WorldWideScience

Sample records for californium 242

  1. Historical review of californium-252 discovery and development

    Science.gov (United States)

    Stoddard, D. H.

    This paper discusses the discovery and history of californium 252. This isotope may be synthesized by irradiating plutonium 239, plutonium 242, americium 243, or curium 244 with neutrons in a nuclear reactor. Various experiments and inventions involving (252)Cf conducted at the Savannah River Plant are discussed. The evolution of radiotherapy using californium 252 is reviewed.

  2. Californium-252 progress, report No. 7, April 1971

    Energy Technology Data Exchange (ETDEWEB)

    1971-12-31

    This report contains discusses of the following topics on Californium-252: First sales of californium-252; encapsulation services discussed; three new participants in market evaluation program; summer training programs to use californium; Californium-252 shipping casks available; Californium-252 questions and answers, radiotherapy; neutron radiography; natural resources exploration; nuclear safeguards; process control; dosimetry; neutron radiography; neutron shielding; and nuclear safeguards.

  3. Californium-252: a remarkable versatile radioisotope

    Energy Technology Data Exchange (ETDEWEB)

    Osborne-Lee, I.W.; Alexander, C.W.

    1995-10-10

    A product of the nuclear age, Californium-252 ({sup 252}Cf) has found many applications in medicine, scientific research, industry, and nuclear science education. Californium-252 is unique as a neutron source in that it provides a highly concentrated flux and extremely reliable neutron spectrum from a very small assembly. During the past 40 years, {sup 252}Cf has been applied with great success to cancer therapy, neutron radiography of objects ranging from flowers to entire aircraft, startup sources for nuclear reactors, fission activation for quality analysis of all commercial nuclear fuel, and many other beneficial uses, some of which are now ready for further growth. Californium-252 is produced in the High Flux Isotope Reactor (HFIR) and processed in the Radiochemical Engineering Development Center (REDC), both of which are located at the Oak Ridge National Laboratory (ORNL) in Oak Ridge, Tennessee. The REDC/HFIR facility is virtually the sole supplier of {sup 252}Cf in the western world and is the major supplier worldwide. Extensive exploitation of this product was made possible through the {sup 252}Cf Market Evaluation Program, sponsored by the United States Department of Energy (DOE) [then the Atomic Energy Commission (AEC) and later the Energy Research and Development Administration (ERDA)]. This program included training series, demonstration centers, seminars, and a liberal loan policy for fabricated sources. The Market Evaluation Program was instituted, in part, to determine if large-quantity production capability was required at the Savannah River Laboratory (SRL). Because of the nature of the product and the means by which it is produced, {sup 252}Cf can be produced only in government-owned facilities. It is evident at this time that the Oak Ridge research facility can meet present and projected near-term requirements. The production, shipment, and sales history of {sup 252}Cf from ORNL is summarized herein.

  4. Production, Distribution, and Applications of Californium-252 Neutron Sources

    Energy Technology Data Exchange (ETDEWEB)

    Balo, P.A.; Knauer, J.B.; Martin, R.C.

    1999-10-03

    The radioisotope {sup 252}Cf is routinely encapsulated into compact, portable, intense neutron sources with a 2.6-year half-life. A source the size of a person's little finger can emit up to 10{sup 11} neutrons/s. Californium-252 is used commercially as a reliable, cost-effective neutron source for prompt gamma neutron activation analysis (PGNAA) of coal, cement, and minerals, as well as for detection and identification of explosives, laud mines, and unexploded military ordnance. Other uses are neutron radiography, nuclear waste assays, reactor start-up sources, calibration standards, and cancer therapy. The inherent safety of source encapsulations is demonstrated by 30 years of experience and by U.S. Bureau of Mines tests of source survivability during explosions. The production and distribution center for the U. S Department of Energy (DOE) Californium Program is the Radiochemical Engineering Development Center (REDC) at Oak Ridge National Laboratory (ORNL). DOE sells The radioisotope {sup 252}Cf is routinely encapsulated into compact, portable, intense neutron sources with a 2.6- year half-life. A source the size of a person's little finger can emit up to 10 neutrons/s. Californium-252 is used commercially as a reliable, cost-effective neutron source for prompt gamma neutron activation analysis (PGNAA) of coal, cement, and minerals, as well as for detection and identification of explosives, laud mines, and unexploded military ordnance. Other uses are neutron radiography, nuclear waste assays, reactor start-up sources, calibration standards, and cancer therapy. The inherent safety of source encapsulations is demonstrated by 30 years of experience and by U.S. Bureau of Mines tests of source survivability during explosions. The production and distribution center for the U. S Department of Energy (DOE) Californium Program is the Radiochemical Engineering Development Center (REDC) at Oak Ridge National Laboratory(ORNL). DOE sells {sup 252}Cf to commercial

  5. Unusual structure, bonding and properties in a californium borate

    Energy Technology Data Exchange (ETDEWEB)

    Polinski, Matthew J.; Garner, Edward B.; Maurice, Rémi; Planas, Nora; Stritzinger, Jared T.; Parker, T. Gannon; Cross, Justin N.; Green, Thomas D.; Alekseev, Evgeny V.; Van Cleve, Shelley M.; Depmeier, Wulf; Gagliardi, Laura; Shatruk, Michael; Knappenberger, Kenneth L.; Liu, Guokui; Skanthakumar, S.; Soderholm, Lynda; Dixon, David A.; Albrecht-Schmitt, Thomas E.

    2014-03-23

    The participation of the valence orbitals of actinides in bonding has been debated for decades. Recent experimental and computational investigations demonstrated the involvement of 6p, 6d and/or 5f orbitals in bonding. However, structural and spectroscopic data, as well as theory, indicate a decrease in covalency across the actinide series, and the evidence points to highly ionic, lanthanide-like bonding for late actinides. Here we show that chemical differentiation between californium and lanthanides can be achieved by using ligands that are both highly polarizable and substantially rearrange on complexation. A ligand that suits both of these desired properties is polyborate. We demonstrate that the 5f, 6d and 7p orbitals are all involved in bonding in a Cf(III) borate, and that large crystal-field effects are present. Synthetic, structural and spectroscopic data are complemented by quantum mechanical calculations to support these observations.

  6. Biomedical neutron research at the Californium User Facility for neutron science

    Energy Technology Data Exchange (ETDEWEB)

    Martin, R.C. [Oak Ridge National Lab., TN (United States); Byrne, T.E. [Roane State Community College, Harriman, TN (United States); Miller, L.F. [Univ. of Tennessee, Knoxville, TN (United States)

    1997-04-01

    The Californium User Facility for Neutron Science has been established at Oak Ridge National Laboratory (ORNL). The Californium User Facility (CUF) is a part of the larger Californium Facility, which fabricates and stores compact {sup 252}Cf neutron sources for worldwide distribution. The CUF can provide a cost-effective option for research with {sup 252}Cf sources. Three projects at the CUF that demonstrate the versatility of {sup 252}Cf for biological and biomedical neutron-based research are described: future establishment of a {sup 252}Cf-based neutron activation analysis system, ongoing work to produce miniature high-intensity, remotely afterloaded {sup 252}Cf sources for tumor therapy, and a recent experiment that irradiated living human lung cancer cells impregnated with experimental boron compounds to test their effectiveness for boron neutron capture therapy.

  7. Apparatus for the measurement of total body nitrogen using prompt neutron activation analysis with californium-252.

    Science.gov (United States)

    Mackie, A; Hannan, W J; Smith, M A; Tothill, P

    1988-01-01

    Details of clinical apparatus designed for the measurement of total body nitrogen (as an indicator of body protein), suitable for the critically ill, intensive-care patient are presented. Californium-252 radio-isotopic neutron sources are used, enabling a nitrogen measurement by prompt neutron activation analysis to be made in 40 min with a precision of +/- 3.2% for a whole body dose equivalent of 0.145 mSv. The advantages of Californium-252 over alternative neutron sources are discussed. A comparison between two irradiation/detection geometries is made, leading to an explanation of the geometry adopted for the apparatus. The choice of construction and shielding materials to reduce the count rate at the detectors and consequently to reduce the pile-up contribution to the nitrogen background is discussed. Salient features of the gamma ray spectroscopy system to reduce spectral distortion from pulse pile-up are presented.

  8. Safety Analysis Report for Packaging (SARP) of the Oak Ridge National Laboratory TRU Californium Shipping Container

    Energy Technology Data Exchange (ETDEWEB)

    Box, W.D.; Shappert, L.B.; Seagren, R.D.; Klima, B.B.; Jurgensen, M.C.; Hammond, C.R.; Watson, C.D.

    1980-01-01

    An analytical evaluation of the Oak Ridge National Laboratory TRU Californium Shipping Container was made in order to demonstrate its compliance with the regulations governing off-site shipment of packages that contain radioactive material. The evaluation encompassed five primary categories: structural integrity, thermal resistance, radiation shielding, nuclear criticality safety, and quality assurance. The results of this evaluation demonstrate that the container complies with the applicable regulations.

  9. 32 CFR 242a.8 - Effective date.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false Effective date. 242a.8 Section 242a.8 National Defense Department of Defense (Continued) OFFICE OF THE SECRETARY OF DEFENSE (CONTINUED) MISCELLANEOUS... § 242a.8 Effective date. This part shall become effective on March 12, 1977. ...

  10. 48 CFR 53.242 - Contract administration.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Contract administration. 53.242 Section 53.242 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION (CONTINUED) CLAUSES AND FORMS FORMS Prescription of Forms 53.242 Contract administration...

  11. 25 CFR 242.7 - Suspension.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Suspension. 242.7 Section 242.7 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR FISH AND WILDLIFE COMMERCIAL FISHING ON RED LAKE INDIAN RESERVATION § 242.7 Suspension. All commercial fishing operations may be suspended by order of the Secretary at any...

  12. 37 CFR 2.42 - Concurrent use.

    Science.gov (United States)

    2010-07-01

    ... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Concurrent use. 2.42 Section 2.42 Patents, Trademarks, and Copyrights UNITED STATES PATENT AND TRADEMARK OFFICE, DEPARTMENT OF COMMERCE RULES OF PRACTICE IN TRADEMARK CASES The Written Application § 2.42 Concurrent use. An application...

  13. 32 CFR 242.7 - Responsibilities.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false Responsibilities. 242.7 Section 242.7 National Defense Department of Defense (Continued) OFFICE OF THE SECRETARY OF DEFENSE (CONTINUED) MISCELLANEOUS... SCIENCES § 242.7 Responsibilities. (a) The President of the University shall: (1) Develop and prescribe...

  14. Dicty_cDB: VSF242 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VS (Link to library) VSF242 (Link to dictyBase) - - - Contig-U16488-1 VSF242P (Link to Original site) VSF...242F 378 VSF242Z 306 VSF242P 684 - - Show VSF242 Library VS (Link to library) Clone ID VSF... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VS/VSF2-B/VSF242Q.Seq.d/ Representative seq. ID VSF...242P (Link to Original site) Representative DNA sequence >VSF242 (VSF242Q) /CSM/VS/VSF2-B/VSF2...lsrl*nhhyrfltrpkrchlqfmfn cycstnwwsc*nhcrlsfktkirlrlpsnrtnafnfffnrk*tikknamcrvii*

  15. 24 CFR 242.61 - Management.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Management. 242.61 Section 242.61... Management. The mortgagor shall provide for management of the hospital in a manner satisfactory to HUD. (a) Contract Management of Hospital. The mortgagor shall not execute a management agreement or any other...

  16. 24 CFR 242.37 - Mortgage prepayment.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Mortgage prepayment. 242.37 Section... DEVELOPMENT MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES MORTGAGE INSURANCE FOR HOSPITALS Mortgage Requirements § 242.37 Mortgage prepayment. (a) Prepayment privilege. Except...

  17. 42 CFR 24.2 - Allocation.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 1 2010-10-01 2010-10-01 false Allocation. 24.2 Section 24.2 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES PERSONNEL SENIOR BIOMEDICAL RESEARCH SERVICE § 24... talent. (e) The Secretary will ensure that SBRS slots are used in support of high priority programs...

  18. 24 CFR 242.40 - Mortgagee certificate.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Mortgagee certificate. 242.40... URBAN DEVELOPMENT MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES MORTGAGE INSURANCE FOR HOSPITALS Endorsement for Insurance § 242.40 Mortgagee certificate. At initial...

  19. 24 CFR 242.39 - Insurance endorsement.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Insurance endorsement. 242.39... MORTGAGE INSURANCE FOR HOSPITALS Endorsement for Insurance § 242.39 Insurance endorsement. Initial endorsement of the mortgage note shall occur before any mortgage proceeds are insured, and the time of final...

  20. 48 CFR 242.1106 - Reporting requirements.

    Science.gov (United States)

    2010-10-01

    ... inventory control manager. (ii) If the contractor's report indicates that the contract is on schedule and... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Reporting requirements. 242.1106 Section 242.1106 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS...

  1. 24 CFR 242.82 - Energy conservation.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Energy conservation. 242.82 Section... INSURANCE FOR HOSPITALS Miscellaneous Requirements § 242.82 Energy conservation. Construction, mechanical equipment, and energy and metering selections shall provide cost-effective energy conservation in accordance...

  2. 17 CFR 242.403 - Required margin.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Required margin. 242.403...) REGULATIONS M, SHO, ATS, AC, AND NMS AND CUSTOMER MARGIN REQUIREMENTS FOR SECURITY FUTURES Customer Margin Requirements for Security Futures § 242.403 Required margin. (a) Applicability. Each security futures...

  3. 24 CFR 242.52 - Construction contracts.

    Science.gov (United States)

    2010-04-01

    ...; a construction management contract with a guaranteed maximum price, the final costs of which are... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Construction contracts. 242.52... MORTGAGE INSURANCE FOR HOSPITALS Construction § 242.52 Construction contracts. (a) Awarding of contract. A...

  4. 32 CFR 242.3 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... ADMISSION POLICIES AND PROCEDURES FOR THE SCHOOL OF MEDICINE, UNIFORMED SERVICES UNIVERSITY OF THE HEALTH SCIENCES § 242.3 Definitions. As used herein, the following definitions apply: (a) Uniformed Services. As used herein, means the Army, Navy, Air Force, Marine Corps, and the Commissioned Corps of the Public...

  5. 32 CFR 242a.2 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... PUBLIC MEETING PROCEDURES OF THE BOARD OF REGENTS, UNIFORMED SERVICES UNIVERSITY OF THE HEALTH SCIENCES § 242a.2 Definitions. (a) Board or Board of Regents means the collegial body that conducts the business of the Uniformed Services University of the Health Sciences as specified in Title 10, U.S. Code 2113...

  6. 12 CFR 24.2 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... ENTITIES, COMMUNITY DEVELOPMENT PROJECTS, AND OTHER PUBLIC WELFARE INVESTMENTS § 24.2 Definitions. For... that may be CEDEs: (1) National bank community development corporation subsidiaries; (2) Private or... Institutions or Community Development Entities; (4) Limited liability companies or limited partnerships; (5...

  7. Application of TSH bioindicator for studying the biological efficiency of neutrons from californium-252 source

    Energy Technology Data Exchange (ETDEWEB)

    Cebulska-Wasilewska, A.; Rekas, K. [Institute of Nuclear Physics, Cracow (Poland); Kim, J.K. [Korea Atomic Energy Research Inst., Taejon (Korea, Republic of)

    1997-12-31

    The effectiveness of neutrons from a Californium-252 source in the induction of various abnormalities in the Tradescantia clone 4430 stamen hair cells (TSH-assay) was studied. The special attention was paid to check whether any enhancement in effects caused by process of boron neutron capture is visible in the cells enriched with boron ions. Two chemicals (borax and BSH) were applied to introduce boron-10 ions into cells. Inflorescence, normal or pretreated with chemicals containing boron, were irradiated in the air with neutrons from a Cf-252 source at KAERI, Taejon, Korea. To estimate the relative biological effectiveness (RBE) in the induction of gene mutations of the neutron beam under the study, Tradescantia inflorescences, without any chemical pretreatment, were irradiated with various doses of X-rays. The ranges of radiation doses used were 0-0.1 Gy in neutrons and 0-0.5 Gy in X-rays. After the time needed to complete the postirradiation repair Tradescantia cuttings were transferred to Cracow, where screening of gene and lethal; mutations, cell cycle alterations in somatic cells have been done, and dose response relationships were figured. The maximal RBE values were estimated in the range of 4.6-6.8. Alterations of RBE value were observed; from 6.8 to 7.8 in the case of plants pretreated with 240 ppm of B-10 from borax, and 4.6 to 6.1 in the case of 400 ppm of B-10 from BSH. Results showed a slight, although statistically insignificant increase in biological efficacy of radiation from the Cf-252 source in samples pretreated with boron containing chemicals. (author)

  8. Study of the shielding for spontaneous fission sources of Californium-252; Estudio de blindaje para fuentes de fision espontanea de Californio-252

    Energy Technology Data Exchange (ETDEWEB)

    Davila R, I

    1991-06-15

    A shielding study is made to attenuate, until maximum permissible levels, the neutrons radiation and photons emitted by spontaneous fission coming from a source of Californium-252. The compound package by a database (Library DLC-23) and the ANISNW code is used, in it version for personal computer. (Author)

  9. 36 CFR 242.18 - Regulation adoption process.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Regulation adoption process. 242.18 Section 242.18 Parks, Forests, and Public Property FOREST SERVICE, DEPARTMENT OF AGRICULTURE SUBSISTENCE MANAGEMENT REGULATIONS FOR PUBLIC LANDS IN ALASKA Program Structure § 242.18 Regulation adoption...

  10. 17 CFR 242.301 - Requirements for alternative trading systems.

    Science.gov (United States)

    2010-04-01

    ... trading systems. 242.301 Section 242.301 Commodity and Securities Exchanges SECURITIES AND EXCHANGE... FUTURES Regulation Ats-Alternative Trading Systems § 242.301 Requirements for alternative trading systems. (a) Scope of section. An alternative trading system shall comply with the requirements in paragraph...

  11. 9 CFR 354.242 - Cleaning of equipment and utensils.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Cleaning of equipment and utensils. 354.242 Section 354.242 Animals and Animal Products FOOD SAFETY AND INSPECTION SERVICE, DEPARTMENT OF... Sanitary Conditions and Precautions Against Contamination of Products § 354.242 Cleaning of equipment and...

  12. 42 CFR 438.242 - Health information systems.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 4 2010-10-01 2010-10-01 false Health information systems. 438.242 Section 438.242... Measurement and Improvement Standards § 438.242 Health information systems. (a) General rule. The State must ensure, through its contracts, that each MCO and PIHP maintains a health information system that collects...

  13. 28 CFR 2.42 - Probation officer's reports to Commission.

    Science.gov (United States)

    2010-07-01

    ... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Probation officer's reports to Commission. 2.42 Section 2.42 Judicial Administration DEPARTMENT OF JUSTICE PAROLE, RELEASE, SUPERVISION AND... § 2.42 Probation officer's reports to Commission. A supervision report shall be submitted by the...

  14. 7 CFR 1220.242 - Books and records.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 10 2010-01-01 2010-01-01 false Books and records. 1220.242 Section 1220.242... CONSUMER INFORMATION Soybean Promotion and Research Order Reports, Books, and Records § 1220.242 Books and... subpart shall maintain and make available for inspection by the Board or Secretary such books and records...

  15. 17 CFR 242.505 - Exclusion for news media.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Exclusion for news media. 242.505 Section 242.505 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION (CONTINUED...-Analyst Certification § 242.505 Exclusion for news media. No provision of this Regulation AC shall apply...

  16. Dicty_cDB: CFH242 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CF (Link to library) CFH242 (Link to dictyBase) - - - Contig-U16349-1 CFH242Z (Link... to Original site) - - CFH242Z 650 - - - - Show CFH242 Library CF (Link to library) Clone ID CFH242 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16349-1 Original site URL http://dict...d Amino Acid sequence ---ASGSVVEQCSSVDSISNLPTTMQLFAGIKSICTEMAMDGCEKCSGNSPTTTCDVLPV YSSLCMAMPDMSQCANWTKMCSSSG...*fn*fiflk wflskill*ryn*rmftcyrtnm*lcfnaccndi*cctl Frame C: ---ASGSVVEQCSSVDSISNLPTTMQLFAGIKSICT

  17. Simulation and design of an electron beam ion source charge breeder for the californium rare isotope breeder upgrade

    Directory of Open Access Journals (Sweden)

    Clayton Dickerson

    2013-02-01

    Full Text Available An electron beam ion source (EBIS will be constructed and used to charge breed ions from the californium rare isotope breeder upgrade (CARIBU for postacceleration into the Argonne tandem linear accelerator system (ATLAS. Simulations of the EBIS charge breeder performance and the related ion transport systems are reported. Propagation of the electron beam through the EBIS was verified, and the anticipated incident power density within the electron collector was identified. The full normalized acceptance of the charge breeder with a 2 A electron beam, 0.024π  mm mrad for nominal operating parameters, was determined by simulating ion injection into the EBIS. The optics of the ion transport lines were carefully optimized to achieve well-matched ion injection, to minimize emittance growth of the injected and extracted ion beams, and to enable adequate testing of the charge bred ions prior to installation in ATLAS.

  18. Extraction of Trivalent Actinides and Lanthanides from Californium Campaign Rework Solution Using TODGA-based Solvent Extraction System

    Energy Technology Data Exchange (ETDEWEB)

    Benker, Dennis [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Delmau, Laetitia Helene [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Dryman, Joshua Cory [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States)

    2017-07-01

    This report presents the studies carried out to demonstrate the possibility of quantitatively extracting trivalent actinides and lanthanides from highly acidic solutions using a neutral ligand-based solvent extraction system. These studies stemmed from the perceived advantage of such systems over cationexchange- based solvent extraction systems that require an extensive feed adjustment to make a low-acid feed. The targeted feed solutions are highly acidic aqueous phases obtained after the dissolution of curium targets during a californium (Cf) campaign. Results obtained with actual Cf campaign solutions, but highly diluted to be manageable in a glove box, are presented, followed by results of tests run in the hot cells with Cf campaign rework solutions. It was demonstrated that a solvent extraction system based on the tetraoctyl diglycolamide molecule is capable of quantitatively extracting trivalent actinides from highly acidic solutions. This system was validated using actual feeds from a Cf campaign.

  19. Beyond Californium-A Neutron Generator Alternative for Dosimetry and Instrument Calibration in the U.S.

    Science.gov (United States)

    Piper, Roman K; Mozhayev, Andrey V; Murphy, Mark K; Thompson, Alan K

    2017-09-01

    Evaluations of neutron survey instruments, area monitors, and personal dosimeters rely on reference neutron radiations, which have evolved from the heavy reliance on (α,n) sources to a shared reliance on (α,n) and the spontaneous fission neutrons of californium-252 (Cf). Capable of producing high dose equivalent rates from an almost point source geometry, the characteristics of Cf are generally more favorable when compared to the use of (α,n) and (γ,n) sources or reactor-produced reference neutron radiations. Californium-252 is typically used in two standardized configurations: unmoderated, to yield a fission energy spectrum; or with the capsule placed within a heavy-water moderating sphere to produce a softened spectrum that is generally considered more appropriate for evaluating devices used in nuclear power plant work environments. The U.S. Department of Energy Cf Loan/Lease Program, a longtime origin of affordable Cf sources for research, testing and calibration, was terminated in 2009. Since then, high-activity sources have become increasingly cost-prohibitive for laboratories that formerly benefited from that program. Neutron generators, based on the D-T and D-D fusion reactions, have become economically competitive with Cf and are recognized internationally as important calibration and test standards. Researchers from the National Institute of Standards and Technology and the Pacific Northwest National Laboratory are jointly considering the practicality and technical challenges of implementing neutron generators as calibration standards in the U.S. This article reviews the characteristics of isotope-based neutron sources, possible isotope alternatives to Cf, and the rationale behind the increasing favor of electronically generated neutron options. The evaluation of a D-T system at PNNL has revealed characteristics that must be considered in adapting generators to the task of calibration and testing where accurate determination of a dosimetric quantity is

  20. Californium-252 Brachytherapy Combined With External-Beam Radiotherapy for Cervical Cancer: Long-Term Treatment Results

    Energy Technology Data Exchange (ETDEWEB)

    Lei Xin; Qian Chengyuan; Qing Yi; Zhao Kewei; Yang Zhengzhou; Dai Nan; Zhong Zhaoyang; Tang Cheng; Li Zheng; Gu Xianqing; Zhou Qian; Feng Yan; Xiong Yanli; Shan Jinlu [Cancer Center, Research Institute of Surgery and Daping Hospital, Third Military Medical University, Chongqing (China); Wang Dong, E-mail: dongwang64@hotmail.com [Cancer Center, Research Institute of Surgery and Daping Hospital, Third Military Medical University, Chongqing (China)

    2011-12-01

    Purpose: To observe, by retrospective analysis, the curative effects and complications due to californium-252 ({sup 252}Cf) neutron intracavitary brachytherapy (ICBT) combined with external-beam radiotherapy (EBRT) in the treatment of cervical cancer. Methods and Materials: From February 1999 to December 2007, 696 patients with cervical cancer (Stages IB to IIIB) were treated with {sup 252}Cf-ICBT in combination of EBRT. Of all, 31 patients were at Stage IB, 104 at IIA, 363 at IIB, 64 at IIIA, and 134 at IIIB. Californium-252 ICBT was delivered at 7-12 Gy per insertion per week, with a total dose of 29-45 Gy to reference point A in three to five insertions. The whole pelvic cavity was treated with 8-MV X-ray external irradiation at 2 Gy per fraction, four times per week. After 16-38 Gy of external irradiation, the center of the whole pelvic field was blocked with a 4-cm-wide lead shield, with a total external irradiation dose of 44-56 Gy. The total treatment course was 5 to 6 weeks. Results: Overall survival rate at 3 and 5 years for all patients was 76.0% and 64.9%, respectively. Disease-free 3- and 5-year survival rates of patients were 71.2% and 58.4%, respectively. Late complications included vaginal contracture and adhesion, radiation proctitis, radiation cystitis, and inflammatory bowel, which accounted for 5.8%, 7.1%, 6.2%, and 4.9%, respectively. Univariate analysis results showed significant correlation of stage, age, histopathologic grade, and lymph node status with overall survival. Cox multiple regression analysis showed that the independent variables were stage, histopathologic grade, tumor size, and lymphatic metastasis in all patients. Conclusion: Results of this series suggest that the combined use of {sup 252}Cf-ICBT with EBRT is an effective method for treatment of cervical cancer.

