare earth elements contained in ash samples from Powder River Basin sub-bituminous coal (PRB-coal). We have identified many elements in the lanthanide series (cerium, europium, holmium, lanthanum, lutetium, praseodymium, promethium, samarium, terbium, ytterbium) and some elements in the actinide series (actinium, thorium, uranium, plutonium, berkelium, californium) in the ash samples. In addition, various metals were also seen to present in the ash samples

  2. Protein (Cyanobacteria): 647695635 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 3:147 ... hypothetical protein, partial Prochlorococcus sp. scB243_498I20 HICLSFNKQCLILDTHKLFAFPISFSIFLIIAIAIYKRSLLNENWKYLTTLIF...LLFSQITLGVLSLKTNLNEPIFIIGHQLNASLFIAILTTLIFRNPFTKKGHNHYLNPQTVGINS

  3. ORF Alignment: NC_006397 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available DLSISNNAQDELGHARLWYDAVQQLGYS 60 ... Query: 141 TSRIQGEEGYHLEHAESWLDRMALDKEASERVQAAIDELYPYALTLFEPVGDVEADIDRL 200... ... TSRIQGEEGYHLEHAESWLDRMALDKEASERVQAAIDELYPYALTLFEPVGDVEADIDRL Sbjct: 1...21 TSRIQGEEGYHLEHAESWLDRMALDKEASERVQAAIDELYPYALTLFEPVGDVEADIDRL 180 ... Query: 261 RNL 263 ... RNL Sbjct: 241 RNL 243

  4. ORF Alignment: NC_004578 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ALADRYADVDCS 60 ... Query: 123 VTGKPVIIHTRGARADTLSLLREAALPQAGVLHCFTEDWDMAKAALDMGYYISLSGIVTF 182 ... VTGK...PVIIHTRGARADTLSLLREAALPQAGVLHCFTEDWDMAKAALDMGYYISLSGIVTF Sbjct: 121 VTGKPVIIHTRGA...RADTLSLLREAALPQAGVLHCFTEDWDMAKAALDMGYYISLSGIVTF 180 ... Query: 243 AEQTTANFARLFP 255 ... AEQTTANFARLFP Sbjct: 241 AEQTTANFARLFP 253

  5. Protein (Cyanobacteria): 661291714 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 99 ... UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase, partial Prochlorococcus sp. scB243..._496A2 MEFSLSELNNVLGNIKNLSEGKRDFFNFKNVSIDSRTLLKNDLFIAIEGKNFDGHSFLPKVLDKGVKSVVIKKGMQRLLPSNFPYWVVNDTLEAFQKLALLKRKKLNIPVIAITGSVG

  6. Nanoscale materials in chemistry

    National Research Council Canada - National Science Library

    Klabunde, Kenneth J; Richards, Ryan

    2009-01-01

    ...: Disordered, Porous Nanostructures Stephanie L. Brock 209 9 Ordered Microporous and Mesoporous Materials Freddy Kleitz 243 10 Applications of Microporous and Mesoporous Materials Anirban Ghosh,...

  7. Marine data and information management system for the Indian Ocean

    Digital Repository Service at National Institute of Oceanography (India)

    Sarupria, J.S.

    stream_size 8 stream_content_type text/plain stream_name IGBP_India_2000_243.pdf.txt stream_source_info IGBP_India_2000_243.pdf.txt Content-Encoding ISO-8859-1 Content-Type text/plain; charset=ISO-8859-1 ...

  8. Browse Title Index

    African Journals Online (AJOL)

    Items 201 - 243 of 243 ... Vol 14, No 1 (2004), The harmful effects of cigarette smoking on the fetus: editorial, Details ... Vol 14, No 2 (2004), The role of chemotherapy in the management of cervical cancer: review article, Details ... Vol 13, No 3 (2003), The role of radiation therapy in epithelial ovarian cancer, Abstract. G Dreyer.

  9. 26 CFR 1.861-8T - Computation of taxable income from sources within the United States and from other sources and...

    Science.gov (United States)

    2010-04-01

    ... of profit contribution, (v) Comparison of expenses incurred, assets used, salaries paid, space... section 243(a)(1), section 243(a)(2), or section 245(a). In the case of a life insurance company taxable under section 801, the amount of such stock that is treated as tax exempt shall not be reduced because a...

  10. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 23; Issue 2. Homi Bhabha Centre for Science Education: Admission to PhD Programme in Science Education - 2018. Information and Announcements Volume 23 Issue 2 February 2018 pp 243-243 ...

  11. Minor actinide separation by liquid-liquid extraction. World study system system overview; Separation des actinides mineurs par extraction liquide-liquide. Panorama des systemes etudies dans le monde

    Energy Technology Data Exchange (ETDEWEB)

    Madic, C.

    1994-12-31

    Long term management of nuclear wastes, coming from fuel reprocessing may be improved on one condition, to separate the long half-time radioisotopes. The mainest are {sup 237N}p,{sup 241A}m-{sup 243A}m, {sup 243C}m-{sup 245C}m. 1 fig.

  12. 19 CFR 10.244 - Certificate of Origin.

    Science.gov (United States)

    2010-04-01

    ... though D 10.243(a)(2). F Handloomed, handmade, or folklore textile and apparel goods 10.243(a)(3). G... Producer Name & Address: 8. Handloomed, Handmade, or Folklore Article: 9. Name of Short Supply Fabric or... name of the folklore article or should state that the article is handloomed or handmade of handloomed...

  13. Gclust Server: 1358 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available Sequences Related Sequences(20) 243 biotin/lipoate A/B protein ligase family 60 1.00e-12 14.29 33.33 100...length 243 Representative annotation biotin/lipoate A/B protein ligase family Number of Sequences 60 Homologs

  14. The Fundamental Skills Training Project

    Science.gov (United States)

    2003-08-01

    Computers in Human Behavior . 1. 59-74. Slavin, R. E. (1990). Cooperative learning and the gifted: Who benefits? Journal for the... Computers in Human Behavior , 15, 243-254. ISIS Scores on Design Experiment Subscale (Skills Test) By Skill Level 1997-1998 0% 10% 20% 30% 40% 50...word problem solving. Computers in Human Behavior , 15, 243-254. ________________________________________________________________________

  15. Sacred Space and Sublime Sacramental Piety

    DEFF Research Database (Denmark)

    Petersen, Nils Holger

    2012-01-01

    Analyses and Discussions of Mozart's Sacramental Litanies K. 125 and K. 243 in relation to the notions of the Sacred and the Sublime.......Analyses and Discussions of Mozart's Sacramental Litanies K. 125 and K. 243 in relation to the notions of the Sacred and the Sublime....

  16. Browse Title Index

    African Journals Online (AJOL)

    Items 201 - 243 of 243 ... Vol 16, No 1 (2006), Women librarians in Ghana: their status and career development, Abstract. ohn-Oswald Amekuedee, Theodosia SA Adanu. Vol 17, No 1 (2007), Workplace, Biographical and Motivation Factors Affecting Organisational Commitment of Records Officers in Nigerian Federal ...

  17. Browse Title Index

    African Journals Online (AJOL)

    Items 201 - 243 of 243 ... Vol 20 (2011): Series C: Mathematical Sciences, Engineering and Technology, Web geoprocessing services on GML with a fast XML database, Abstract PDF. C Kagoyire. Vol 19 (2010): Series B: Social Sciences, Well-Being in Central Asia and the Caucasus, Abstract PDF. P Abbott, C Wallace, ...

  18. The Nature of Dynamic Arteriolar Vasoreactivity: A Mini-Review and A classification Scheme

    Science.gov (United States)

    1993-06-08

    microcirculation, central hemodynamics, and respiration in decerebrate rats. Am. J. Physiol., 243:H837-H843, 1982. 22. Faber, J.E., P.D. Harris and F.N...Miller. Microvascular sensitivity to PGE2 and PGI2 in skeletal muscle ot decerebrate rat. Am. J. Physiol., 243:H844- H851, 1982. 23. Salerud, E.G., T

  19. Petroleum hydrocarbons in surface sediments in Kandla creek (Gujarat)

    Digital Repository Service at National Institute of Oceanography (India)

    Kadam, A.N.

    stream_size 6 stream_content_type text/plain stream_name Mahasagar_20_243.pdf.txt stream_source_info Mahasagar_20_243.pdf.txt Content-Encoding ISO-8859-1 Content-Type text/plain; charset=ISO-8859-1 ...

  20. ORF Alignment: NC_005835 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available he Bacterial Chromosome Segregation Protein ... Soj pdb|1WCV|1 Chain 1, Structure Of The Bacterial ... Chromosome Segre...gation Protein Soj ... Length = 243 ... Query: 5 ... KVRRIALANQKGGVGKTTTAINLAAYLA... NC_005835 gi|46199907 >1wcv1 1 243 5 247 3e-93 ... pdb|2BEJ|A Chain A, Structure Of T

  1. Marine data and information management system for the Indian Ocean

    Digital Repository Service at National Institute of Oceanography (India)

    Sarupria, J.S.

    stream_size 5 stream_content_type text/plain stream_name IGBP_Symp_Changes_Global_Clim_Natural_Human_Act_1997_243.pdf.txt stream_source_info IGBP_Symp_Changes_Global_Clim_Natural_Human_Act_1997_243.pdf.txt Content-Encoding ISO-8859...

  2. Aetiology of vertigo in a Nigerian tertiary health facility, a ...

    African Journals Online (AJOL)

    Trauma occurred in 4(8.7%), Ocular pathology in 3(6.5%), while Vestibulotoxicity was found in 2(4.3%). Others include, Psychogenic causes in 2(4.3%) and vestibular neuronitis was the least found in 1(2.2%) of the patients. Laboratory investigations were unremarkable in all of the cases. Fasting blood sugar was found to ...

  3. Novel α-Tubulin Mutations Conferring Resistance to Dinitroaniline Herbicides in Lolium rigidum

    Directory of Open Access Journals (Sweden)

    Zhizhan Chu

    2018-02-01

    Full Text Available The dinitroaniline herbicides (particularly trifluralin have been globally used in many crops for selective grass weed control. Consequently, trifluralin resistance has been documented in several important crop weed species and has recently reached a level of concern in Australian Lolium rigidum populations. Here, we report novel mutations in the L. rigidum α-tubulin gene which confer resistance to trifluralin and other dinitroaniline herbicides. Nucleotide mutations at the highly conserved codon Arg-243 resulted in amino acid substitutions of Met or Lys. Rice calli transformed with the mutant 243-Met or 243-Lys α-tubulin genes were 4- to 8-fold more resistant to trifluralin and other dinitroaniline herbicides (e.g., ethalfluralin and pendimethalin compared to calli transformed with the wild type α-tubulin gene from L. rigidum. Comprehensive modeling of molecular docking predicts that Arg-243 is close to the trifluralin binding site on the α-tubulin surface and that replacement of Arg-243 by Met/Lys-243 results in a spatial shift of the trifluralin binding domain, reduction of trifluralin-tubulin contacts, and unfavorable interactions. The major effect of these substitutions is a significant rise of free interaction energy between α-tubulin and trifluralin, as well as between trifluralin and its whole molecular environment. These results demonstrate that the Arg-243 residue in α-tubulin is a determinant for trifluralin sensitivity, and the novel Arg-243-Met/Lys mutations may confer trifluralin resistance in L. rigidum.

  4. 75 FR 61050 - Removal From Regulation FD of the Exemption for Credit Rating Agencies

    Science.gov (United States)

    2010-10-04

    ... COMMISSION 17 CFR Part 243 Removal From Regulation FD of the Exemption for Credit Rating Agencies AGENCY... Securities and Exchange Commission amend Regulation FD to remove the specific exemption from the rule for... Commission is deleting Rule 100(b)(2)(iii) \\1\\ under Regulation FD.\\2\\ \\1\\ 17 CFR 243.100(b)(2)(iii). \\2\\ 17...

  5. Finding a Depression App: A Review and Content Analysis of the Depression App Marketplace

    Science.gov (United States)

    Shen, Nelson; Levitan, Michael-Jane; Johnson, Andrew; Bender, Jacqueline Lorene; Hamilton-Page, Michelle; Jadad, Alejandro (Alex) R

    2015-01-01

    Background Depression is highly prevalent and causes considerable suffering and disease burden despite the existence of wide-ranging treatment options. Mobile phone apps offer the potential to help close this treatment gap by confronting key barriers to accessing support for depression. Objectives Our goal was to identify and characterize the different types of mobile phone depression apps available in the marketplace. Methods A search for depression apps was conducted on the app stores of the five major mobile phone platforms: Android, iPhone, BlackBerry, Nokia, and Windows. Apps were included if they focused on depression and were available to people who self-identify as having depression. Data were extracted from the app descriptions found in the app stores. Results Of the 1054 apps identified by the search strategy, nearly one-quarter (23.0%, 243/1054) unique depression apps met the inclusion criteria. Over one-quarter (27.7%, 210/758) of the excluded apps failed to mention depression in the title or description. Two-thirds of the apps had as their main purpose providing therapeutic treatment (33.7%, 82/243) or psychoeducation (32.1%, 78/243). The other main purpose categories were medical assessment (16.9%, 41/243), symptom management (8.2%, 20/243), and supportive resources (1.6%, 4/243). A majority of the apps failed to sufficiently describe their organizational affiliation (65.0%, 158/243) and content source (61.7%, 150/243). There was a significant relationship (χ 2 5=50.5, Pbook (20.6%, 50/243), audio therapy (16.9%, 41/243), or screening (16.9%, 41/243) function. Most apps had a dynamic user interface (72.4%, 176/243) and used text as the main type of media (51.9%, 126/243), and over a third (14.4%, 35/243) incorporated more than one form of media. Conclusion Without guidance, finding an appropriate depression app may be challenging, as the search results yielded non-depression–specific apps to depression apps at a 3:1 ratio. Inadequate reporting of

  6. Finding a depression app: a review and content analysis of the depression app marketplace.

    Science.gov (United States)

    Shen, Nelson; Levitan, Michael-Jane; Johnson, Andrew; Bender, Jacqueline Lorene; Hamilton-Page, Michelle; Jadad, Alejandro Alex R; Wiljer, David

    2015-02-16

    Depression is highly prevalent and causes considerable suffering and disease burden despite the existence of wide-ranging treatment options. Mobile phone apps offer the potential to help close this treatment gap by confronting key barriers to accessing support for depression. Our goal was to identify and characterize the different types of mobile phone depression apps available in the marketplace. A search for depression apps was conducted on the app stores of the five major mobile phone platforms: Android, iPhone, BlackBerry, Nokia, and Windows. Apps were included if they focused on depression and were available to people who self-identify as having depression. Data were extracted from the app descriptions found in the app stores. Of the 1054 apps identified by the search strategy, nearly one-quarter (23.0%, 243/1054) unique depression apps met the inclusion criteria. Over one-quarter (27.7%, 210/758) of the excluded apps failed to mention depression in the title or description. Two-thirds of the apps had as their main purpose providing therapeutic treatment (33.7%, 82/243) or psychoeducation (32.1%, 78/243). The other main purpose categories were medical assessment (16.9%, 41/243), symptom management (8.2%, 20/243), and supportive resources (1.6%, 4/243). A majority of the apps failed to sufficiently describe their organizational affiliation (65.0%, 158/243) and content source (61.7%, 150/243). There was a significant relationship (χ(2) 5=50.5, P<.001) between the main purpose of the app and the reporting of content source, with most medical assessment apps reporting their content source (80.5%, 33/41). A fifth of the apps featured an e-book (20.6%, 50/243), audio therapy (16.9%, 41/243), or screening (16.9%, 41/243) function. Most apps had a dynamic user interface (72.4%, 176/243) and used text as the main type of media (51.9%, 126/243), and over a third (14.4%, 35/243) incorporated more than one form of media. Without guidance, finding an appropriate

  7. Measurements of the neutron capture cross sections and incineration potentials of minor-actinides in high thermal neutron fluxes: Impact on the transmutation of nuclear wastes; Mesures des sections efficaces de capture et potentiels d'incineration des actinides mineurs dans les hauts flux de neutrons: Impact sur la transmutation des dechets

    Energy Technology Data Exchange (ETDEWEB)

    Bringer, O

    2007-10-15

    This thesis comes within the framework of minor-actinide nuclear transmutation studies. First of all, we have evaluated the impact of minor actinide nuclear data uncertainties within the cases of {sup 241}Am and {sup 237}Np incineration in three different reactor spectra: EFR (fast), GT-MHR (epithermal) and HI-HWR (thermal). The nuclear parameters which give the highest uncertainties were thus highlighted. As a result of fact, we have tried to reduce data uncertainties, in the thermal energy region, for one part of them through experimental campaigns in the moderated high intensity neutron fluxes of ILL reactor (Grenoble). These measurements were focused onto the incineration and transmutation of the americium-241, the curium-244 and the californium-249 isotopes. Finally, the values of 12 different cross sections and the {sup 241}Am isomeric branching ratio were precisely measured at thermal energy point. (author)

  8. A gas secondary electron detector

    CERN Document Server

    Drouart, A; Alamanos, N; Auger, F; Besson, P; Bougamont, E; Bourgeois, P; Lobo, G; Pollacco, E C; Riallot, M

    2002-01-01

    A new Secondary Electron gas Detector (SED) is under development to be used in conjunction with an emissive foil to detect low energy heavy ions as an alternative to micro-channel plates. It could measure position and time of flight. Secondary electrons are accelerated to 10 keV so that they can cross through the 0.9 mu m Mylar entrance window. The electrons then are multiplied in the isobutane gas of the detector at 4-10 Torr. A time resolution of 150 ps and a spatial resolution of 3 mm have been obtained by using californium fission fragments on a prototype detector of 7x7 cm sup 2. The advantage of the SED against MCP is that its size is not limited. Our final goal is to build a large size detector (15x40 cm sup 2) that will operate at the focal plane of the VAMOS magnetic spectrometer at GANIL.

  9. Environmental assessment of the thermal neutron activation explosive detection system for concourse use at US airports

    Energy Technology Data Exchange (ETDEWEB)

    Jones, C.G.

    1990-08-01

    This document is an environmental assessment of a system designed to detect the presence of explosives in checked airline baggage or cargo. The system is meant to be installed at the concourse or lobby ticketing areas of US commercial airports and uses a sealed radioactive source of californium-252 to irradiate baggage items. The major impact of the use of this system arises from direct exposure of the public to scattered or leakage radiation from the source and to induced radioactivity in baggage items. Under normal operation and the most likely accident scenarios, the environmental impacts that would be created by the proposed licensing action would not be significant. 44 refs., 19 figs., 18 tabs.

  10. Chelation and stabilization of berkelium in oxidation state +IV

    Science.gov (United States)

    Deblonde, Gauthier J.-P.; Sturzbecher-Hoehne, Manuel; Rupert, Peter B.; An, Dahlia D.; Illy, Marie-Claire; Ralston, Corie Y.; Brabec, Jiri; de Jong, Wibe A.; Strong, Roland K.; Abergel, Rebecca J.

    2017-09-01

    Berkelium (Bk) has been predicted to be the only transplutonium element able to exhibit both +III and +IV oxidation states in solution, but evidence of a stable oxidized Bk chelate has so far remained elusive. Here we describe the stabilization of the heaviest 4+ ion of the periodic table, under mild aqueous conditions, using a siderophore derivative. The resulting Bk(IV) complex exhibits luminescence via sensitization through an intramolecular antenna effect. This neutral Bk(IV) coordination compound is not sequestered by the protein siderocalin—a mammalian metal transporter—in contrast to the negatively charged species obtained with neighbouring trivalent actinides americium, curium and californium (Cf). The corresponding Cf(III)-ligand-protein ternary adduct was characterized by X-ray diffraction analysis. Combined with theoretical predictions, these data add significant insight to the field of transplutonium chemistry, and may lead to innovative Bk separation and purification processes.

  11. The CARIBU EBIS control and synchronization system

    Science.gov (United States)

    Dickerson, Clayton; Peters, Christopher

    2015-01-01

    The Californium Rare Isotope Breeder Upgrade (CARIBU) Electron Beam Ion Source (EBIS) charge breeder has been built and tested. The bases of the CARIBU EBIS electrical system are four voltage platforms on which both DC and pulsed high voltage outputs are controlled. The high voltage output pulses are created with either a combination of a function generator and a high voltage amplifier, or two high voltage DC power supplies and a high voltage solid state switch. Proper synchronization of the pulsed voltages, fundamental to optimizing the charge breeding performance, is achieved with triggering from a digital delay pulse generator. The control system is based on National Instruments realtime controllers and LabVIEW software implementing Functional Global Variables (FGV) to store and access instrument parameters. Fiber optic converters enable network communication and triggering across the platforms.

  12. Off-line commissioning of EBIS and plans for its integration into ATLAS and CARIBU

    Energy Technology Data Exchange (ETDEWEB)

    Ostroumov, P. N., E-mail: ostroumov@anl.gov; Barcikowski, A.; Dickerson, C. A.; Mustapha, B.; Perry, A.; Sharamentov, S. I.; Vondrasek, R. C.; Zinkann, G. [Argonne National Laboratory, Argonne, Illinois 60439 (United States)

    2016-02-15

    An Electron Beam Ion Source Charge Breeder (EBIS-CB) has been developed at Argonne to breed radioactive beams from the CAlifornium Rare Isotope Breeder Upgrade (CARIBU) facility at Argonne Tandem Linac Accelerator System (ATLAS). The EBIS-CB will replace the existing ECR charge breeder to increase the intensity and significantly improve the purity of reaccelerated radioactive ion beams. The CARIBU EBIS-CB has been successfully commissioned offline with an external singly charged cesium ion source. The performance of the EBIS fully meets the specifications to breed rare isotope beams delivered from CARIBU. The EBIS is being relocated and integrated into ATLAS and CARIBU. A long electrostatic beam transport system including two 180° bends in the vertical plane has been designed. The commissioning of the EBIS and the beam transport system in their permanent location will start at the end of this year.

  13. Populations of selected microbial and fungal species growing on the surface of rape seeds following treatment with desiccants or plant growth regulators.

    Science.gov (United States)

    Frac, Magdalena; Jezierska-Tys, Stefania; Tys, Jerzy

    2010-01-01

    The aim of this study was to determine the effects of desiccants and plant growth regulators on selected microbial species affecting rape seeds, with special emphasis on the growth of fungi and identification of the genus and species composition. The experimental material in the study was seeds of winter rape cv. Californium that were collected from the field during combine harvest. The chemical agents applied, both desiccants and growth regulators, generally decreased the populations of bacteria occurring on the surface of rape seeds. The responses of fungi depended upon the type of agent applied and were manifested as either stimulation or inhibition of the growth of the fungal species. The fungi isolated from the surface of rape seeds were characteristic of those found in the field environment (Cladosporium and Penicillium) and typical for those present on the surface of rape seeds (Alternaria).

  14. Reliability of semiconductor and gas-filled diodes for over-voltage protection exposed to ionizing radiation

    Directory of Open Access Journals (Sweden)

    Stanković Koviljka

    2009-01-01

    Full Text Available The wide-spread use of semiconductor and gas-filled diodes for non-linear over-voltage protection results in a variety of possible working conditions. It is therefore essential to have a thorough insight into their reliability in exploitation environments which imply exposure to ionizing radiation. The aim of this paper is to investigate the influence of irradiation on over-voltage diode characteristics by exposing the diodes to californium-252 combined neutron/gamma radiation field. The irradiation of semiconductor over-voltage diodes causes severe degradation of their protection characteristics. On the other hand, gas-filled over-voltage diodes exhibit a temporal improvement of performance. The results are presented with the accompanying theoretical interpretations of the observed changes in over-voltage diode behaviour, based on the interaction of radiation with materials constituting the diodes.

  15. Triton and alpha-particle contribution from LiF converter for neutron dosimeter

    CERN Document Server

    Camacho, M E; Balcazar, M

    1999-01-01

    A personnel neutron dosimeter prototype based on chemical and electrochemical etched CR-39 detector, combined with LiF converter, has been calibrated using an ICRP-like phantom, under a heavy-water moderated Californium source neutron spectra; A conversion factor of 1.052+-126 spots cm sup - sup 2 mSv sup - sup 1 was obtained. The sealing properties of the detector holder showed a ten-fold reduction in radon background when it was tested in a high radon atmosphere. A convenient mechanical shock resistance was achieved in LiF converters by sintering to 11 tons pressure LiF powder at 650 deg. C, during one hour.

  16. Chromosome band 16q24 is frequently deleted in human gastric cancer

    OpenAIRE

    Mori, Y; Matsunaga, M; Abe, T.; Fukushige, S; Miura, K; Sunamura, M; Shiiba, K; Sato, M.; Nukiwa, T.; Horii, A

    1999-01-01

    We have analysed the loss of heterozygosity (LOH) on chromosome bands 16q22?q24 in 24 primary gastric cancer tissues and found three regions of frequent allelic loss (16q22, 16q24.1?q24.3 and 16q24.3). The region for the most frequent allelic loss (63%) was in 16q24.1?q24.3. LOH of this region had no relationship with histological subtype, but a significant association between LOH and microscopic lymphangial invasion was observed. Although not significant, vascular and gastric wall invasions ...

  17. Study of reproducibility of measurements with the spectrometer of Bonner multispheres

    Energy Technology Data Exchange (ETDEWEB)

    Azevedo, G.A.; Pereira, W.W.; Patrao, K.C.S.; Fonseca, E.S., E-mail: geisadeazevedo@gmail.com, E-mail: walsan@ird.gov.br, E-mail: karla@ird.gov.br, E-mail: evaldo@ird.gov.br [Instituto de Radionprotecao e Dosimetria (IRD/CNEN-RJ), Rio de Janeiro, RJ (Brazil)

    2013-07-01

    This work aims to study the metrological behavior of the Bonner Multisphere Spectrometer (BMS) of the LN / LNMRI / IRD - Laboratorio Metrologia de Neutrons / Laboratorio Nacional de Metrologia e Radiacao Ionizante / Instituto de Radioprotecao e Dosimetria, for measurements in repeatability and reproducibility conditions. Initially, a simulation was done by applying the Monte Carlo method, using the MCNP code and respecting the ISO 8529-1 (2001), using the sources of Californium ({sup 252} Cf), Americium-Beryllium ({sup 241} AmBe) and californium in heavy water (Cf + D{sub 2}O), all located at a distance of 100 cm from the neutron detector ({sup 6}Li (Eu) - crystal scintillator). In this program, the counting of neutrons that are captured by the detector was made. The source is located in the center of a sphere of radius 300 cm. Analyzes the impact of these neutrons in a point of the sphere wall, which in this case acted as a neutron detector and from there, it is estimated the number of neutrons that collide in the whole sphere. The purpose is to obtain the neutron count for different energy bands in a solid field of neutrons, since they have a spectrum ranging from a low to a high energy that can also vary within a particular environment. Wishes to obtain new fields with different sources and moderators materials to be used as new reference fields. Measurements are being conducted for these fields, with the aim of analyzing the variability conditions of the measurement (repeatability and reproducibility) in LEN - Laboratorio de Espectrometria de Neutrons of the LN/LMNRI/IRD. Thus, the spectrometer will be used to improve both the knowledge of the spectrum as the standard of neutrons of the lab, proving that a spectrometry is essential for correct measurement.

  18. To Green or Not to Green: A Political, Economic and Social Analysis for the Past Failure of Green Logistics

    National Research Council Canada - National Science Library

    Matthias Klumpp

    2016-01-01

      The objective of green logistics has thus far failed. For example, the share of greenhouse gas emissions by the transportation and logistics sector in Europe rose from 16.6% in 1990 to 24.3% in 2012...

  19. Effects of soil solarization and some amendments to control ...

    African Journals Online (AJOL)

    hope&shola

    2010-10-04

    borne pathogens ... samples of diseased trees were confirmed by pathogen isolations from affected twigs during the ..... mulching for controlling Verticillium wilt in established pistachio nut groves. Phytopathology, 72: 243- 246.

  20. Large-scale evaluation of carnivore road mortality: the effect of landscape and local scale characteristics

    Czech Academy of Sciences Publication Activity Database

    Červinka, J.; Riegert, J.; Grill, S.; Šálek, Martin

    2015-01-01

    Roč. 60, č. 3 (2015), s. 233-243 ISSN 2199-2401 Institutional support: RVO:68081766 Keywords : Carnivores * Landscape characteristics * Linear structures * Local characteristics * Road mortality * Temporal pattern Subject RIV: EH - Ecology, Behaviour

  1. GALILEO SSI/IDA RADIOMETRICALLY CALIBRATED IMAGES V1.0

    Data.gov (United States)

    National Aeronautics and Space Administration — This data set includes Galileo Orbiter SSI radiometrically calibrated images of the asteroid 243 Ida, created using ISIS software and assuming nadir pointing. This...

  2. STOOKE SMALL BODY SHAPE MODELS V2.0

    Data.gov (United States)

    National Aeronautics and Space Administration — This data set contains Philip Stooke shape models for 243 Ida, 253 Mathilde, 951 Gaspra, comet Halley, J5 Amalthea, J14 Thebe, N7 Larissa, N8 Proteus, S10 Janus, S11...

  3. HIRES NIMS IDA SPECTRAL IMAGE CUBES

    Data.gov (United States)

    National Aeronautics and Space Administration — This data volume contains 17 channel spectral image cubes of asteroid 243 Ida ranging from 0.7 to 5.2 micrometers in wavelength in cgs units of radiance. These data...

  4. Dicty_cDB: Contig-U00723-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available lus Query: 4 tttaaaggaacaatttggaaaagntttagctnggnttggnaanttaaaanaanaaggttn 63 |||||||||||||||||||||||||||||||...||||||||||||||||||||||||||||| Sbjct: 4 tttaaaggaacaatttggaaaagntttagctnggnttggnaanttaaaanaan...aagacaaaaaccanaagggacatttttagggggntt 183 Query: 184 cncaanaagngaaaanggggnnnacncaatttctaaagntagnaanaannnnnnna...tttc 243 ||||||||||||||||||||||||||||||||||||||||||||||||| ||||| Sbjct: 184 cncaanaagngaaaanggggnnnacncaatttctaaagntagnaanaan...entities = 291/364 (79%) Strand = Plus / Plus Query: 28 tttagctnggnttggnaanttaaaanaan

  5. Data of evolutionary structure change: 1DC3B-1VSVC [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1DC3B-1VSVC 1DC3 1VSV B C TIKVGINGFGRIGRIVFRAAQKRSDIEIVAINDL-LDAD...SNASCTTNCLAPLAKVINDNFGIIEGLMTTVHATTATQKTVDGPS--HKDWRGGRGASQNIIPSSTGAAKAVGKVLPELNGKLTGMAFRVPTPNVSVVDLTVRLEKAA...GRCAGNNIIPASTGAAKAVGKVIPALNGKLTGMAIRVPTPDVSVVDLTCKLAKPASIEEIYQAVKEASNGPMKGIMGYTSD... 243 ALA CA 310 ASP CA 265 TYR CA 267 1VSV... C 1VSVC

  6. K některým otázkám etnochoreologického studia: tanec, gender a politika

    Czech Academy of Sciences Publication Activity Database

    Stavělová, Daniela

    2010-01-01

    Roč. 20, č. 4 (2010), s. 239-243 ISSN 0862-8351 Institutional research plan: CEZ:AV0Z90580513 Keywords : dance * gender * politics * national movement * identity Subject RIV: AC - Archeology, Anthropology, Ethnology

  7. Dealing with food allergies in babies and children

    National Research Council Canada - National Science Library

    Joneja, Janice M. Vickerstaff

    2007-01-01

    ... . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 231 CHAPTER 14 CornAllergy ...243 CHAPTER 15 SeafoodAllergy ...253 CHAPTER 16 The Top Ten Allergens: Avoidance of Milk, Egg, Wheat, Corn, Peanuts, Soy, Tree Nuts...

  8. Africa Development - Vol 42, No 1 (2017)

    African Journals Online (AJOL)

    Producing and Reproducing Inequality: Biopolitical Exclusion, Marginalized Bodies and AIDS Care in Central Mozambique · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Carla Teófilo Braga, 221-243 ...

  9. Tagasi Pariisis / Karl Rumor

    Index Scriptorium Estoniae

    Rumor, Karl, pseud., 1886-1971

    2008-01-01

    Prantsusmaa sisepoliitilisest olustikust. Poliitilistest oludest 1937. aasta Euroopas, sõjameeleoludest Vahemerel, Nyloni konverentsist. Varem ilmunud: Uus Eesti 21. juuni 1937, nr. 166; 8., 13. sept. 1937, nr. 243, 248

  10. Dutch occupational physicians and general practitioners wish to improve cooperation

    NARCIS (Netherlands)

    Buijs, P.; Amstel, R. van; Dijk, F. van

    1999-01-01

    Objectives - To investigate cooperation between occupational physicians (OPs) and general practitioners (GPs). Methods - Literature review; structured interviews; questionnaires sent to randomised samples of OPs (n = 232) and GPs (n = 243). Results - Actual cooperation is poor. However, more than

  11. Download this PDF file

    African Journals Online (AJOL)

    Nishant-3

    2Division of Animal Genetics, Indian Veterinary Research Institute, Izatnagar, Bareilly-243 122, India. ... the main source of meat, milk and draft power (Basar,. 2002). Mithun .... comparisons by MEGALIGN and chromatograph evaluation by.

  12. 'No jäägu jummal mu jälile...' : Mõtteid setu rahvuseeposest / Ruth Mirov

    Index Scriptorium Estoniae

    Mirov, Ruth

    1996-01-01

    Ilmunud ka kogumikus: Mirov, Ruth. Sõnast sõnasse : valik artikleid ja retsensioone. Tallinn ; Tartu : Eesti Keele Sihtasutus, 2002, lk. 231-243. Peko : Setu rahvuseepos / Laulnud Anne Vabarna; Toim. Paul Hagu ja Seppo Suhonen. Kuopio : Snellmann-instituutti, 1995

  13. Congenital malaria: an overview

    African Journals Online (AJOL)

    related mortality and morbidity particularly in Africa, South-East Asia, Eastern. Mediterranean Regions and parts of South America (WHO 2008). In the World Malaria Report. (WMR) of 2009 the World Health Organization (WHO) estimated that 243 ...