  1. 242-A evaporator safety analysis report

    Energy Technology Data Exchange (ETDEWEB)

    CAMPBELL, T.A.

    1999-05-17

    This report provides a revised safety analysis for the upgraded 242-A Evaporator (the Evaporator). This safety analysis report (SAR) supports the operation of the Evaporator following life extension upgrades and other facility and operations upgrades (e.g., Project B-534) that were undertaken to enhance the capabilities of the Evaporator. The Evaporator has been classified as a moderate-hazard facility (Johnson 1990). The information contained in this SAR is based on information provided by 242-A Evaporator Operations, Westinghouse Hanford Company, site maintenance and operations contractor from June 1987 to October 1996, and the existing operating contractor, Waste Management Hanford (WMH) policies. Where appropriate, a discussion address the US Department of Energy (DOE) Orders applicable to a topic is provided. Operation of the facility will be compared to the operating contractor procedures using appropriate audits and appraisals. The following subsections provide introductory and background information, including a general description of the Evaporator facility and process, a description of the scope of this SAR revision,a nd a description of the basic changes made to the original SAR.

  2. 48 CFR 242.202 - Assignment of contract administration.

    Science.gov (United States)

    2010-10-01

    ... the military department, and subject to prior agreement, perform contract administration services on a... subcontract that includes foreign contract military sale (FMS) requirements, the contract administration... administration. 242.202 Section 242.202 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS...

  3. 16 CFR 24.2 - Deception as to composition.

    Science.gov (United States)

    2010-01-01

    ... 16 Commercial Practices 1 2010-01-01 2010-01-01 false Deception as to composition. 24.2 Section 24... LEATHER AND IMITATION LEATHER PRODUCTS § 24.2 Deception as to composition. It is unfair or deceptive to misrepresent, directly or by implication, the composition of any industry product or part thereof. It is unfair...

  4. 10 CFR 431.242 - Test Procedures [Reserved

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 3 2010-01-01 2010-01-01 false Test Procedures 431.242 Section 431.242 Energy DEPARTMENT OF ENERGY ENERGY CONSERVATION ENERGY EFFICIENCY PROGRAM FOR CERTAIN COMMERCIAL AND INDUSTRIAL... upstream of the draft control device of an individual, automatically operated, fossil fuel-fired appliance...

  5. 24 CFR 242.14 - Mortgage reserve fund.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Mortgage reserve fund. 242.14... URBAN DEVELOPMENT MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES MORTGAGE INSURANCE FOR HOSPITALS General Eligibility Requirements § 242.14 Mortgage reserve fund. As a...

  6. 24 CFR 242.35 - Mortgage lien certifications.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Mortgage lien certifications. 242... URBAN DEVELOPMENT MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES MORTGAGE INSURANCE FOR HOSPITALS Mortgage Requirements § 242.35 Mortgage lien certifications. At initial...

  7. 24 CFR 242.7 - Maximum mortgage amounts.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Maximum mortgage amounts. 242.7... URBAN DEVELOPMENT MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES MORTGAGE INSURANCE FOR HOSPITALS General Eligibility Requirements § 242.7 Maximum mortgage amounts. The...

  8. 24 CFR 242.45 - Early commencement of work.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Early commencement of work. 242.45... MORTGAGE INSURANCE FOR HOSPITALS Construction § 242.45 Early commencement of work. (a) Site preparation... work can commence only after the review of the work and concurrence by HUD, including the environmental...

  9. 10 CFR 72.242 - Recordkeeping and reports.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 2 2010-01-01 2010-01-01 false Recordkeeping and reports. 72.242 Section 72.242 Energy... following specific information as appropriate for the particular event: (i) Dates and approximate times of... component or system failure; (vi) The manufacturer and model number (or other identification) of each...

  10. 17 CFR 242.405 - Withdrawal of margin.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Withdrawal of margin. 242.405...) REGULATIONS M, SHO, ATS, AC, AND NMS AND CUSTOMER MARGIN REQUIREMENTS FOR SECURITY FUTURES Customer Margin Requirements for Security Futures § 242.405 Withdrawal of margin. (a) By the customer. Except as otherwise...

  11. 24 CFR 242.26 - Agreed interest rate.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Agreed interest rate. 242.26... MORTGAGE INSURANCE FOR HOSPITALS Mortgage Requirements § 242.26 Agreed interest rate. (a) The mortgage shall bear interest at the rate or rates agreed upon by the mortgagee and the mortgagor. (b) The amount...

  12. 40 CFR 86.242-94 - Records required.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 18 2010-07-01 2010-07-01 false Records required. 86.242-94 Section 86.242-94 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED... Later Model Year Gasoline-Fueled New Light-Duty Vehicles, New Light-Duty Trucks and New Medium-Duty...

  13. 24 CFR 242.11 - Regulatory compliance required.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Regulatory compliance required. 242... MORTGAGE INSURANCE FOR HOSPITALS General Eligibility Requirements § 242.11 Regulatory compliance required... with a hospital that is in substantial compliance with regulations of the Department of Health and...

  14. 24 CFR 242.67 - New corporations, subsidiaries, affiliations, and mergers.

    Science.gov (United States)

    2010-04-01

    ..., affiliations, and mergers. 242.67 Section 242.67 Housing and Urban Development Regulations Relating to Housing... Reporting, and Financial Requirements § 242.67 New corporations, subsidiaries, affiliations, and mergers... written approval for all future mergers. ...

  15. Long-term effects of an intracavitary treatment with californium-252 on normal tissue. [Swine, /sup 226/Ra

    Energy Technology Data Exchange (ETDEWEB)

    Sullivan, M.F.; Beamer, J.L.; Mahony, T.D.; Cross, F.T.; Lund, J.E.; Endres, G.W.R.

    1976-01-01

    About one hundred fifty swine were exposed to either radium-226 or californium-252 sources in the uterine cervix to determine an RBE for both acute and long-term effects. That value for early changes in the tissues at risk in the treatment of cervical cancer was between 6.2 and 6.8. The incidence of complications increased with time after exposure, especially among animals treated with /sup 252/Cf. Analysis of rectal injury showed that ulceration occurred frequently within a year postexposure at doses between 1600 and 2400 rad calculated at 2 cm lateral to the source midline. Fat necrosis and smooth muscle atrophy, resulting in a local rectal stricture, were delayed changes observed in some animals. The lower ureter was the site for a greater frequency of complications than the GI tract. Ureteral stricture often occurred at doses of 1200 rad from /sup 252/Cf and 7000 rad from /sup 226/Ra. Observation of delayed effects in the uterine-cervix in animals held up to 4 years postexposure indicate that the RBE for /sup 252/Cf may be increased to a value as high as 18, while repair may have even decreased it to about 5.6 in the rectum. Fifty swine are still being observed for long-term effects after doses above 800 rad from /sup 252/Cf and 5000 rad from /sup 226/Ra.

  16. Determination of 242Pu by correlation with 239Pu only

    Science.gov (United States)

    Swinhoe, M. T.; Iwamoto, T.; Tamura, T.

    2010-03-01

    Correlations are used to determine the 242Pu content of material using high resolution gamma measurements on the other plutonium isotopes because 242Pu itself has no practically detectable gamma emission lines. This paper presents an improved correlation that is particularly useful because, unlike some previous correlations, no prior knowledge of the reactor type or initial enrichment is required. This correlation has been shown to perform well over a range of plutonium from commercial BWR and PWR reactors. The agreement of the calculated 242Pu values with IDMS values is within 1% for 239Pu content of less than 70% and within 4% for 239Pu content of less than 80%. This simple form of the correlation is somewhat surprising given the complex behavior of 239/240 and 242/240 ratios.

  17. 17 CFR 242.302 - Recordkeeping requirements for alternative trading systems.

    Science.gov (United States)

    2010-04-01

    ... alternative trading systems. 242.302 Section 242.302 Commodity and Securities Exchanges SECURITIES AND... SECURITY FUTURES Regulation Ats-Alternative Trading Systems § 242.302 Recordkeeping requirements for alternative trading systems. To comply with the condition set forth in paragraph (b)(8) of § 242.301, an...

  18. National Low-Level Waste Management Program radionuclide report series. Volume 13, Curium-242

    Energy Technology Data Exchange (ETDEWEB)

    Adams, J.P.

    1995-08-01

    This report, Volume 13 of the National Low-Level Waste Management Program Radionuclide Report Series, discusses the radiological and chemical characteristics of curium-242 ({sup 242}Cm). This report also includes discussions about waste types and forms in which {sup 242}Cm can be found and {sup 242}Cm behavior in the environment and in the human body.

  19. 242Pu absolute neutron-capture cross section measurement

    Science.gov (United States)

    Buckner, M. Q.; Wu, C. Y.; Henderson, R. A.; Bucher, B.; Chyzh, A.; Bredeweg, T. A.; Baramsai, B.; Couture, A.; Jandel, M.; Mosby, S.; O'Donnell, J. M.; Ullmann, J. L.

    2017-09-01

    The absolute neutron-capture cross section of 242Pu was measured at the Los Alamos Neutron Science Center using the Detector for Advanced Neutron-Capture Experiments array along with a compact parallel-plate avalanche counter for fission-fragment detection. During target fabrication, a small amount of 239Pu was added to the active target so that the absolute scale of the 242Pu(n,γ) cross section could be set according to the known 239Pu(n,f) resonance at En,R = 7.83 eV. The relative scale of the 242Pu(n,γ) cross section covers four orders of magnitude for incident neutron energies from thermal to ≈ 40 keV. The cross section reported in ENDF/B-VII.1 for the 242Pu(n,γ) En,R = 2.68 eV resonance was found to be 2.4% lower than the new absolute 242Pu(n,γ) cross section.

  20. 242Pu absolute neutron-capture cross section measurement

    Directory of Open Access Journals (Sweden)

    Buckner M.Q.

    2017-01-01

    Full Text Available The absolute neutron-capture cross section of 242Pu was measured at the Los Alamos Neutron Science Center using the Detector for Advanced Neutron-Capture Experiments array along with a compact parallel-plate avalanche counter for fission-fragment detection. During target fabrication, a small amount of 239Pu was added to the active target so that the absolute scale of the 242Pu(n,γ cross section could be set according to the known 239Pu(n,f resonance at En,R = 7.83 eV. The relative scale of the 242Pu(n,γ cross section covers four orders of magnitude for incident neutron energies from thermal to ≈ 40 keV. The cross section reported in ENDF/B-VII.1 for the 242Pu(n,γ En,R = 2.68 eV resonance was found to be 2.4% lower than the new absolute 242Pu(n,γ cross section.

  1. Ab initio full-potential study of mechanical properties and magnetic phase stability of californium monopnictides (CfN and CfP)

    Energy Technology Data Exchange (ETDEWEB)

    Amari, S., E-mail: siham_amari@yahoo.fr [Faculté des Sciences de la Nature et de la Vie, Université Hassiba Benbouali, Chlef, 02000 (Algeria); Bouhafs, B. [Laboratoire de Modélisation et Simulation en Sciences des Matériaux, Université Djillali Liabès de Sidi Bel-Abbés, Sidi Bel-Abbés, 22000 (Algeria)

    2016-09-15

    Based on the first-principles methods, the structural, elastic, electronic, properties and magnetic ordering of californium monopnictides CfX (X = P) have been studied using the full-potential augmented plane wave plus local orbitals (FP-L/APW + lo) method within the framework of density functional theory (DFT). The electronic exchange correlation energy is described by generalized gradient approximation GGA and GGA+U (U is the Hubbard correction). The GGA+U method is applied to the rare-earth 5f states. We have calculated the lattice parameters, bulk modulii and the first pressure derivatives of the bulk modulii. The elastic properties of the studied compounds are only investigated in the most stable calculated phase. In order to gain further information, we have calculated Young’s modulus, shear modulus, anisotropy factor and Kleinman parameter by the aid of the calculated elastic constants. The results mainly show that californium monopnictides CfX (X = P) have an antiferromagnetic spin ordering. Density of states (DOS) and charge densities for both compounds are also computed in the NaCl (B1) structure.

  2. Americium 242m and its potential use in space applications

    Energy Technology Data Exchange (ETDEWEB)

    Benetti, P [Istituto Nazionale di Fisica Nucleare (INFN) Sezione di Pavia, via Bassi 6, I-27100 Pavia. (Italy); Cesana, A [Ansaldo Nucleare, Division of Ansaldo Energia S.p.A., c.so Perrone 25, I-16161, Genova (Italy); Cinotti, L [Dipartimento di Ingegneria Nucleare, Politecnico di Milano, via Ponzio 34/3, I-20133 Milan (Italy); Raselli, G L [Istituto Nazionale di Fisica Nucleare (INFN) Sezione di Pavia, via Bassi 6, I-27100 Pavia. (Italy); Terrani, M [Ansaldo Nucleare, Division of Ansaldo Energia S.p.A., c.so Perrone 25, I-16161, Genova (Italy)

    2006-05-15

    The isotope Am242m is an interesting nuclide as it shows one of the known highest neutron fission cross section. This could be useful in some special applications, like the nuclear reactor for space propulsion proposed by C. Rubbia. A detailed measurement of the energy transfer from the fission fragments to the gas as a function of the path and the gas type is an important item for the evaluation of the engine performances. This was carried out by means of an ionisation chamber. However the Am242m availability, in particular at high isotopic abundance, is still at present a serious drawback. A production model, experimentally tested in thermal nuclear reactors, has been used to evaluate the achievable isotopic abundances. The results are quite below 70% and advise the use of separation techniques for further enrichment. The use of Am242m for other applications like nuclear pumped laser is suggested.

  3. Measurement of the 242Pu neutron capture cross section

    Science.gov (United States)

    Buckner, M. Q.; Wu, C. Y.; Henderson, R. A.; Bucher, B.; Bredeweg, T. A.; Baramsai, B.; Couture, A.; Jandel, M.; Mosby, S.; O'Donnell, J. M.; Ullmann, J. L.; Chyzh, A.; Dance Collaboration

    2015-10-01

    Precision (n,f) and (n, γ) cross sections are important for the network calculations of the radiochemical diagnostic chain for the U.S. DOE's Stockpile Stewardship Program. 242Pu(n, γ) cross section is relevant to the network calculations of Pu and Am. Additionally, new reactor concepts have catalyzed considerable interest in the measurement of improved cross sections for neutron-induced reactions on key actinides. To date, little or no experimental data has been reported on 242Pu(n, γ) for incident neutron energy below 50 keV. A new measurement of the 242Pu(n, γ) reaction was performed with the DANCE together with an improved PPAC for fission-fragment detection at LANSCE during FY14. The relative scale of the 242Pu(n, γ) cross section spans four orders of magnitude for incident neutron energies from thermal to ~ 30 keV. The absolute scale of the 242Pu(n, γ) cross section is set according to the measured 239Pu(n,f) resonance at 7.8 eV; the target was spiked with 239Pu for this measurement. The absolute 242Pu(n, γ) neutron capture cross section is ~ 30% higher than the cross section reported in ENDF for the 2.7 eV resonance. Latest results to be reported. Funded by U.S. DOE Contract No. DE-AC52-07NA27344 (LLNL) and DE-AC52-06NA25396 (LANL). U.S. DOE/NNSA Office of Defense Nuclear Nonproliferation Research and Development. Isotopes (ORNL).

  4. Low-Dose-Rate Californium-252 Neutron Intracavitary Afterloading Radiotherapy Combined With Conformal Radiotherapy for Treatment of Cervical Cancer

    Energy Technology Data Exchange (ETDEWEB)

    Zhang Min [Department of Oncology, Armed Police Hospital of Hangzhou, Hangzhou, Zhejiang Province (China); Xu Hongde [Cancer Center, Armed Police Hospital of Hangzhou, Hangzhou, Zhejiang Province (China); Pan Songdan; Lin Shan; Yue Jianhua [Department of Oncology, Armed Police Hospital of Hangzhou, Hangzhou, Zhejiang Province (China); Liu Jianren, E-mail: liujianren0571@hotmail.com [Second Affiliated Hospital, School of Medicine, Zhejiang University, Hangzhou, Zhejiang Province (China)

    2012-07-01

    Purpose: To study the efficacy of low-dose-rate californium-252 ({sup 252}Cf) neutron intracavitary afterloading radiotherapy (RT) combined with external pelvic RT for treatment of cervical cancer. Methods and Materials: The records of 96 patients treated for cervical cancer from 2006 to 2010 were retrospectively reviewed. For patients with tumors {<=}4 cm in diameter, external beam radiation was performed (1.8 Gy/day, five times/week) until the dose reached 20 Gy, and then {sup 252}Cf neutron intracavitary afterloading RT (once/week) was begun, and the frequency of external beam radiation was changed to four times/week. For patients with tumors >4 cm, {sup 252}Cf RT was performed one to two times before whole-pelvis external beam radiation. The tumor-eliminating dose was determined by using the depth limit of 5 mm below the mucosa as the reference point. In all patients, the total dose of the external beam radiation ranged from 46.8 to 50 Gy. For {sup 252}Cf RT, the dose delivered to point A was 6 Gy/fraction, once per week, for a total of seven times, and the total dose was 42 Gy. Results: The mean {+-} SD patient age was 54.7 {+-} 13.7 years. Six patients had disease assessed at stage IB, 13 patients had stage IIA, 49 patients had stage IIB, 3 patients had stage IIIA, 24 patients had stage IIIB, and 1 patient had stage IVA. All patients obtained complete tumor regression (CR). The mean {+-} SD time to CR was 23.5 {+-} 3.4 days. Vaginal bleeding was fully controlled in 80 patients within 1 to 8 days. The mean {+-} SD follow-up period was 27.6 {+-} 12.7 months (range, 6-48 months). Five patients died due to recurrence or metastasis. The 3-year survival and disease-free recurrence rates were 89.6% and 87.5 %, respectively. Nine patients experienced mild radiation proctitis, and 4 patients developed radiocystitis. Conclusions: Low-dose-rate {sup 252}Cf neutron RT combined with external pelvic RT is effective for treating cervical cancer, with a low incidence of

  5. 17 CFR 242.606 - Disclosure of order routing information.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Disclosure of order routing... Regulation Nms-Regulation of the National Market System § 242.606 Disclosure of order routing information. (a) Quarterly report on order routing. (1) Every broker or dealer shall make publicly available for each...

  6. 48 CFR 242.705-2 - Auditor determination procedure.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Auditor determination... Indirect Cost Rates 242.705-2 Auditor determination procedure. (b) Procedures. (2)(iii) When agreement cannot be reached with the contractor, the auditor will issue a DCAA Form 1, Notice of Contract Costs...

  7. Process Control Plan for 242A Evaporator Campaign

    Energy Technology Data Exchange (ETDEWEB)

    LE, E.Q.

    2000-04-06

    The wastes in tanks 107-AP and 108-AP are designated as feed for 242-A Evaporator Campaign 2000-1, which is currently scheduled for the week of April 17, 2000. Waste in tanks 107-AP and 108-AP is predominantly comprised of saltwell liquor from 200 West Tank Farms.

  8. 24 CFR 242.2 - Program financial self-sufficiency.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Program financial self-sufficiency... self-sufficiency and actuarial soundness; i.e., to avoid mortgage defaults and claims for insurance... AUTHORITIES MORTGAGE INSURANCE FOR HOSPITALS General Eligibility Requirements § 242.2 Program financial self...

  9. 48 CFR 52.242-14 - Suspension of Work.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Suspension of Work. 52.242... Suspension of Work. As prescribed in 42.1305(a), insert the following clause in solicitations and contracts when a fixed-price construction or architect-engineer contract is contemplated: Suspension of Work (APR...

  10. 48 CFR 52.242-17 - Government Delay of Work.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Government Delay of Work....242-17 Government Delay of Work. As prescribed in 42.1305(c), insert the following clause in... services, or for supplies that are commercial or modified-commercial items. Government Delay of Work (APR...

  11. 17 CFR 242.607 - Customer account statements.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Customer account statements... (CONTINUED) REGULATIONS M, SHO, ATS, AC, AND NMS AND CUSTOMER MARGIN REQUIREMENTS FOR SECURITY FUTURES Regulation Nms-Regulation of the National Market System § 242.607 Customer account statements. (a) No broker...

  12. 24 CFR 242.58 - Books, accounts, and financial statements.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Books, accounts, and financial... Requirements § 242.58 Books, accounts, and financial statements. (a) Books and accounts. The mortgagor's books... Agreement. (f) Books of management agents. The books and records of management agents, lessees, operators...

  13. 40 CFR 60.242 - Standard for fluorides.

    Science.gov (United States)

    2010-07-01

    ...) STANDARDS OF PERFORMANCE FOR NEW STATIONARY SOURCES Standards of Performance for the Phosphate Fertilizer Industry: Granular Triple Superphosphate Storage Facilities § 60.242 Standard for fluorides. (a) On and... operator subject to the provisions of this subpart shall ship fresh granular triple superphosphate from an...

  14. 48 CFR 2452.242-71 - Contract management system.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Contract management system... 2452.242-71 Contract management system. As prescribed in 2442.1107, insert the following clause: Contract Management System (FEB 2006) (a) The contractor shall use contract management baseline planning...

  15. 17 CFR 242.604 - Display of customer limit orders.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Display of customer limit... Regulation Nms-Regulation of the National Market System § 242.604 Display of customer limit orders. (a... to such customer's orders, that the order not be displayed. (3) That is an odd-lot order. (4) That is...

  16. 24 CFR 242.81 - Lead-based paint poisoning prevention.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Lead-based paint poisoning prevention. 242.81 Section 242.81 Housing and Urban Development Regulations Relating to Housing and Urban... AUTHORITIES MORTGAGE INSURANCE FOR HOSPITALS Miscellaneous Requirements § 242.81 Lead-based paint poisoning...

  17. 17 CFR 242.303 - Record preservation requirements for alternative trading systems.

    Science.gov (United States)

    2010-04-01

    ... requirements for alternative trading systems. 242.303 Section 242.303 Commodity and Securities Exchanges... REQUIREMENTS FOR SECURITY FUTURES Regulation Ats-Alternative Trading Systems § 242.303 Record preservation requirements for alternative trading systems. (a) To comply with the condition set forth in paragraph (b)(9) of...

  18. 20 CFR 404.242 - Use of old-start primary insurance amount as guaranteed alternative.

    Science.gov (United States)

    2010-04-01

    ... guaranteed alternative. 404.242 Section 404.242 Employees' Benefits SOCIAL SECURITY ADMINISTRATION FEDERAL OLD-AGE, SURVIVORS AND DISABILITY INSURANCE (1950- ) Computing Primary Insurance Amounts Old-Start Method of Computing Primary Insurance Amounts § 404.242 Use of old-start primary insurance amount as...

  19. 19 CFR 24.2 - Persons authorized to receive Customs collections.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Persons authorized to receive Customs collections. 24.2 Section 24.2 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY CUSTOMS FINANCIAL AND ACCOUNTING PROCEDURE § 24.2 Persons authorized to receive...

  20. Table of radionuclides (Vol. 2 - A = 151 to 242)

    Energy Technology Data Exchange (ETDEWEB)

    Be, M.M.; Chiste, V.; Dulieu, C. [CEA Saclay, Laboratoire national Henri Becquerel (LNHB), 91 - Gif-sur-Yvette (France); Browne, E. [Lawrence Berkeley National Lab., CA (United States); Chechev, V.; Kuzmenko, N. [V.G. Khlopin Radium Institute, Saint Petersburg (Russian Federation); Helmer, R. [Idaho National Engineering and Environmental Lab., Idaho Falls, ID (United States); Nichols, A. [International Atomic Energy Agency - Nuclear Data Section, Vienna (Austria); Schonfeld, E.; Dersch, R. [Physikalisch-Technische Bundesanstalt, Braunschweig (Germany)

    2004-07-01

    The aim of this table is to provide recommended data for nuclides of special interest for metrology or practical applications like nuclear medicine, monitoring, reactor shielding, etc. This volume, including 29 nuclides begins with {sup 152}Eu and ends with {sup 242}Pu. These recommended data comprise half-lives, decay modes, X-rays, gamma rays, electron emission, alpha- and beta-particle transitions and emissions and their uncertainties. All the references used for the evaluation are given. This work is the result of an international cooperation involving laboratories or staff from France, Germany, Usa, Russia and IAEA. The data and associated uncertainties were evaluated from all available experiments and theoretical considerations were also taken into account.

  1. 1998 interim 242-A Evaporator tank system integrity assessment report

    Energy Technology Data Exchange (ETDEWEB)

    Jensen, C.E.