  14. NT-proBNP and Circulating Inflammation Markers in Prediction of a Normal Myocardial Scintigraphy in Patients with Symptoms of Coronary Artery Disease

    DEFF Research Database (Denmark)

    Rathcke, C.N.; Kjøller, Erik; Fogh-Andersen, N.

    2010-01-01

    Background: Myocardial perfusion imaging (MPI) can detect myocardial perfusion abnormalities but many examinations are without pathological findings. This study examines whether circulating biomarkers can be used as screening modality prior to MPI. Methodology/Principal Findings: 243 patients...

  15. Highland Medical Research Journal: Contact

    African Journals Online (AJOL)

    Principal Contact. Professor Emmanuel I Agaba Editor-in-Chief Department of Medicine. Department of Medicine. Jos University Teaching Hospital. PMB 2076. Jos, Nigeria. Phone: +2348037001392. Fax: +243 073454172. Email: highmedresj@gmail.com ...

  16. 78 FR 78302 - Proposed Modification and Establishment of Air Traffic Service (ATS) Routes in the Vicinity of...

    Science.gov (United States)

    2013-12-26

    ... airway route segment of V-243 between BWG and TTH described above. The proposed routing of T-325 between... scope of that authority as it would modify the route structure as necessary to preserve the safe and...

  17. Protein (Cyanobacteria): 13693 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available YP_007119861.1 1117:243 1150:1292 44471:3625 1173027:891 KGK domain protein Microcoleus sp. PCC 7113 MVKRHEL...LENNAIVSVKAFDLILMPHVTFKMSEFIERLGAVLGISGDKWRRWGFEGVESEILSPGKGWRKGTIRLTLEFLPDESELEVTEINKEIEQPESPLDDIRRMINENS ...

  18. The contribution of IL-6 to beta 3 adrenergic receptor mediated adipose tissue remodeling

    Science.gov (United States)

    Buzelle, Samyra L; MacPherson, Rebecca E K; Peppler, Willem T; Castellani, Laura; Wright, David C

    2015-01-01

    The chronic activation of beta 3 adrenergic receptors results in marked alterations in adipose tissue morphology and metabolism, including increases in mitochondrial content and the expression of enzymes involved in lipogenesis and glyceroneogenesis. Acute treatment with CL 316,243, a beta 3 adrenergic agonist, induces the expression of interleukin 6. Interestingly, IL-6 has been shown to induce mitochondrial genes in cultured adipocytes. Therefore, the purpose of this paper was to examine the role of interleukin 6 in mediating the in vivo effects of CL 316,243 in white adipose tissue. Circulating IL-6, and markers of IL-6 signaling in white adipose tissue were increased 4 h following a single injection of CL 316,243 in C57BL6/J mice. Once daily injections of CL 316,243 for 5 days increased the protein content of a number of mitochondrial proteins including CORE1, Cytochrome C, PDH, MCAD, and Citrate Synthase to a similar extent in adipose tissue from WT and IL-6−/− mice. Conversely, CL 316,243-induced increases in COXIV and phosphorylated AMPK were attenuated in IL-6−/− mice. Likewise, the slight, but significant, CL 316,243-induced increases in ATGL, PEPCK, and PPARγ, were reduced or absent in adipose tissue IL-6−/− mice. The attenuated response to CL 316,243 in white adipose tissue in IL-6−/− mice was associated with reductions in whole-body oxygen consumption and energy expenditure in the light phase. Our findings suggest that IL-6 plays a limited role in CL 316,243-mediated adipose tissue remodeling. PMID:25713332

  19. EST Table: FS863113 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available FS863113 E_FL_fner_20N15_R_0 10/09/28 48 %/243 aa ref|XP_975194.1| PREDICTED: similar to something.../249 aa gnl|Amel|GB19080-PA 10/09/10 48 %/243 aa gi|91081571|ref|XP_975194.1| PREDICTED: similar to something about silencing protein 10 [Tribolium castaneum] FS823506 fner ...

  20. The Environment in Denmark 1999

    DEFF Research Database (Denmark)

    Utzon-Frank, T.; Andersen, B.; Lausen, J.

    Rapporten opdateres årligt og er baseret på: The State of the Environment in Denmark 1997. NERI Technical Report 243, 1998.; Den danske udgave: Natur og Miljø 1999. Udvalgte indikatorer.......Rapporten opdateres årligt og er baseret på: The State of the Environment in Denmark 1997. NERI Technical Report 243, 1998.; Den danske udgave: Natur og Miljø 1999. Udvalgte indikatorer....

  1. Environmental Assessment Construction of a New Fire Station, Wright-Patterson Air Force Base

    Science.gov (United States)

    2003-09-01

    designated to receive additional attention and more intensive maintenance. Vegetation in this area consists primarily of grasses, with few weeds ...Figure 2.4-1). Dominant species include tall fescue (Festuca arundinacea), Kentucky bluegrass (Poa pratensis), dandelion (Taraxacum officinale), and...and weeds (Figures 2.4-3b and 2.4-3c). Some ornamental and ordinary trees are also present. Building 30201 is in an area designated as “enhanced

  2. ICO Topical Meeting on Atmospheric, Volume and Surface Scattering and Propagation Held in Florence, Italy on 27-30 August 1991

    Science.gov (United States)

    1991-01-01

    R. Machorro, J.M. Siqueiros : Ran Roughness Characterization of CaF2/Ag and Ag/CaF2 Systems ................. 243 SCATTERING R. Maynard: Multiple...SHISHKAREV A.A. 433 SHISHKARIEV A.A. 505 VAISHYA J.S. 339 SINEV S.N. 411 VALERO P.J. 389 SINGH U.N. 533 VAN ALBADA M.P. 213 SIQUEIROS J.M. 243 VAN C.L

  3. The EhADH112 recombinant polypeptide inhibits cell destruction and liver abscess formation by Entamoeba histolytica trophozoites.

    Science.gov (United States)

    Martínez-López, Carolina; Orozco, Esther; Sánchez, Tomás; García-Pérez, Rosa María; Hernández-Hernández, Fidel; Rodríguez, Mario A

    2004-04-01

    The Entamoeba histolytica EhCPADH complex, formed by a cysteine proteinase (EhCP112) and an adhesin (EhADH112), is involved in adherence, phagocytosis and cytolysis. This makes this complex an attractive candidate as a vaccine against amoebiasis. Here, we produced the recombinant polypeptide EhADH243, which includes the adherence epitope detected by a monoclonal antibody against the EhCPADH complex. EhADH243 was purified, and the effect of the polypeptide on in vitro and in vivo virulence was studied. Antibodies against EhADH243 reacted with the EhCPADH complex and with the recombinant polypeptide. EhADH243 and antibodies against this polypeptide inhibited adherence, phagocytosis and destruction of cell monolayers by live trophozoites, but had little effect on cell monolayer destruction by trophozoite extracts. EhADH243 recognized a 97 kDa protein in the MDCK membrane fraction that could be a putative receptor for E. histolytica trophozoites. Hamsters immunized with EhADH243 developed humoral response against EhCPADH, and animals were partially protected from amoebic liver abscess.

  4. Description of Three New α Variants and Four New β Variants: Hb Montluel [α110(G17)Ala → Val; HBA1: c.332C > T], Hb Cap d'Agde [α131(H14)Ser → Cys; HBA2: c.395C > G] and Hb Corsica [α100(G7)Leu → Pro; HBA1: 302T > C]; Hb Nîmes [β104(G6)Arg → Gly; HBB: c.313A > G], Hb Saint Marcellin [β112(G14)Cys → Gly; HBB: c.337T > G], Hb Saint Chamond [β80(EF4)Asn → 0; HBB: c.241_243delAAC] and Hb Dompierre [β29(B11)Gly → Arg; HBB: c.88G > C].

    Science.gov (United States)

    Renoux, Céline; Feray, Cécile; Joly, Philippe; Lacan, Philippe; Francina, Alain

    2015-01-01

    We present here seven new hemoglobin (Hb) variants identified during routine Hb analysis. All of them are caused by a missense mutation except Hb Saint Chamond, which results from an in-frame deletion of the asparagine residue at β80. All these variants are clinically silent in the heterozygous state but two of them (Hb Cap d'Agde and Hb Dompierre) may be unstable, whereas Hb Nîmes could present a very slightly elevated oxygen affinity. These data are to be confirmed by appropriate biochemical tests.

  5. Functional Characterization of a Novel Truncating Mutation in Lamin A/C Gene in a Family with a Severe Cardiomyopathy with Conduction Defects.

    Science.gov (United States)

    Gerbino, Andrea; Bottillo, Irene; Milano, Serena; Lipari, Martina; Zio, Roberta De; Morlino, Silvia; Mola, Maria Grazia; Procino, Giuseppe; Re, Federica; Zachara, Elisabetta; Grammatico, Paola; Svelto, Maria; Carmosino, Monica

    2017-12-04

    Truncating LMNA gene mutations occur in many inherited cardiomyopathy cases, but the molecular mechanisms involved in the disease they cause have not yet been systematically investigated. Here, we studied a novel frameshift LMNA variant (p.D243Gfs*4) identified in three members of an Italian family co-segregating with a severe form of cardiomyopathy with conduction defects. HEK293 cells and HL-1 cardiomyocytes were transiently transfected with either Lamin A or D243Gfs*4 tagged with GFP (or mCherry). D243Gfs*4 expression, cellular localization and its effects on diverse cellular mechanisms were evaluated with western blotting, laser-scanning confocal microscopy and video-imaging analysis in single cells. When expressed in HEK293 cells, GFP- (or mCherry)-tagged LMNA D243Gfs*4 colocalized with calnexin within the ER. ER mislocalization of LMNA D243Gfs*4 did not significantly induce ER stress response, abnormal Ca2+ handling and apoptosis when compared with HEK293 cells expressing another truncated mutant of LMNA (R321X) which similarly accumulates within the ER. Of note, HEK293-LMNA D243Gfs*4 cells showed a significant reduction of connexin 43 (CX43) expression level, which was completely rescued by activation of the WNT/β-catenin signaling pathway. When expressed in HL-1 cardiomyocytes, D243Gfs*4 significantly impaired the spontaneous Ca2+ oscillations recorded in these cells as result of propagation of the depolarizing waves through the gap junctions between non-transfected cells surrounding a cell harboring the mutation. Furthermore, mCh-D243Gfs*4 HL-1 cardiomyocytes showed reduced CX43-dependent Lucifer Yellow (LY) loading and propagation. Of note, activation of β-catenin rescued both LY loading and LMNA D243Gfs*4 -HL-1 cells spontaneous activity propagation. Overall, the present results clearly indicate the involvement of the aberrant CX43 expression/activity as a pathogenic mechanism for the conduction defects associated to this LMNA truncating alteration.

  6. Functional Characterization of a Novel Truncating Mutation in Lamin A/C Gene in a Family with a Severe Cardiomyopathy with Conduction Defects

    Directory of Open Access Journals (Sweden)

    Andrea Gerbino

    2017-12-01

    Full Text Available Background/Aims: Truncating LMNA gene mutations occur in many inherited cardiomyopathy cases, but the molecular mechanisms involved in the disease they cause have not yet been systematically investigated. Here, we studied a novel frameshift LMNA variant (p.D243Gfs*4 identified in three members of an Italian family co-segregating with a severe form of cardiomyopathy with conduction defects. Methods: HEK293 cells and HL-1 cardiomyocytes were transiently transfected with either Lamin A or D243Gfs*4 tagged with GFP (or mCherry. D243Gfs*4 expression, cellular localization and its effects on diverse cellular mechanisms were evaluated with western blotting, laser-scanning confocal microscopy and video-imaging analysis in single cells. Results: When expressed in HEK293 cells, GFP- (or mCherry-tagged LMNA D243Gfs*4 colocalized with calnexin within the ER. ER mislocalization of LMNA D243Gfs*4 did not significantly induce ER stress response, abnormal Ca2+ handling and apoptosis when compared with HEK293 cells expressing another truncated mutant of LMNA (R321X which similarly accumulates within the ER. Of note, HEK293-LMNA D243Gfs*4 cells showed a significant reduction of connexin 43 (CX43 expression level, which was completely rescued by activation of the WNT/β-catenin signaling pathway. When expressed in HL-1 cardiomyocytes, D243Gfs*4 significantly impaired the spontaneous Ca2+ oscillations recorded in these cells as result of propagation of the depolarizing waves through the gap junctions between non-transfected cells surrounding a cell harboring the mutation. Furthermore, mCh-D243Gfs*4 HL-1 cardiomyocytes showed reduced CX43-dependent Lucifer Yellow (LY loading and propagation. Of note, activation of β-catenin rescued both LY loading and LMNA D243Gfs*4 -HL-1 cells spontaneous activity propagation. Conclusion: Overall, the present results clearly indicate the involvement of the aberrant CX43 expression/activity as a pathogenic mechanism for the

  7. Effects of a novel beta(3)-adrenoceptor agonist, AJ-9677, on relaxation of the detrusor muscle: an in vitro study.

    Science.gov (United States)

    Otsuka, Atsushi; Shinbo, Hitoshi; Hasebe, Ko; Matsumoto, Rikiya; Ozono, Seiichiro

    2008-12-01

    To examine the relaxant effects of AJ-9677, a novel beta(3)-adrenoceptor agonist, on the isolated rat, monkey and human detrusor muscle. The isolated detrusor strips of rats, monkeys and humans were mounted in organ baths containing Krebs solution. By the cumulative addition of beta-adrenoceptor agonists (isoproterenol, AJ-9677, CL 316,243 and salbutamol in rats; isoproterenol, AJ-9677 and CL 316,243 in monkeys and humans), concentration-relaxation curves were obtained. The maximal relaxation responses and pEC(50) values were calculated. In rats, concentration-relaxation curves to isoproterenol and AJ-9677 were obtained in the presence and absence of propranolol or SR 59230A. Isoproterenol, AJ-9677, CL 316,243 and salbutamol induced concentration-dependent relaxation in rats. The rank order of their relaxing potency in the rat detrusor muscle was AJ-9677 > isoproterenol > CL 316,243 > salbutamol. Isoproterenol and AJ-9677 also produced a concentration-dependent relaxation with high potency in monkeys and humans, whilst CL 316,243 had low relaxing potency. According to the antagonist studies in rats, propranolol and SR 59230A caused a rightward shift of the concentration-relaxation curves to isoproterenol or AJ-9677, respectively. AJ-9677 has a high relaxant potency on the rat, monkey and human detrusor smooth muscle, and it may have the potential to treat overactive bladder.

  8. Dicty_cDB: Contig-U10800-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available (217), Expect = 7e-16 Identities = 59/190 (31%), Positives = 81/190 (42%), Gaps = 14/190 (7%) Frame = +3...(216), Expect = 9e-16 Identities = 74/260 (28%), Positives = 99/260 (38%), Gaps = 52/260 (20%) Frame = +3...(211), Expect = 3e-15 Identities = 64/230 (27%), Positives = 89/230 (38%), Gaps = 44/230 (19%) Frame = +3...(203), Expect = 3e-14 Identities = 65/203 (32%), Positives = 85/203 (41%), Gaps = 17/203 (8%) Frame = +3...(201), Expect = 5e-14 Identities = 67/243 (27%), Positives = 93/243 (38%), Gaps = 40/243 (16%) Frame = +3

  9. Dicty_cDB: CFD659 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFD659 (Link to dictyBase) - - - Contig-U16243-1 CFD659F (Link to Original site) CFD...659F 608 - - - - - - Show CFD659 Library CF (Link to library) Clone ID CFD659 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/CF/CFD6-C/CFD659Q.Seq.d/ Representative seq. ID CFD65...9F (Link to Original site) Representative DNA sequence >CFD659 (CFD659Q) /CSM/CF/CFD6-C/CFD659Q.Seq.d/ ATATA...05 0.0 SFD243 (SFD243Q) /CSM/SF/SFD2-B/SFD243Q.Seq.d/ 1205 0.0 CFF662 (CFF662Q) /CSM/CF/CFF6-C/CFF662Q.Seq.d/ 1205 0.0 CFD659 (CFD

  10. Dicty_cDB: SLJ605 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLJ605 (Link to dictyBase) - - - Contig-U16284-1 SLJ605Z (Link... to Original site) - - SLJ605Z 253 - - - - Show SLJ605 Library SL (Link to library) Clone ID SLJ605 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLJ6-A/SLJ605Q.Seq.d/ Representative seq. ID SLJ60...5Z (Link to Original site) Representative DNA sequence >SLJ605 (SLJ605Q) /CSM/SL/SLJ6-A/SLJ605Q.Seq.d/ XXXXX...04 VFE243 (VFE243Q) /CSM/VF/VFE2-B/VFE243Q.Seq.d/ 379 e-104 SLJ605 (SLJ605Q) /CSM/SL/SLJ6-A/SLJ605Q.Seq.d/ 379 e-104 SLJ536 (SLJ

  11. New data on transuranium elements in the ecosystem of the Yenisei river floodplain

    Energy Technology Data Exchange (ETDEWEB)

    Bolsunovsky, A. [Russian Academy of Sciences, Siberian Branch, Krasnoyarsk (Russian Federation). Inst. of Biophysics; Ermakov, A.; Sobolev, A. [SIA ' RADON' , Moscow (Russian Federation)

    2007-07-01

    The aim of the study is to investigate levels of transuranium elements in the ecosystem of the Yenisei river floodplain in the vicinity of the Mining-and-Chemical Combine of Rosatom. For the first time, the transuranium isotopes {sup 243,244}Cm have been detected in sediment, floodplain soil, and a berry shrub (Ribes nigrum - the blackcurrant) in the floodplain of the Yenisei river. The highest level of curium isotopes registered in the sediment of the Yenisei river is 21.4Bq/kg (dry), which is more than twice higher than maximum curium levels reported for soils sampled not far from the Chernobyl Nuclear Plant. Blackcurrant plants growing on radioactively contaminated soils contain the same transuranium elements as the soil (plutonium isotopes, americium, and curium). The highest activity concentrations of all transuranic elements have been found in ashed roots of the blackcurrant plants: {sup 239,240}Pu - 9.3Bq/kg, {sup 241}Am - 6.9Bq/kg, and {sup 243,244}Cm - 1.8Bq/kg. The highest soil-plant transfer factor (TF) for {sup 243,244}Cm is determined for roots - 0.073; the TF of {sup 243,244}Cm in berries is 0.027. The TF for {sup 239,240}Pu in berries is 0.006, which is several times lower than the TF for {sup 243,244}Cm. Analysis of our results and the literature data suggests that TFs for {sup 243,244}Cm are higher than those for {sup 239,240}Pu and {sup 241}Am. (orig.)