    1998-07-02

    This Integrity Assessment Report (IAR) is prepared by Fluor Daniel Northwest (FDNW) under contract to Lockheed-Martin Hanford Company (LMHC) for Waste Management Hanford (WMH), the 242-A Evaporator (facility) operations contractor for Fluor Daniel Hanford, and the US Department of Energy, the system owner. The contract specifies that FDNW perform an interim (5 year) integrity assessment of the facility and prepare a written IAR in accordance with Washington Administrative Code (WAC) 173-303-640. The WAC 173-303 defines a treatment, storage, or disposal (TSD) facility tank system as the ``dangerous waste storage or treatment tank and its ancillary equipment and containment.`` This integrity assessment evaluates the two tank systems at the facility: the evaporator vessel, C-A-1 (also called the vapor-liquid separator), and the condensate collection tank, TK-C-100. This IAR evaluates the 242-A facility tank systems up to, but not including, the last valve or flanged connection inside the facility perimeter. The initial integrity assessment performed on the facility evaluated certain subsystems not directly in contact with dangerous waste, such as the steam condensate and used raw water subsystems, to provide technical information. These subsystems were not evaluated in this IAR. The last major upgrade to the facility was project B-534. The facility modifications, as a result of project B-534, were evaluated in the 1993 facility interim integrity assessment. Since that time, the following upgrades have occurred in the facility: installation of a process condensate recycle system, and installation of a package steam boiler to provide steam for the facility. The package boiler is not within the scope of the facility TSD.

  2. Organic emission calculations for the 242-A evaporator vessel vent system

    Energy Technology Data Exchange (ETDEWEB)

    Bowman, M.R.

    1996-06-20

    This document contains historical calculations originally published in the 242-A Evaporator Dangerous Waste Permit Application, DOE/RL-90-42, Rev 0. They are being released as a supporting document, along with brief explanatory information, to be used as a reference in Rev 1 of the permit application and in other supporting documents, such as the 242-A Evaporator Data Quality Objectives.

  3. Archaeological Investigations at Sites 45-DO-242 and 45-DO-243, Chief Joseph Dam Project, Washington.

    Science.gov (United States)

    1984-01-01

    242 - NISP=2) Ranidae/ Bufonidae (frogs and toads) 45-D0-242 -- 2 elements. Both frogs and toads Inhabit the project area (Stebbins 1966). Inadequate...Chelydridae Chrysemys pJa Zone 11: 1 shell fragment. Zone 13: 53 shell fragments. Fmllly Ranldae/ Bufonidae Zone 14: 1 skull fragment, I tibia. Failly

  4. 24 CFR 242.25 - Mortgage form and disbursement of mortgage proceeds.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Mortgage form and disbursement of mortgage proceeds. 242.25 Section 242.25 Housing and Urban Development Regulations Relating to Housing and..., DEPARTMENT OF HOUSING AND URBAN DEVELOPMENT MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT...

  5. 48 CFR 352.242-74 - Final decisions on audit findings.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Final decisions on audit findings. 352.242-74 Section 352.242-74 Federal Acquisition Regulations System HEALTH AND HUMAN SERVICES... decisions under the Disputes clause of this contract concerning monetary audit findings, the Contracting...

  6. 17 CFR 242.609 - Registration of securities information processors: form of application and amendments.

    Science.gov (United States)

    2010-04-01

    ... information processors: form of application and amendments. 242.609 Section 242.609 Commodity and Securities....609 Registration of securities information processors: form of application and amendments. (a) An application for the registration of a securities information processor shall be filed on Form SIP (§ 249.1001...

  7. 48 CFR 252.242-7004 - Material management and accounting system.

    Science.gov (United States)

    2010-10-01

    ... CLAUSES Text of Provisions And Clauses 252.242-7004 Material management and accounting system. As prescribed in 242.7204, use the following caluse: Material Management and Accounting System (JUL 2009) (a) Definitions. As used in this clause— (1) Material management and accounting system (MMAS) means the Contractor...

  8. Californium-252 neutron intracavity brachytherapy alone for T1N0 low-lying rectal adenocarcinoma: A definitive anal sphincter-preserving radiotherapy

    Science.gov (United States)

    Xiong, Yanli; Shan, Jinlu; Liu, Jia; Zhao, Kewei; Chen, Shu; Xu, Wenjing; Zhou, Qian; Yang, Mei; Lei, Xin

    2017-01-01

    This study evaluated the 4-year results of 32 patients with T1N0 low-lying rectal adenocarcinoma treated solely with californium-252 (Cf-252) neutron intracavity brachytherapy (ICBT). Patients were solicited into the study from January 2008 to June 2011. All the patients had refused surgery or surgery was contraindicated. The patients were treated with Cf-252 neutron ICBT using a novel 3.5-cm diameter off-axis 4-channel intrarectal applicator designed by the authors. The dose reference point was defined on the mucosa surface, with a total dose of 55–62 Gy-eq/4 f (13–16 Gy-eq/f/wk). All the patients completed the radiotherapy in accordance with our protocol. The rectal lesions regressed completely, and the acute rectal toxicity was mild (≤G2). The 4-year local control, overall survival, disease-free survival, and late complication (≥G2) rates were 96.9%, 90.6%, 87.5% and 15.6%, respectively. No severe late complication (≥G3) occurred. The mean follow-up was 56.1 ± 16.0 months. At the end of last follow-up, 29 patients remained alive. The mean survival time was 82.1 ± 2.7 months. Cf-252 neutron ICBT administered as the sole treatment (without surgery) for patients with T1N0 low-lying rectal adenocarcinoma is effective with acceptable late complications. Our study and method offers a definitive anal sphincter-preserving radiotherapy for T1N0 low-lying rectal adenocarcinoma patients. PMID:28094790

  9. 27 CFR 24.242 - Authority to use greater quantities of decolorizing material in juice or wine.

    Science.gov (United States)

    2010-04-01

    ... quantities of decolorizing material in juice or wine. 24.242 Section 24.242 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY LIQUORS WINE Storage, Treatment and Finishing of Wine § 24.242 Authority to use greater quantities of decolorizing material in...

  10. 17 CFR 242.601 - Dissemination of transaction reports and last sale data with respect to transactions in NMS stocks.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Dissemination of transaction reports and last sale data with respect to transactions in NMS stocks. 242.601 Section 242.601 Commodity... National Market System § 242.601 Dissemination of transaction reports and last sale data with respect to...

  11. 29 CFR 779.242 - Goods that “have been moved in” commerce.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 3 2010-07-01 2010-07-01 false Goods that âhave been moved inâ commerce. 779.242 Section... Commerce by Any Person § 779.242 Goods that “have been moved in” commerce. For the purpose of section 3(s), goods will be considered to “have been moved * * * in commerce” when they have moved across State lines...

  12. Comprehensive Amm242 neutron-induced reaction cross sections and resonance parameters

    Science.gov (United States)

    Buckner, M. Q.; Wu, C. Y.; Henderson, R. A.; Bucher, B.; Wimer, N.; Chyzh, A.; Bredeweg, T. A.; Baramsai, B.; Couture, A.; Jandel, M.; Mosby, S.; Ullmann, J. L.

    2017-06-01

    The 242Am metastable isomer's neutron-induced destruction mechanisms were studied at the Los Alamos Neutron Science Center using the Detector for Advanced Neutron-Capture Experiments array with a compact parallel-plate avalanche counter. New Amm242 neutron-capture cross sections were determined from 100 meV to 10 keV, and the absolute scale was set with respect to a concurrent measurement of the well-known Amm242 neutron-induced-fission cross section. The new fission cross section spans an energy range from 100 meV to 1 MeV and was normalized to the ENDF/B-VII.1 evaluated cross section to set the absolute scale. Our Amm242(n ,f ) cross section agrees well with the cross section of Browne et al. [Phys. Rev. C 29, 2188 (1984)], 10.1103/PhysRevC.29.2188 over this large energy interval. The new neutron-capture cross section measurement complements and agrees well with our recent results reported below 1 eV in Buckner et al. [Phys. Rev. C 95, 024610 (2017)], 10.1103/PhysRevC.95.024610. This new work comprises the most comprehensive study of Amm242(n ,γ ) above thermal energy. Neutron-induced resonance energies and parameters were deduced with the sammy R -matrix code for incident neutron energies up to 45 eV, and the new average Γγ is 13 % higher than the evaluated average γ width.

  13. Fast-neutron-induced fission of 242Pu at nELBE

    Directory of Open Access Journals (Sweden)

    Kögler Toni

    2017-01-01

    Full Text Available The fast neutron-induced fission cross section of 242Pu was determined in the range of 0.5 MeV to 10 MeV relative to 235U(n,f at the neutron time-of-flight facility nELBE. The number of target nuclei was calculated by means of measuring the spontaneous fission rate of 242Pu. Neutron transport simulations with Geant4 and MCNP6 are used to correct the relative cross section for neutron scattering. The determined results are in good agreement with current experimental and evaluated data sets.

  14. Californium-252 Program Equipment Evaluation

    Energy Technology Data Exchange (ETDEWEB)

    Chattin, Fred Rhea [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Wilson, Kenton [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Ezold, Julie G. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States)

    2017-12-01

    To successfully continue the 252Cf production and meet the needs of the customers, a comprehensive evaluation of the Building 7920 processing equipment was requested to identify equipment critical to the operational continuity of the program.

  15. 32 CFR 242.9 - Academic, intellectual, and personal requirements for admission to advanced standing.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false Academic, intellectual, and personal... FOR THE SCHOOL OF MEDICINE, UNIFORMED SERVICES UNIVERSITY OF THE HEALTH SCIENCES § 242.9 Academic... techniques as may be deemed appropriate to use by the School of Medicine. (b) To be eligible academically for...

  16. 48 CFR 1852.242-71 - Travel outside of the United States.

    Science.gov (United States)

    2010-10-01

    ... authorize in advance and in writing travel to locations outside of the United States by Contractor employees... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Travel outside of the... Provisions and Clauses 1852.242-71 Travel outside of the United States. As prescribed in 1842.7002, insert...

  17. 17 CFR 242.404 - Type, form and use of margin.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Type, form and use of margin... (CONTINUED) REGULATIONS M, SHO, ATS, AC, AND NMS AND CUSTOMER MARGIN REQUIREMENTS FOR SECURITY FUTURES Customer Margin Requirements for Security Futures § 242.404 Type, form and use of margin. (a) When margin...

  18. 36 CFR 242.25 - Subsistence taking of fish, wildlife, and shellfish: general regulations.

    Science.gov (United States)

    2010-07-01

    ..., mountain goat, moose, musk ox, Dall sheep, wolf, and wolverine. Bow means a longbow, recurve bow, or..., ground squirrel, marmot, wolf, or wolverine. Fyke net means a fixed, funneling (fyke) device used to... may not use wildlife as food for a dog or furbearer, or as bait, except as allowed for in § 242.26...

  19. 40 CFR 61.242-9 - Standards: Surge control vessels and bottoms receivers.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 8 2010-07-01 2010-07-01 false Standards: Surge control vessels and... Emission Standard for Equipment Leaks (Fugitive Emission Sources) § 61.242-9 Standards: Surge control vessels and bottoms receivers. Each surge control vessel or bottoms receiver that is not routed back to...

  20. Purification and characterization of chitinase showing antifungal and biodegradation properties obtained from Streptomyces anulatus CS242.

    Science.gov (United States)

    Mander, Poonam; Cho, Seung Sik; Choi, Yun Hee; Panthi, Sandesh; Choi, Yoon Seok; Kim, Hwan Mook; Yoo, Jin Cheol

    2016-07-01

    In an effort to identify a microbial enzyme that can be useful as a fungicide and biodegradation agent of chitinous wastes, a chitinase (Chi242) was purified from the culture supernatant of Streptomyces anulatus CS242 utilizing powder of shrimp shell wastes as a sole carbon source. It was purified employing ammonium sulfate precipitation and gel permeation chromatography techniques. The molecular weight of the purified chitinase was ~38 kDa by SDS-PAGE. The N-terminal amino acid sequence (A-P-G-A-P-G-T-G-A-L) showed close similarity to those of other Streptomyes chitinases. The purified enzyme displayed optimal activity at pH 6.0 and 50 °C respectively. It showed substantial thermal stability for 2 h at 30-60 °C, and exhibited broad pH stability in the range 5.0-13.0 for 48 h at 4 °C. Scanning electron microscopy confirmed the ability of this enzyme to adsorb onto solid shrimp bio-waste and to degrade chitin microfibers. Chi242 could proficiently convert colloidal chitin to N-acetyl glucosamine (GlcNAc) and N-acetyl chitobiose (GlcNAc)2 signifying that this enzyme is suitable for bioconversion of chitin waste. In addition, it exerted an effective antifungal activity towards fungal pathogen signifying its role as a biocontrol agent. Thus, a single microbial cell of Streptomyces anulatus CS242 justified its dual role.

  1. Absolute measurement of the 242Pu neutron-capture cross section

    Science.gov (United States)

    Buckner, M. Q.; Wu, C. Y.; Henderson, R. A.; Bucher, B.; Chyzh, A.; Bredeweg, T. A.; Baramsai, B.; Couture, A.; Jandel, M.; Mosby, S.; O'Donnell, J. M.; Ullmann, J. L.; Dance Collaboration

    2016-04-01

    The absolute neutron-capture cross section of 242Pu was measured at the Los Alamos Neutron Science Center using the Detector for Advanced Neutron-Capture Experiments array along with a compact parallel-plate avalanche counter for fission-fragment detection. The first direct measurement of the 242Pu(n ,γ ) cross section was made over the incident neutron energy range from thermal to ≈6 keV, and the absolute scale of the (n ,γ ) cross section was set according to the known 239Pu(n ,f ) resonance at En ,R=7.83 eV. This was accomplished by adding a small quantity of 239Pu to the 242Pu sample. The relative scale of the cross section, with a range of four orders of magnitude, was determined for incident neutron energies from thermal to ≈40 keV. Our data, in general, are in agreement with previous measurements and those reported in ENDF/B-VII.1; the 242Pu(n ,γ ) cross section at the En ,R=2.68 eV resonance is within 2.4 % of the evaluated value. However, discrepancies exist at higher energies; our data are ≈30 % lower than the evaluated data at En≈1 keV and are approximately 2 σ away from the previous measurement at En≈20 keV.

  2. 42 CFR 456.242 - UR plan requirements for medical care evaluation studies.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 4 2010-10-01 2010-10-01 false UR plan requirements for medical care evaluation...: Mental Hospitals Ur Plan: Medical Care Evaluation Studies § 456.242 UR plan requirements for medical care... medical care evaluation studies under paragraph (b)(1) of this section. (b) The UR plan must provide that...

  3. 17 CFR 242.602 - Dissemination of quotations in NMS securities.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Dissemination of quotations in... FUTURES Regulation Nms-Regulation of the National Market System § 242.602 Dissemination of quotations in NMS securities. (a) Dissemination requirements for national securities exchanges and national...

  4. 5 CFR 531.242 - Setting pay upon loss of GM status.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Setting pay upon loss of GM status. 531... PAY UNDER THE GENERAL SCHEDULE Determining Rate of Basic Pay Special Rules for Gm Employees § 531.242 Setting pay upon loss of GM status. (a) On loss of status as a GM employee under § 531.241 (except as...

  5. 48 CFR 1852.242-73 - NASA contractor financial management reporting.

    Science.gov (United States)

    2010-10-01

    ... Provisions and Clauses 1852.242-73 NASA contractor financial management reporting. As prescribed in 1842.7202, insert the following clause: NASA Contractor Financial Management Reporting (NOV 2004) (a) The Contractor... instructions in NASA Procedures and Guidelines (NPR) 9501.2, NASA Contractor Financial Management Reporting...

  6. Analytical services: 222-S characterization of 242-A Evaporator Slurry, Campaign 94-1. Addendum 1A

    Energy Technology Data Exchange (ETDEWEB)

    1994-09-13

    During the 242-A Evaporator`s 94-1 campaign, five process samples were collected from the slurry stream for waste characterization. The five samples were collected over a 36 day time span, respectively on May 4, May 9, May 16, May 23, and June 9, 1994. Sample collections were performed per the protocol described in 242-A Evaporator Waste Analysis Plan, WHC-SD-WM-EV-060, Rev. 3 and in 242-A Evaporator Quality Assurance Project Plan, WHC-SD-WM-QAPP-009, Rev. 0. Slurry waste was characterized chemically and radiochemically by the Westinghouse Hanford Company, 222-S Laboratory as directed.

  7. Deletion of (11)(q24.2) in a mother and daughter with similar phenotypes

    Energy Technology Data Exchange (ETDEWEB)

    Neavel, C.B.; Soukup, S. [Univ. Affiliated Cincinnati Center for Developmental Disorders, OH (United States)

    1994-12-01

    A del(11) (q24.2) was ascertained in a 2-year-old child and subsequently in her 20-year-old mother. Both mother and daughter had developmental delay, short stature, and {open_quotes}coarse{close_quotes} facial appearance. We compare our patients` manifestations to those associated with the distal 11q2 deletion phenotype ({open_quotes}Jacobsen{close_quotes} syndrome), and to the one other reported case of del(11)(q24.2). Our patients did not resemble this latter case, but had some findings in common with Jacobsen syndrome. We present our findings in order to contribute to the information on 11q2 deletions. 13 refs., 3 figs., 1 tab.

  8. Sequence and batch language programs and alarm related C Programs for the 242-A MCS

    Energy Technology Data Exchange (ETDEWEB)

    Berger, J.F.

    1996-04-15

    A Distributive Process Control system was purchased by Project B-534, 242-A Evaporator/Crystallizer Upgrades. This control system, called the Monitor and Control system (MCS), was installed in the 242-A evaporator located in the 200 East Area. The purpose of the MCS is to monitor and control the Evaporator and monitor a number of alarms and other signals from various Tank Farm facilities. Applications software for the MCS was developed by the Waste Treatment Systems Engineering (WTSE) group of Westinghouse. The standard displays and alarm scheme provide for control and monitoring, but do not directly indicate the signal location or depict the overall process. To do this, WTSE developed a second alarm scheme.

  9. Common variants on 8p12 and 1q24.2 confer risk of schizophrenia

    DEFF Research Database (Denmark)

    Shi, Yongyong; Li, Zhiqiang; Xu, Qi

    2011-01-01

    of 4,383 cases and 4,539 controls from the Han Chinese population. Meta-analysis identified common SNPs that associated with schizophrenia with genome-wide significance on 8p12 (rs16887244, P = 1.27 × 10(-10)) and 1q24.2 (rs10489202, P = 9.50 × 10(-9)). Our findings provide new insights...

  10. The Molecular Cloud S242: Physical Environment and Star-formation Activities

    Science.gov (United States)

    Dewangan, L. K.; Baug, T.; Ojha, D. K.; Janardhan, P.; Devaraj, R.; Luna, A.

    2017-08-01

    We present a multi-wavelength study to probe the star-formation (SF) processes on a larger scale (˜ 1\\buildrel{\\circ}\\over{.} 05× 0\\buildrel{\\circ}\\over{.} 56) around the S242 site. The S242 molecular cloud is depicted in a velocity range from -3.25 to 4.55 km s-1 and has a spatially elongated appearance. Based on the virial analysis, the cloud is prone to gravitational collapse. The cloud harbors an elongated filamentary structure (EFS; length ˜25 pc), which is evident in the Herschel column density map, and the EFS has an observed mass per unit length of ˜200 {M}⊙ pc-1, exceeding the critical value of ˜16 {M}⊙ pc-1 (at T = 10 K). The EFS contains a chain of Herschel clumps (M clump ˜ 150-1020 {M}⊙ ), revealing the evidence of fragmentation along its length. The most massive clumps are observed at both the EFS ends, while the S242 H II region is located at one EFS end. Based on the radio continuum maps at 1.28 and 1.4 GHz, the S242 H II region is ionized by a B0.5V-B0V type star and has a dynamical age of ˜0.5 Myr. The photometric 1-5 μm data analysis of point-like sources traces young stellar objects (YSOs) toward the EFS and the clusters of YSOs are exclusively found at both the EFS ends, revealing the SF activities. Considering the spatial presence of massive clumps and YSO clusters at both the EFS ends, the observed results are consistent with the prediction of an SF scenario of the end-dominated collapse driven by the higher acceleration of gas.

  11. Manganese determination om minerals by activation analysis, using the californium-252 as a neutron source; Determinacao de manganes em minerios, por analise por ativacao, usando californio-252 como fonte de neutrons

    Energy Technology Data Exchange (ETDEWEB)

    Cardoso, Antonio

    1976-07-01

    Neutron Activation Analysis, using a Californium-252 neutron source, has been applied for the determination of manganese in ores such as pyrolusite, rodonite (manganese silicate)' and blending used in dry-batteries The favorable nuclear properties of manganese, such as high thermal neutron cross-section for the reaction {sup 55}Mn (n.gamma){sup 56} Mn, high concentration of manganese in the matrix and short half - life of {sup 56}Mn, are an ideal combination for non-destructive analysis of manganese in ores. Samples and standards of manganese dioxide were irradiated for about 20 minutes, followed by a 4 to 15 minutes decay and counted in a single channel pulse-height discrimination using a NaI(Tl) scintillation detector. Counting time was equal to 10 minutes. The interference of nuclear reactions {sup 56}Fe(n,p){sup 56}Mn and {sup 59} Co (n, {alpha}){sup 56} were studied, as well as problems in connection with neutron shadowing during irradiation, gamma-rays attenuation during counting and influence of granulometry of samples. One sample,was also analysed by wet-chemical method (sodium bismuthate) in order to compare results. As a whole, i t was shown that the analytical method of neutron activation for manganese in ores and blending, is a method simple, rapid and with good precision and accuracy. (author)

  12. Design of a homogeneous subcritical nuclear reactor based on thorium with a source of californium 252; Diseno de un reactor nuclear subcritico homogeneo a base de Torio con una fuente de Californio 252

    Energy Technology Data Exchange (ETDEWEB)

    Delgado H, C. E.; Vega C, H. R. [Universidad Autonoma de Zacatecas, Unidad Academica de Estudios Nucleares, Cipres No. 10, Fracc. La Penuela, 98068 Zacatecas, Zac. (Mexico); Sajo B, L., E-mail: ce_delgado89@hotmail.com [Universidad Simon Bolivar, Laboratorio de Fisica Nuclear, Apdo. 89000, 1080A Caracas (Venezuela, Bolivarian Republic of)

    2015-10-15

    Full text: One of the energy alternatives to fossil fuels which do not produce greenhouse gases is the nuclear energy. One of the drawbacks of this alternative is the generation of radioactive wastes of long half-life and its relation to the generation of nuclear materials to produce weapons of mass destruction. An option to these drawbacks of nuclear energy is to use Thorium as part of the nuclear fuel which it becomes in U{sup 233} when capturing neutrons, that is a fissile material. In this paper Monte Carlo methods were used to design a homogeneous subcritical reactor based on thorium. As neutron reflector graphite was used. The reactor core is homogeneous and is formed of 70% light water as moderator, 12% of enriched uranium UO{sub 2}(NO{sub 3}){sub 4} and 18% of thorium Th(NO{sub 3}){sub 4} as fuel. To start the nuclear fission chain reaction an isotopic source of californium 252 was used with an intensity of 4.6 x 10{sup 7} s{sup -1}. In the design the value of the effective multiplication factor, whose value turned out k{sub eff} <1 was calculated. Also, the neutron spectra at different distances from the source and the total fluence were calculated, as well as the values of the ambient dose equivalent in the periphery of the reactor. (Author)

  13. Neutron induced fission cross section measurements of 240Pu and 242Pu

    Science.gov (United States)

    Belloni, F.; Eykens, R.; Heyse, J.; Matei, C.; Moens, A.; Nolte, R.; Plompen, A. J. M.; Richter, S.; Sibbens, G.; Vanleeuw, D.; Wynants, R.

    2017-09-01

    Accurate neutron induced fission cross section of 240Pu and 242Pu are required in view of making nuclear technology safer and more efficient to meet the upcoming needs for the future generation of nuclear power plants (GEN-IV). The probability for a neutron to induce such reactions figures in the NEA Nuclear Data High Priority Request List [1]. A measurement campaign to determine neutron induced fission cross sections of 240Pu and 242Pu at 2.51 MeV and 14.83 MeV has been carried out at the 3.7 MV Van De Graaff linear accelerator at Physikalisch-Technische Bundesanstalt (PTB) in Braunschweig. Two identical Frisch Grid fission chambers, housing back to back a 238U and a APu target (A = 240 or A = 242), were employed to detect the total fission yield. The targets were molecular plated on 0.25 mm aluminium foils kept at ground potential and the employed gas was P10. The neutron fluence was measured with the proton recoil telescope (T1), which is the German primary standard for neutron fluence measurements. The two measurements were related using a De Pangher long counter and the charge as monitors. The experimental results have an average uncertainty of 3-4% at 2.51 MeV and for 6-8% at 14.81 MeV and have been compared to the data available in literature.

  14. Neutron induced fission cross section measurements of 240Pu and 242Pu

    Directory of Open Access Journals (Sweden)

    Belloni F.

    2017-01-01

    Full Text Available Accurate neutron induced fission cross section of 240Pu and 242Pu are required in view of making nuclear technology safer and more efficient to meet the upcoming needs for the future generation of nuclear power plants (GEN-IV. The probability for a neutron to induce such reactions figures in the NEA Nuclear Data High Priority Request List [1]. A measurement campaign to determine neutron induced fission cross sections of 240Pu and 242Pu at 2.51 MeV and 14.83 MeV has been carried out at the 3.7 MV Van De Graaff linear accelerator at Physikalisch-Technische Bundesanstalt (PTB in Braunschweig. Two identical Frisch Grid fission chambers, housing back to back a 238U and a APu target (A = 240 or A = 242, were employed to detect the total fission yield. The targets were molecular plated on 0.25 mm aluminium foils kept at ground potential and the employed gas was P10. The neutron fluence was measured with the proton recoil telescope (T1, which is the German primary standard for neutron fluence measurements. The two measurements were related using a De Pangher long counter and the charge as monitors. The experimental results have an average uncertainty of 3–4% at 2.51 MeV and for 6–8% at 14.81 MeV and have been compared to the data available in literature.

  15. de novo interstitial deletions at the 11q23.3-q24.2 region.

    Science.gov (United States)

    Su, Jiasun; Chen, Rongyu; Luo, Jingsi; Fan, Xin; Fu, Chunyun; Wang, Jin; He, Sheng; Hu, Xuyun; Zhang, ShuJie; Yi, Shang; Chen, Shaoke; Shen, Yiping

    2016-01-01

    Jacobsen syndrome (JBS) is a contiguous gene deletion syndrome involving 11q terminal deletion. Interstitial deletions at distal 11q are rare and their contributions to the clinical phenotype of JBS are unknown. We presented the chromosome microarray (CMA) data and the clinical features of two individuals carrying a non-overlapping de novo deletion each at the 11q23.3-q24.2 region in an effort to analyze the correlation between region of deletion at 11q and phenotype. Both deletions are likely pathogenic for patient's condition. The deletion at 11q23.3q24.1 is associated with short stature, relative microcephaly, failure to thrive, hypotonia and sleeping disorder. The deletion at 11q24.2 involves HEPACAM and our patient's clinical presentation (relative macrocephaly, abnormal MRI, mild developmental delay and seizure) is not inconsistent with Megalencephalic leukoencephalopathy with subcortical cysts 2B. Our finds support the notion that more than one critical region at 11q23.3-qter are responsible for the variable clinical presentation of JBS, thus JBS is a true contiguous gene deletion syndrome where multiple loci contributed to the clinical characteristics of JBS. Small interstitial deletions at 11q23.3-q24.2 and their associated unique features also suggest emerging novel genomic disorders.

  16. Measurement of neutron-induced reactions on 242mAm

    Science.gov (United States)

    Buckner, M. Q.; Wu, C.-Y.; Henderson, R. A.; Bucher, B.; Chyzh, A.; Bredeweg, T. A.; Baramsai, B.; Couture, A.; Jandel, M.; Mosby, S.; Ullmann, J. L.; Dance Collaboration

    2016-09-01

    Neutron-induced reaction cross sections of 242mAm were measured at the Los Alamos Neutron Science Center using the Detector for Advanced Neutron-Capture Experiments array along with a compact parallel-plate avalanche counter for fission-fragment detection. A new neutron-capture cross section was determined relative to a simultaneous measurement of the well-known 242mAm(n,f) cross section. The (n, γ) cross section was measured from thermal to an incident energy of 1 eV. Our new 242mAm fission cross section was normalized to ENDF/B-VII.1 and agreed well with the (n,f) cross section reported in the literature from thermal energy to 1 keV. The capture-to-fission ratio was determined from thermal energy to En = 0.1 eV, and it was found to be (n, γ)/(n,f) = 26(4)% compared to 19% from ENDF/B-VII.1. Our latest results will be reported. US Department of Energy by Lawrence Livermore National Security, LLC Contract DE-AC52-07NA27344 and Los Alamos National Security, LLC Contract DE-AC52-06NA25396 and U.S. DOE/NNSA Office of Defense Nuclear Nonproliferation Research and Development.

  17. Measurement of the Amm242 neutron-induced reaction cross sections

    Science.gov (United States)

    Buckner, M. Q.; Wu, C. Y.; Henderson, R. A.; Bucher, B.; Wimer, N.; Chyzh, A.; Bredeweg, T. A.; Baramsai, B.; Couture, A.; Jandel, M.; Mosby, S.; Ullmann, J. L.; Dance Collaboration

    2017-02-01

    The neutron-induced reaction cross sections of Amm242 were measured at the Los Alamos Neutron Science Center using the Detector for Advanced Neutron-Capture Experiments array along with a compact parallel-plate avalanche counter for fission-fragment detection. A new neutron-capture cross section was determined, and the absolute scale was set according to a concurrent measurement of the well-known Amm242(n ,f ) cross section. The (n ,γ ) cross section was measured from thermal energy to an incident energy of 1 eV at which point the data quality was limited by the reaction yield in the laboratory. Our new Amm242 fission cross section was normalized to ENDF/B-VII.1 to set the absolute scale, and it agreed well with the (n ,f ) cross section reported by Browne et al. (1984) from thermal energy to 1 keV. The average absolute capture-to-fission ratio was determined from thermal energy to En=0.1 eV, and it was found to be 26(4)% as opposed to the ratio of 19 % from the ENDF/B-VII.1 evaluation.

  18. Functional design criteria for the 242-A evaporator and PUREX (Plutonium-Uranium Extraction) Plant condensate interim retention basin

    Energy Technology Data Exchange (ETDEWEB)

    Cejka, C.C.

    1990-01-01

    This document contains the functional design criteria for a 26- million-gallon retention basin and 10 million gallons of temporary storage tanks. The basin and tanks will be used to store 242-A Evaporator process condensate, the Plutonium-Uranium Extraction (PUREX) Plant process distillate discharge stream, and the PUREX Plant ammonia scrubber distillate stream. Completion of the project will allow both the 242-A Evaporator and the PUREX Plant to restart. 4 refs.

  19. Project C-018H, 242-A Evaporator/PUREX Plant Process Condensate Treatment Facility, functional design criteria. Revision 3

    Energy Technology Data Exchange (ETDEWEB)

    Sullivan, N.

    1995-05-02

    This document provides the Functional Design Criteria (FDC) for Project C-018H, the 242-A Evaporator and Plutonium-Uranium Extraction (PUREX) Plant Condensate Treatment Facility (Also referred to as the 200 Area Effluent Treatment Facility [ETF]). The project will provide the facilities to treat and dispose of the 242-A Evaporator process condensate (PC), the Plutonium-Uranium Extraction (PUREX) Plant process condensate (PDD), and the PUREX Plant ammonia scrubber distillate (ASD).

  20. de novo interstitial deletions at the 11q23.3-q24.2 region

    OpenAIRE

    Su, Jiasun; Chen, Rongyu; Luo, Jingsi; Fan, Xin; Fu, Chunyun; Wang, Jin; He, Sheng; Hu, Xuyun; Zhang, ShuJie; Yi, Shang; Chen, Shaoke; Shen, Yiping

    2016-01-01

    Background Jacobsen syndrome (JBS) is a contiguous gene deletion syndrome involving 11q terminal deletion. Interstitial deletions at distal 11q are rare and their contributions to the clinical phenotype of JBS are unknown. Case presentation We presented the chromosome microarray (CMA) data and the clinical features of two individuals carrying a non-overlapping de novo deletion each at the 11q23.3-q24.2 region in an effort to analyze the correlation between region of deletion at 11q and phenot...

  1. Directed mutagenesis of the strongly conserved aspartate 242 in the beta-subunit of Escherichia coli proton-ATPase.

    Science.gov (United States)

    Al-Shawi, M K; Parsonage, D; Senior, A E

    1988-12-25

    Oligonucleotide-directed mutagenesis was used to substitute Asn or Val for residue Asp-242 in the beta-subunit of Escherichia coli F1-ATPase. Asp-242 is strongly conserved in beta-subunits of F1-ATPase enzymes, in a region of sequence which shows homology with numerous nucleotide-binding proteins. By analogy with adenylate kinase (Fry, D.C., Kuby, S.A., and Mildvan, A.S. (1986) Proc. Natl. Acad. Sci. U.S.A. 83, 907-911), beta-Asp-242 of F1-ATPase might participate in catalysis through electrostatic effects on the substrate Mg2+ or through hydrogen bonding to the substrate(s); an acid-base catalytic role is also plausible. The substitutions Asn and Val were chosen to affect the charge, hydrogen-bonding ability, and hydrophobicity of residue beta-Asp-242. Both mutations significantly impaired oxidative phosphorylation rates in vivo and membrane ATPase and ATP-driven proton-pumping activities in vitro. Asn-242 was more detrimental than Val-242. Purified soluble mutant F1-ATPases had normal molecular size and subunit composition, and displayed 7% (beta-Asn-242) and 17% (beta-Val-242) of normal specific Mg-ATPase activity. The relative MgATPase activities of both mutant enzymes showed similar pH dependence to normal. Relative MgATPase and CaATPase activities of normal and mutant enzymes were compared at widely varied pMg and pCa. The mutations had little effect on KM MgATP, but KM CaATP was reduced. The data showed that the carboxyl side-chain of beta-Asp-242 is not involved in catalysis either as a general acid-base catalyst or through direct involvement in any protonation/deprotonation-linked mechanism, nor is it likely to be directly involved in liganding to substrate Mg2+ during the reaction. Specificity constants (kcat/KM) for MgATP and CaATP were reduced in both mutant enzymes, showing that the mutations destabilized interactions between the catalytic nucleotide-binding domain and the transition state.

  2. Statistical properties of $^{243}$Pu, and $^{242}$Pu(n,$\\gamma$) cross section calculation

    CERN Document Server

    Laplace, T A; Guttormsen, M; Larsen, A C; Bleuel, D L; Bernstein, L A; Goldblum, B L; Siem, S; Garotte, F L Bello; Brown, J A; Campo, L Crespo; Eriksen, T K; Giacoppo, F; Görgen, A; Hadyńska-Klȩk, K; Henderson, R A; Klintefjord, M; Lebois, M; Renstrøm, T; Rose, S J; Sahin, E; Tornyi, T G; Tveten, G M; Voinov, A; Wiedeking, M; Wilson, J N; Younes, W

    2015-01-01

    The level density and gamma-ray strength function (gammaSF) of 243Pu have been measured in the quasi-continuum using the Oslo method. Excited states in 243Pu were populated using the 242Pu(d,p) reaction. The level density closely follows the constant-temperature level density formula for excitation energies above the pairing gap. The gammaSF displays a double-humped resonance at low energy as also seen in previous investigations of actinide isotopes. The structure is interpreted as the scissors resonance and has a centroid of omega_{SR}=2.42(5)MeV and a total strength of B_{SR}=10.1(15)mu_N^2, which is in excellent agreement with sum-rule estimates. The measured level density and gammaSF were used to calculate the 242Pu(n,gamma) cross section in a neutron energy range for which there were previously no measured data.

  3. Process control plan for 242-A Evaporator Campaign 95-1

    Energy Technology Data Exchange (ETDEWEB)

    Le, E.Q.; Guthrie, M.D.

    1995-05-18

    The wastes from tanks 106-AP, 107-AP, and 106-AW have been selected to be candidate feed wastes for Evaporator Campaign 95-1. The wastes in tank 106-AP and 107-AP are primarily from B-Plant strontium processing and PUREX neutralized cladding removal, respectively. The waste in tank 106-AW originated primarily from the partially concentrated product from 242-A Evaporator Campaign 94-2. Approximately 8.67 million liters of waste from these tanks will be transferred to tank 102-AW during the campaign. Tank 102-AW is the dedicated waste feed tank for the evaporator and currently contains 647,000 liters of processable waste. The purpose of the 242-A Evaporator Campaign 95-1 Process Control Plan (hereafter referred to as PCP) is to certify that the wastes in tanks 106-AP, 107-AP, 102-AW, and 106-AW are acceptable for processing through evaporator and provide a general description of process strategies and activities which will take place during Campaign 95-1. The PCP also summarizes and presents a comprehensive characterization of the wastes in these tanks.

  4. Measurement of the $^{240,242}$Pu(n,f) cross section at the CERN n_TOF facility

    CERN Document Server

    Tsinganis, A; Guerrero, C; Colonna, N; Calviani, M; Vlastou, R; Andriamonje, S; Vlachoudis, V; Gunsing, F; Massimi, C; Altstadt, S; Andrzejewski, J; Audouin, L; Barbagallo, M; Bécares, V; Becvár, F; Belloni, F; Billowes, J; Boccone, V; Bosnar, D; Brugger, M; Calviño, F; Cano-Ott, D; Carrapiço, C; Cerutti, F; Chin, M; Cortés, G; Cortés-Giraldo, M A; Diakaki, M; Domingo-Pardo, C; Duran, I; Dressler, R; Dzysiuk, N; Eleftheriadis, C; Ferrari, A; Fraval, K; Ganesan, S; García, A R; Giubrone, G; Gómez-Hornillos, M B; Gonçalves, I F; González-Romero, E; Griesmayer, E; Gurusamy, P; Hernández-Prieto, A; Jenkins, D G; Jericha, E; Kadi, Y; Käppeler, F; Karadimos, D; Kivel, N; Koehler, P; Kokkoris, M; Krtiˇcka, M; Kroll, J; Lampoudis, C; Langer, C; Leal-Cidoncha, E; Lederer, C; Leeb, H; Leong, L S; Losito, R; Mallick, A; Manousos, A; Marganiec, J; Martínez, T; Mastinu, P F; Mastromarco, M; Meaze, M; Mendoza, E; Mengoni, A; Milazzo, P M; Mingrone, F; Mirea, M; Mondalaers, W; Paradela, C; Pavlik, A; Perkowski, J; Plompen, A; Praena, J; Quesada, J M; Rauscher, T; Reifarth, R; Riego, A; Robles, M S; Roman, F; Rubbia, C; Sabaté-Gilarte, M; Sarmento, R; Saxena, A; Schillebeeckx, P; Schmidt, S; Schumann, D; Tagliente, G; Tain, J L; Tarrío, D; Tassan-Got, L; Valenta, S; Vannini, G; Variale, V; Vaz, P; Ventura, A; Versaci, R; Vermeulen, M J; Wallner, A; Ware, T; Weigand, M; Weiss, C; Wright, T; Zugec, P

    2014-01-01

    Knowledge of neutron cross sections of various plutonium isotopes and other minor actinides is crucial for the design of advanced nuclear systems. The $^{240 , 242}$Pu(n,f) cross sections were measured at the CERN n_TOF facility, taking advantage of the wide energy range (from thermal to GeV) and the high instantaneous f ux of the neutron beam. In this work, preliminary results for $^{242}$Pu are presented along with a theoretical cross section calculation performed with the EMPIRE code.

  5. Fission cross section measurement of Am-242m using lead slowing-down spectrometer

    Energy Technology Data Exchange (ETDEWEB)

    Kai, Tetsuya; Kobayashi, Katsuhei; Yamamoto, Shuji; Fujita, Yoshiaki [Kyoto Univ., Kumatori, Osaka (Japan). Research Reactor Inst.; Kimura, Itsuro; Ohkawachi, Yasushi; Wakabayashi, Toshio

    1998-03-01

    By making use of double fission chamber and lead slowing-down spectrometer coupled to an electron linear accelerator, fission cross section for the {sup 242m}Am(n,f) reaction has been measured relative to that for the {sup 235}U(n,f) reaction in the energy range from 0.1 eV to 10 keV. The measured result was compared with the evaluated nuclear data appeared in ENDF/B-VI and JENDL-3.2, of which evaluated data were broadened by the energy resolution function of the spectrometer. Although the JENDL-3.2 data seem to be a little smaller than the present measurement, good agreement can be seen in the general shape and the absolute values. The ENDF/B-VI data are larger more than 50 % than the present values above 3 eV. (author)

  6. MR imaging of musculoskeletal tumors and tumor mimickers with intravenous gadolinium: experience with 242 patients

    Energy Technology Data Exchange (ETDEWEB)

    May, D.A. [Department of Radiology, Wilford Hall USAF Medical Center, San Antonio, TX (United States)]|[WHMC/PSRD, Lackland AFB, TX (United States); Good, R.B. [Department of Radiology, Wilford Hall USAF Medical Center, San Antonio, TX (United States); Smith, D.K. [Department of Radiology, Wilford Hall USAF Medical Center, San Antonio, TX (United States); Parsons, T.W. [Department of Orthopaedic Surgery, Wilford Hall USAF Medical Center, San Antonio, TX (United States)

    1997-01-01

    Purpose. This pictorial essay reviews our experience with MR scans with gadolinium in patients with musculoskeletal tumors and tumor mimickers. Design. Review of 242 MR scans obtained in the initial evaluation of a possible primary musculoskeletal neoplasm. All scans included a T1-weighted, fat-suppressed sequence following intravenous administration of gadolinium. Results. MR scans with gadolinium did not contribute to differential diagnosis or patient management in 89% of the patients in this series. However, intravenous gadolinium did assist in guiding the biopsy of bulky lesions and evaluating treated tumor beds for possible recurrence. MR scans with gadolinium were sometimes helpful when the differential diagnosis included synovitis, Morton`s neuroma or intramuscular myxoma, and when it was important to differentiate cystic from solid lesions. Conclusions. Routine use of gadolinium in every initial MR examination of a possible musculoskeletal mass is not warranted. However, there are appropriate selected indications for gadolinium administration as outlined above. (orig.). With 19 figs., 1 tab.

  7. THE ICONOGRAPHIC CHOICES OF THE MINUCII AUGURINI: RE-READING RRC 242 AND 243

    Directory of Open Access Journals (Sweden)

    Liv Mariah Yarrow

    2017-03-01

    Full Text Available The coinage of the Minucii Augurini (RRC 242 and 243 has received extensive scholarly commentary (Crawford 1974, 273-6; Wiseman 1996; Evans 2011; Elkins 2015, 21-2, but a holistic comparative approach to the iconography of these two types leads to new conclusions regarding likely compositional prototypes in other media, the motivations behind the design choice, and the attributes and identification of the figures. All this helps explain compositional variations between the two coin types that previous scholars have found problematic. A wide range of comparative evidence is used including glass paste intaglios, Etruscan tomb decoration, relief depictions and archaeological finds of priestly implements, further coin imagery, and literary testimony, especially Plut. Mor. 89F.

  8. High level waste storage tank farms/242-A evaporator Standards/Requirements Identification Document (S/RID), Volume 6

    Energy Technology Data Exchange (ETDEWEB)

    1994-04-01

    The High-Level Waste Storage Tank Farms/242-A Evaporator Standards/Requirements Identification Document (S/RID) is contained in multiple volumes. This document (Volume 6) outlines the standards and requirements for the sections on: Environmental Restoration and Waste Management, Research and Development and Experimental Activities, and Nuclear Safety.

  9. 77 FR 55800 - Foreign-Trade Zone 242-Boundary County, ID; Application for Subzone AREVA Enrichment Services...

    Science.gov (United States)

    2012-09-11

    ... From the Federal Register Online via the Government Publishing Office DEPARTMENT OF COMMERCE Foreign-Trade Zones Board Foreign-Trade Zone 242--Boundary County, ID; Application for Subzone AREVA... status for the facility of AREVA Enrichment Services, LLC (AES), located in Bonneville County, Idaho. The...

  10. High-level waste storage tank farms/242-A evaporator Standards/Requirements Identification Document (S/RID), Volume 4

    Energy Technology Data Exchange (ETDEWEB)

    1994-04-01

    The High-Level Waste Storage Tank Farms/242-A Evaporator Standards/Requirements Identification Document (S/RID) is contained in multiple volumes. This document (Volume 4) presents the standards and requirements for the following sections: Radiation Protection and Operations.

  11. High-level waste storage tank farms/242-A evaporator Standards/Requirements Identification Document (S/RID)

    Energy Technology Data Exchange (ETDEWEB)

    1994-04-01

    The High-Level Waste Storage Tank Farms/242-A Evaporator Standards/Requirements Identification Document (S/RID) is contained in multiple volumes. This document (Volume 3) presents the standards and requirements for the following sections: Safeguards and Security, Engineering Design, and Maintenance.

  12. High-level waste storage tank farms/242-A evaporator Standards/Requirements Identification Document (S/RID), Volume 2

    Energy Technology Data Exchange (ETDEWEB)

    1994-04-01

    The High-Level Waste Storage Tank Farms/242-A Evaporator Standards/Requirements Document (S/RID) is contained in multiple volumes. This document (Volume 2) presents the standards and requirements for the following sections: Quality Assurance, Training and Qualification, Emergency Planning and Preparedness, and Construction.

  13. 17 CFR 242.400 - Customer margin requirements for security futures-authority, purpose, interpretation, and scope.

    Science.gov (United States)

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Customer margin requirements..., AND NMS AND CUSTOMER MARGIN REQUIREMENTS FOR SECURITY FUTURES Customer Margin Requirements for Security Futures § 242.400 Customer margin requirements for security futures—authority, purpose...

  14. Combination of cetuximab and PP242 synergistically suppress the progression of wild-type KRAS colorectal carcinoma

    Directory of Open Access Journals (Sweden)

    Cheng L

    2015-11-01

    Full Text Available Lei Cheng,1,* Zuguang Xia,2,3,* Xinyu Bian,1 Guangchao Li,4 Jing Hu,1 Ya Cao,5 Qing Wang,1 Xiaoping Qian1 1Comprehensive Cancer Center of Drum-Tower Hospital, Medical School of Nanjing University, Clinical Cancer Institute of Nanjing University, Nanjing, 2Department of Medical Oncology, Fudan University Shanghai Cancer Center, Shanghai, 3Department of Oncology, Shanghai Medical College, Fudan University, Shanghai, 4School of Bioscience and Bioengineering, South China University of Technology, Guangzhou, Guangdong, 5Department of Biological Science and Technology and State Key Laboratory of Pharmaceutical Biotechnology, School of Life Sciences, Nanjing University, Nanjing, People’s Republic of China *These authors contributed equally to this work Abstract: Mammalian target of rapamycin (mTOR has been shown to be overactive in human colorectal cancer, but the first-generation mTOR inhibitor, rapamycin, has failed to show clinical efficacy against colorectal cancer. On the other hand, although the second-generation mTOR inhibitor, PP242, has exerted substantial efficacy, it was revealed that independent inhibition by PP242 was transient, which could lead to positive-feedback loop to EGFR. Using wild-type KRAS colorectal cancer cells as models, we investigate the treatment efficacy of a widely used anti-EGFR monoclonal antibody, cetuximab, and PP242, alone or in combination in vitro and in vivo. Results of cell viability assays confirmed the synergistic inhibitory effect of PP242 and cetuximab on the survival of Caco-2 and HT-29 cells. Moreover, the ability of cancer-cell invasion and proliferation was also significantly inhibited by the combination therapy when compared with cetuximab or PP242 alone. Interestingly, the percentage of CD44-positive cancer cells was substantially decreased by the combination therapy in comparison with PP242 alone through fluorescence-activated cell sorting. The growth of cancer stem-like cell spheres in vitro was

  15. Microsatellite Alterations with Allelic Loss at 9p24.2 Signify Less-aggressive Colorectal Cancer Metastasis

    Science.gov (United States)

    Koi, Minoru; Garcia, Melissa; Choi, Chan; Kim, Hyeong-Rok; Koike, Junichi; Hemmi, Hiromichi; Nagasaka, Takeshi; Okugawa, Yoshinaga; Toiyama, Yuji; Kitajima, Takahito; Imaoka, Hiroki; Kusunoki, Masato; Chen, Yin-Hsiu; Mukherjee, Bhramar; Boland, C Richard; Carethers, John M

    2016-01-01

    Background & Aims Molecular events that lead to recurrence and/or metastasis after curative treatment of patients with colorectal cancers (CRCs) are poorly understood. Patients with stage II or III primary CRC with increased numbers of microsatellite alterations at selected tetra-nucleotide repeats (EMAST) and low levels of microsatellite instability (E/L) are more likely to have disease recurrence after treatment. Hypoxia and/or inflammation not only promote metastasis but also induce EMAST by causing deficiency of MSH3 in the cancer cell nucleus. We aimed to identify genetic alterations associated with metastasis of primary colorectal tumors to liver and to determine their effects on survival. Methods We obtained 4 sets of primary colorectal tumors and matched liver metastases from hospitals in Korea and Japan. Intragenic microsatellites with large repeats at 141 loci were examined for frame-shift mutations and/or loss of heterozygosity (LOH) as possible consequences of MSH3 deficiency. Highly altered loci were examined for association with E/L in liver metastases. We analyzed data from 156 of the patients with stage II or III primary colorectal tumors to determine outcomes and whether altered loci were associated with E/L. Results LOH at several loci at chromosome 9p24.2 (9p24.2-LOH) was associated with E/L in liver metastases (odds ratio, 10.5; 95% confidence interval [CI], 2.69–40.80; P=.0007). We found no significant difference in the frequency of E/L, 9p24.2-LOH, mutations in KRAS or BRAF, or the combination of E/L and 9p24.2-LOH between primary colorectal tumors and their matched metastases. Patients with stage II or III colorectal tumors with E/L and 9p24.2-LOH had increased survival following CRC recurrence (hazard ratio, 0.25; 95% CI, 0.12–0.50; P=.0001), compared to patients without with E/L and 9p24.2-LOH. E/L with 9p24.2-LOH appeared to be an independent prognostic factor for overall survival of patients with stage III CRC (hazard ratio, 0.06; 95

  16. Microsatellite Alterations With Allelic Loss at 9p24.2 Signify Less-Aggressive Colorectal Cancer Metastasis.

    Science.gov (United States)

    Koi, Minoru; Garcia, Melissa; Choi, Chan; Kim, Hyeong-Rok; Koike, Junichi; Hemmi, Hiromichi; Nagasaka, Takeshi; Okugawa, Yoshinaga; Toiyama, Yuji; Kitajima, Takahito; Imaoka, Hiroki; Kusunoki, Masato; Chen, Yin-Hsiu; Mukherjee, Bhramar; Boland, C Richard; Carethers, John M

    2016-04-01

    Molecular events that lead to recurrence and/or metastasis after curative treatment of patients with colorectal cancers (CRCs) are poorly understood. Patients with stage II or III primary CRC with elevated microsatellite alterations at selected tetranucleotide repeats and low levels of microsatellite instability (E/L) are more likely to have disease recurrence after treatment. Hypoxia and/or inflammation not only promote metastasis, but also induce elevated microsatellite alterations at selected tetranucleotide repeats by causing deficiency of MSH3 in the cancer cell nucleus. We aimed to identify genetic alterations associated with metastasis of primary colorectal tumors to liver and to determine their effects on survival. We obtained 4 sets of primary colorectal tumors and matched liver metastases from hospitals in Korea and Japan. Intragenic microsatellites with large repeats at 141 loci were examined for frame-shift mutations and/or loss of heterozygosity (LOH) as possible consequences of MSH3 deficiency. Highly altered loci were examined for association with E/L in liver metastases. We analyzed data from 156 of the patients with stage II or III primary colorectal tumors to determine outcomes and whether altered loci were associated with E/L. LOH at several loci at chromosome 9p24.2 (9p24.2-LOH) was associated with E/L in liver metastases (odds ratio = 10.5; 95% confidence interval: 2.69-40.80; P = .0007). We found no significant difference in the frequency of E/L, 9p24.2-LOH, mutations in KRAS or BRAF, or the combination of E/L and 9p24.2-LOH, between primary colorectal tumors and their matched metastases. Patients with stage II or III colorectal tumors with E/L and 9p24.2-LOH had increased survival after CRC recurrence (hazard ratio = 0.25; 95% CI: 0.12-0.50; P = .0001), compared with patients without with E/L and 9p24.2-LOH. E/L with 9p24.2-LOH appeared to be an independent prognostic factor for overall survival of patients with stage III CRC (hazard

  17. Genetic variation at 16q24.2 is associated with small vessel stroke

    Science.gov (United States)

    Traylor, Matthew; Malik, Rainer; Nalls, Mike A.; Cotlarciuc, Ioana; Radmanesh, Farid; Thorleifsson, Gudmar; Hanscombe, Ken B.; Langefeld, Carl; Saleheen, Danish; Rost, Natalia S.; Yet, Idil; Spector, Tim D.; Bell, Jordana T.; Hannon, Eilis; Mill, Jonathan; Chauhan, Ganesh; Debette, Stephanie; Bis, Joshua C.; Longstreth, W.T.; Ikram, M. Arfan; Launer, Lenore J.; Seshadri, Sudha; Hamilton‐Bruce, Monica Anne; Jimenez‐Conde, Jordi; Cole, John W.; Schmidt, Reinhold; Słowik, Agnieszka; Lemmens, Robin; Lindgren, Arne; Melander, Olle; Grewal, Raji P.; Sacco, Ralph L.; Rundek, Tatjana; Rexrode, Kathryn; Arnett, Donna K.; Johnson, Julie A.; Benavente, Oscar R.; Wasssertheil‐Smoller, Sylvia; Lee, Jin‐Moo; Pulit, Sara L.; Wong, Quenna; Rich, Stephen S.; de Bakker, Paul I.W.; McArdle, Patrick F.; Woo, Daniel; Anderson, Christopher D.; Xu, Huichun; Heitsch, Laura; Fornage, Myriam; Jern, Christina; Stefansson, Kari; Thorsteinsdottir, Unnur; Gretarsdottir, Solveig; Lewis, Cathryn M.; Sharma, Pankaj; Sudlow, Cathie L.M.; Rothwell, Peter M.; Boncoraglio, Giorgio B.; Thijs, Vincent; Levi, Chris; Meschia, James F.; Rosand, Jonathan; Kittner, Steven J.; Mitchell, Braxton D.; Dichgans, Martin; Worrall, Bradford B.; Markus, Hugh S.