  12. Decreto de libros prohibidos del Papa Alejandro VII

    OpenAIRE

    2012-01-01

    "Alexander Papa Septimus ad perpetuam furor an Rei memoriam [...]" Manuscrito. -- 2 hs. [P.V. 3 - ff. 241-242v.] [f. 243-243v. en bl.] : Papel; 200x295mm. -- Conservación regular, manchas de oxidación Texto en Latín. -- Copia de obra impresa en la Imprenta Apostólica de Roma. Vivas Moreno, Agustín. "Fondos documentales del Archivo Histórico de la Universidad de Salamanca. La colección de Papeles Varios: análisis descriptivo, tesauro y gestión documental automatizada". Tesis doctoral,...

  13. INTERTAN nail versus proximal femoral nail antirotation-Asia for intertrochanteric femur fractures in elderly patients with primary osteoporosis

    OpenAIRE

    Zhang, Hui; Zeng, Xianshang; Zhang, Nan; Zeng, Dan; Xu, Ping; Zhang, Lili; Chen, Deng; Yu, Weiguang; Zhang, Xinchao

    2017-01-01

    Objectives To compare the long-term functional and radiographic outcomes of the proximal femoral nail antirotation-Asia (PFNA-II) and INTERTAN nail (IT) in the management of intertrochanteric femoral fractures (IFFs) (AO/OTA Type 31A1.1-A2.3) in elderly patients with primary osteoporosis. Methods A retrospective comparative study was performed in our institution. From January 2009 to March 2012, 243 patients with osteoporosis (243 hips) with IFFs (AO/OTA Type 3.1A1.1-A2.3) underwent repair wi...

  14. Comparison of fission and capture cross sections of minor actinides

    CERN Document Server

    Nakagawa, T

    2003-01-01

    The fission and capture cross sections of minor actinides given in JENDL-3.3 are compared with other evaluated data and experimental data. The comparison was made for 32 nuclides of Th-227, 228, 229, 230, 233, 234, Pa-231, 232, 233, U-232, 234, 236, 237, Np-236, 237, 238, Pu-236, 237, 238, 242, 244, Am-241, 242, 242m, 243, Cm-242, 243, 244, 245, 246, 247 and 248. Given in the present report are figures of these cross sections and tables of cross sections at 0.0253 eV and resonance integrals.

  15. Some notes on the butterflies (Lepidoptera: Papilionoidea of Tantirimale Archaeological Site, Anuradhapura District, Sri Lanka

    Directory of Open Access Journals (Sweden)

    M.D.C. Asela

    2009-07-01

    Full Text Available There are 243 species of butterflies which including 5 families in Sri Lanka and 20 of them are endemic. However out of the 243 species 37 butterfly species belonging to 4 families was discovered from Tanthirimale Archaeological Forest area. This forest is classified as a Tropical dry mixed evergreen forests and its situated dry zone in Anuradapura district of Sri Lanka. We select three habitat types such as: forests, Rock outcrops and scrublands for studding composition and structure of butterflies in Archaeological Forest area. However, this important forest is threatened by harmful human activities such as man made fire, illegal logging, chena cultivation and road kills.

  16. Exclusion of BBC1 and CMAR as candidate breast tumour-suppressor genes.

    OpenAIRE

    Moerland, E.; Breuning, M H; Cornelisse, C J; Cleton-Jansen, A M

    1997-01-01

    Loss of heterozygosity (LOH) on chromosome arm 16q occurs in 48-65% of breast tumours. One small region of overlap is located at 16q24.3. Two genes located in this region, the cellular adhesion regulatory molecule (CMAR) and the breast basic conserved gene (BBC1), are plausible candidate tumour-suppressor genes. Mutational analysis of the retained copy of these genes has been performed by direct sequencing in a selected set of breast tumours that show LOH at 16q24.3 but not at other regions o...

  17. Crosstalk-Managed Heterogeneous Single-Mode 32-Core Fibre

    DEFF Research Database (Denmark)

    Sasaki, Y.; Fukumoto, Ryohei; Takenaga, Katsuhiro

    2016-01-01

    A heterogeneous single-mode 32-core fibre with a cladding diameter of 243 micrometer is designed and fabricated. The highest core count in single-mode multi-core fibres and low worst-case crosstalk of less than -24 dB/1000 km in C-band are achieved simultaneously.......A heterogeneous single-mode 32-core fibre with a cladding diameter of 243 micrometer is designed and fabricated. The highest core count in single-mode multi-core fibres and low worst-case crosstalk of less than -24 dB/1000 km in C-band are achieved simultaneously....

  18. Compensated bismuth-loaded plastic scintillators for neutron detection using low-energy pseudo-spectroscopy

    Energy Technology Data Exchange (ETDEWEB)

    Dumazert, Jonathan, E-mail: jonathan.dumazert@cea.fr [CEA, LIST, Laboratoire Capteurs Architectures Electroniques, 91191 Gif-sur-Yvette (France); Coulon, Romain; Bertrand, Guillaume H.V.; Normand, Stéphane [CEA, LIST, Laboratoire Capteurs Architectures Electroniques, 91191 Gif-sur-Yvette (France); Méchin, Laurence [CNRS, UCBN, Groupe de Recherche en Informatique, Image, Automatique et Instrumentation de Caen, 14050 Caen (France); Hamel, Matthieu [CEA, LIST, Laboratoire Capteurs Architectures Electroniques, 91191 Gif-sur-Yvette (France)

    2016-05-21

    Gadolinium-covered modified plastic scintillators show a high potential for the deployment of cost-effective neutron detectors. Taking advantage of the low-energy photon and electron signature of thermal neutron captures in gadolinium-155 and gadolinium-157 however requires a background correction. In order to display a trustable rate, dual compensation schemes appear as an alternative to Pulse Shape Discrimination. This paper presents the application of such a compensation scheme to a two-bismuth loaded plastic scintillator system. A detection scintillator interacts with incident photon and fast neutron radiations and is covered with a gadolinium converter to become thermal neutron-sensitive as well. In the meantime, an identical compensation scintillator, covered with terbium, solely interacts with the photon and fast neutron part of incident radiations. After the acquisition and the treatment of the counting signals from both sensors, a hypothesis test determines whether the resulting count rate after subtraction falls into statistical fluctuations or provides a robust image of neutron activity. A laboratory prototype is tested under both photon and neutron radiations, allowing us to investigate the performance of the overall compensation system. The study reveals satisfactory results in terms of robustness to a cesium-137 background and in terms of sensitivity in presence of a californium-252 source.

  19. Systematic studies of the fundamental chemistry of pyrochlore oxides. An{sub 2}Zr{sub 2}O{sub 7} [An=Pu, Am, Cm, Bk and Cf

    Energy Technology Data Exchange (ETDEWEB)

    Haire, R.G.; Assefa, Z. [Oak Ridge National Laboratory, Oak Ridge, TN (United States); Raison, P.E. [Commissariat a l' Energie Atomique, CEA-Cadarache DRN/DEC/SPUA/LACA (France)

    2002-11-01

    Our efforts to pursue the fundamental science of actinide pyrochlore oxides, An{sub 2}Zr{sub 2}O{sub 7}, (An=plutonium through californium), are presented. We have addressed their structural and chemical behavior via X-ray diffraction, Raman spectroscopy and by considering the pseudo-oxidation potentials of the actinides. The structure, fundamental chemistry, ionic radii and the electronic configuration of the specific actinide involved in these oxide systems all have a significant impact on their science. We are also exploring a calculational approach based on valence-bond relationships to assess the position of the oxygen atoms located at the general crystallographic position. The oxygen position is important regarding the chemical behavior and thermal stability of these materials. Also considered is the structural stability of the materials regarding self-irradiation, and with some compounds, their resistance towards oxidation. These aspects will be discussed using a systematic evaluation of the five-actinide systems together with comparable lanthanide systems studied. (author)

  20. 1982 US-CEC neutron personnel dosimetry intercomparison study

    Energy Technology Data Exchange (ETDEWEB)

    Swaja, R.E.; Sims, C.S.; Greene, R.T.; Schraube, H.; Burger, G.

    1983-11-01

    A neutron personnel dosimetry intercomparison study was conducted during April 19-23, 1982, as a joint effort between the United States and the Commission of European Communities. Dosimeters from 48 participating agencies were mounted on cylindrical phantoms and exposed to a range of low-level dose equivalents (0.48-13.91 mSv neutron and 0.02-1.32 mSv gamma) in nine different radiation fields. Exposure conditions considered in this study included four mixed-field spectra produced using the Health Physics Research Reactor, four monoenergetic neutron fields generated by accelerators, and one 15-cm D/sub 2/O-moderated californium source spectrum. In general, neutron results reported by the participating agencies were consistent with expected dosimeter performance based on energy response characteristics of the detection systems. Albedo dosimeters, which were the most popular neutron monitoring systems used in this study, provided the best overall accuracy for all exposure conditions. Film, Cr-39 recoil track, and Th-232 fission track systems generally underestimated dose equivalents relative to reference values. Associated gamma measurements showed that TLD monitors produced more accurate results than film dosimeters although both systems overestimated gamma dose equivalents in mixed radiation fields. 24 references, 10 figures, 19 tables.

  1. Application of the backward extrapolation method to pulsed neutron sources

    Energy Technology Data Exchange (ETDEWEB)

    Talamo, Alberto; Gohar, Yousry

    2018-01-01

    Particle detectors operated in pulse mode are subjected to the dead-time effect. When the average of the detector counts is constant over time, correcting for the dead-time effect is simple and can be accomplished by analytical formulas. However, when the average of the detector counts changes over time it is more difficult to take into account the dead-time effect. When a subcritical nuclear assembly is driven by a pulsed neutron source, simple analytical formulas cannot be applied to the measured detector counts to correct for the dead-time effect because of the sharp change of the detector counts over time. This work addresses this issue by using the backward extrapolation method. The latter can be applied not only to a continuous (e.g. californium) external neutron source but also to a pulsed external neutron source (e.g. by a particle accelerator) driving a subcritical nuclear assembly. The backward extrapolation method allows to obtain from the measured detector counts both the dead-time value and the real detector counts.

  2. The cross sections of fusion-evaporation reactions: the most promising route to superheavy elements beyond Z=118

    Science.gov (United States)

    Jadambaa, Khuyagbaatar

    2017-11-01

    The synthesis of superheavy elements beyond oganesson (Og), which has atomic number Z = 118, is currently one of the main topics in nuclear physics. An absence of sufficient amounts of target material with atomic numbers heavier than californium (Z = 98) forces the use of projectiles heavier than 48Ca (Z = 20), which has been successfully used for the discoveries of elements with Z = 114 - 118 in complete fusion reactions. Experimental cross sections of 48Ca with actinide targets behave very differently to "cold" and "hot" fusion-evaporation reactions, where doubly-magic lead and deformed actinides are used as targets, respectively. The known cross sections of these reactions have been analysed compared to calculated fission barriers. It has been suggested that observed discrepancies between the cross sections of 48Ca-induced and other fusionevaporation reactions originate from the shell structure of the compound nucleus, which lies in the island of the stability. Besides scarcely known data on other reactions involving heavier projectiles, the most promising projectile for the synthesis of the elements beyond Og seems to be 50Ti. However, detailed studies of 50Ti, 54Cr, 58Fe and 64Ni-induced reactions are necessary to be performed in order to fully understand the complexities of superheavy element formation.

  3. Report to the DOE nuclear data committee. [EV RANGE 10-100; CROSS SECTIONS; PHOTONEUTRONS; NEUTRONS; GAMMA RADIATION; COUPLED CHANNEL THEORY; DIFFERENTIAL CROSS SECTIONS; MEV RANGE 01-10; ; CAPTURE; GAMMA SPECTRA; THERMAL NEUTRONS; COMPUTER CALCULATIONS; DECAY; FISSION PRODUCTS; FISSION YIELD; SHELL MODELS; NUCLEAR DATA COLLECTIONS

    Energy Technology Data Exchange (ETDEWEB)

    Struble, G.L.; Haight, R.C.

    1981-03-01

    Topics covered include: studies of (n, charged particle) reactions with 14 to 15 MeV neutrons; photoneutron cross sections for /sup 15/N; neutron radiative capture; Lane-model analysis of (p,p) and (n,n) scattering on the even tin isotopes; neutron scattering cross sections for /sup 181/Ta, /sup 197/Au, /sup 209/Bi, /sup 232/Th, and /sup 238/U inferred from proton scattering and charge exchange cross sections; neutron-induced fission cross sections of /sup 245/Cm and /sup 242/Am; fission neutron multiplicities for /sup 245/Cm and /sup 242/Am; the transport of 14 MeV neutrons through heavy materials 150 < A < 208; /sup 249/Cm energy levels from measurement of thermal neutron capture gamma rays; /sup 231/Th energy levels from neutron capture gamma ray and conversion electron spectroscopy; new measurements of conversion electron binding energies in berkelium and californium; nuclear level densities; relative importance of statistical vs. valence neutron capture in the mass-90 region; determination of properties of short-lived fission products; fission yield of /sup 87/Br and /sup 137/I from 15 nuclei ranging from /sup 232/Th to /sup 249/Cf; evaluation of charged particle data for the ECPL library; evaluation of secondary charged-particle energy and angular distributions for ENDL; and evaluated nuclear structure libraries derived from the table of isotopes. (GHT)

  4. Activation analysis of ITER blanket first wall

    Energy Technology Data Exchange (ETDEWEB)

    Lopatkin, A.; Muratov, V. [RDIPE (NIKIET), Moscow (Russian Federation)

    1998-09-01

    To analyze the activation of ITER blanket structural components, the authors have prepared the AUCDAS code that calculates changes in nuclide concentrations and radioactivity characteristics during neutron irradiation and during cooling. UCDAS takes into account all neutron reactions and decay types, the prepared library of constants contains nuclear data of nuclides from hydrogen to californium. A comparative analysis of the results as obtained using UCDAS code and the widely known FISPACT code is given. The analysis of decay heat, gas generation and activity of ITER blanket first wall`s structural components was carried out. The beryllium coating, copper alloy and stainless steel were analysed. Calculations were performed for the first plasma burning pulse, 6 months and 1 year of operation in accordance with the ITER scenario. The materials recommended by ITER central team and their Russian analogs were considered: TGR and B1 (beryllium coating), GlidCop AL-25 Ds and Br-MKX (copper alloy), 316LN-IG and 12Cr18Ni10Ti (stainless steel). It has been demonstrated that there is a difference in all of the considered characteristics between the above materials. It is caused by impurities which are present in the materials. The report also considers the accumulation of gases (H, D, T, He{sup 3}, He{sup 4}) in the above materials. Besides, the change in the activity of irradiated materials during the cooling of up to 10{sup 7} years was calculated. (orig.) 7 refs.

  5. Toward achieving flexible and high sensitivity hexagonal boron nitride neutron detectors

    Science.gov (United States)

    Maity, A.; Grenadier, S. J.; Li, J.; Lin, J. Y.; Jiang, H. X.