    2017-01-01

    Objective Genome‐wide association studies (GWAS) have been successful at identifying associations with stroke and stroke subtypes, but have not yet identified any associations solely with small vessel stroke (SVS). SVS comprises one quarter of all ischemic stroke and is a major manifestation of cerebral small vessel disease, the primary cause of vascular cognitive impairment. Studies across neurological traits have shown that younger‐onset cases have an increased genetic burden. We leveraged this increased genetic burden by performing an age‐at‐onset informed GWAS meta‐analysis, including a large younger‐onset SVS population, to identify novel associations with stroke. Methods We used a three‐stage age‐at‐onset informed GWAS to identify novel genetic variants associated with stroke. On identifying a novel locus associated with SVS, we assessed its influence on other small vessel disease phenotypes, as well as on messenger RNA (mRNA) expression of nearby genes, and on DNA methylation of nearby CpG sites in whole blood and in the fetal brain. Results We identified an association with SVS in 4,203 cases and 50,728 controls on chromosome 16q24.2 (odds ratio [OR; 95% confidence interval {CI}] = 1.16 [1.10–1.22]; p = 3.2 × 10−9). The lead single‐nucleotide polymorphism (rs12445022) was also associated with cerebral white matter hyperintensities (OR [95% CI] = 1.10 [1.05–1.16]; p = 5.3 × 10−5; N = 3,670), but not intracerebral hemorrhage (OR [95% CI] = 0.97 [0.84–1.12]; p = 0.71; 1,545 cases, 1,481 controls). rs12445022 is associated with mRNA expression of ZCCHC14 in arterial tissues (p = 9.4 × 10−7) and DNA methylation at probe cg16596957 in whole blood (p = 5.3 × 10−6). Interpretation 16q24.2 is associated with SVS. Associations of the locus with expression of ZCCHC14 and DNA methylation suggest the locus acts through changes to regulatory elements. Ann Neurol 2017;81:383–394

  18. New measurement of the 242Pu(n,γ cross section at n_TOF

    Directory of Open Access Journals (Sweden)

    Lerendegui-Marco J.

    2016-01-01

    Full Text Available The use of MOX fuel (mixed-oxide fuel made of UO2 and PuO2 in nuclear reactors allows substituting a large fraction of the enriched Uranium by Plutonium reprocessed from spent fuel. With the use of such new fuel composition rich in Pu, a better knowledge of the capture and fission cross sections of the Pu isotopes becomes very important. In particular, a new series of cross section evaluations have been recently carried out jointly by the European (JEFF and United States (ENDF nuclear data agencies. For the case of 242Pu, the two only neutron capture time-of-flight measurements available, from 1973 and 1976, are not consistent with each other, which calls for a new time-of flight capture cross section measurement. In order to contribute to a new evaluation, we have perfomed a neutron capture cross section measurement at the n_TOF-EAR1 facility at CERN using four C6D6 detectors, using a high purity target of 95 mg. The preliminary results assessing the quality and limitations (background, statistics and γ-flash effects of this new experimental data are presented and discussed, taking into account that the aimed accuracy of the measurement ranges between 7% and 12% depending on the neutron energy region.

  19. FAST, LOW-IONIZATION EMISSION REGIONS OF THE PLANETARY NEBULA M2-42

    Energy Technology Data Exchange (ETDEWEB)

    Danehkar, A.; Parker, Q. A. [Department of Physics and Astronomy, Macquarie University, Sydney, NSW 2109 (Australia); Steffen, W., E-mail: ashkbiz.danehkar@cfa.harvard.edu [Instituto de Astronomía, Universidad Nacional Autónoma de México, C.P.22860, Ensenada (Mexico)

    2016-02-15

    Spatially resolved observations of the planetary nebula M2-42 (PN G008.2−04.8) obtained with the Wide Field Spectrograph on the Australian National University 2.3 m telescope have revealed the remarkable features of bipolar collimated jets emerging from its main structure. Velocity-resolved channel maps derived from the [N ii] λ6584 emission line disentangle different morphological components of the nebula. This information is used to develop a three-dimensional morpho-kinematic model, which consists of an equatorial dense torus and a pair of asymmetric bipolar outflows. The expansion velocity of about 20 km s{sup −1} is measured from the spectrum integrated over the main shell. However, the deprojected velocities of the jets are found to be in the range of 80–160 km s{sup −1} with respect to the nebular center. It is found that the mean density of the collimated outflows, 595 ± 125 cm{sup −3}, is five times lower than that of the main shell, 3150 cm{sup −3}, whereas their singly ionized nitrogen and sulfur abundances are about three times higher than those determined from the dense shell. The results indicate that the features of the collimated jets are typical of fast, low-ionization emission regions.

  20. Neutron-induced fission cross section of 242Pu from 15 MeV to 20 MeV

    Directory of Open Access Journals (Sweden)

    Jovančević N.

    2017-01-01

    Full Text Available Accurate nuclear-data needs in the fast-neutron-energy region have been recently addressed for the development of next generation nuclear power plants (GEN-IV by the OECD Nuclear Energy Agency (NEA. This sensitivity study has shown that of particular interest is the 242Pu(n,f cross section for fast reactor systems. Measurements have been performed with quasi-monoenergetic neutrons in the energy range from 15 MeV to 20 MeV produced by the Van de Graaff accelerator of the JRC-Geel. A twin Frisch-grid ionization chamber has been used in a back-to-back configuration as fission fragment detector. The 242Pu(n,f cross section has been normalized to 238U(n,f cross section data. The results were compared with existing literature data and show acceptable agreement within 5%.

  1. Measurement of the $^{242}$Pu(n,f) reaction cross-section at the CERN n_TOF facility

    CERN Document Server

    AUTHOR|(CDS)2080481; Kokkoris, Michael; Vlachoudis, Vasilis

    The accurate knowledge of relevant nuclear data, such as the neutron-induced fission cross sections of various plutonium isotopes and other minor actinides, is crucial for the design of advanced nuclear systems as well as the development of comprehensive theoretical models of the fission process. The $^{242}$Pu(n,f) cross section was measured at the CERN n_TOF facility taking advantage of the wide energy range and the high instantaneous flux of the neutron beam. In this work, results for the $^{242}$Pu(n,f) measurement are presented along with a detailed description of the experimental setup, Monte-Carlo simulations and the analysis procedure, and a theoretical cross section calculation performed with the EMPIRE code.

  2. Neutron-induced fission cross section of 242Pu from 15 MeV to 20 MeV

    Science.gov (United States)

    Jovančević, N.; Salvador-Castineira, P.; Daraban, L.; Vidali, M.; Heyse, J.; Oberstedt, S.; Hambsch, F.-J.; Bonaldi, C.; Geerts, W.

    2017-09-01

    Accurate nuclear-data needs in the fast-neutron-energy region have been recently addressed for the development of next generation nuclear power plants (GEN-IV) by the OECD Nuclear Energy Agency (NEA). This sensitivity study has shown that of particular interest is the 242Pu(n,f) cross section for fast reactor systems. Measurements have been performed with quasi-monoenergetic neutrons in the energy range from 15 MeV to 20 MeV produced by the Van de Graaff accelerator of the JRC-Geel. A twin Frisch-grid ionization chamber has been used in a back-to-back configuration as fission fragment detector. The 242Pu(n,f) cross section has been normalized to 238U(n,f) cross section data. The results were compared with existing literature data and show acceptable agreement within 5%.

  3. Measurement of the 242Pu(n,f) Cross Section at the CERN n_TOF Facility

    CERN Document Server

    Tsinganis, A; Guerrero, C; Colonna, N; Calviani, M; Vlastou, R; Andriamonje, S; Vlachoudis, V; Gunsing, F; Massimi, C; Altstadt, S; Andrzejewski, J; Audouin, L; Barbagallo, M; Bécares, V; Bečvář, F; Belloni, F; Billowes, J; Boccone, V; Bosnar, D; Brugger, M; Calviño, F; Cano-Ott, D; Carrapiço, C; Cerutti, F; Chin, M; Cortés, G; Cortés-Giraldo, M A; Diakaki, M; Domingo-Pardo, C; Duran, I; Dressler, R; Dzysiuk, N; Eleftheriadis, C; Ferrari, A; Fraval, K; Ganesan, S; García, A R; Giubrone, G; Gómez-Hornillos, M B; Gonçalves, I F; González-Romero, E; Griesmayer, E; Gurusamy, P; Hernández-Prieto, A; Jenkins, D G; Jericha, E; Kadi, Y; Käppeler, F; Karadimos, D; Kivel, N; Koehler, P; Kokkoris, M; Krtička, M; Kroll, J; Lampoudis, C; Langer, C; Leal-Cidoncha, E; Lederer, C; Leeb, H; Leong, L S; Losito, R; Mallick, A; Manousos, A; Marganiec, J; Martínez, T; Massimi, C; Mastinu, P F; Mastromarco, M; Meaze, M; Mendoza, E; Mengoni, A; Milazzo, P M; Mingrone, F; Mirea, M; Mondalaers, W; Paradela, C; Pavlik, A; Perkowski, J; Plompen, A; Praena, J; Quesada, J M; Rauscher, T; Reifarth, R; Riego, A; Robles, M S; Roman, F; Rubbia, C; Sabaté-Gilarte, M; Sarmento, R; Saxena, A; Schillebeeckx, P; Schmidt, S; Schumann, D; Tagliente, G; Tain, J L; Tarrío, D; Tassan-Got, L; Valenta, S; Vannini, G; Variale, V; Vaz, P; Ventura, A; Versaci, R; Vermeulen, M J; Wallner, A; Ware, T; Weigand, M; Weiss, C; Wright, T; Žugec, P

    2014-01-01

    The accurate knowledge of relevant nuclear data is crucial for the design of advanced nuclear systems. These data include neutron cross sections of various plutonium isotopes and other minor actinides. The Pu-242(n,f) cross section was measured at the CERN n\\_TOF facility, taking advantage of the wide energy range (from thermal to GeV) and the high instantaneous flux of the neutron beam. Preliminary results for the measurement are presented.

  4. Measurement of the 242Pu(n,f) Cross Section at the CERN n_TOF Facility

    Science.gov (United States)

    Tsinganis, A.; Berthoumieux, E.; Guerrero, C.; Colonna, N.; Calviani, M.; Vlastou, R.; Andriamonje, S.; Vlachoudis, V.; Gunsing, F.; Massimi, C.; Altstadt, S.; Andrzejewski, J.; Audouin, L.; Barbagallo, M.; Bécares, V.; Bečvář, F.; Belloni, F.; Billowes, J.; Boccone, V.; Bosnar, D.; Brugger, M.; Calviño, F.; Cano-Ott, D.; Carrapiço, C.; Cerutti, F.; Chin, M.; Cortés, G.; Cortés-Giraldo, M. A.; Diakaki, M.; Domingo-Pardo, C.; Duran, I.; Dressler, R.; Dzysiuk, N.; Eleftheriadis, C.; Ferrari, A.; Fraval, K.; Ganesan, S.; García, A. R.; Giubrone, G.; Gómez-Hornillos, M. B.; Gonçalves, I. F.; González-Romero, E.; Griesmayer, E.; Gurusamy, P.; Hernández-Prieto, A.; Jenkins, D. G.; Jericha, E.; Kadi, Y.; Käppeler, F.; Karadimos, D.; Kivel, N.; Koehler, P.; Kokkoris, M.; Krtička, M.; Kroll, J.; Lampoudis, C.; Langer, C.; Leal-Cidoncha, E.; Lederer, C.; Leeb, H.; Leong, L. S.; Losito, R.; Mallick, A.; Manousos, A.; Marganiec, J.; Martínez, T.; Massimi, C.; Mastinu, P. F.; Mastromarco, M.; Meaze, M.; Mendoza, E.; Mengoni, A.; Milazzo, P. M.; Mingrone, F.; Mirea, M.; Mondalaers, W.; Paradela, C.; Pavlik, A.; Perkowski, J.; Plompen, A.; Praena, J.; Quesada, J. M.; Rauscher, T.; Reifarth, R.; Riego, A.; Robles, M. S.; Roman, F.; Rubbia, C.; Sabaté-Gilarte, M.; Sarmento, R.; Saxena, A.; Schillebeeckx, P.; Schmidt, S.; Schumann, D.; Tagliente, G.; Tain, J. L.; Tarrío, D.; Tassan-Got, L.; Valenta, S.; Vannini, G.; Variale, V.; Vaz, P.; Ventura, A.; Versaci, R.; Vermeulen, M. J.; Wallner, A.; Ware, T.; Weigand, M.; Weiss, C.; Wright, T.; Žugec, P.

    2014-05-01

    The accurate knowledge of relevant nuclear data is crucial for the design of advanced nuclear systems. These data include neutron cross sections of various plutonium isotopes and other minor actinides. The 242Pu(n,f) cross section was measured at the CERN n_TOF facility, taking advantage of the wide energy range (from thermal to GeV) and the high instantaneous flux of the neutron beam. Preliminary results for the measurement are presented.

  5. A Diagnostic and Therapeutic Algorithm for Impacted Teeth for Plastic Surgeons: Outcomes of 242 Extracted Teeth

    Directory of Open Access Journals (Sweden)

    Nebil Yeşiloğlu

    2016-09-01

    Full Text Available Objective: Impacted teeth are important for plastic surgeons that frequently perform maxillofacial operations because of their tendency to affect dental occlusion, and thus, cephalometric results. Moreover, severe complications are also caused by the tooth and its surgical removal. In this study, retrospective analysis of 242 extracted teeth and 24 extracted roots was performed and an algorithmic approach to different types and the localizations of impacted teeth was presented. Possible complications and salvage procedures were also discussed. Material and Methods: A retrospective analysis of 128 patients who underwent impacted teeth removal surgery between 2013 and 2015 was performed. Mean age was 26 years (Range: 18–42 years, and the female to male ratio was 39/89. Sixteen of the patients were operated under regional nerve block, whereas the remaining were operated under general anesthesia. In 107 patients, the whole tooth was removed, whereas the residual root of the tooth was removed in 21 patients. In 89 patients, bone interventions like the creation of bone window or peridental milling to loosen the tooth were needed, whereas only oral mucosal incisions were performed in the remaining patients. Results: The most common onset symptom was localized pain, and the most common complications were swelling and edema. The most common extracted tooth was the mandibular 3rd molar. Lower lip hypoesthesia, which was continued up to eight months, was encountered in six patients who underwent mandibular 3rd molar extraction. Conclusion: In our opinion, a wide range of possible complications secondary to impacted teeth surgery makes them important for plastic surgeons who are more experienced than other disciplines, and learning teeth extraction is essential to learn in plastic surgery specialty training.

  6. TAK-242 treatment ameliorates liver ischemia/reperfusion injury by inhibiting TLR4 signaling pathway in a swine model of Maastricht-category-III cardiac death.

    Science.gov (United States)

    Shao, Zigong; Jiao, Baoping; Liu, Tingting; Cheng, Ying; Liu, Hao; Liu, Yongfeng

    2016-12-01

    This study aims to test the effects of TAK-242 on liver transplant viability in a model of swine Maastricht-category-III cardiac death. A swine DCD Maastricht-III model of cardiac death was established, and TAK-242 was administered prior to the induction of cardiac death. The protein and mRNA level of TLR4 signaling pathway molecules and cytokines that are important in mediating immune and inflammatory responses were assessed at different time points following the induction of cardiac death. After induction of cardiac death, both the mRNA and protein levels of key molecules (TLR4, TRAF6, NF-ϰB, ICAM-1, MCP-1 and MPO), TNF-α and IL-6 increased significantly. Infusion of TAK-242 1h before induction of cardiac death blocked the increase of immune and inflammatory response molecules. However, the increase of TLR4 level was not affected by infusion of TAK-242. Histology study showed that infusion of TAK-242 protect liver tissue from damage during cardiac death. These results indicates that TLR4 signaling pathway may contribute to ischemia/reperfusion injury in the liver grafts, and blocking TLR4 pathway with TAk-242 may reduce TLR4-mediated tissue damage. Copyright © 2016 Elsevier Masson SAS. All rights reserved.

  7. Cigarette smoking and colorectal cancer mortality among 602,242 Norwegian males and females

    Directory of Open Access Journals (Sweden)

    Parajuli R

    2014-04-01

    Full Text Available Ranjan Parajuli,1 Eivind Bjerkaas,1 Aage Tverdal,2 Loïc Le Marchand,3 Elisabete Weiderpass1,4–6 Inger T Gram1,7 1Department of Community Medicine, Faculty of Health Sciences UiT, The Arctic University of Norway, Tromsø, Norway; 2Division of Epidemiology, Department of Pharmacoepidemiology, Norwegian Institute of Public Health, Oslo, Norway; 3Epidemiology Program, University of Hawaii Cancer Center, Honolulu, HI, USA; 4Department of Medical Epidemiology and Biostatistics, Karolinska Institutet, Stockholm, Sweden; 5Department of Genetic Epidemiology, Samfundet Folkhälsan, Helsinki, Finland; 6Department of Research, Cancer Registry of Norway, Oslo, Norway; 7Norwegian Centre for Integrated Care and Telemedicine, University Hospital of North Norway, Tromsø, Norway Background: Colorectal cancer (CRC is one of the main cancer types, with high incidence and mortality in Norway. We examined the association between different measures of smoking exposure and CRC mortality overall and by subsite in a large Norwegian cohort. Methods: We followed 602,242 participants from four Norwegian health surveys, aged 19–67 years at enrollment between 1972 and 2003 by linkage to the national registries through December 2007. We used Cox proportional hazard models to estimate hazard ratios (HRs and 95% confidence intervals (CIs by smoking categories for different CRC endpoints. Results: During a mean follow-up of 14 years, 2,333 Norwegian males and females died of CRC (60% men. Male and female ever smokers had a 20% (HR 1.23, CI 1.08–1.40 and HR 1.22, 95% CI 1.06–1.40, respectively increased risk of death from CRC compared with sex-specific never smokers. For proximal colon cancer mortality, female ever smokers had a 50% (HR 1.49, 95% CI 1.20–1.87 increased risk compared with female never smokers. The increased risk of rectal cancer mortality was about 40% higher for male ever smokers (HR 1.43, 95% CI 1.14–1.81 compared with male never smokers. A test for

  8. Sequence and batch language programs and alarm-related ``C`` programs for the 242-A MCS. Revision 2

    Energy Technology Data Exchange (ETDEWEB)

    Berger, J.F.

    1995-03-01

    A Distributive Process Control system was purchased by Project B-534, ``242-A Evaporator/Crystallizer Upgrades``. This control system, called the Monitor and Control System (MCS), was installed in the 242-A Evaporator located in the 200 East Area. The purpose of the MCS is to monitor and control the Evaporator and monitor a number of alarms and other signals from various Tank Farm facilities. Applications software for the MCS was developed by the Waste Treatment Systems Engineering (WTSE) group of Westinghouse. The standard displays and alarm scheme provide for control and monitoring, but do not directly indicate the signal location or depict the overall process. To do this, WTSE developed a second alarm scheme which uses special programs, annunciator keys, and process graphics. The special programs are written in two languages; Sequence and Batch Language (SABL), and ``C`` language. The WTSE-developed alarm scheme works as described below: SABL relates signals and alarms to the annunciator keys, called SKID keys. When an alarm occurs, a SABL program causes a SKID key to flash, and if the alarm is of yellow or white priority then a ``C`` program turns on an audible horn (the D/3 system uses a different audible horn for the red priority alarms). The horn and flashing key draws the attention of the operator.

  9. High-level waste storage tank farms/242-A evaporator standards/requirements identification document (S/RID), Vol. 4

    Energy Technology Data Exchange (ETDEWEB)

    1994-04-01

    Radiation protection of personnel and the public is accomplished by establishing a well defined Radiation Protection Organization to ensure that appropriate controls on radioactive materials and radiation sources are implemented and documented. This Requirements Identification Document (RID) applies to the activities, personnel, structures, systems, components, and programs involved in executing the mission of the Tank Farms. The physical boundaries within which the requirements of this RID apply are the Single Shell Tank Farms, Double Shell Tank Farms, 242-A Evaporator-Crystallizer, 242-S, T Evaporators, Liquid Effluent Retention Facility (LERF), Purgewater Storage Facility (PWSF), and all interconnecting piping, valves, instrumentation, and controls. Also included is all piping, valves, instrumentation, and controls up to and including the most remote valve under Tank Farms control at any other Hanford Facility having an interconnection with Tank Farms. The boundary of the structures, systems, components, and programs to which this RID applies, is defined by those that are dedicated to and/or under the control of the Tank Farms Operations Department and are specifically implemented at the Tank Farms.

  10. The use of MOX caramel fuel mixed with241Am,242mAm and243Am as burnable absorber actinides for the MTR research reactors.

    Science.gov (United States)

    Shaaban, Ismail; Albarhoum, Mohamad

    2017-07-01

    The MOX (UO 2 &PuO 2 ) caramel fuel mixed with 241 Am, 242m Am and 243 Am as burnable absorber actinides was proposed as a fuel of the MTR-22MW reactor. The MCNP4C code was used to simulate the MTR-22MW reactor and estimate the criticality and the neutronic parameters, and the power peaking factors before and after replacing its original fuel (U 3 O 8 -Al) by the MOX caramel fuel mixed with 241 Am, 242m Am and 243 Am actinides. The obtained results of the criticality, the neutronic parameters, and the power peaking factors for the MOX caramel fuel mixed with 241 Am, 242m Am and 243 Am actinides were compared with the same parameters of the U 3 O 8 -Al original fuel and a maximum difference is -6.18% was found. Additionally, by recycling 2.65% and 2.71% plutonium and 241 Am, 242m Am and 243 Am actinides in the MTR-22MW reactor, the level of 235 U enrichment is reduced from 4.48% to 3% and 2.8%, respectively. This also results in the reduction of the 235 U loading by 32.75% and 37.22% for the 2.65%, the 2.71% plutonium and 241 Am, 242m Am and 243 Am actinides, respectively. Copyright © 2017 Elsevier Ltd. All rights reserved.