    2017-07-01

    Hexagonal boron nitride (h-BN) detectors have demonstrated the highest thermal neutron detection efficiency to date among solid-state neutron detectors at about 51%. We report here the realization of h-BN neutron detectors possessing one order of magnitude enhancement in the detection area but maintaining an equal level of detection efficiency of previous achievement. These 3 mm × 3 mm detectors were fabricated from 50 μm thick freestanding and flexible 10B enriched h-BN (h-10BN) films, grown by metal organic chemical vapor deposition followed by mechanical separation from sapphire substrates. Mobility-lifetime results suggested that holes are the majority carriers in unintentionally doped h-BN. The detectors were tested under thermal neutron irradiation from californium-252 (252Cf) moderated by a high density polyethylene moderator. A thermal neutron detection efficiency of ˜53% was achieved at a bias voltage of 200 V. Conforming to traditional solid-state detectors, the realization of h-BN epilayers with enhanced electrical transport properties is the key to enable scaling up the device sizes. More specifically, the present results revealed that achieving an electrical resistivity of greater than 1014 Ωṡcm and a leakage current density of below 3 × 10-10 A/cm2 is needed to fabricate large area h-BN detectors and provided guidance for achieving high sensitivity solid state neutron detectors based on h-BN.

  6. Design of the low energy beam transport line between CARIBU and the EBIS charge breeder

    Energy Technology Data Exchange (ETDEWEB)

    Perry, A., E-mail: aperry4@hawk.iit.edu [Argonne National Laboratory, Argonne, IL 60439, USA and Illinois Institute of Technology, Chicago, IL 60616 (United States); Ostroumov, P. N.; Barcikowski, A.; Dickerson, C.; Kondrashev, S. A.; Mustapha, B.; Savard, G. [Argonne National Laboratory, Argonne, IL 60439 (United States)

    2015-01-09

    An Electron Beam Ion Source Charge Breeder (EBIS-CB) has been developed to breed radioactive beams from the CAlifornium Rare Isotope Breeder Upgrade (CARIBU) facility at ATLAS. The EBIS-CB will replace the existing ECR charge breeder to increase the intensity and improve the purity of reaccelerated radioactive ion beams. The EBIS-CB is in the final stage of off-line commissioning. Currently, we are developing a low energy beam transport (LEBT) system to transfer CARIBU beams to the EBIS-CB. As was originally planned, an RFQ cooler-buncher will precede the EBIS-CB. Recently, it was decided to include a multi-reflection time-of-flight (MR-TOF) mass-spectrometer following the RFQ. MR-TOF is a relatively new technology used to purify beams with a mass-resolving power up to 3×10{sup 5} as was demonstrated in experiments at CERN/ISOLDE. Very high purity singly-charged radioactive ion beams will be injected into the EBIS for charge breeding and due to its inherent properties, the EBIS-CB will maintain the purity of the charge bred beams. Possible contamination of residual gas ions will be greatly suppressed by achieving ultra-high vacuum in the EBIS trap. This paper will present and discuss the design of the LEBT and the overall integration of the EBIS-CB into ATLAS.

  7. Analysis of patents on mining technology

    Energy Technology Data Exchange (ETDEWEB)

    Menyailo, N.I.; Grishchenko, A.N.; Ratner, M.V.; Kobylyanskii, A.Ya.; Tyshlek, E.G.

    1987-09-01

    Analyses the current work being carried out with the aim of developing and perfecting coal mining technology with regard to improving safety and working conditions (equipment is currently responsible for 6.3% of all hazards in coal mines) by examining patents of class ES 21 S produced in the USSR, USA, UK, FRG, Japan and France between 1970-1984. By far the majority of patents is concerned with improving technology and productivity and a disappointing number deals with safety matters (only 7.2% of the patents for new cutter loader designs deal with dust suppression systems and most of these come from the FRG; no patents for powered mining complexes deal with the problem of noise and vibration reduction). The patents with the most direct relevance to health and safety concern remote control devices for mining equipment, in particular, devices based on radioactive isotopes (e.g. cesium-137, americum-241, selenium-75, californium-252) but measures for monitoring them and protecting against them are not found.

  8. MinT: Middleware for Cooperative Interaction of Things

    Directory of Open Access Journals (Sweden)

    Soobin Jeon

    2017-06-01

    Full Text Available This paper proposes an Internet of Things (IoT middleware called Middleware for Cooperative Interaction of Things (MinT. MinT supports a fully distributed IoT environment in which IoT devices directly connect to peripheral devices easily construct a local or global network, and share their data in an energy efficient manner. MinT provides a sensor abstract layer, a system layer and an interaction layer. These enable integrated sensing device operations, efficient resource management, and active interconnection between peripheral IoT devices. In addition, MinT provides a high-level API to develop IoT devices easily for IoT device developers. We aim to enhance the energy efficiency and performance of IoT devices through the performance improvements offered by MinT resource management and request processing. The experimental results show that the average request rate increased by 25% compared to Californium, which is a middleware for efficient interaction in IoT environments with powerful performance, an average response time decrease of 90% when resource management was used, and power consumption decreased by up to 68%. Finally, the proposed platform can reduce the latency and power consumption of IoT devices.

  9. MinT: Middleware for Cooperative Interaction of Things

    Science.gov (United States)

    Jeon, Soobin; Jung, Inbum

    2017-01-01

    This paper proposes an Internet of Things (IoT) middleware called Middleware for Cooperative Interaction of Things (MinT). MinT supports a fully distributed IoT environment in which IoT devices directly connect to peripheral devices easily construct a local or global network, and share their data in an energy efficient manner. MinT provides a sensor abstract layer, a system layer and an interaction layer. These enable integrated sensing device operations, efficient resource management, and active interconnection between peripheral IoT devices. In addition, MinT provides a high-level API to develop IoT devices easily for IoT device developers. We aim to enhance the energy efficiency and performance of IoT devices through the performance improvements offered by MinT resource management and request processing. The experimental results show that the average request rate increased by 25% compared to Californium, which is a middleware for efficient interaction in IoT environments with powerful performance, an average response time decrease of 90% when resource management was used, and power consumption decreased by up to 68%. Finally, the proposed platform can reduce the latency and power consumption of IoT devices. PMID:28632182

  10. An Account of Oak Ridge National Laboratory's Thirteen Research Reactors

    Energy Technology Data Exchange (ETDEWEB)

    Rosenthal, Murray Wilford [ORNL

    2009-08-01

    The Oak Ridge National Laboratory has built and operated 13 nuclear reactors in its 66-year history. The first was the graphite reactor, the world's first operational nuclear reactor, which served as a plutonium production pilot plant during World War II. It was followed by two aqueous-homogeneous reactors and two red-hot molten-salt reactors that were parts of power-reactor development programs and by eight others designed for research and radioisotope production. One of the eight was an all-metal fast burst reactor used for health physics studies. All of the others were light-water cooled and moderated, including the famous swimming-pool reactor that was copied dozens of times around the world. Two of the reactors were hoisted 200 feet into the air to study the shielding needs of proposed nuclear-powered aircraft. The final reactor, and the only one still operating today, is the High Flux Isotope Reactor (HFIR) that was built particularly for the production of californium and other heavy elements. With the world's highest flux and recent upgrades that include the addition of a cold neutron source, the 44-year-old HFIR continues to be a valuable tool for research and isotope production, attracting some 500 scientific visitors and guests to Oak Ridge each year. This report describes all of the reactors and their histories.

  11. Neutron Detector Signal Processing to Calculate the Effective Neutron Multiplication Factor of Subcritical Assemblies

    Energy Technology Data Exchange (ETDEWEB)

    Talamo, Alberto [Argonne National Lab. (ANL), Argonne, IL (United States). Nuclear Engineering Division; Gohar, Yousry [Argonne National Lab. (ANL), Argonne, IL (United States). Nuclear Engineering Division

    2016-06-01

    This report describes different methodologies to calculate the effective neutron multiplication factor of subcritical assemblies by processing the neutron detector signals using MATLAB scripts. The subcritical assembly can be driven either by a spontaneous fission neutron source (e.g. californium) or by a neutron source generated from the interactions of accelerated particles with target materials. In the latter case, when the particle accelerator operates in a pulsed mode, the signals are typically stored into two files. One file contains the time when neutron reactions occur and the other contains the times when the neutron pulses start. In both files, the time is given by an integer representing the number of time bins since the start of the counting. These signal files are used to construct the neutron count distribution from a single neutron pulse. The built-in functions of MATLAB are used to calculate the effective neutron multiplication factor through the application of the prompt decay fitting or the area method to the neutron count distribution. If the subcritical assembly is driven by a spontaneous fission neutron source, then the effective multiplication factor can be evaluated either using the prompt neutron decay constant obtained from Rossi or Feynman distributions or the Modified Source Multiplication (MSM) method.

  12. Fast neutron tomography with real-time pulse-shape discrimination in organic scintillation detectors

    Energy Technology Data Exchange (ETDEWEB)

    Joyce, Malcolm J., E-mail: m.joyce@lancaster.ac.uk [Department of Engineering, Lancaster University, Lancaster, Lancashire LA1 4YW (United Kingdom); Agar, Stewart [Department of Engineering, Lancaster University, Lancaster, Lancashire LA1 4YW (United Kingdom); Aspinall, Michael D. [Hybrid Instruments Ltd., Gordon Manley Building, Lancaster Environment Centre, Lancaster University, Lancaster LA1 4YW (United Kingdom); Beaumont, Jonathan S.; Colley, Edmund; Colling, Miriam; Dykes, Joseph; Kardasopoulos, Phoevos; Mitton, Katie [Department of Engineering, Lancaster University, Lancaster, Lancashire LA1 4YW (United Kingdom)

    2016-10-21

    A fast neutron tomography system based on the use of real-time pulse-shape discrimination in 7 organic liquid scintillation detectors is described. The system has been tested with a californium-252 source of dose rate 163 μSv/h at 1 m and neutron emission rate of 1.5×10{sup 7} per second into 4π and a maximum acquisition time of 2 h, to characterize two 100×100×100 mm{sup 3} concrete samples. The first of these was a solid sample and the second has a vertical, cylindrical void. The experimental data, supported by simulations with both Monte Carlo methods and MATLAB®, indicate that the presence of the internal cylindrical void, corners and inhomogeneities in the samples can be discerned. The potential for fast neutron assay of this type with the capability to probe hydrogenous features in large low-Z samples is discussed. Neutron tomography of bulk porous samples is achieved that combines effective penetration not possible with thermal neutrons in the absence of beam hardening.

  13. Report on the workshop "Decay spectroscopy at CARIBU: advanced fuel cycle applications, nuclear structure and astrophysics". 14-16 April 2011, Argonne National Laboratory, USA.

    Energy Technology Data Exchange (ETDEWEB)

    Kondev, F.; Carpenter, M.P.; Chowdhury, P.; Clark, J.A.; Lister, C.J.; Nichols, A.L.; Swewryniak, D. (Nuclear Engineering Division); (Univ. of Massachusetts); (Univ. of Surrey)

    2011-10-06

    A workshop on 'Decay Spectroscopy at CARIBU: Advanced Fuel Cycle Applications, Nuclear Structure and Astrophysics' will be held at Argonne National Laboratory on April 14-16, 2011. The aim of the workshop is to discuss opportunities for decay studies at the Californium Rare Isotope Breeder Upgrade (CARIBU) of the ATLAS facility with emphasis on advanced fuel cycle (AFC) applications, nuclear structure and astrophysics research. The workshop will consist of review and contributed talks. Presentations by members of the local groups, outlining the status of relevant in-house projects and availabile equipment, will also be organized. time will also be set aside to discuss and develop working collaborations for future decay studies at CARIBU. Topics of interest include: (1) Decay data of relevance to AFC applications with emphasis on reactor decay heat; (2) Discrete high-resolution gamma-ray spectroscopy following radioactive decya and related topics; (3) Calorimetric studies of neutron-rich fission framgents using Total ABsorption Gamma-Ray Spectrometry (TAGS) technique; (4) Beta-delayed neutron emissions and related topics; and (5) Decay data needs for nuclear astrophysics.

  14. The cross sections of fusion-evaporation reactions: the most promising route to superheavy elements beyond Z=118

    Directory of Open Access Journals (Sweden)

    Jadambaa Khuyagbaatar

    2017-01-01

    Full Text Available The synthesis of superheavy elements beyond oganesson (Og, which has atomic number Z = 118, is currently one of the main topics in nuclear physics. An absence of sufficient amounts of target material with atomic numbers heavier than californium (Z = 98 forces the use of projectiles heavier than 48Ca (Z = 20, which has been successfully used for the discoveries of elements with Z = 114 - 118 in complete fusion reactions. Experimental cross sections of 48Ca with actinide targets behave very differently to “cold” and “hot” fusion-evaporation reactions, where doubly-magic lead and deformed actinides are used as targets, respectively. The known cross sections of these reactions have been analysed compared to calculated fission barriers. It has been suggested that observed discrepancies between the cross sections of 48Ca-induced and other fusionevaporation reactions originate from the shell structure of the compound nucleus, which lies in the island of the stability. Besides scarcely known data on other reactions involving heavier projectiles, the most promising projectile for the synthesis of the elements beyond Og seems to be 50Ti. However, detailed studies of 50Ti, 54Cr, 58Fe and 64Ni-induced reactions are necessary to be performed in order to fully understand the complexities of superheavy element formation.

  15. Intracavitary moderator balloon combined with (252)Cf brachytherapy and boron neutron capture therapy, improving dosimetry in brain tumour and infiltrations.

    Science.gov (United States)

    Brandão, S F; Campos, T P R

    2015-07-01

    This article proposes a combination of californium-252 ((252)Cf) brachytherapy, boron neutron capture therapy (BNCT) and an intracavitary moderator balloon catheter applied to brain tumour and infiltrations. Dosimetric evaluations were performed on three protocol set-ups: (252)Cf brachytherapy combined with BNCT (Cf-BNCT); Cf-BNCT with a balloon catheter filled with light water (LWB) and the same set-up with heavy water (HWB). Cf-BNCT-HWB has presented dosimetric advantages to Cf-BNCT-LWB and Cf-BNCT in infiltrations at 2.0-5.0 cm from the balloon surface. However, Cf-BNCT-LWB has shown superior dosimetry up to 2.0 cm from the balloon surface. Cf-BNCT-HWB and Cf-BNCT-LWB protocols provide a selective dose distribution for brain tumour and infiltrations, mainly further from the (252)Cf source, sparing the normal brain tissue. Malignant brain tumours grow rapidly and often spread to adjacent brain tissues, leading to death. Improvements in brain radiation protocols have been continuously achieved; however, brain tumour recurrence is observed in most cases. Cf-BNCT-LWB and Cf-BNCT-HWB represent new modalities for selectively combating brain tumour infiltrations and metastasis.

  16. Intracavitary moderator balloon combined with 252Cf brachytherapy and boron neutron capture therapy, improving dosimetry in brain tumour and infiltrations

    Science.gov (United States)

    Brandão, S F

    2015-01-01

    Objective: This article proposes a combination of californium-252 (252Cf) brachytherapy, boron neutron capture therapy (BNCT) and an intracavitary moderator balloon catheter applied to brain tumour and infiltrations. Methods: Dosimetric evaluations were performed on three protocol set-ups: 252Cf brachytherapy combined with BNCT (Cf-BNCT); Cf-BNCT with a balloon catheter filled with light water (LWB) and the same set-up with heavy water (HWB). Results: Cf-BNCT-HWB has presented dosimetric advantages to Cf-BNCT-LWB and Cf-BNCT in infiltrations at 2.0–5.0 cm from the balloon surface. However, Cf-BNCT-LWB has shown superior dosimetry up to 2.0 cm from the balloon surface. Conclusion: Cf-BNCT-HWB and Cf-BNCT-LWB protocols provide a selective dose distribution for brain tumour and infiltrations, mainly further from the 252Cf source, sparing the normal brain tissue. Advances in knowledge: Malignant brain tumours grow rapidly and often spread to adjacent brain tissues, leading to death. Improvements in brain radiation protocols have been continuously achieved; however, brain tumour recurrence is observed in most cases. Cf-BNCT-LWB and Cf-BNCT-HWB represent new modalities for selectively combating brain tumour infiltrations and metastasis. PMID:25927876

  17. Investigation of Workplace-like Calibration Fields via a Deuterium-Tritium (D-T) Neutron Generator.

    Science.gov (United States)

    Mozhayev, Andrey V; Piper, Roman K; Rathbone, Bruce A; McDonald, Joseph C

    2017-04-01

    Radiation survey meters and personal dosimeters are typically calibrated in reference neutron fields based on conventional radionuclide sources, such as americium-beryllium (Am-Be) or californium-252 (Cf), either unmodified or heavy-water moderated. However, these calibration neutron fields differ significantly from the workplace fields in which most of these survey meters and dosimeters are being used. Although some detectors are designed to yield an approximately dose-equivalent response over a particular neutron energy range, the response of other detectors is highly dependent upon neutron energy. This, in turn, can result in significant over- or underestimation of the intensity of neutron radiation and/or personal dose equivalent determined in the work environment. The use of simulated workplace neutron calibration fields that more closely match those present at the workplace could improve the accuracy of worker, and workplace, neutron dose assessment. This work provides an overview of the neutron fields found around nuclear power reactors and interim spent fuel storage installations based on available data. The feasibility of producing workplace-like calibration fields in an existing calibration facility has been investigated via Monte Carlo simulations. Several moderating assembly configurations, paired with a neutron generator using the deuterium tritium (D-T) fusion reaction, were explored.