  11. Relationship between peripheral and mesenteric serum levels of CEA and CA 242 with staging and histopathological variables in colorectal adenocarcinoma Níveis séricos periféricos e mesentéricos de CEA e CA 242, estadiamento e variáveis histopatológicas no adenocarcinoma colorretal

    Directory of Open Access Journals (Sweden)

    Mauro Lamelas Cardoso

    2009-10-01

    Full Text Available PURPOSE: To compare histopathological variables and staging in colorectal adenocarcinoma cases with CEA and CA 242 in peripheral and mesenteric blood. METHODS: In 169 individuals underwent surgery for colorectal cancer, CEA and CA 242 were analyzed and compared to mesenteric and peripheral blood and correlated with macroscopic tumor's morphology and size, degree of cell differentiation, venous, neural and lymphatic involvement and TNM classification. RESULTS: There was a difference between the mesenteric (M and peripheral (P serum levels of CEA (p=0.020. Higher levels of markers were correlated with venous invasion CEA (P p=0.013, CEA (M p=0.05, CA 242 (M p=0.005 and CA 242 (P p=0.038; with advanced staging CEA (P OBJETIVO: Comparar variáveis histopatológicas e graus de estadiamento do adenocarcinoma colorretal com níveis sanguíneos periféricos e mesentéricos de CEA e CA-242. MÉTODOS: Em 169 doentes submetidos ao tratamento cirúrgico por adenocarcinoma colorretal, CEA e CA-242 foram analisados e comparados quanto aos níveis sanguíneos periféricos e mesentéricos e correlacionados com o tamanho e a morfologia macroscópica do tumor, grau de diferenciação celular, invasões venosa, linfática, neural e a classificação TNM. RESULTADOS: Verificou-se diferença significante entre o nível sérico mesentérico e periférico de CEA (p= 0,02. Níveis séricos mais elevados dos marcadores foram observados e correlacionados com invasão venosa, CEA (P p=0,013, CEA(M, p=0,05, CA-242 (M p=0,005 e CA-242 (P p=0,038. Grau de estadiamento TNM avançado foi associado com CEA(P < CEA(M p<0,05, CA-242(P < CA-242(M p<0,05. Nas maiores dimensões tumorais constatou-se CEA(P < CEA(M p=0,001 e CA 242 (P < CA 242 (M (p < 0.001. O CA 242 periférico e mesentérico aumentados associaram-se com a invasão neural, p=0.014 e p=0.003, respectivamente. CONCLUSÕES: O nível sérico mesentérico de CEA é superior ao nível sérico periférico. Os níveis s

  12. Measurement of the fission cross-section of $^{240}$Pu and $^{242}$Pu at CERN's n_TOF Facility

    CERN Multimedia

    Pavlik, A F; Gonzalez romero, E M

    The n_TOF Collaboration proposes to continue the fission program, already started in 2002-2004, taking advantage of the newly constructed Work Sector Type A, with the measurement of the two isotopes : $^{240}$ Pu and $^{242}$ Pu. They are both of major importance for reactor physics applications and are included in the Nuclear Energy Agency (NEA) High Priority List [1], in the NEA WPEC Subgroup 26 Report on the accuracy of nuclear data for advanced reactor designe [2] and in the EU 6$^{th}$ Framework Programme IP-EUROTRANS/NUDATRA reports [3]. Based on those requests, the measurement of the fission cross-section of the two Pu isotopes is one of the objectives of the project ANDES of the FP7 EURATOM program [4].

  13. Corrigendum to ;Late Devonian carbonate magnetostratigraphy from the Oscar and Horse Spring Ranges, Lennard Shelf, Canning Basin, Western Australia; [Earth Planet. Sci. Lett. 409 (2015) 232-242

    Science.gov (United States)

    Hansma, Jeroen; Tohver, Eric; Yan, Maodu; Trinajstic, Kate; Roelofs, Brett; Peek, Sarah; Slotznick, Sarah P.; Kirschvink, Joseph; Playton, Ted; Haines, Peter; Hocking, Roger

    2017-11-01

    We thank Sergei Pisarevsky for bringing to our attention an error in the stated geomagnetic pole position within our article (pp. 232, 237, and 242). The correct pole position should be 30.3°E/54.3°S, A95 = 2.6, n = 501.

  14. The C242T-polymorphism of the NADPH/NADH oxidase gene p22phox subunit is not associated with pre-eclampsia.

    NARCIS (Netherlands)

    Raijmakers, M.; Roes, E.M.; Steegers, E.A.P.; Peters, W.H.M.

    2002-01-01

    Pre-eclampsia is a pregnancy-related multisystem disorder characterised by elevation of blood pressure and proteinuria, in which oxidative stress may play an important role. Blood pressure is partly controlled by O(-)(2) production by NADPH/NADH oxidase and recently it was shown that a C242T

  15. High-level waste storage tank farms/242-A evaporator Standards/Requirements Identification Document (S/RID), Volume 7. Revision 1

    Energy Technology Data Exchange (ETDEWEB)

    Burt, D.L.

    1994-04-01

    The High-Level Waste Storage Tank Farms/242-A Evaporator Standards/Requirements Identification Document (S/RID) is contained in multiple volumes. This document (Volume 7) presents the standards and requirements for the following sections: Occupational Safety and Health, and Environmental Protection.

  16. Moisture source signals preserved in a 242-year tree-ring δ18O chronology in the western Himalaya

    Science.gov (United States)

    Sano, Masaki; Dimri, A. P.; Ramesh, R.; Xu, Chenxi; Li, Zhen; Nakatsuka, Takeshi

    2017-10-01

    The oxygen isotope ratio (δ18O) of tree-ring cellulose is known to be a reliable proxy for hydroclimate in monsoon Asia. However, tree-ring δ18O data are still spatially and temporally limited, so a denser tree-ring network in Asia is required to better understand the dynamics of the monsoon circulation and its past variability. Here, we present a 242-year δ18O chronology calculated from five silver fir trees collected in the western (Indian) Himalaya, a region located on the northwestern periphery of the summer monsoon incursions. Response analyses using regionalized climatic data revealed that tree-ring δ18O is controlled by hydroclimatic variables, including precipitation, relative humidity, and the drought index, during the summer monsoon season. In addition, spatial correlation analyses with gridded climatic parameters showed that the strongest correlations of tree-ring δ18O are not observed with the climatic parameters at the sampling site, but with those in a region several hundred kilometers to the southwest, indicating that water vapor originating in the Arabian Sea is transported to the study site. Based on these results, we reconstructed the self-calibrating Palmer Drought Severity Index (scPDSI) for the summer monsoon season (June-September) over the past 242 years (1767-2008 CE), using a linear regression model that accounts for 45.0% of the actual scPDSI variance. Our chronology showed significant correlations with other tree-ring δ18O data from Nepal and Bhutan, indicating that common signals related to the moisture supply from the Bay of Bengal are also recorded in the present reconstruction. However, the tree-ring record from India often showed weak correlations with that from Bhutan, especially when the summer monsoon was relatively weak. This result, together with the fact that the water vapor at the tree site was also derived from the Arabian Sea, implies that a weaker monsoon circulation enhances the flux of Arabian Sea moisture and

  17. Laparoscopic gastrointestinal anastomoses using knotless barbed absorbable sutures are safe and reproducible: a single-center experience with 242 patients

    Science.gov (United States)

    Lee, Sang-Woong; Kawai, Masaru; Tashiro, Keitaro; Nomura, Eiji; Tokuhara, Takaya; Kawashima, Satoshi; Tanaka, Ryo; Uchiyama, Kazuhisa

    2016-01-01

    Objective Intracorporeal reconstruction of the digestive tract is technically challenging. The V-Loc 180 wound closure device (Covidien) is a self-anchoring unidirectional barbed suture that obviates the need for knot tying. The aim of this prospective cohort study was to investigate the use of the novel suture in gastrointestinal enterotomy closure. Methods The subjects comprised patients with malignant disease who were scheduled to undergo laparoscopic gastrectomy with curative intent. The barbed suture was used to close the entry hole for the linear stapler during intracorporeal reconstruction following laparoscopic gastric resection. The primary endpoint was the proportion of patients who developed anastomotic leakage at the site where the barbed suture was applied. Results Between July 2012 and March 2015, 242 patients were enrolled. Of 362 anastomoses, the enterotomy hole at 256 sites was closed using the barbed suture. These 256 sites consisted of 95 gastroduodenostomies, 25 gastrogastrostomies, 13 gastrojejunostomies, 90 jejunojejunostomies, 17 esophagojejunostomies and 16 primary closures of the stomach following local gastric resection. There were no anastomosis-related complications, conversion to usual sutures, mechanical closure of the entry hole and reoperation due to adhesive obstructions or mortality over a median follow-up period of 17.8 months. Conclusions The use of the unidirectional barbed absorbable suture for gastrointestinal closure is safe and effective in laparoscopic gastrectomy. PMID:26819279

  18. Prenatal Diagnosis of a 2.5 Mb De Novo 17q24.1q24.2 Deletion Encompassing KPNA2 and PSMD12 Genes in a Fetus with Craniofacial Dysmorphism, Equinovarus Feet, and Syndactyly

    Directory of Open Access Journals (Sweden)

    Marie-Emmanuelle Naud

    2017-01-01

    Full Text Available Interstitial 17q24.1 or 17q24.2 deletions were reported after conventional cytogenetic analysis or chromosomal microarray analysis in patients presenting intellectual disability, facial dysmorphism, and/or malformations. We report on a fetus with craniofacial dysmorphism, talipes equinovarus, and syndactyly associated with a de novo 2.5 Mb 17q24.1q24.2 deletion. Among the deleted genes, KPNA2 and PSMD12 are discussed for the correlation with the fetal phenotype. This is the first case of prenatal diagnosis of 17q24.1q24.2 deletion.

  19. Mutation of Lys242 allows Delta3-Delta2-enoyl-CoA isomerase to acquire enoyl-CoA hydratase activity.

    Science.gov (United States)

    Yu, Wenhua; Chu, Xiusheng; Deng, Guisheng; Liu, Xiaojun; Chen, Gong; Li, Ding

    2006-12-01

    We report here a novel example of generating hydratase activity through site-directed mutagenesis of a single residue Lys242 of rat liver mitochondrial Delta3-Delta2-enoyl-CoA isomerase, which is one of the key enzymes involved in fatty acid oxidation and a member of the crotonase superfamily. Lys242 is at the C-terminal of the enzyme, which is far from the active site in the crotonase superfamily and forms a salt bridge with Asp149. A variety of mutant expression plasmids were constructed, and it was observed that mutation of Lys242 to nonbasic residues allowed the mutants to have enoyl-CoA hydratase activity confirmed by HPLC analysis of the incubation mixture. Kinetic studies of these mutants were carried out for both isomerase and hydratase activities. Mutant K242C showed a k(cat) value of 1.0 s(-1) for hydration reaction. This activity constitutes about 10% of the total enzyme activity, and the remaining 90% is its natural isomerase activity. To the best of our knowledge, this is the first report on the generation of functional promiscuity through single amino acid mutation far from the active site. This may be a simple and efficient approach to designing a new enzyme based on an existing template. It could perhaps become a general methodology for facilitating an enzyme to acquire a type enzymatic activity that belongs to another member of the same superfamily, by interrupting a key structural element in order to introduce ambiguity, using site-directed mutagenesis.

  20. Development of Intent Information Changes to Revised Minimum Aviation System Performance Standards for Automatic Dependent Surveillance Broadcast (RTCA/DO-242A)

    Science.gov (United States)

    Barhydt, Richard; Warren, Anthony W.

    2002-01-01

    RTCA Special Committee 186 has recently adopted a series of changes to the original Minimum Aviation System Performance Standards (MASPS) for Automatic Dependent Surveillance Broadcast (ADS-B). The new document will be published as DO-242A. Major changes to the MASPS include a significant restructuring and expansion of the intent parameters for future ADS-B systems. ADS-B provides a means for aircraft to exchange information about their intended trajectories with each other and with ground systems. NASA and Boeing have played significant roles in recommending these changes and providing supporting analysis. The intent changes are anticipated to provide substantial benefits to several programs and operational concepts under development by the two organizations. Major changes include the addition of Target State reports and the replacement of Trajectory Change Point reports with Trajectory Change reports. These changes have been designed to better reflect the capabilities of existing and future aircraft avionics, while providing benefits to current and proposed applications. DO-242A implements intent information elements that can be supported by current avionics systems and data buses. Provisions are made for future incorporation of other intent elements, as needed to meet operational requirements. This document summarizes the reasons for the DO-242A intent changes and provides a detailed overview of current and future intended ADS-B MASPS changes related to aircraft intent.

  1. 242Pu neutron-induced fission cross-section measurement from 1 to 2 MeV neutron energy

    Science.gov (United States)

    Marini, P.; Mathieu, L.; Aïche, M.; Belier, G.; Czajkowski, S.; Ducasse, Q.; Jurado, B.; Kessedjian, G.; Matarranz, J.; Plompen, A.; Salvador-Castiñeira, P.; Taieb, J.; Tsekhanovich, I.

    2017-11-01

    Relative values of the neutron-induced fission cross section σ (n ,f ) of 242Pu have been measured with respect to the standard 1H(n ,p ) elastic scattering cross section, at average energies of 1.0, 1.4, and 1.9 MeV . The measurements are part of an international effort to reduce uncertainties and provide independent nuclear data relevant for fast-spectrum reactors. The shape of the measured cross section is in good agreement with data from Tovesson et al. [Phys. Rev. C 79, 014613 (2009), 10.1103/PhysRevC.79.014613] and with the most recent data from Matei et al. [Phys. Rev. C 95, 024606 (2017), 10.1103/PhysRevC.95.024606], but disagrees with the shapes of ENDF/B-VII.1 and JEFF3.2 evaluations. Absolute values of σ (n ,f ) , obtained under some assumptions, indicate an overestimation of σ (n ,f ) in the evaluated libraries at 1.0 and 1.4 MeV , while a good agreement is found with ENDF/B-VII.1 at 1.9 MeV . A careful analysis of the impact of scattered neutrons and anisotropy of the fission fragment angular distribution has been performed. The measurement of the neutron flux by means of a proton-recoil detector is discussed. A comprehensive study of corrections applied to the data, of associated uncertainties, and of correlations between the measurements at the different energies is presented.

  2. Pages 242 - 248.pmd

    African Journals Online (AJOL)

    Administrator

    seizure disorders in Gbawein and Wroughbarh clan region of Grand Bassa County, Liberia. Neuroepidemiology 1983; 2:35-44. 6. Winkler AS, Friedrich K, Konig R, Meindl M,. Helbok R, I U, et al. The head nodding. Syndrome: clinical manifestations and possible causes. Epilepsia 2008;49(12):2008. 7. Nyungura JL, Akim T, ...

  3. The C242T polymorphism of the p22-phox gene (CYBA is associated with higher left ventricular mass in Brazilian hypertensive patients

    Directory of Open Access Journals (Sweden)

    Krieger José E

    2011-08-01

    Full Text Available Abstract Background Reactive oxygen species have been implicated in the physiopathogenesis of hypertensive end-organ damage. This study investigated the impact of the C242T polymorphism of the p22-phox gene (CYBA on left ventricular structure in Brazilian hypertensive subjects. Methods We cross-sectionally evaluated 561 patients from 2 independent centers [Campinas (n = 441 and Vitória (n = 120] by clinical history, physical examination, anthropometry, analysis of metabolic and echocardiography parameters as well as p22-phox C242T polymorphism genotyping. In addition, NADPH-oxidase activity was quantified in peripheral mononuclear cells from a subgroup of Campinas sample. Results Genotype frequencies in both samples were consistent with the Hardy- Weinberg equilibrium. Subjects with the T allele presented higher left ventricular mass/height2.7 than those carrying the CC genotype in Campinas (76.8 ± 1.6 vs 70.9 ± 1.4 g/m2.7; p = 0.009, and in Vitória (45.6 ± 1.9 vs 39.9 ± 1.4 g/m2.7; p = 0.023 samples. These results were confirmed by stepwise regression analyses adjusted for age, gender, blood pressure, metabolic variables and use of anti-hypertensive medications. In addition, increased NADPH-oxidase activity was detected in peripheral mononuclear cells from T allele carriers compared with CC genotype carriers (p = 0.03. Conclusions The T allele of the p22-phox C242T polymorphism is associated with higher left ventricular mass/height2.7 and increased NADPH-oxidase activity in Brazilian hypertensive patients. These data suggest that genetic variation within NADPH-oxidase components may modulate left ventricular remodeling in subjects with systemic hypertension.

  4. Surface Properties of Wild-Type Rhizobium leguminosarum bv. trifolii Strain 24.2 and Its Derivatives with Different Extracellular Polysaccharide Content.

    Directory of Open Access Journals (Sweden)

    Jolanta Cieśla

    Full Text Available Rhizobium leguminosarum bv. trifolii is a soil bacterium able to establish symbiosis with agriculturally important legumes, i.e., clover plants (Trifolium spp.. Cell surface properties of rhizobia play an essential role in their interaction with both biotic and abiotic surfaces. Physicochemical properties of bacterial cells are underpinned by the chemical composition of their envelope surrounding the cells, and depend on various environmental conditions. In this study, we performed a comprehensive characterization of cell surface properties of a wild-type R. leguminosarum bv. trifolii strain 24.2 and its derivatives producing various levels of exopolysaccharide (EPS, namely, pssA mutant Rt5819 deficient in EPS synthesis, rosR mutant Rt2472 producing diminished amounts of this polysaccharide, and two EPS-overproducing strains, Rt24.2(pBA1 and Rt24.2(pBR1, under different growth conditions (medium type, bacterial culture age, cell viability, and pH. We established that EPS plays an essential role in the electrophoretic mobility of rhizobial cells, and that higher amounts of EPS produced resulted in greater negative electrophoretic mobility and higher acidity (lower pKapp,av of the bacterial cell surface. From the tested strains, the electrophoretic mobility was lowest in EPS-deficient pssA mutant. Moreover, EPS produced by rhizobial strains resulted not only in an increase of negative surface charge but also in increased hydrophobicity of bacterial cell surface. This was determined by measurements of water contact angle, surface free energy, and free energy of bacterial surface-water-bacterial surface interaction. Electrophoretic mobility of the studied strains was also affected by the structure of the bacterial population (i.e., live/dead cell ratio, medium composition (ionic strength and mono- and divalent cation concentrations, and pH.

  5. New measurement of the 242Pu(n,γ) cross section at n_TOF-EAR1 for MOX fuels: Preliminary results in the RRR

    Science.gov (United States)

    Lerendegui-Marco, J.; Guerrero, C.; Cortés-Giraldo, M. A.; Quesada, J. M.; Mendoza, E.; Cano-Ott, D.; Eberhardt, K.; Junghans, A.; Aberle, O.; Andrzejewski, J.; Audouin, L.; Bacak, M.; Balibrea, J.; Barbagallo, M.; Bečvář, F.; Berthoumieux, E.; Billowes, J.; Bosnar, D.; Brown, A.; Caamaño, M.; Calviño, F.; Calviani, M.; Cardella, R.; Casanovas, A.; Cerutti, F.; Chen, Y. H.; Chiaveri, E.; Colonna, N.; Cortés, G.; Cosentino, L.; Damone, L. A.; Diakaki, M.; Domingo-Pardo, C.; Dressler, R.; Dupont, E.; Durán, I.; Fernández-Domínguez, B.; Ferrari, A.; Ferreira, P.; Finocchiaro, P.; Göbel, K.; Gómez-Hornillos, M. B.; García, A. R.; Gawlik, A.; Gilardoni, S.; Glodariu, T.; Gonçalves, I. F.; González, E.; Griesmayer, E.; Gunsing, F.; Harada, H.; Heinitz, S.; Heyse, J.; Jenkins, D. G.; Jericha, E.; Käppeler, F.; Kadi, Y.; Kalamara, A.; Kavrigin, P.; Kimura, A.; Kivel, N.; Kokkoris, M.; Krtička, M.; Kurtulgil, D.; Leal-Cidoncha, E.; Lederer, C.; Leeb, H.; Meo, S. Lo; Lonsdale, S. J.; Macina, D.; Marganiec, J.; Martínez, T.; Masi, A.; Massimi, C.; Mastinu, P.; Mastromarco, M.; Maugeri, E. A.; Mazzone, A.; Mengoni, A.; Milazzo, P. M.; Mingrone, F.; Musumarra, A.; Negret, A.; Nolte, R.; Oprea, A.; Patronis, N.; Pavlik, A.; Perkowski, J.; Porras, I.; Praena, J.; Radeck, D.; Rauscher, T.; Reifarth, R.; Rout, P. C.; Rubbia, C.; Ryan, J. A.; Sabaté-Gilarte, M.; Saxena, A.; Schillebeeckx, P.; Schumann, D.; Smith, A. G.; Sosnin, N. V.; Stamatopoulos, A.; Tagliente, G.; Tain, J. L.; Tarifeño-Saldivia, A.; Tassan-Got, L.; Valenta, S.; Vannini, G.; Variale, V.; Vaz, P.; Ventura, A.; Vlachoudis, V.; Vlastou, R.; Wallner, A.; Warren, S.; Woods, P. J.; Wright, T.; Žugec, P.

    2017-09-01

    The spent fuel of current nuclear reactors contains fissile plutonium isotopes that can be combined with 238U to make mixed oxide (MOX) fuel. In this way the Pu from spent fuel is used in a new reactor cycle, contributing to the long-term sustainability of nuclear energy. The use of MOX fuels in thermal and fast reactors requires accurate capture and fission cross sections. For the particular case of 242Pu, the previous neutron capture cross section measurements were made in the 70's, providing an uncertainty of about 35% in the keV region. In this context, the Nuclear Energy Agency recommends in its "High Priority Request List" and its report WPEC-26 that the capture cross section of 242Pu should be measured with an accuracy of at least 7-12% in the neutron energy range between 500 eV and 500 keV. This work presents a brief description of the measurement performed at n_TOF-EAR1, the data reduction process and the first ToF capture measurement on this isotope in the last 40 years, providing preliminary individual resonance parameters beyond the current energy limits in the evaluations, as well as a preliminary set of average resonance parameters.

  6. New measurement of the 242Pu(n,γ cross section at n_TOF-EAR1 for MOX fuels: Preliminary results in the RRR

    Directory of Open Access Journals (Sweden)

    Lerendegui-Marco J.

    2017-01-01

    Full Text Available The spent fuel of current nuclear reactors contains fissile plutonium isotopes that can be combined with 238U to make mixed oxide (MOX fuel. In this way the Pu from spent fuel is used in a new reactor cycle, contributing to the long-term sustainability of nuclear energy. The use of MOX fuels in thermal and fast reactors requires accurate capture and fission cross sections. For the particular case of 242Pu, the previous neutron capture cross section measurements were made in the 70's, providing an uncertainty of about 35% in the keV region. In this context, the Nuclear Energy Agency recommends in its “High Priority Request List” and its report WPEC-26 that the capture cross section of 242Pu should be measured with an accuracy of at least 7–12% in the neutron energy range between 500 eV and 500 keV. This work presents a brief description of the measurement performed at n_TOF-EAR1, the data reduction process and the first ToF capture measurement on this isotope in the last 40 years, providing preliminary individual resonance parameters beyond the current energy limits in the evaluations, as well as a preliminary set of average resonance parameters.

  7. Targeting of mTORC1/2 by the mTOR kinase inhibitor PP242 induces apoptosis in AML cells under conditions mimicking the bone marrow microenvironment

    Science.gov (United States)

    Zeng, Zhihong; Shi, Yue Xi; Tsao, Twee; Qiu, YiHua; Kornblau, Steven M.; Baggerly, Keith A.; Liu, Wenbin; Jessen, Katti; Liu, Yi; Kantarjian, Hagop; Rommel, Christian; Fruman, David A.; Andreeff, Michael

    2012-01-01

    The interactions between the bone marrow (BM) microenvironment and acute myeloid leukemia (AML) is known to promote survival of AML cells. In this study, we used reverse phase-protein array (RPPA) technology to measure changes in multiple proteins induced by stroma in leukemic cells. We then investigated the potential of an mTOR kinase inhibitor, PP242, to disrupt leukemia/stroma interactions, and examined the effects of PP242 in vivo using a mouse model. Using RPPA, we confirmed that multiple survival signaling pathways, including the phosphatidylinositol 3-kinase (PI3K)/protein kinase B (AKT)/mammalian target of rapamycin (mTOR), were up-regulated in primary AML cells cocultured with stroma. PP242 effectively induced apoptosis in primary samples cultured with or without stroma. Mechanistically, PP242 attenuated the activities of mTORC1 and mTORC2, sequentially inhibited phosphorylated AKT, S6K, and 4EBP1, and concurrently suppressed chemokine receptor CXCR4 expression in primary leukemic cells and in stromal cells cultured alone or cocultured with leukemic cells. In the in vivo leukemia mouse model, PP242 inhibited mTOR signaling in leukemic cells and demonstrated a greater antileukemia effect than rapamycin. Our findings indicate that disrupting mTOR/AKT signaling with a selective mTOR kinase inhibitor can effectively target leukemic cells within the BM microenvironment. PMID:22826565

  8. Automated absolute activation analysis with californium-252 sources

    Energy Technology Data Exchange (ETDEWEB)

    MacMurdo, K.W.; Bowman, W.W.

    1978-09-01

    A 100-mg /sup 252/Cf neutron activation analysis facility is used routinely at the Savannah River Laboratory for multielement analysis of many solid and liquid samples. An absolute analysis technique converts counting data directly to elemental concentration without the use of classical comparative standards and flux monitors. With the totally automated pneumatic sample transfer system, cyclic irradiation-decay-count regimes can be pre-selected for up to 40 samples, and samples can be analyzed with the facility unattended. An automatic data control system starts and stops a high-resolution gamma-ray spectrometer and/or a delayed-neutron detector; the system also stores data and controls output modes. Gamma ray data are reduced by three main programs in the IBM 360/195 computer: the 4096-channel spectrum and pertinent experimental timing, counting, and sample data are stored on magnetic tape; the spectrum is then reduced to a list of significant photopeak energies, integrated areas, and their associated statistical errors; and the third program assigns gamma ray photopeaks to the appropriate neutron activation product(s) by comparing photopeak energies to tabulated gamma ray energies. Photopeak areas are then converted to elemental concentration by using experimental timing and sample data, calculated elemental neutron capture rates, absolute detector efficiencies, and absolute spectroscopic decay data. Calculational procedures have been developed so that fissile material can be analyzed by cyclic neutron activation and delayed-neutron counting procedures. These calculations are based on a 6 half-life group model of delayed neutron emission; calculations include corrections for delayed neutron interference from /sup 17/O. Detection sensitivities of < or = 400 ppB for natural uranium and 8 ppB (< or = 0.5 (nCi/g)) for /sup 239/Pu were demonstrated with 15-g samples at a throughput of up to 140 per day. Over 40 elements can be detected at the sub-ppM level.

  9. Metastable charge-transfer state of californium(iii) compounds.

    Science.gov (United States)

    Liu, Guokui; Cary, Samantha K; Albrecht-Schmitt, Thomas E

    2015-06-28

    Among a series of anomalous physical and chemical properties of Cf(iii) compounds revealed by recent investigations, the present work addresses the characteristics of the optical spectra of An(HDPA)3·H2O (An = Am, Cm, and Cf), especially the broadband photoluminescence from Cf(HDPA)3·H2O induced by ligand-to-metal charge transfer (CT). As a result of strong ion-ligand interactions and the relative ease of reducing Cf(iii) to Cf(ii), a CT transition occurs at low energy (transfer state undergoes radiative and non-radiative relaxations. Broadening of the CT transition arises from strong vibronic coupling and hole-charge interactions in the valence band. The non-radiative relaxation of the metastable CT state results from a competition between phonon-relaxation and thermal tunneling that populates the excited states of Cf(iii).

  10. Performance Characterization of Loctite (Registered Trademark) 242 and 271 Liquid Locking Compounds (LLCs) as a Secondary Locking Feature for International Space Station (ISS) Fasteners

    Science.gov (United States)

    Dube, Michael J.; Gamwell, Wayne R.

    2011-01-01

    Several International Space Station (ISS) hardware components use Loctite (and other polymer based liquid locking compounds (LLCs)) as a means of meeting the secondary (redundant) locking feature requirement for fasteners. The primary locking method is the fastener preload, with the application of the Loctite compound which when cured is intended to resist preload reduction. The reliability of these compounds has been questioned due to a number of failures during ground testing. The ISS Program Manager requested the NASA Engineering and Safety Center (NESC) to characterize and quantify sensitivities of Loctite being used as a secondary locking feature. The findings and recommendations provided in this investigation apply to the anaerobic LLCs Loctite 242 and 271. No other anaerobic LLCs were evaluated for this investigation. This document contains the findings and recommendations of the NESC investigation

  11. RELAP5-3D Developmental Assessment: Comparison of Versions 4.0.3is and 2.4.2is

    Energy Technology Data Exchange (ETDEWEB)

    Paul D. Bayless

    2012-09-01

    Figures have been generated comparing the parameters used in the developmental assessment of the RELAP5-3D code using versions 4.0.3is and 2.4.2is. The figures, which are the same as those used in Volume III of the RELAP5-3D code manual, compare calculations using the semi-implicit solution scheme with available experiment data. These figures provide a quick, visual indication of how the code predictions changed between these two code versions and can be used to identify cases in which the assessment judgment may need to be changed in Volume III of the code manual. Changes to the assessment judgments made after reviewing all of the assessment cases are also provided.

  12. Method for Determination of Neptunium in Large-Sized Urine Samples Using Manganese Dioxide Coprecipitation and 242Pu as Yield Tracer

    DEFF Research Database (Denmark)

    Qiao, Jixin; Hou, Xiaolin; Roos, Per

    2013-01-01

    A novel method for bioassay of large volumes of human urine samples using manganese dioxide coprecipitation for preconcentration was developed for rapid determination of 237Np. 242Pu was utilized as a nonisotopic tracer to monitor the chemical yield of 237Np. A sequential injection extraction...... to 100% and high separation capacity of processing up to 5 L of human urine samples. The MnO2 coprecipitation process is simple and straightforward in which a batch (8–12) of samples can be pretreated within 4 h (i.e., sample). In connection with the automated column separation and ICPMS...... quantification, which takes less than 1.5 h in total, the overall analytical time was on average less than 2 h for each sample. The high effectiveness and sample throughput make the developed method well suited for urine bioassay of 237Np in routine monitoring of occupationally internal radiation exposure...

  13. GSE4, a Small Dyskerin- and GSE24.2-Related Peptide, Induces Telomerase Activity, Cell Proliferation and Reduces DNA Damage, Oxidative Stress and Cell Senescence in Dyskerin Mutant Cells.

    Science.gov (United States)

    Iarriccio, Laura; Manguán-García, Cristina; Pintado-Berninches, Laura; Mancheño, José Miguel; Molina, Antonio; Perona, Rosario; Sastre, Leandro

    2015-01-01

    Dyskeratosis congenita is an inherited disease caused by mutations in genes coding for telomeric components. It was previously reported that expression of a dyskerin-derived peptide, GSE24.2, increases telomerase activity, regulates gene expression and decreases DNA damage and oxidative stress in dyskeratosis congenita patient cells. The biological activity of short peptides derived from GSE24.2 was tested and one of them, GSE4, that probed to be active, was further characterized in this article. Expression of this eleven amino acids long peptide increased telomerase activity and reduced DNA damage, oxidative stress and cell senescence in dyskerin-mutated cells. GSE4 expression also activated c-myc and TERT promoters and increase of c-myc, TERT and TERC expression. The level of biological activity of GSE4 was similar to that obtained by GSE24.2 expression. Incorporation of a dyskerin nuclear localization signal to GSE24.2 did not change its activity on promoter regulation and DNA damage protection. However, incorporation of a signal that increases the rate of nucleolar localization impaired GSE24.2 activity. Incorporation of the dyskerin nuclear localization signal to GSE4 did not alter its biological activity. Mutation of the Aspartic Acid residue that is conserved in the pseudouridine synthase domain present in GSE4 did not impair its activity, except for the repression of c-myc promoter activity and the decrease of c-myc, TERT and TERC gene expression in dyskerin-mutated cells. These results indicated that GSE4 could be of great therapeutic interest for treatment of dyskeratosis congenita patients.

  14. Method for determination of neptunium in large-sized urine samples using manganese dioxide coprecipitation and 242Pu as yield tracer.

    Science.gov (United States)

    Qiao, Jixin; Hou, Xiaolin; Roos, Per

    2013-02-05

    A novel method for bioassay of large volumes of human urine samples using manganese dioxide coprecipitation for preconcentration was developed for rapid determination of (237)Np. (242)Pu was utilized as a nonisotopic tracer to monitor the chemical yield of (237)Np. A sequential injection extraction chromatographic (SI-EC) system coupled with inductively coupled plasma mass spectrometry (ICPMS) was exploited to facilitate the rapid column separation and quantification. The analytical results demonstrated satisfactory performance of the MnO(2) coprecipitation as indicated by the high chemical yields close to 100% and high separation capacity of processing up to 5 L of human urine samples. The MnO(2) coprecipitation process is simple and straightforward in which a batch (8-12) of samples can be pretreated within 4 h (i.e., <0.5 h/sample). In connection with the automated column separation and ICPMS quantification, which takes less than 1.5 h in total, the overall analytical time was on average less than 2 h for each sample. The high effectiveness and sample throughput make the developed method well suited for urine bioassay of (237)Np in routine monitoring of occupationally internal radiation exposure and rapid analysis of neptunium contamination level for emergency preparedness.

  15. Computational Thermodynamic Modeling of Hot Corrosion of Alloys Haynes 242 and HastelloyTM N for Molten Salt Service in Advanced High Temperature Reactors

    Energy Technology Data Exchange (ETDEWEB)

    V. Glazoff, Michael; Charit, Indrajt; Sabharwall, Piyush

    2014-09-17

    An evaluation of thermodynamic aspects of hot corrosion of the superalloys Haynes 242 and HastelloyTM N in the eutectic mixtures of KF and ZrF4 is carried out for development of Advanced High Temperature Reactor (AHTR). This work models the behavior of several superalloys, potential candidates for the AHTR, using computational thermodynamics tool (ThermoCalc), leading to the development of thermodynamic description of the molten salt eutectic mixtures, and on that basis, mechanistic prediction of hot corrosion. The results from these studies indicated that the principal mechanism of hot corrosion was associated with chromium leaching for all of the superalloys described above. However, HastelloyTM N displayed the best hot corrosion performance. This was not surprising given it was developed originally to withstand the harsh conditions of molten salt environment. However, the results obtained in this study provided confidence in the employed methods of computational thermodynamics and could be further used for future alloy design efforts. Finally, several potential solutions to mitigate hot corrosion were proposed for further exploration, including coating development and controlled scaling of intermediate compounds in the KF-ZrF4 system.

  16. Hypoxia Enhances the Toxicity of Corexit EC9500A and Chemically Dispersed Southern Louisiana Sweet Crude Oil (MC-242) to Sheepshead Minnow (Cyprinodon variegatus) Larvae.

    Science.gov (United States)

    Dasgupta, Subham; Huang, Irvin J; McElroy, Anne E

    2015-01-01

    Oil exploration and production activities are common in the northern Gulf of Mexico as well as many other coastal and near coastal areas worldwide. Seasonal hypoxia is also a common feature in the Northern Gulf, and many other coastal areas, which is likely to increase in severity and extent with continuing anthropogenic nutrient inputs. Hypoxia has well established physiological effects on many organisms, and it has been shown to enhance the toxicity of polycyclic aromatic hydrocarbons (persistent components of petroleum) in fish. The goal of this study was to examine the combined effects of hypoxia and exposure to contaminants associated with oil spills. We evaluated the effects of short term (48 hr) exposures to Corexit EC9500A, water accommodated fractions (WAF), and chemically enhanced water accommodated fractions (CEWAF) prepared from Southern Louisiana Sweet Crude Oil (MC 242) on survival of sheepshead minnow (Cyprinodon variegatus) larvae held under normoxic (ambient air) or hypoxic (2 mg/L O2) conditions. Results demonstrated that hypoxia significantly enhances mortality observed in response to Corexit or CEWAF solutions. In the latter case, significant interactions between the two stressors were also observed. Our data supports the need to further evaluate the combined stresses imparted by hypoxia and exposure to petroleum hydrocarbons and dispersants.

  17. Hypoxia Enhances the Toxicity of Corexit EC9500A and Chemically Dispersed Southern Louisiana Sweet Crude Oil (MC-242 to Sheepshead Minnow (Cyprinodon variegatus Larvae.

    Directory of Open Access Journals (Sweden)

    Subham Dasgupta

    Full Text Available Oil exploration and production activities are common in the northern Gulf of Mexico as well as many other coastal and near coastal areas worldwide. Seasonal hypoxia is also a common feature in the Northern Gulf, and many other coastal areas, which is likely to increase in severity and extent with continuing anthropogenic nutrient inputs. Hypoxia has well established physiological effects on many organisms, and it has been shown to enhance the toxicity of polycyclic aromatic hydrocarbons (persistent components of petroleum in fish. The goal of this study was to examine the combined effects of hypoxia and exposure to contaminants associated with oil spills. We evaluated the effects of short term (48 hr exposures to Corexit EC9500A, water accommodated fractions (WAF, and chemically enhanced water accommodated fractions (CEWAF prepared from Southern Louisiana Sweet Crude Oil (MC 242 on survival of sheepshead minnow (Cyprinodon variegatus larvae held under normoxic (ambient air or hypoxic (2 mg/L O2 conditions. Results demonstrated that hypoxia significantly enhances mortality observed in response to Corexit or CEWAF solutions. In the latter case, significant interactions between the two stressors were also observed. Our data supports the need to further evaluate the combined stresses imparted by hypoxia and exposure to petroleum hydrocarbons and dispersants.

  18. Complex chromosomal rearrangement in a girl with psychomotor-retardation and a de novo inversion: inv(2)(p15;q24.2).

    Science.gov (United States)

    Granot-Hershkovitz, Einat; Raas-Rothschild, Annick; Frumkin, Ayala; Granot, David; Silverstein, Shira; Abeliovich, Dvorah

    2011-08-01

    Cytogenetic analysis of DNA from a girl with severe psychomotor retardation revealed a de novo pericentric inversion of chromosome 2: 46,XX,inv(2)(p15q24.2). In order to elucidate the possible role of the inversion in the girl's abnormal phenotype, we analyzed the inversion breakpoints. FISH analysis revealed BAC clones spanning the breakpoints at 2p and 2q of the inversion. Southern blot hybridization with DNA probes from the BAC regions was used to refine the localization of the breakpoints, followed by inverse-PCR which enabled us to sequence the inversion breakpoints. We found a complex chromosomal rearrangement, including five breakpoints, four at 2q and one at 2p joined with minor insertions/deletions of a few bases. The breakpoint at 2p was within the NRXN1 gene that has previously been associated with autism, intellectual disabilities, and psychiatric disorders. In 2q, the breakpoints disrupted two genes, TANC1 and RBMS1; the phenotypic effect of these genes is not currently known. Copyright © 2011 Wiley-Liss, Inc.

  19. A new case of de novo 6q24.2-q25.2 deletion on paternal chromosome 6 with growth hormone deficiency: a twelve-year follow-up and literature review.

    Science.gov (United States)

    Stagi, Stefano; Lapi, Elisabetta; Pantaleo, Marilena; Carella, Massimo; Petracca, Antonio; De Crescenzo, Agostina; Zelante, Leopoldo; Riccio, Andrea; de Martino, Maurizio

    2015-08-23

    Deletions on the distal portion of the long arm of chromosome 6 are relatively uncommon, and only a small number occurs in the paternal copy, causing growth abnormalities. As a result, extensive clinical descriptions are lacking. We describe a male of Italian descent born at 35 weeks by elective caesarean delivery presenting hypoplastic left colon, bilateral inguinal hernia, dysplastic tricuspid and pulmonary valves, premature ventricular contractions, recurrent otitis media, poor feeding, gastro-oesophageal reflux, bilateral pseudopapilledema, and astigmatism. He also showed particular facial dysmorphisms and postnatal growth failure. Early psychomotor development was mildly delayed. At 3.75 years, he was evaluated for severe short stature (-2.98 SD) and delayed bone age. He showed an insulin-like growth factor 1 concentration (IGF-1) in the low-normal range. Growth hormone stimulation tests showed a low response to clonidine and insulin. Magnetic resonance imaging showed hypophyseal hypoplasia. Genetic evaluation by Single Nucleotide Polymorphism arrays showed a de novo 6q24.2-q25.2 deletion on paternal chromosome 6. We confirm that this is a new congenital malformation syndrome associated with a deletion of 6q24.2-q25.2 on paternal chromosome 6. We suggest evaluating the growth hormone axis in children with 6q24.2-q25.2 deletions and growth failure.

  20. SALINITY, WATER TEMPERATURE, FLUORESCENCE, PHOTOSYNTHETIC ACTIVE RADIATION (PAR) and other profile data collected in the Gulf of Alaska on the ALPHA HELIX cruises HX242, HX244 and others as part of the NEP project from 2001-04-18 to 2003-08-11 (NODC Accession 0115255)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NODC Accession 0115255 includes profile, biological and physical data collected aboard the ALPHA HELIX during cruises HX242, HX244, HX247, HX271 and HX275 in the...

  1. SILICATE, WATER TEMPERATURE, FLUORESCENCE, PHOTOSYNTHETIC ACTIVE RADIATION (PAR) and other profile and discrete sample data collected in the Gulf of Alaska on the ALPHA HELIX cruises HX242, HX244 and others as part of the NEP project from 2001-04-18 to 2003-08-11 (NODC Accession 0113348)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NODC Accession 0113348 includes profile, discrete sample, biological, chemical and physical data collected aboard the ALPHA HELIX during cruises HX242, HX244, HX247,...

  2. CHLOROPHYLL A, growth rate and graze rate (or grazing rate) site samples data collected in the Gulf of Alaska on the ALPHA HELIX cruises HX242, HX244 and others as part of the NEP project from 2001-04-18 to 2003-08-10 (NODC Accession 0114241)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NODC Accession 0114241 includes site samples and biological data collected aboard the ALPHA HELIX during cruises HX242, HX244, HX247, HX271 and HX275 in the Gulf of...

  3. 242 EAST AFRICAN MEDICAL JOURNAL

    African Journals Online (AJOL)

    2002-05-05

    May 5, 2002 ... methodologies in settings with high disease prevalence. INTRODUCTION .... Subspecics Oxygen Growth on TCH Cyclo» PZA Nitrate preference pyruvate/ serine reduction gycerol. Classical A P=G R S S. Asian A PIG S S S. Africanum I M ..... in HIV-infected and uninfected adults in Uganda: application of a.

  4. SAJP-24(2) FIN

    African Journals Online (AJOL)

    Danie Strauss

    This prem ise can how ever be ques tioned. I aim to show that it is at the very least an un clear and con tro ver sial mat - ter, whether we would want to deny that in di vidu als who lack com mit ments – or even the po ten tial to form com mit ments – to prac ti cal rea son or so cia bil ity are hu man be - ings. This con tro versy is ...

  5. Measurement of the Neutron Capture Cross Sections of $^{233}$U, $^{237}$Np, $^{240,242}$Pu, $^{241,243}$Am and $^{245}$Cm with a Total Absorption Calorimeter at n_TOF

    CERN Multimedia

    Beer, H; Wiescher, M; Cox, J; Rapp, W; Embid, M; Dababneh, S

    2002-01-01

    Accurate and reliable neutron capture cross section data for actinides are necessary for the poper design, safety regulation and precise performance assessment of transmutation devices such as Fast Critical Reactors or Accelerator Driven Systems (ADS). The goal of this proposal is the measurement of the neutron capture cross sections of $^{233}$U, $^{237}$Np, $^{240,242}$Pu, $^{241,243}$Am and $^{245}$Cm at n_TOF with an accuracy of 5~\\%. $^{233}$U plays an essential role in the Th fuel cycle, which has been proposed as a safer and cleaner alternative to the U fuel cycle. The capture cross sections of $^{237}$Np,$^{240,242}$Pu, $^{241,243}$Am and $^{245}$Cm play a key role in the design and optimization of a strategy for the Nuclear Waste Transmutation. A high accuracy can be achieved at n_TOF in such measurements due to a combination of features unique in the world: high instantaneous neutron fluence and excellent energy resolution of the facility, innovative Data Acquisition System based on flash ADCs and t...

  6. Microwave-Assisted Solution Phase Synthesis of Novel 2-{4-[2-(N-Methyl-2-pyridylaminoethoxy]phenyl}-5-Substituted 1,3,4-Oxadiazole  Library

    Directory of Open Access Journals (Sweden)

    Santosh L. Gaonkar

    2011-01-01

    Full Text Available A new series of 2-{4-[2-(N-methyl-2-pyridylaminoethoxy]phenyl}-5-substituted 1,3,4-oxadiazoles were synthesized by the oxidative cyclization of hydrazones derived from 4-[2-(methylpyridin-2-ylaminoethoxy]benzaldehyde and aryl hydrazines using chloramine-T as an efficient catalyst. All steps were assisted by microwave irradiation. Microwave enables all these reactions to be simple, rapid, high yielding, and avoid chromatograph purification and led environmentally benign total synthesis of focused oxadiazole library. All the synthesized compounds were isolated in good yield and characterized by 1H NMR, 13C NMR, and elemental analyses. The title compounds represent a novel class of biologically active heterocycles.

  7. Subtle familial translocation t(11;22)(q24.2;q13.33) resulting in Jacobsen syndrome and distal trisomy 22q13.3: further details of genotype-phenotype maps.

    Science.gov (United States)

    Jamsheer, Aleksander; Smyk, Marta; Wierzba, Jolanta; Kołowska, Jolanta; Woźniak, Anna; Skołozdrzy, Joanna; Fischer, Maria; Latos-Bieleńska, Anna

    2008-01-01

    We report on 3 kindred patients with terminal 11q monosomy and distal 22q trisomy involving the SHANK3 gene, resulting from a subtle familial translocation t(11;22)(q24.2;q13.33). The patients presented with the characteristic symptoms of Jacobsen syndrome (JBS), including: mental retardation, short stature, and craniofacial dysmorphism in all 3 cases; cardiac defects in 2 cases; and thrombocytopenia, brain abnormality, eye coloboma, recurrent infections, cryptorchidism and toe anomalies in single cases. The oldest patient also had Hashimoto disease and diabetes mellitus type 2. So far, these 2 conditions have not been reported in adult patients with JBS. Features typical for distal 22q trisomy in our patients include muscular hypotonia and prenatal failure to thrive, seen in 2 and 1 cases, respectively. We also present a family member with 11q24.2-qter trisomy and 22q13.33-qter monosomy, whose clinical phenotype is partially overlapping with several dysmorphic features of JBS. In addition, multiple pregnancy losses and infantile deaths occurred in this family, suggesting that these chromosomal imbalances may produce a lethal phenotype. FISH with a panel of BAC probes determined the accurate sizes of the deletion 11q (9.9 Mb) and trisomy 22q (0.8 Mb). To date, only 5 cases of submicroscopic 22q13.3-qter trisomy have been reported. A detailed clinical description of our patients, along with a precise cytogenetic designation of chromosomal breakpoints, allow further refinement of genotype-phenotype correlation for distal imbalances in 11q and 22q.

  8. Further delineation of the phenotype maps for partial trisomy 16q24 and Jacobsen syndrome by a subtle familial translocation t(11;16)(q24.2;q24.1).

    Science.gov (United States)

    Zahn, Susanne; Ehrbrecht, Antje; Bosse, Kristin; Kalscheuer, Vera; Propping, Peter; Schwanitz, Gesa; Albrecht, Beate; Engels, Hartmut

    2005-11-15

    We report on two cases of distal monosomy 11q and partial trisomy 16q due to a familial subtle translocation detected by FISH subtelomere screening. Exact breakpoint analyses by FISH with panels of BAC probes demonstrated a 9.3-9.5 megabase partial monosomy of 11q24.2-qter and a 4.9-5.4 megabase partial trisomy of 16q24.1-qter. The index patient displayed craniofacial dysmorphisms, mild mental retardation and postnatal growth retardation, muscular hypotonia, mild periventricular leukodystrophy, patent ductus arteriosus, thrombocytopenia, recurrent infections, inguinal hernia, cryptorchidism, pes equinovarus, and hearing deficiencies. In his mother's cousin who bears the identical unbalanced translocation, mild mental retardation, patent ductus arteriosus, hypogammaglobulinemia, recurrent infections, unilateral kidney hypoplasia, pes equinovarus, and hearing deficiencies were reported. Since only four descriptions of cryptic or subtle partial trisomies 16q have been published to date, our patients contribute greatly to the delineation of the phenotype of this genomic imbalance. In contrast to this, terminal deletions of the long arm of chromosome 11 cause a haploinsufficiency disorder (Jacobsen syndrome) in which karyotype-phenotype correlations are already being established. Here, our findings contribute to the refinement of a phenotype map for several Jacobsen syndrome features including abnormal brain imaging, renal malformations, thrombocytopenia/pancytopenia, inguinal hernia, testicular ectopy, pes equinovarus, and hearing deficiency.

  9. Neutron Protection Factor Determination and Validation for a Vehicle Surrogate Using a Californium Fission Source

    Science.gov (United States)

    2017-06-01

    a 4 mm x 4 mm (0.157" x 0.157") LiI(Eu) crystal with 96% enrichment of lithium -6. The crystal is connected to a photomultiplier tube (PMT) which...32 Figure 17. Lithium -6 Iodide, Europium Doped Scintillation Detector. Source: [27...Alamos National Laboratory LiI(Eu) Lithium Iodide Europium Doped LLD Low Level Discriminator LLNL Lawrence Livermore National Laboratory MASH Monte

  10. Prevalência e padrão de distribuição das doenças cerebrovasculares em 242 idosos, procedentes de um hospital geral, necropsiados em Belo Horizonte, Minas Gerais, no período de 1976 a 1997 Prevalence and types of cerebrovascular diseases in 242 hospitalized elderly patients, autopsied in Belo Horizonte, Minas Gerais, Brazil, from 1976 to 1997

    Directory of Open Access Journals (Sweden)

    José Eymard H. Pittella

    2002-03-01

    Full Text Available OBJETIVO: Descrever a prevalência e os tipos das doenças cerebrovasculares (DCVs em indivíduos idosos necropsiados. MÉTODO: Foram consultados os laudos neuropatológicos de 242 pacientes com idade igual ou superior a 61 anos, procedentes em sua maioria do Hospital das Clínicas da Universidade Federal de Minas Gerais, em Belo Horizonte, Minas Gerais, e necropsiados consecutivamente no período 1976 a 1997. RESULTADO: Os principais grupos de doenças do sistema nervoso central (SNC foram representados por DCVs (71,9%, infecções (12,4%, neoplasias (7,1%, traumatismos crânio-encefálicos (3,7%, doenças nutricionais (2,5% e doenças degenerativas (1,7%. As DCVs mais frequentes foram: aterosclerose (61,2%, doença cerebrovascular hipertensiva (25,6% e infarto cerebral (14,9%. Observou-se aumento da frequência e da gravidade da aterosclerose e da frequência da doença cerebrovascular hipertensiva com o avançar da idade. Houve associação significativa entre doença cerebrovascular hipertensiva e aterosclerose. As DCVs foram clinicamente sintomáticas e as responsáveis diretas pelo óbito em 42,7% e 17,3% dos pacientes, respectivamente. CONCLUSÃO: As DCVs constituíram o principal grupo de doenças do SNC no idoso. A aterosclerose e a doença cerebrovascular hipertensiva foram as principais doenças deste grupo, notando-se aumento de sua frequência com o avançar da idade e associação significativa entre ambas.OBJECTIVE: To describe the prevalence and the types of cerebrovascular diseases (CVDs in autopsied elderly individuals. METHOD: Consecutive clinical charts and neuropathological reports of 242 patients aged 61 years or older were reviewed. The patients died in Hospital das Clínicas, Federal University of Minas Gerais, in Belo Horizonte, Minas Gerais, Brazil, from 1976 to 1997. RESULTS: The prevalent diseases of the central nervous system (CNS found in decreasing order were: CVDs (71.9%, infections (12.4%, neoplasms (7.1%, head

  11. Reference: 242 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available ional mutants of RCI2A were identified. Although the growth of rci2a mutants was comparable with that of wil...he growth reduction was comparable between wild-type and rci2a plants. These results suggested that RCI2A pl...owth than wild type. Under treatments of tetramethylammonium chloride, CaCl2, MgCl2, mannitol or sorbitol, t

  12. 48 CFR 5252.242-9000 - Refunds.