  18. Production of medical radioisotopes in the ORNL High Flux Isotope Reactor (HFIR) for cancer treatment and arterial restenosis therapy after PTCA

    Energy Technology Data Exchange (ETDEWEB)

    Knapp, F.F. Jr.; Beets, A.L.; Mirzadeh, S.; Alexander, C.W.; Hobbs, R.L.

    1998-06-01

    The High Flux Isotope Reactor (HFIR) at the Oak Ridge National Laboratory (ORNL) represents an important resource for the production of a wide variety of medical radioisotopes. In addition to serving as a key production site for californium-252 and other transuranic elements, important examples of therapeutic radioisotopes which are currently routinely produced in the HFIR for distribution include dysprosium-166 (parent of holmium-166), rhenium-186, tin-117m and tungsten-188 (parent of rhenium-188). The nine hydraulic tube (HT) positions in the central high flux region permit the insertion and removal of targets at any time during the operating cycle and have traditionally represented a major site for production of medical radioisotopes. To increase the irradiation capabilities of the HFIR, special target holders have recently been designed and fabricated which will be installed in the six Peripheral Target Positions (PTP), which are also located in the high flux region. These positions are only accessible during reactor refueling and will be used for long-term irradiations, such as required for the production of tin-117m and tungsten-188. Each of the PTP tubes will be capable of housing a maximum of eight HT targets, thus increasing the total maximum number of HT targets from the current nine, to a total of 57. In this paper the therapeutic use of reactor-produced radioisotopes for bone pain palliation and vascular brachytherapy and the therapeutic medical radioisotope production capabilities of the ORNL HFIR are briefly discussed.

  19. Predictors of Psychological Adaptation of Cape Verdean Students in Portugal

    Science.gov (United States)

    Neto, Félix; Wilks, Daniela C.

    2017-01-01

    We examined the predictors of psychological adaptation regarding subjective well-being and loneliness among international students. The sample included 243 Cape Verdean students attending Portuguese universities, and the control group was composed by 265 native-born Portuguese students. The latter group reported higher levels of well-being and…

  20. Drug: D03888 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D03888 Drug Domiodol (USAN) C5H9IO3 243.9596 244.0276 D03888.gif Mucolytic ATC code...ND COLD PREPARATIONS R05C EXPECTORANTS, EXCL. COMBINATIONS WITH COUGH SUPPRESSANTS R05CB Mucolytics R05CB08 Domiodol D03888 Domiodo

  1. Great Lakes Research Review, 1982. Appendices.

    Science.gov (United States)

    1982-11-01

    Process Control and Upgrading of Effluent Filtration Operations 234 C 81-35 WTC Treatment of Blast Furnaces Scrubber Water 235 C 81-36/77 WTC...C.P.N. Removal System 154 C 243 WTC Removal of NH3 -NO3from Industrial Effluents 155 C 244 WTC Biological Nitrification of Industrial Wastes 156 C 244

  2. Oil Price Movements and Globalisation: Is There a Connection?

    Science.gov (United States)

    2002-09-01

    ranging from the pace and scale of global integration and the characteristics of the digital di- vide to the impact of globalisation on income...linkages versus size effects”, Economia Internazionale, Vol. XLIV, No.2–3, pp. 228–243. Looney, Robert E. (1990), “Oil revenues and the Dutch disease

  3. Browse Title Index

    African Journals Online (AJOL)

    Items 101 - 150 of 243 ... Vol 23, No 1 (2013), Management guidelines for assisted reproduction in the HIV infected couple, Abstract. S Nosarka. Vol 21, No 3 (2011), Management of HIV infected patients with assisted reproductive techniques, Abstract. M Bhana, S Naidu. Vol 18, No 2 (2008), Management of intra uterine growth ...

  4. Ho

    Indian Academy of Sciences (India)

    Projects under Scientific and Technological planning of the education office, Jiangxi Province (GCJ2011-243), domestic visiting scholar of Jiangxi provincial higher education insti- tution, Jiangxi Province Training Programs of Innovation and. Entrepreneurship for Undergraduates (201310407028), the. Science Program of ...

  5. 78 FR 47703 - Food and Drug Administration Modernization Act of 1997: Modifications to the List of Recognized...

    Science.gov (United States)

    2013-08-06

    ... Specification for newer version. Wrought Nickel- Titanium Shape Memory Alloys for Medical Devices and Surgical... Laboratory Analysis; Approved Guideline. 7-243 Method for Antifungal Disk CLSI M51-A Diffusion Susceptibility... Part 9: Classification of surface cleanliness by particle concentration. 14-390 Cleanrooms and...

  6. Screening for phenylketonuria and galactosemia among Egyptian ...

    African Journals Online (AJOL)

    Aim of the Work: Was to study the prevalence of phenylketonuria and galactosemia in Menoufiya Governorate newborns. Among 3000 newborns, their mean ages were 9.3±2.43 days; mean weight was 3.1 ±0.82 Kg. Among them 1800( 60% ) males and 1200 (40% ) females who attended the central hospital and medical ...

  7. Vreugde en verdriet in die huis van Jakob

    African Journals Online (AJOL)

    p1243322

    Volgens Wenham (1994:243) sinspeel hierdie woorde van Lea tegelyk op die naam Simeon. So 'n klankooreenkoms is egter nie voor die hand liggend nie. • Die naam Levi (yw]l @) sinspeel ook op 'n bekende Hebreeuse werkwoord: (I) hwl. Hierdie werkwoord beteken in die Qal om te vergesel en in die. Nif'al om jouself te ...

  8. International Journal of Herbs and Pharmacological Research

    African Journals Online (AJOL)

    2015-10-31

    Oct 31, 2015 ... International Forum on Research and Development for procedures involving Risk assessment of Toxic chemicals. In Korean Soc. Toxicol. 3(1):243 – 257. Cheesbrough, M. (2005): Clinical chemistry test.In: District laboratory practices tropical countries. Cambridge University press. Low price edition.

  9. Dicty_cDB: Contig-U13538-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 50764_1( AY350764 |pid:none) Parascaris univalens ribosomal pro... 95 2e-18 AE016817_243( AE016817 |pid:none...5e-17 EU125004_1( EU125004 |pid:none) Eurythoe complanata ribosomal prot... 91 5e-17 AY350763_1( AY350763 |pid:none) Parascaris

  10. Moral Disengagement Moderates the Link between Psychopathic Traits and Aggressive Behavior among Early Adolescents

    Science.gov (United States)

    Gini, Gianluca; Pozzoli, Tiziana; Bussey, Kay

    2015-01-01

    This study investigated the relationships between three psychopathic dimensions (callousness/unemotionality, grandiosity/manipulation, and impulsivity/irresponsibility) and reactive and instrumental aggression in a community sample of early adolescents (N = 243, age M = 12.29, SD = 1.18). The moderating role of moral disengagement (MD) was also…

  11. Secondary queens in the parthenogenetic termite Cavitermes tuberosus develop through a transitional helper stage

    Czech Academy of Sciences Publication Activity Database

    Hellemans, S.; Fournier, D.; Hanus, Robert; Roisin, Y.

    2017-01-01

    Roč. 19, č. 6 (2017), s. 253-262 ISSN 1520-541X Institutional support: RVO:61388963 Keywords : facultative parthenogenesis * replacement queens * termites * asexual queen succession * ontogeny * Cavitermes Subject RIV: EG - Zoology Impact factor: 2.243, year: 2016

  12. Financing Housing Improvement in Urban Ghana: Experiences from ...

    African Journals Online (AJOL)

    UN-Habitat, 2001 ). Needless to say, the vast majority of these people are living in the cities and towns of ...... Gippsland, Australia". Journal of Environmental Manage-men/ 38: 233- 243. Malpezzi, S. (1988). "Analyzing Incentives in Housing ...

  13. EST Table: AU005278 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AU005278 ws30487 10/09/28 88 %/235 aa ref|NP_001036933.1| molting fluid carboxypept...idase A [Bombyx mori] dbj|BAD60916.1| molting fluid carboxypeptidase A [Bombyx mori] 10/08/28 40 %/243 aa FB

  14. PRODUCTIVE AND PHYSIOLOGICAL ADAPTIVE RESPONSES OF ...

    African Journals Online (AJOL)

    Corticosterone (CS) and 3,5,3¢-triiodothyronine (T3) levels were determined from 480 blood samples taken at 4 age points. Commercial hens reared at high temperature showed significant (p<0.05) performance reductions in egg production (33%), feed intake (15%) and shell thickness (24.3%). The effect of heat stress on ...

  15. Monitoring load, recovery and performance in young elite soccer players

    NARCIS (Netherlands)

    Brink, Michel S.; Nederhof, Esther; Visscher, Chris; Schmikli, Sandor L.; Lemmink, Koen A. P. M.

    Brink, MS, Nederhof, E, Visscher, C, Schmikli, SL, and Lemmink, KAPM. Monitoring load, recovery, and performance in young elite soccer players. J Strength Cond Res 24(3): 597603, 2010-The purpose of this study was to investigate the relation between training load, recovery, and monthly field test

  16. Using Paraffin PCM, Cryogel and TEC to Maintain Comet Surface Sample Cold from Earth Approach Through Retrieval

    Science.gov (United States)

    Choi, Michael K.

    2017-01-01

    An innovative thermal design concept to maintain comet surface samples cold (for example, 263 degrees Kelvin, 243 degrees Kelvin or 223 degrees Kelvin) from Earth approach through retrieval is presented. It uses paraffin phase change material (PCM), Cryogel insulation and thermoelectric cooler (TEC), which are commercially available.

  17. An Exploratory Study of the Relationship between Collaboration and Mathematics and Game Outcomes. CRESST Report 797

    Science.gov (United States)

    Buschang, Rebecca E.; Chung, Gregory K. W. K.; Kim, Jinok

    2011-01-01

    This study is an exploratory study of the relationship between collaboration and mathematics and game outcomes in a video game aimed at teaching concepts related to rational numbers. The sample included 243 middle school students who played the video game either with one partner or individually for 40 minutes. Results suggest that participants…

  18. Simple Computation of the Heat of Formation and Density from Theoretically Predicted Values

    Science.gov (United States)

    2012-09-01

    Hare, J. J.; Byrd, E.F.C. J. Phys. Chem. A 2007, 111 (42), 10874–10879. 4. Atkins , P. W. Physical Chemistry ; Oxford University Press: Oxford, 1982...Solvent Interactions, (Politzer P.; Murray, J. S., Editors), Theoretical and Computational Chemistry 1994, 1, Elsevier Scientific, Amsterdam, pp. 243

  19. Larose to Golden Meadow, Louisiana, Hurricane Protection Project. Draft Supplemental Environmental Impact Statement and Draft Mitigation Report. Technical Appendixes.

    Science.gov (United States)

    1984-06-01

    Snakes Serpentes - V A-8 TABLE A.1.2. (CONT.) BIRDS Common Name Scientific Name American bittern Botaurus lentiginosus American coot Fulica americana...proposed mitigation area. Of this total, 2,243 acres are fresh/intermediate marsh. The vegetation in thkmarsh type includes bull- tongue , cyperus

  20. Science Teachers' and Senior Secondary Schools Students' Perceptions of Earth and Environmental Science Topics

    Science.gov (United States)

    Dawson, Vaille; Carson, Katherine

    2013-01-01

    This article presents an evaluation of a new upper secondary Earth and Environmental Science (EES) course in Western Australia. Twenty-seven EES teachers were interviewed and 243 students were surveyed about the degree of difficulty, relevance and interest of EES topics in the course. The impact of the course on students' views about EES topics…

  1. The Effect of Prolonged Military Activities in Man. Physiological and Biochemical Changes. Possible Means of Rapid Recuperation (les Effets d’activites mi1itaires prolongees sur l’homme. Changements physiologiques et biochimiques. Moyens possibles de recuperation rapide.)

    Science.gov (United States)

    2001-03-01

    adrenals, ovaries, uterus, placenta, testis, prostate, 1-18 seminal vesicles, Leydig cells, hypothalamus, choroid plexus , pancreatic islets, lymphoid tissue...Proceedings of the AC 243/Panel 8 (RSG 23) Meeting, The Hague, May 7-8th, 4.2.1-12 Dahlgren C, Follin F, Johanson A, Lock R, Lundqvist H, Walan Å (1991

  2. Success for All: Eroding the Culture of Power in the One-to-One Teaching and Learning Context

    Science.gov (United States)

    Rakena, Te Oti; Airini,; Brown, Deidre

    2016-01-01

    This study applied a cultural lens to the "expert-novice dyad" (Kennell, 2002, p. 243) and explored the learning experiences of indigenous minorities studying in this context. The purpose of this study was to gather narratives that reflected the nature of teaching practices in the one-to-one studio context. The resulting data presented…

  3. AcEST: BP914053 [AcEST

    Lifescience Database Archive (English)

    Full Text Available alignments: (bits) Value sp|Q5DM57|IF172_CHLRE Intraflagellar transport protein 172 OS=Ch... 33 1.1 sp|Q6PBN5|AUP1_DANRE Ancient...SSCIVSSERKFIGLSKSVLGEILH 243 + ++++ ++ L KS+ +LH Sbjct: 1476 QVFAQHGITAQPQYFELYKSIAQGVLH 1502 >sp|Q6PBN5|AUP1_DANRE Ancient

  4. Does information about patients who are intellectually disabled translate into better cooperation during dental visits?

    NARCIS (Netherlands)

    Meurs, D.; Rutten, M.; de Jongh, A.

    2010-01-01

    The objective of this study was to investigate whether having background information about a patient with an intellectual disability (ID) would have a positive effect on the level of cooperation during a first dental visit. Study participants were 57 consecutive dental patients (mean age = 24.3

  5. JOS JOURNAL MAY-AUGUST

    African Journals Online (AJOL)

    FOBUR

    Posterior strictures were located in the bulbomembranous junction (7.8%) and bladder neck(2%). (Tablc2). Table 1: Aetiology of urethral stricture. Aetiology. Number. Percelllage. Infection so. 48.S. Trau.na. 43. 417. F.~ternal trauma. 25. 24.3. Straddle in~.ry. 6.8. Pelvic fmclure. 13. 12.6. Gun shot. 4. 39. lmpJiemement injury.

  6. Annual Progress Report, Fiscal Year 1980.

    Science.gov (United States)

    1980-09-30

    Caused by Listeria Monocytogenes . Arch Neurolo- 37(4):243, 1980. Old, C.: Diuretic Therapy. Presented at the District I Medical Society of Texas...routine surgical p)roce tIures TI:(]INT(-.U VTIROACII heeffects o nremedi cation prior to surg1erv on glastric juice voliu,.) and p11 will beevaluated in

  7. Interfaces of regeneration, structure, diversity and uses of some ...

    African Journals Online (AJOL)

    A total of 243 plant species belonging to 85 families were recorded from the Bonga Forest. Of these, 66 families were angiosperms, 2 gymnosperms and 17 monilophytes (ferns). Studies on the structure and regeneration of some woody species indicated that there are species that require urgent conservation measures.

  8. 77 FR 15644 - Airworthiness Directives; Airbus Airplanes

    Science.gov (United States)

    2012-03-16

    ... INFORMATION CONTACT: Vladimir Ulyanov, Aerospace Engineer, International Branch, ANM-116, Transport Airplane...) 88. In line with SFAR88, the JAA issued policy JAA INT/POL 25/12 and recommended to the National... production. (2) Airbus Model A330-223F and -243F airplanes; all serial numbers; except airplanes on which...

  9. 77 FR 48425 - Airworthiness Directives; Airbus Airplanes

    Science.gov (United States)

    2012-08-14

    ... INFORMATION CONTACT: Vladimir Ulyanov, Aerospace Engineer, International Branch, ANM-116, Transport Airplane... including Special Federal Aviation Regulation (SFAR) 88. In line with SFAR88, the JAA issued policy JAA INT... accomplished in production. (2) Airbus Model A330-223F and -243F airplanes; all serial numbers; except...

  10. Progressive rod-cone degeneration (PRCD) in selected dog breeds and variability in its phenotypic expression

    Czech Academy of Sciences Publication Activity Database

    Dostál, Jaromír; Hrdlicová, Anna; Horák, Pavel

    2011-01-01

    Roč. 56, č. 5 (2011), s. 243-247 ISSN 0375-8427 Institutional research plan: CEZ:AV0Z50450515 Keywords : canine * retinitis pigmentosa * autosomal Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 0.748, year: 2011

  11. Study of a composite from reactive blending of methylol urea resin ...

    African Journals Online (AJOL)

    GREGO

    2007-03-19

    Mar 19, 2007 ... natural rubber (NR) with starch and studied both rheo- logical and curing ... sodium hydroxide pellets and sucrose were reagent grades products ... Resin synthesis. Trimethylol urea was prepared by reacting one mole (6.0 g) of urea with three moles (24.3 ml) of 37% (w/v) formaldehyde. Sodium dihydrogen ...

  12. Basic Psychological Skills Usage and Competitive Anxiety Responses: Perceived Underlying Mechanisms

    Science.gov (United States)

    Wadey, Ross; Hanton, Sheldon

    2008-01-01

    This study examined the relationship between basic psychological skills usage (i.e., goal-setting, imagery, self-talk, and relaxation) and the intensity and directional dimensions of competitive anxiety. Semistructured interviews were used on a sample of 15 elite athletes (M age = 24.3 years, SD = 4.2) from a variety of team and individual sports.…

  13. Kartha, Dr Chandrasekharan Cheranellore

    Indian Academy of Sciences (India)

    Date of birth: 14 December 1951. Specialization: Cardiac Pathology, Cardiac Biology and Cell-based Therapies Address: Hon. Distinguished Professor, MM&DB, Rajiv Gandhi Centre for Biotechnology, Jagathi, Thiruvananthapuram 695 014, Kerala Contact: Office: (0471) 252 9448. Residence: (0471) 243 4108

  14. Page 1 JOURNAL OF THE CAMEROON ACADEMY OFSCIENCES ...

    African Journals Online (AJOL)

    Biochemical Pharmacology 36,. 2405-2513. 96. Research Commission p243. Nkeh B, Njamen D, Wandji J, Fomum Z, Dongmo. A, Nguelefack TB, Wansi B, Kamanyi A (2002) Anti inflammatory and analgesic effect of Drypermolundein. A, a sesquiterpene lactone from Drypetes molunduana. Pharmaceutical Biology 40, 1-5.

  15. Autonomous Robot Skill Acquisition

    Science.gov (United States)

    2011-05-01

    single demonstration using either a learned Hidden Markov Model (HMM) (Pook and Ballard, 1993; Hovland et al., 1996; Dixon and Khosla, 2004) or...of the Nineteenth International Conference on Machine Learning, pages 243– 250. Hovland , G., Sikka, P., and McCarragher, B. (1996). Skill acquisition

  16. Dicty_cDB: CHH349 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available tinuing with this limit ANTI-DNA BLAST search was proces...: 15 (29.7 bits) S1: 12 (24.3 bits) S2: 21 (42.1 bits) [blastall] WARNING: [000.000] Reached max 400 HSPs in BlastSaveCurrentHsp, con

  17. An Examination of Multiple Intelligence Domains and Learning Styles of Pre-Service Mathematics Teachers: Their Reflections on Mathematics Education

    Science.gov (United States)

    Ozgen, Kemal; Tataroglu, Berna; Alkan, Huseyin

    2011-01-01

    The present study aims to identify pre-service mathematics teachers' multiple intelligence domains and learning style profiles, and to establish relationships between them. Employing the survey model, the study was conducted with the participation of 243 pre-service mathematics teachers. The study used the "multiple intelligence domains…

  18. Application of the Best Available Science in Ecosystem Restoration: Lessons Learned From Large-Scale Restoration Project Efforts in the USA

    Science.gov (United States)

    2004-05-01

    Washington. Available at http://pugetsoundnearshore. org. Cover: Cama Beach on Camano Island , Washington is an example of a bluff backed beach...Restoration Program. Lee, K. N. 1993. Compass and Gyroscope: Integrating Science and Politics for the Environment. Island Press, Washington, D.C. 243 p

  19. Structured Interviewing: Raising the Psychometric Properties of the Employment Interview.

    Science.gov (United States)

    Campion, Michael A.; And Others

    1988-01-01

    Proposes a highly structured six-step employment interviewing technique which includes asking the same questions, consistently administering the process to all candidates, and having an interview panel. Results of a field study of 243 job applicants using this technique demonstrated interrater reliability, predictive validity, test fairness for…

  20. Browse Title Index

    African Journals Online (AJOL)

    Items 151 - 200 of 243 ... Vol 22, No 1 (2012), Review: Methamphetamine use by pregnant women: Impact on the neonate and challenges for the perinatal team, Abstract. A Madide, J Smith, H Odendaal ... Vol 14, No 1 (2004), Smoking cessation interventions for pregnant women: review article, Details. K Everett. Vol 20, No 3 ...

  1. The Use of Models: experience and prospects,

    NARCIS (Netherlands)

    J. Tinbergen (Jan)

    1981-01-01

    textabstractLecture to the Memory of Alfred Nobel, Oslo, December 12, 1969. Originally published in: Les Prix Nobel en 1969, The Nobel Foundation, Stockholm, 1970, pp. 243-252. Also published in: Assar Lindbeck (Ed.), Nobel Lectures in Economic Sciences 1969-1980 Vol. 1, World Scientific, Singapore,

  2. ( Colocasia esculenta ) starch from Ethiopia

    African Journals Online (AJOL)

    Physicochemical properties of starch isolated from tuber of Godare [Colocasia esculenta (Araceae)] have been characterised. Amylose content was found to be 24.3%. The starch granules are polygonal to spherical in shape with indentations in some granules. The granules exist as single entities. The starch has normal ...

  3. Relationships among Shyness, Social Competence, Peer Relations, and Theory of Mind among Pre-Adolescents

    Science.gov (United States)

    Kokkinos, Constantinos M.; Kakarani, Styliani; Kolovou, Demetra

    2016-01-01

    The present study examined the relationships between shyness, a number of personal and interpersonal variables (i.e. social skills, self-esteem, attachment style, advanced Theory of Mind skills and peer relations) in a sample of 243 Greek pre-adolescents. Participants completed self-reports of the variables. Results indicated that females scored…

  4. Page 1 322 Sudhanshu S Jha References Ablowitz M. J, Kaup D J ...

    Indian Academy of Sciences (India)

    . Steudel H. 1977 Ann, Phys. 34 188 1971 - . Zakharov V E and Shabat A B 1971 Z. Exsp. Thor, Fiz. 61 118. Zakharov V E and Manakov S W 1973 Soy. Phys. JETP Lett. 18 243. Zakharov V E and Manakov S W 1976 Soy. Phys, JETP 42 842.

  5. Progressive sensorineural hearing impairment in maternally inherited diabetes mellitus and deafness (MIDD).

    NARCIS (Netherlands)

    Hendrickx, J.J.; Mudde, A.H.; Hart, L.M. 't; Huygen, P.L.M.; Cremers, C.W.R.J.

    2006-01-01

    OBJECTIVE: To study the progression of hearing impairment (HI) and audiological features in patients with the mitochondrial A to G mutation in the tRNA(LEU(RUU)) gene at position 3,243 associated with maternally inherited diabetes and deafness. DESIGN: Retrospective phenotype genotype family study.

  6. Emotional Intelligence and Leadership Success of Secondary ...

    African Journals Online (AJOL)

    This is an expost facto research designed to determine the influence of emotional intelligence on leadership success of secondary school principals in Rivers State of Nigeria. The population consisted 441 principals (243 in public and 198 in private) secondary schools in Rivers State. A sample of 208 principals drawn ...

  7. Evidence for the role of AMPK in regulating PGC-1 alpha expression and mitochondrial proteins in mouse epididymal adipose tissue.

    Science.gov (United States)

    Wan, Zhongxiao; Root-McCaig, Jared; Castellani, Laura; Kemp, Bruce E; Steinberg, Gregory R; Wright, David C

    2014-03-01

    PGC-1α is a transcriptional co-activator and master regulator of mitochondrial biogenesis. While extensively studied in skeletal and cardiac muscle, recent findings suggest that white adipose tissue PGC-1α plays an important role in regulating glucose homeostasis. The purpose of the present investigation was to evaluate the role of AMPK in regulating PGC-1α and mitochondrial enzymes in mouse epididymal and inguinal subcutaneous adipose tissue. Mitochondrial protein content and norepinephrine and CL 316,243-induced PGC-1α mRNA expression were studied in mouse epididymal and inguinal adipose tissue from wild-type and AMPK β1(-/-) mice. The protein content and phosphorylation of AMPKα was reduced in epididymal adipose tissue from AMPK β1(-/-) compared to WT mice, concomitant with decreases in PGC-1α and mitochondrial marker proteins. Norepinephrine and CL 316,243-mediated induction of PGC-1α were decreased in cultured epididymal adipose tissue from AMPK β1(-/-) relative to WT mice. In inguinal adipose tissue from AMPK β1(-/-) mice, mitochondrial marker protein content and norepinephrine and CL 316,243-mediated increases in PGC-1α were normal despite reductions in the content and phosphorylation of AMPKα. Norepinephrine- and CL 316,243-mediated induction of PGC-1α and mitochondrial protein expression is regulated by AMPK in epididymal, but not inguinal adipose tissue. Copyright © 2013 The Obesity Society.

  8. In Vitro and In Vivo Activity of Omadacycline Against Two Biothreat Pathogens: Bacillus Anthracis and Yersinia Pestis

    Science.gov (United States)

    2013-02-27

    odontology in the management of bioterrorism. In Evidence-Based Forensic Dentistry . Springer-Verlag Berlin Heidelberg 2013. pp. 149-152. Rotz LD...2014;58(2):1127-35. May KR. The collison nebulizer description, performance and applications. J. Aerosol Sci. 1973;4:235-243. Rai B, Kaur J. Forensic

  9. The Predictors of Distress in Parents of Children with Autism Spectrum Disorder

    Science.gov (United States)

    Firth, Ian; Dryer, Rachel

    2013-01-01

    Background: It is well recognised that parents of children with autism spectrum disorder (ASD) often experience clinically significant levels of stress and depression. This study examined which ASD characteristic best predicted parental distress. Method: Parents of 109 children aged between 4 and 12 (M age = 7.89, SD = 2.43) completed self-report…

  10. EST Table: FS893448 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available er dense fiber protein 2 (Outer dense fiber of sperm tails protein 2) (84 kDa out...ogy 10/09/10 43 %/244 aa gnl|Amel|GB14311-PA 10/09/10 46 %/243 aa gi|91078946|ref|XP_974065.1| PREDICTED: similar to Out

  11. Assessment of soil-pollution by slag from an automobile battery ...

    African Journals Online (AJOL)

    Assessment of soil-pollution by slag from an automobile battery manufacturing plant in Nigeria. ... Samples were analyzed for lead, cadmium, chromium and nickel using standard analytical methods. Lead level in soil ranged from 243 to 126000 mg/kg on the premises of the manufacturing plant with about 98% of all soil ...

  12. How Linearity and Structural Complexity Interact and Affect the Recognition of Italian Derived Words

    Science.gov (United States)

    Bridgers, Franca Ferrari; Kacinik, Natalie

    2017-01-01

    The majority of words in most languages consist of derived poly-morphemic words but a cross-linguistic review of the literature (Amenta and Crepaldi in Front Psychol 3:232-243, 2012) shows a contradictory picture with respect to how such words are represented and processed. The current study examined the effects of linearity and structural…

  13. 77 FR 37829 - Airworthiness Directives; Airbus Airplanes

    Science.gov (United States)

    2012-06-25

    ... Federal Aviation Administration 14 CFR Part 39 RIN 2120-AA64 Airworthiness Directives; Airbus Airplanes... A330-243, -341, -342 and -343 airplanes. The existing AD currently requires modifying certain cowl... life limits, and would also add airplanes to the applicability. We are proposing this AD to prevent...

  14. 76 FR 79560 - Airworthiness Directives; Airbus Airplanes

    Science.gov (United States)

    2011-12-22

    ... Federal Aviation Administration 14 CFR Part 39 RIN 2120-AA64 Airworthiness Directives; Airbus Airplanes... airplanes; Model A330-223F and -243F airplanes; and Model A340-200, -300, -500, and -600 series airplanes... airplane flight manual. We are proposing this AD to prevent movement of the elevators to zero position...

  15. Journal of Astrophysics and Astronomy | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Astrophysics and Astronomy. Nagendra Kumar. Articles written in Journal of Astrophysics and Astronomy. Volume 29 Issue 1-2 March-June 2008 pp 243-248. Damping of Slow Magnetoacoustic Waves in an Inhomogeneous Coronal Plasma · Nagendra Kumar Pradeep Kumar Shiv Singh Anil ...

  16. Dicty_cDB: Contig-U01145-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available quences better than 10.0: 0 Length of query: 137 Length of database: 101,790,757,118 Length adjustment: 22 E...umber of HSP's successfully gapped: 0 Length of query: 45 Length of database: 1,051,180,864 Length adjustm...ent: 19 Effective length of query: 26 Effective length of database: 989,686,243 Eff

  17. Ecology of Malaria Vectors in a Rainforest Suburban Community of ...

    African Journals Online (AJOL)

    Of 263 adults mosquitoes collected from inside houses, 243 (92.40%) were from houses with ceilings and 20 (7.60%) from houses without ceilings. Of the 3 mosquito species collected indoors, A. gambiae 156 (59.3%), had the highest number with a room density of 5.2 mosquitoes/room/night. Ground water pools sustained ...

  18. Ecology of Malaria Vectors in a Rainforest Suburban Community of ...

    African Journals Online (AJOL)

    User

    2011-04-19

    Apr 19, 2011 ... collected from inside houses, 243 (92.40%) were from houses with ceilings and 20 (7.60%) from houses without ceilings. Of the 3 mosquito species collected indoors, A. gambiae 156 (59.3%), had the highest number with a room density of 5.2 mosquitoes/room/night. Ground water pools sustained by.

  19. Alcohol consumption in the rural population of Misungwi subdistrict in Mwanza Region, Tanzania

    NARCIS (Netherlands)

    Rijken, T; Velema, JP; Dijkstra, R

    Objective: This study was undertaken to investigate the frequency and quantity of alcohol consumption in four villages on the southern shores of Lake Victoria, Tanzania. Method: Study participants were 148 men and 162 women selected by cluster sampling from the population (N = 9,243) of four

  20. Anharmonic solution of Schrödinger time-independent equation

    Indian Academy of Sciences (India)

    243–261. Anharmonic solution of Schrödinger time-independent equation. MOHAMMED ASHRAFUL ISLAM1,2,∗ and JAMAL NAZRUL ISLAM1. 1Research Centre for Mathematical and Physical Sciences, University of Chittagong, Chittagong,. Bangladesh. 2Department of Mathematics, University of Chittagong, Chittagong, ...

  1. EST Table: BP123135 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available BP123135 epV30626 10/09/28 55 %/243 aa dbj|BAA86911.1| homologue of Sarcophaga 26,29kDa proteinase [Periplan...eta americana] 10/08/29 51 %/241 aa FBpp0127246|DanaGF24054-PA 10/08/28 n.h 10/09/1

  2. MAPTIP - Marine Aerosol Properties and Thermal Imager Performance : Summary and initial results

    NARCIS (Netherlands)

    Eijk, A.M.J. van; Leeuw, G. de; Jensen, D.R.

    1995-01-01

    The marine aerosol properties and thermal imager performance trial (MAPTIP) was conducted by NATO AC/243 Panel 04/RSG.8 and 04/RSG.5 in the Dutch coastal waters during the fall of 1993. The main objectives of the trial were (1) to assess marine boundary layer effects on thermal imaging systems and

  3. ARL Supplementary Statistics, 2006-2007

    Science.gov (United States)

    Bland, Les, Comp.; Kyrillidou, Martha, Comp.

    2009-01-01

    This report presents statistics on how Association of Research Libraries (ARL) member libraries spend money on electronic resources. This report indicates that 108 ARL libraries purchased 25,006,758 electronic books. In 2006-2007, there was an ARL median of 243,725 acquisitions of electronic books (this includes one institution that purchased…

  4. AcEST: BP920406 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ng pro... 32 2.4 sp|Q55274|ISIA_SYNY3 Iron stress-induced chlorophyll-binding pro... 31 4.1 sp|Q62ZD8|VGB_BACLD Virgin... 208 LYHLTVPPLHWMKTSKSFSGHAIIA 282 ++H+ VPPL W K FSG AI++ Sbjct: 219 IWHILVPPLGWAKKVLLFSGEAILS 243 >sp|Q62ZD8|VGB_BACLD Virgin

  5. Longitudinal Test of Self-Determination Theory's Motivation Mediation Model in a Naturally Occurring Classroom Context

    Science.gov (United States)

    Jang, Hyungshim; Kim, Eun Joo; Reeve, Johnmarshall

    2012-01-01

    This study provides the first longitudinally designed, classroom-based empirical test of self-determination theory's motivation mediation model. Measures of perceived autonomy support, motivation (autonomy need satisfaction), engagement, and achievement were collected from 500 (257 females, 243 males) 8th-grade students in Korea in a 3-wave…

  6. Download this PDF file

    African Journals Online (AJOL)

    ALADDIN

    2011-10-03

    Oct 3, 2011 ... of kernels per panicle, number of filled kernels and grain yield per plant, and specific combining ability. (SCA) effect was ..... Establishment of a rice protoplast culture and application of an asymmetric protoplast fusion technique to hybrid rice breeding. Plant. Tissue Cult. Lett. 13: 243-247. Ganesan KN ...

  7. Is the ancient permafrost bacteria able to keep DNA stable?

    Indian Academy of Sciences (India)

    ANATOLI

    2013 Probiotic activity of a bacterial strain isolated from ancient permafrost against salmonella infection in mice. Probiotics Antimicrob. Proteins 4, 145–153. Gilichinsky D. and Wagener S. 1995 Microbial life in permafrost: a historical review. Permafrost Periglac. 6, 243–250. Greenblatt C. L., Baum J., Klein B. Y., Nachshon S.

  8. Public Diplomacy: An Alternative Diplomacy in Foreign Affairs’ Issues. Greek Public Diplomacy: Capabilities and Perspectives

    Science.gov (United States)

    2011-06-01

    Communication Offices ( PCOs ) attached to Greek embassies and the Ministry of Foreign Affairs. This bipolarity created confusing responsibilities...243 • Gastronomy: The Mediterranean diet must be in the forefront of a challenging campaign. • Made in Hellas: The creation of such a logo as a

  9. Reflections on educational research in South Africa | Kamper | South ...

    African Journals Online (AJOL)

    It is evident that educational research in South Africa has a noteworthy record of national and regional impact. Present threats to its academic stature and praxiological impact can only be overcome by taking appropriate and timely research management action. South African Journal of Education Vol.24(3) 2004: 233-238 ...

  10. Using torsional forces to explain the gradient temperature Raman spectra of endosulfan isomers and its irreversible isomerization

    Science.gov (United States)

    Since the 1950's, the broad-spectrum, organochlorine insecticide endosulfan (6,7,8, 9,10,10-hexachloro-1,5,5a,6,9,9a-hexahydro-6,9-methano-2,4,3-benzodioxathiepine-3-oxide) has been used on numerous crops. Due to its persistence, bioaccumulation, long-range transport, and adverse effects to human he...

  11. An effective method for extraction and polymerase chain reaction ...

    African Journals Online (AJOL)

    root

    –3555. Chase MR, Etter RJ, Rex MA, Quattro JM (1998). Extraction and amplification of mitochondrial DNA from formalin-fixed deep-sea molluscs. Biol. Technol. 24: 243–247. Chaw YM, Crane LE, Lange P, Shapiro R (1980). Isolation and.

  12. JMBR - SEPTEMBER 2013.cdr

    African Journals Online (AJOL)

    FinePrint

    Antimicrobial disc susceptibility tests and pathogenicity tests were also ... Pseudomonas aeruginosa each exhibiting higher levels of multidrug resistance. A number of the isolates exhibited pathogenicity traits. Whereas 27.6% of them were positive for virulence gene, 24.3% were invasive while 17.2% were diarrheagenic.

  13. Objekt nejstarších zemědělců z Nových Dvorů 3 podruhé. Výpověď zvířecích kostí a prostorové distribuce artefaktů

    Czech Academy of Sciences Publication Activity Database

    Končelová, Markéta; Kovačiková, L.

    2016-01-01

    Roč. 33, 1-2 (2016), s. 235-243 ISSN 0231-5432 R&D Projects: GA ČR GA15-16963S Institutional support: RVO:67985912 Keywords : Linear Pottery culture (early stage) * animal remains * spatial distribution Subject RIV: AC - Archeology, Anthropology, Ethnology

  14. Download this PDF file

    African Journals Online (AJOL)

    particularly in poor sanitary conditions. (Colosio et al., 2010). In this report, we present two clinical cases of tetanus in a pig farming complex in Lagos, Nigeria. .... Kingdom. pp. 243,379,536 and 813. CENTERS FOR DISEASE CONTROL AND. PREVENTION. Tetanus surveillance - United. States, 2001-2008. (2011). Morb.

  15. Disclosure of double exchange bias effect in chromium (III) oxide nanoparticles

    Czech Academy of Sciences Publication Activity Database

    Rinaldi-Montes, N.; Gorria, P.; Fuertes, A.B.; Martinez-Blanco, D.; Olivi, L.; Puente-Orench, I.; Alonso, J.M.; Phan, M.-H.; Skrikanth, H.; Martí, Xavier; Blanco, J.A.

    2017-01-01

    Roč. 53, č. 1 (2017), s. 1-4, č. článku 2300204. ISSN 0018-9464 R&D Projects: GA ČR GB14-37427G Institutional support: RVO:68378271 Keywords : antiferromagnetism * exchange bias (EB) * magnetic nanoparticles * magnetoelectric effect Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.243, year: 2016

  16. Low-temperature photoluminescence in chalcogenide glasses doped with rare-earth ions

    Czech Academy of Sciences Publication Activity Database

    Kostka, Petr; Zavadil, Jiří; Iovu, M.S.; Ivanova, Z. G.; Furniss, D.; Seddon, A.B.

    2015-01-01

    Roč. 648, NOV 5 (2015), s. 237-243 ISSN 0925-8388 R&D Projects: GA ČR GAP106/12/2384 Institutional support: RVO:67985891 ; RVO:67985882 Keywords : chalcogenide glasses * rare earth ions * low-temperature photoluminescence * optical transmission Subject RIV: JH - Ceramics, Fire-Resistant Materials and Glass Impact factor: 3.014, year: 2015

  17. Employees' Willingness to Participate in Work-Related Learning: A Multilevel Analysis of Employees' Learning Intentions

    Science.gov (United States)

    Kyndt, Eva; Onghena, Patrick; Smet, Kelly; Dochy, Filip

    2014-01-01

    The current study focuses on employees' learning intentions, or the willingness to undertake formal work-related learning. This cross-sectional survey study included a sample of 1,243 employees that are nested within 21 organisations. The results of the multilevel analysis show that self-directedness in career processes, time management,…

  18. Experiment list: SRX1430140 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available or control and decision making. 28821627,98.6,6.7,243 GSM1939119: NAI-00H-ACC-NEU-H3K4ME1-1; Mus musculus; C...R of the cingulate gyrus, possessing multiple intracortical and subcortical connections, and involved in mot

  19. CEPHALOPOD BEAKS FROM THE STOMACH OF A JACKASS ...

    African Journals Online (AJOL)

    Davies (1955, 1956, 1958), Rand (1960) and Matthews (1961) have shown that cephalopods form only 1 to 4 per cent by weight of the diet of the Jackass Penguin Spheniscus demersus. At certain times of the year, however, this percentage increases considerably; Rand (1960) counted up to 243 beaks in one stomach in ...

  20. How Does One Manage ’Information? Making Sense of the Information Being Received

    Science.gov (United States)

    2012-12-01

    Army defines them slightly (if not fundamentally) differently than the IT world, and has thus caused some translation problems within the DoD as we...an IMO. “By wisdom a house is built, and through understand- ing it is established.” — Proverbs 24:3 We need to know what information we are trying

  1. Voice Disorders in Teachers and the General Population: Effects on Work Performance, Attendance, and Future Career Choices

    Science.gov (United States)

    Roy, Nelson; Merrill, Ray M.; Thibeault, Susan; Gray, Steven D.; Smith, Elaine M.

    2004-01-01

    To examine the frequency and adverse effects of voice disorders on job performance and attendance in teachers and the general population, 2,401 participants from Iowa and Utah ([n.sub.1] = 1,243 teachers and [n.sub.2] = 1,279 nonteachers) were randomly selected and were interviewed by telephone using a voice disorder questionnaire. Teachers were…

  2. Magnetoconductivity of the La.sub.1-x./sub.Sr.sub.x./sub.MnO.sub.3./sub.@TiO.sub.2./sub. Nanocomposite

    Czech Academy of Sciences Publication Activity Database

    Koktan, Jakub; Goglio, G.; Hejtmánek, Jiří; Jirák, Zdeněk; Knížek, Karel; Kuličková, Jarmila; Maryško, Miroslav; Kaman, Ondřej

    2017-01-01

    Roč. 53, č. 11 (2017), s. 1-6, č. článku 8109606. ISSN 0018-9464 R&D Projects: GA ČR GA15-10088S Institutional support: RVO:68378271 Keywords : nanoparticles * conductivity * magnetic cores * magnetic tunneling * temperature measurement * coating s Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.243, year: 2016

  3. The Economic Effect of Insurgency on Smoked Fish Sellers in ...

    African Journals Online (AJOL)

    User

    perishable nature and lack of access to capital with 21.9%, 31.4%. 22.5% and 24.3% respectively. The insurgency attack has negative effect on the economic activities of smoke fish sellers. Local dried fish marketers should be organized into cooperative groups by extension agents and government should provide adequate ...

  4. Management of patients with rheumatic fever and rheumatic heart ...

    African Journals Online (AJOL)

    McLaren M, Markowitz M, Gerber M. Rheumatic heart disease in developing countries. Ann. Intern Med 1994; 120: 243-244. 2. Marcus R, Sareli P, Pocock W, Barlow J. The spectrum of severe rheumatic mitral valve disease in a developing country. Correlations among clinical presentation, surgical pathologic findings and ...

  5. Behaviour of LaAlO3+LnTiTaO6 (Ln= Ce, Pr or Nd) dielectric ...

    Indian Academy of Sciences (India)

    materials used in the electronic industry. The tolerance fac- tor and cell parameter are two important ... lopment of smaller, faster and more efficient electronic and optoelectronic devices (Qi et al 1996). Jacob et al (2007) ..... Solomon S 2010 J. Alloys Compd 506 243. Solomon S, Dhwajam D B, Remya G R, John A and ...

  6. Fulltext PDF

    Indian Academy of Sciences (India)

    Unknown

    243. Ascosphaera apis. Feverish honeybees. 215. Aspergillus. Avirulent mutants of Macrophomina phaseolina and Asper- gillus fumigatus initiate infection in Phaseolus mungo in the presence of phaseolinone; levamisole gives protection. 73. Auditory system. Visual and acoustic communication in non-human animals: a.

  7. 77 FR 18651 - Qualifying Urban Areas for the 2010 Census

    Science.gov (United States)

    2012-03-27

    ...,487,483 Indio--Cathedral City, CA 345,580 Iowa City, IA 106,621 Ithaca, NY 53,661 Jackson, MI 90,057... Salisbury, MD--DE 98,081 Salt Lake City--West Valley City, UT 1,021,243 San Angelo, TX 92,984 San Antonio...

  8. Compensatory growth assessment by plasma IGF-I hormone ...

    African Journals Online (AJOL)

    USER

    2010-06-21

    Jun 21, 2010 ... Effects of insulin like growth factor and insulin on the in vitro uptake of sulfate by eel branchial cartilage: evidence for the presence of independent hepatic and panceratic sulfation factors. J. Endocrinol. 139: 243 - 252. Duan C (1998). Nutritional developmental regulation of insulin-like growth factors in fish .

  9. Download this PDF file

    African Journals Online (AJOL)

    tions. The aim of this study was to assess pig rearing in Dschang and determine the gut microflora of these animals. Between February and May 2003, a questionnaire was used to collect data on pigmanagement from 114 farmers resident in Dschang and its environs. Microbial analysis was carriedout on 243 faecal ...

  10. A Survey of ABO, Rhesus (D) Antigen and Haemoglobin Genes ...

    African Journals Online (AJOL)

    olayemitoyin

    Schneider, R.G., (1978): Methods for Detection of. Hemoglobin Variants and Hemoglobinopathies in the Routine Clinical Laboratory CRC Vol. 9, No. 3 ,. Pages 243-271. Sinou M.T. 2003. Antenatal screening of sickle cell disease. 8th postgraduate course for training in reproductive medicine and reproductive biology.

  11. Download this PDF file

    African Journals Online (AJOL)

    Osondu

    2014-04-23

    Apr 23, 2014 ... maximum flow of 3,672m3/hour and length of. 24.3km. The trunk sewer has a capacity of serving 423,000 people. Some few areas are completely covered by lateral sewers of 23km length and 250mm in diameter. Wastewater from this system is finally treated by WSP which are located in Swaswa area.

  12. The risk of multiple sclerosis in nurses

    DEFF Research Database (Denmark)

    Stenager, Egon; Brønnum-Hansen, Henrik; Koch-Henriksen, Nils

    2003-01-01

    The incidence of multiple sclerosis (MS) in nurses during the period 1980-1996 was calculated in a nationwide study. The cohort consisted of 69,428 nurses, 2185 men and 67,243 women. Sixty (two men and 58 women) with definite MS were observed, whereas 69.3 were expected. We found no significant...

  13. A Longitudinal Study of Total Quality Management Processes in Business Colleges.

    Science.gov (United States)

    Vazzana, Gary; Elfrink, John; Bachmann, Duane P.

    2000-01-01

    Surveys of business school deans in 1995 (n=243) and 1998 (n=151) regarding total quality management (TQM) practices revealed increases in mission and strategy development, goal setting, and use of advisory boards and cross-functional teams. Few are using TQM to manage core learning processes. (SK)

  14. 450 Perceived Supervisor's Support and Job Insecurity as Predictors ...

    African Journals Online (AJOL)

    reoccurring decline in productivity, efficiency and effectiveness in the workplace. ..... Dealing with anxiety and depression in the workplace. Journal of Training and Management 17(3),pp. 234-243. Klalatbari, J.(1983). A comparison of the effectiveness of cognitive behavior, Medicine, Cognitive and eclectic therapy in anxiety ...

  15. Study of a Wind Energy Conversion System in New Hampshire.

    Science.gov (United States)

    1981-08-01

    distant in time or place as long as they are "reasonably foreseeable." 129 Effects which are ecological , cultural, economic, aesthetic, health related, or...1276 (West Cum. Supp. 1979). 242 16 U.S.C.A. § 1281(a) (1974). 243 See the Water Bank Act 16 U.S.C. § 1202 et. seq . (1970). The Costal Zone

  16. Management of semi-natural grasslands benefiting both planbt and insect diversity: The importance of heterogeneity and tradition

    Czech Academy of Sciences Publication Activity Database

    Bonari, G.; Fajmon, K.; Malenovský, I.; Zelený, D.; Holuša, J.; Jongepierová, I.; Kočárek, P.; Konvička, Ondřej; Uřičář, J.; Chytrý, M.

    2017-01-01

    Roč. 246, AUG 01 (2017), s. 243-252 ISSN 0167-8809 Institutional support: RVO:60077344 Keywords : Carabidae * conservation management * Lepidoptera Subject RIV: EH - Ecology, Behaviour OBOR OECD: Ecology Impact factor: 4.099, year: 2016 http://www.sciencedirect.com/science/article/pii/S0167880917302530

  17. Reactive oxygen species produced by irradiation of some phthalocyanine derivatives

    Czech Academy of Sciences Publication Activity Database

    Černý, J.; Karásková, M.; Rakušan, J.; Nešpůrek, Stanislav

    2010-01-01

    Roč. 210, č. 1 (2010), s. 82-88 ISSN 1010-6030 R&D Projects: GA AV ČR KAN400720701 Institutional research plan: CEZ:AV0Z40500505 Keywords : singlet oxygen * photosensitizer * phthalocyanine Subject RIV: CG - Electrochemistry Impact factor: 2.243, year: 2010

  18. Assessment of surface water resources availability using catchment modeling and the results of tracer studies in the meso-scale Migina Catchment, Rwanda

    NARCIS (Netherlands)

    Munyaneza, O.; Mukubwa, A.; Maskey, S.; Wenninger, J.W.; Uhlenbrook, S.

    2013-01-01

    In the last couple of years, different hydrological research projects were undertaken in the Migina catchment (243.2 km2), a tributary of the Kagera river in Southern Rwanda. These projects were aimed to understand hydrological processes of the catchment using analytical and experimental approaches

  19. Doing Good, Feeling Good, and Having More: Resources Mediate the Health Benefits of Altruism Differently for Males and Females with Lumbar Spine Disorders

    NARCIS (Netherlands)

    Schwartz, Carolyn E.; Quaranto, Brian R.; Bode, Rita; Finkelstein, Joel A.; Glazer, Paul A.; Sprangers, Mirjam A. G.

    2012-01-01

    We evaluated whether resources mediate and/or moderate the relationship between altruism and health outcomes in adults with lumbar spine disorders. Hierarchical regression modeling on 243 persons with lumbar spine disorders evaluated gender differences and whether physical, emotional, and economic

  20. Occupational Fields 68 (Weather Service) and 70 (Aviation Operations) MOSs 6072, 6075, 6076, 6077, 6078, 6079 (Ground Support Equipment) Task Analysis.

    Science.gov (United States)

    1979-08-01

    243. COMPUTE ALTITUDE OF RAWINSCNDE BALLOON 244. ENCODE CATA OF RAiINSONDE SCUNDINGS 245. ASSEMBLE/CISASSEMBLE RADCME 246. OPERATE GMO VAN (RACAR... DIGESTIBLE (FOD) 473. CRIVE RUNwAY SwEEPER 474. MIX PAINTS 475. BRUSH PAINT GSE 476. PREPARE GSE FOR PAINTING 26 477. SPRAY PAINT GSE 478. REMOVE/REPLACE