    Science.gov (United States)

    2010-10-01

    ..., accuracy and completeness of, cost or pricing data applicable to the item. (End of clause) ... on price was reached and the contract price. Refunds will not be made to recoup the amount of cost... established catalog or market price, plus the value of any unique requirements, including delivery terms...

  13. 48 CFR 242.002 - Interagency agreements.

    Science.gov (United States)

    2010-10-01

    ... pricing services performed for the Supply and Services Canada. (ii) Departments and agencies may request...-DoD activities, foreign governments, or international organizations, unless otherwise provided by reciprocal agreements. (S-70)(i) Foreign governments and international organizations may request contract...

  14. 17 CFR 242.401 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... in section 3(a)(4) of the Act (15 U.S.C. 78c(a)(4)). (3) Contract multiplier means the number of... published reporting or quotation service, and the applicable contract multiplier. (ii) With respect to a...) Dealer shall have the meaning provided in section 3(a)(5) of the Act (15 U.S.C. 78c(a)(5)). (8) Equity...

  15. 7 CFR 58.242 - Product adulteration.

    Science.gov (United States)

    2010-01-01

    ... Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Standards, Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE (CONTINUED) REGULATIONS AND STANDARDS UNDER THE AGRICULTURAL MARKETING ACT OF 1946 AND THE EGG PRODUCTS INSPECTION ACT (CONTINUED) GRADING AND INSPECTION...

  16. 24 CFR 242.1 - Definitions.

    Science.gov (United States)

    2010-04-01

    ...: Interlocking management or ownership, identity of interests among family members, shared facilities and... for inpatient medical care of the sick or injured (including obstetrical care); (2) Where not more... of chronic convalescent and rest, drug and alcoholic, epileptic, mentally deficient, mental, nervous...

  17. 242 EAST AFRICAN MEDICAL JOURNAL May 2001

    African Journals Online (AJOL)

    iodine in the treatment of 359 thyroid cancers. Brit. J. Radiol. 1975; 48:894-907. Hamby, L.S., McGrath, PC. and Schwartz, R.W., et ul. Management of local recurrence in well-differentiated thyroid carcinoma. J. Surg. Research. 1992; 52:1 13-117.

  18. 32 CFR 242b.1 - Regents.

    Science.gov (United States)

    2010-07-01

    ... to conduct the business of the Uniformed Services University of the Health Sciences, and designated this body “the Board of Regents of the Uniformed Services University of the Health Sciences,” referred... PROCEDURES AND DELEGATIONS OF THE BOARD OF REGENTS OF THE UNIFORMED SERVICES UNIVERSITY OF THE HEALTH...

  19. 32 CFR 242.5 - Admission procedures.

    Science.gov (United States)

    2010-07-01

    .... The individual concerned shall initiate the request for approval to apply through appropriate Service... qualified applicants, based on aptitude, intelligence, maturity, personality, emotional stability, diligence... military personnel, if required, shall be performed at the individual's supporting military medical...

  20. 24 CFR 242.16 - Applications.

    Science.gov (United States)

    2010-04-01

    ... application must address and which HUD will review: (i) Current and projected gains from operations and a... mix, market trends, population forecasts, and business climate; (v) The hospital's demonstrated... demonstrated ability to operate effectively and efficiently, and to develop effective strategies for addressing...

  1. 17 CFR 242.300 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... § 240.3a11-1 of this chapter, as well as non-participatory preferred stock. (e) Order means any firm... or indirectly, to direct the management or policies of an alternative trading system, whether through...

  2. Publications | Page 242 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Who pays? municipal services in South Africa. When South Africans discarded apartheid in the heady days of 1994, they showed they could face one of the world's great problems. Now, they're dealing with another — inequitable water, electricity, and waste disposal services. If this.

  3. 19 CFR 10.242 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... all similar articles, by whatever name known, customarily carried by women or girls). The term..., starting with the extrusion of filament, strip, film, or sheet and including drawing to fully orient a filament or slitting a film or sheet into strip, or the spinning of all fibers into yarn, or both, and...

  4. 242-IJBCS-Article-H T Avohou

    African Journals Online (AJOL)

    RHUMSIKI

    2005; Bladé et Vallejo, 2008; Du et Huang,. 2008). Un autre processus par lequel le prétraitement pourrait influer sur le développement des plantules est le raccourcissement du temps d'émergence de la plantule par élimination des possibles obstacles mécaniques au développement de la plantule (Du et Huang, 2008).

  5. 32 CFR 242.4 - Policies.

    Science.gov (United States)

    2010-07-01

    ... character; (5) Meet the physical qualifications and security requirements for a Regular commission in the... serve on active duty as Reserve commissioned officers (Medical Officer Candidates), pay grade O-1, in... Departments, based on projected end strengths of the individual Medical Corps at time of graduation. Students...

  6. 36 CFR 242.4 - Definitions.

    Science.gov (United States)

    2010-07-01

    ...; minimizes the likelihood of irreversible or long-term adverse effects upon such populations and species... 5 U.S.C. Appendix II, 1-15). Family means all persons related by blood, marriage, or adoption or any...

  7. 24 CFR 242.10 - Eligible mortgagors.

    Science.gov (United States)

    2010-04-01

    ... be a public mortgagor (i.e., an owner of a public facility), a private nonprofit corporation or... liability corporations and companies, but may not include natural persons, joint ventures, and general...

  8. TMFunction data: 242 [TMFunction[Archive

    Lifescience Database Archive (English)

    Full Text Available D917N ... YES Ligand binding ... Low density lipoprotein receptor Homo sapiens Human Andersen OM, Christense...n LL, Christensen PA, S?rensen ES, Jacobsen C, Moestrup SK, Etzerodt M, Thogersen HC. J

  9. 48 CFR 242.771-3 - Responsibilities.

    Science.gov (United States)

    2010-10-01

    .... (2) Determine whether IR&D/B&P projects performed by major contractors (see 231.205-18(a)) are of... for performing contract administration functions is responsible for providing the Defense Contract... Defense (Acquisition, Technology, and Logistics (OUSD (AT&L))) setting forth required statistical...

  10. Simultaneous measurement of {sup 239}Pu, {sup 240}Pu, {sup 241}Pu, and {sup 242}Pu by high resolution inductively coupled plasma mass spectrometer (HR ICP-MS) in marine sediments; Mesure des isotopes du plutonium des sediments marins par spectrometrie de masse a plasma couple inductivement haute resolution (HR ICP-MS)

    Energy Technology Data Exchange (ETDEWEB)

    Bruneau, F

    1999-07-01

    Transuranics elements are of particular interest in radioecological studies because of their radiotoxicity and their potential use to decipher source fingerprints and transport processes. The simultaneous measurement of {sup 239}Pu, {sup 240}Pu, {sup 241}Pu, and {sup 242}Pu in environmental samples requires a specific chemical procedure. This work deals with an analytical procedure which yields a very high grade of purification of Pu suitable for ultra low level detection by HR ICP-MS, from marine sediments. After the elimination of major elements (Fe, Al, Mg...) by a first chromatographic separation, a new device of purification by solvent extraction and concentration by a second chromatographic separation is used to obtain a concentrated and high purified solution of plutonium. The chemical procedure have been validated on IAEA certified sediment samples and on sediment samples collected in the roads of Cherbourg which had been previously analysed by other techniques (a spectrometry and thermo-ionisation mass spectrometer). (author)

  11. 5mm Ethiop. ]. 5a., 24(2)

    African Journals Online (AJOL)

    Common onion (A. cepa, 2n = 16) is a monocotyledonous plant that belongs ... number of onions. The details of the assay were described by Fiskesjo. (199% and Bakare et al. (1999b). The roots of A. cepa were generated by suspending the bulbs over 50 .... of genotoxic ingredients in the raw leachate was more than in the.

  12. Radiative capture on $^{242}$Pu for MOX fuel reactors

    CERN Multimedia

    The use of MOX fuel (mixed-oxide fuel made of UO$_{2}$ and PuO$_{2}$) in nuclear reactors allows substituting a large fraction of the enriched Uranium by Plutonium reprocessed from spent fuel. Indeed around 66% of the plutonium from spent fuel is made of $^{239}$Pu and $^{241}$Pu, which are fissile in thermal reactors. A typical reactor of this type uses a fuel with 7% reprocessed Pu and 93% depleted U, thus profiting from both the spent fuel and the remaining $^{238}$U following the $^{235}$U enrichment. With the use of such new fuel compositions rich in Pu the better knowledge of the capture and fission cross sections of the Pu isotopes becomes very important. This is clearly stated in the recent OECD NEA’s “High Priority Request List” and in the WPEC-26 “Uncertainty and target accuracy assessment for innovative systems using recent covariance data evaluations” report. In particular, a new series of cross section evaluations have been recently carried out jointly by the European (JEFF) and United ...

  13. 40 CFR 180.242 - Thiabendazole; tolerances for residues.

    Science.gov (United States)

    2010-07-01

    ..., dry, seed 0.1 None Beet, sugar, dried pulp 3.5 12/25/10 Beet, sugar, roots 0.25 12/25/10 Beet, sugar, tops 10.0 12/25/10 Cantaloupe1 15.0 None Carrot, roots, postharvest 10.0 None Citrus, oil 15.0 None Fruit, citrus, group 10, postharvest 10.0 None Fruit, pome, group 11, postharvest 5.0 None Mango 10.0...

  14. Dicty_cDB: AFH242 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CA sequence update 2001. 6. 2 Translated Amino Acid sequence claywvyntvysytsl*rii...r*snsynirslnykwss*nwc*sleelktslpisnklqs Frame C: claywvyntvysytsl*riikknkkkek*vmfmill*ldqvfqv*cvvin*krmdikf*

  15. 242 The Status of Material Resources for Effective Teaching of ...

    African Journals Online (AJOL)

    User

    2011-07-21

    Jul 21, 2011 ... Simple random technique was used in selecting twenty SS3 physics students from each of the sampled schools. This gave a sample size of 1400 SS3 physics students. A researcher-made instrument, ... spring balance, G-clamps, pendulum bobs, mirrors, calorimeters, thermometers, iron weight, corks, ...

  16. Dicty_cDB: SHB242 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available m-c1051 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1051-7762 5' similar ...66 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1066-1230 5' similar to TR:Q9XEU0 Q9XEU0 ZINC-FINGER

  17. Page 1 242 Ethiopian Journal of Environmental Studies ...

    African Journals Online (AJOL)

    USER

    2015-03-17

    Mar 17, 2015 ... Chrysanthemum found in Kenya gives an insecticidal extract, pyrethrum, which is an active ingredient of many insecticides. (Rajapakse and Ratnasekera, 2008). A study on efficacy of plant oils of different plant species against cowpea weevil C. maculatas and bean seed weevil C. cinensis revealed that ...

  18. 17 CFR 242.100 - Preliminary note; definitions.

    Science.gov (United States)

    2010-04-01

    ... market maker (other than as a specialist in compliance with the rules of a national securities exchange... indirect control or influence over the prices or amounts of the securities to be purchased, the timing of... of its allocations to a plan, or any formula specified in a plan that determines the amount or timing...

  19. 36 CFR 242.26 - Subsistence taking of wildlife.

    Science.gov (United States)

    2010-07-01

    ... payment for the use of a bait station, including barter or exchange of goods; (viii) You may not have more... harvest limit in that unit. (2) An animal taken under Federal or State regulations by any member of a... provided for by this part, an animal taken as part of a community harvest limit counts toward every...

  20. PMKER 24(2)\\BAMBA Vamoussa.xps

    African Journals Online (AJOL)

    HP Pro 2000

    sous formes directe et variable. Ainsi, la maîtrise des coûts de production est désormais un enjeu important pour le producteur. (Lafontaine, 2007). Le modèle économique du producteur est fondé sur la maximisation de la fonction d'utilité, qui traduit la préférence de celui- ci. S'il est vrai que beaucoup de facteurs fixes.

  1. 48 CFR 652.242-72 - Shipping Instructions.

    Science.gov (United States)

    2010-10-01

    ... bracing. All nails shall be cement-coated, of correct size and properly spaced to avoid splitting or... dimensions of lumber for struts, frame members, and single diagonal braces Up to 45 kg 19.05 × 57.15mm 46 to...

  2. 48 CFR 1552.242-72 - Financial administrative contracting officer.

    Science.gov (United States)

    2010-10-01

    ...) Negotiate advance agreements applicable to treatment of costs and to Independent Research & Development/Bid and Proposal costs. (3) Negotiate changes to interim billing rates and establish final indirect cost..., allocation and cost charging methodology, timekeeping and labor distribution policies and procedures...

  3. 32 CFR 242b.7 - Officers of the University.

    Science.gov (United States)

    2010-07-01

    ... Academic Affairs for each designated Center will exercise the authority and responsibilities of that... Services University of the Health Sciences academic and investigative/research activities performed within... Academic Affairs will represent the interests of his/her affiliated Medical Center Command within the...

  4. 36 CFR 242.20 - Request for reconsideration.

    Science.gov (United States)

    2010-07-01

    ... Fish and Game (ADFG) for review and recommendation. The Board shall consider any Regional Council and... Board. (c) To file a request for reconsideration, you must notify the Board in writing within sixty (60... reconsideration is requested. (d) It is your responsibility to provide the Board with sufficient narrative...

  5. Dicty_cDB: SSE242 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available dine kinase gene... 125 1e-33 AF163843_1( AF163843 |pid:none) Ectromelia virus thymidine kinase ... 124 2e-3... AF012825_78( AF012825 |pid:none) Ectromelia virus strain Moscow, c... 124 4e-33 AM905441_1( AM905441 |pid:n

  6. 36 CFR 242.3 - Applicability and scope.

    Science.gov (United States)

    2010-07-01

    ... of the Pacific Ocean (Sheliokof Strait) extending 3,000 feet from the shoreline between a point on... together with the adjacent waters of the Bering Sea extending, for Federal Subsistence Management purposes...) Becharof National Wildlife Refuge; (4) Bering Land Bridge National Preserve; (5) Cape Krusenstern National...

  7. 36 CFR 242.24 - Customary and traditional use determinations.

    Science.gov (United States)

    2010-07-01

    ... bounded by the latitude of Cape Douglas (58°51.10' North latitude) mid-stream Shelikof Strait, north and... the Prince William Sound Area. Waters of the Bering River area from Point Martin to Cape Suckling... Sumner Strait and west of Clarence Strait and Kashevaroff Passage. District 5—North of a line from Point...

  8. Facility effluent monitoring plan for 242-A evaporator facility

    Energy Technology Data Exchange (ETDEWEB)

    Crummel, G.M.; Gustavson, R.D.

    1995-02-01

    A facility effluent monitoring plan is required by the U.S. Department of Energy in DOE Order 5400.1 for any operations that involve hazardous materials and radioactive substances that could affect employee or public safety or the environment. A facility effluent monitoring plan determination was performed during Calendar Year 1991 and the evaluation showed the need for a facility effluent monitoring plan. This document is prepared using the specific guidelines identified in A Guide for Preparing Hanford Site Facility Effluent Monitoring Plans, WHC-EP-0438-1. This facility effluent monitoring plan assesses effluent monitoring systems and evaluates whether they are adequate to ensure the public health and safety as specified in applicable federal, state, and local requirements. This facility effluent monitoring plan shall ensure long-range integrity of the effluent monitoring systems by requiring an update whenever a new process or operation introduces new hazardous materials or significant radioactive materials. This document must be reviewed annually even if there are no operational changes, and it must be updated, as a minimum, every three years.

  9. Dicty_cDB: VFG242 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available NYKGKNHLIKKEIN KVETDQLTHQYTLVI--- ---KEIQAGTLADDWELLPSKQIKDPKQSKPVDWVDVKEIDDPEDVKPAGHDDIPASIVD PEAVK...qlqrkepfnqernq qs*nrsinssihfgh--- ---KEIQAGTLADDWELLPSKQIKDPKQSKPVDWVDVKEIDDPEDVKPAGHDDIPASIVD PEAVK

  10. 7 CFR 2.42 - Administrator, Farm Service Agency.

    Science.gov (United States)

    2010-01-01

    ... implementation of technical assistance, under the Food Security Act of 1985, as amended (16 U.S.C. 1232 et seq..., receipts under section 2501A(e) of the Food, Agriculture, Conservation, and Trade Act of 1990 (7 U.S.C. 2279-1(e)). (56) Administer the following provisions of the Food, Conservation, and Energy Act of 2008...

  11. 17 CFR 242.600 - NMS security designation and definitions.

    Science.gov (United States)

    2010-04-01

    ... with: (i) The planning, development, operation or regulation of a national market system (or a... security; and (ii) Consolidated last sale information for a security. (14) Consolidated last sale... sale data, or quotations with respect to a particular security; and (ii) Displays the most recent...

  12. Preface: phys. stat. sol. (b) 242/9

    Science.gov (United States)

    Sánchez, Maria

    2005-07-01

    The XVII Latin American Symposium on Solid State Physics took place in the conference rooms of the Convent San Francisco de Asis, in the heart of the Old Havana. The sixteen previous editions were organized in eight different countries; the last two were in Colombia (Cartagena, 1999) and Venezuela (Merida, 2002). After eighteen years the meeting came back to Havana in 2004.The program topics included: Surfaces and interfaces analysis; Spintronics; Magnetism; Materials and energy; Ab-initio methods, simulations and modeling in solids; Nanophysics, nanomaterials and nanotechnology; New materials, properties and applications; Preparation of materials, thin films and characterization; High temperature superconductivity; Techniques of structural analysis in solids. The program included 6 plenary talks, 13 invited talks, 58 oral presentations (in eight sessions) and 200 poster contributions (in four poster sessions).The meeting attracted more than 200 participants from 14 countries. The physica status solidi Young Researcher Award sponsored by Wiley-VCH was conferred at the meeting. This prize was divided between two participants: Clara Calderón (Study of electrical transport properties of ZnO thin films used as front contact of solar cells) from Colombia and Aim?? Pelaiz Barranco (AC behavior in lanthanum modified PZT ferroelectric ceramics) from Cuba. Special Mentions went to Val??rie Halté (Femtosec-ond dynamics of transmission of gold arrays of sub-wavelength holes) from France, Erick Larramendi Cancio (Cd desorption induced by Zn exposure during atomic layer epitaxy of CdxZn1-xTe) and Julio Cesar Rimada Herrera (Quantum and conversion efficiency calculation of AlGaAs/GaAs multiple quantum well solar cells) from Cuba.Nanostructures and in general low dimensional physics related to different systems was a very hot topic during the meeting. Some talks and presentations were devoted to optoelectronic materials and devices. Characterization of solids by different structural and optical techniques together with modeling and simulations were also important subjects of the symposium.The XVIII Symposium will be held in Mexico in 2006.The editors wish to thank all the participants who contributed to the success of the meeting and hope that it helped to develop close links between researchers and institutions of Latin America.

  13. Dicty_cDB: CHR242 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 78 5e-12 3 AY303385 |AY303385.1 Lottia austrodigitalis sodium/potassium ATPase alpha subunit mRNA, partial...5e-51 AY303385_1( AY303385 |pid:none) Lottia austrodigitalis sodium/pota... 202 5e-51 ( Q92036 ) RecName:

  14. High School Dropouts: Causes, Consequences, and Cure. Fastback 242.

    Science.gov (United States)

    Grossnickle, Donald R.

    This booklet addresses the issue of high school dropouts. The dropout problem is briefly reviewed and dropout statistics are presented. A section on identifying the dropout lists early warning signs of potential dropouts and examines reasons for dropping out. Seven profiles of dropouts are included which provide personal insights, describe…

  15. 36 CFR 242.27 - Subsistence taking of fish.

    Science.gov (United States)

    2010-07-01

    ... the fish, their parts, or their eggs uses them for personal or family consumption. If you are not a... published open seasons or harvest limits if the harvested fish will be used for food in traditional or... permit when the circumstances have changed significantly, when no permit has been issued within the...

  16. 49 CFR 24.2 - Definitions and acronyms.

    Science.gov (United States)

    2010-10-01

    ... a sink, bathtub or shower stall, and a toilet, all in good working order and properly connected to... shall be a kitchen area that contains a fully usable sink, properly connected to potable hot and cold... unearned) including, but not limited to wages, salary, child support, alimony, unemployment benefits...

  17. 48 CFR 1552.242-70 - Indirect costs.

    Science.gov (United States)

    2010-10-01

    ... procedures require a Contracting Officer determination of indirect cost rates for its contracts. In those... Contracting Officer of the cognizant agency. Upon establishment of the final indirect cost rates, the.... (b) Until final annual indirect cost rates are established for any period, the Government shall...

  18. 50 CFR 216.242 - Permissible methods of taking.

    Science.gov (United States)

    2010-10-01

    ...). (J) Striped dolphin (Stenella coeruleoalba)—873620 (an average of 174274 annually). (K) Common... (Stenella attenuata)—696530 (an average of 139306 annually). (G) Atlantic spotted dolphin (Stenella frontalis)—1881805 (an average of 376361 annually). (H) Spinner dolphin (Stenella longirostris)—105775 (an...

  19. Dicty_cDB: CHE242 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ---xikrgxanfc*xlsxgkpipxxx*rf*xh*kx*kpxskxkkgfpxrsxkvxfsvgkq ikxwwxffrtitfqkespsplsfkixrwyanfc*nshw*nqsl*klkvlitlkm*RLKFK...---xikrgxanfc*xlsxgkpipxxx*rf*xh*kx*kpxskxkkgfpxrsxkvxfsvgkq ikxwwxffrtitfqkespsplsfkixrwyanfc*nshw*nqsl*klkvlitlkm*RLKFK

  20. Dicty_cDB: SLB242 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SNQTAEKDEYEDKMKALEAVVNPIMSKLYQEGGMPQGGGMPGGMSNDSPKSSNNKVDELD *rnfseenisik*is*kiis**nq*sfsyivhi Translated Amino Acid sequence...SNQTAEKDEYEDKMKALEAVVNPIMSKLYQEGGMPQGGGMPGGMSNDSPKSSNNKVDELD *rnfseenisik*is*kiis**nq*sfsyivhi Frame C: qikpqkrmnmkir*k

  1. A retrospective study of californium-252 neutron brachytherapy combined with EBRT versus 3D-CRT in the treatment of esophageal squamous cell cancer.

    Science.gov (United States)

    Wang, Qifeng; Li, Tao; Lang, Jinyi; Wang, Jie; Wang, Jian; Liu, Huiming; Jia, Xitang; Liu, Bo; Wang, C-K Chris

    2015-10-24

    We conducted a retrospective analysis on 884 patients who were diagnosed with esophageal squamous cell carcinoma (ESCC) and treated with either the neutron brachytherapy in combination with external beam radiotherapy (NBT + EBRT) or 3-dimensional conformal radiation therapy (3D-CRT) to determine the differences in efficacy and morbidity between the two treatment groups. The 884 ESCC patients treated with either NBT + EBRT or 3D-CRT between 2002 and 2012 were retrospectively reviewed and analyzed. Multivariable Cox regression was used to compare oncologic outcomes of the two groups of patients in the context of other clinically relevant variables. The acute and chronic toxicities associated with the two groups were compared using Fisher exact and log-rank tests, respectively. Among the 884 patients, 545 received NBT + EBRT and 339 received 3D-CRT (i.e. EBRT-only). The age range is 39-95 years (median 66). The follow-up time range is 3-145 months (median 32). The analysis shows that the NBT + EBRT group has higher overall survival rate and local control rate than that of the 3D-CRT group. The acute toxicity effects were acceptable for both groups of patients with the NBT + EBRT group showing higher rates of leukopenia and thrombocytopenia and the 3D-CRT group showing higher rates on fistula and massive bleeding. The patients treated with NBT + EBRT showed better oncologic outcomes than those treated with 3D-CRT. The toxicity effects were acceptable for both groups with the NBT + EBRT group showing higher rates on the acute effects and the 3D-CRT group showing higher rates on the late effects.

  2. Accurate determination of Curium and Californium isotopic ratios by inductively coupled plasma quadrupole mass spectrometry (ICP-QMS) in 248Cm samples for transmutation studies

    Energy Technology Data Exchange (ETDEWEB)

    Gourgiotis, A.; Isnard, H.; Aubert, M.; Dupont, E.; AlMahamid, I.; Cassette, P.; Panebianco, S.; Letourneau, A.; Chartier, F.; Tian, G.; Rao, L.; Lukens, W.

    2011-02-01

    The French Atomic Energy Commission has carried out several experiments including the mini-INCA (INcineration of Actinides) project for the study of minor-actinide transmutation processes in high intensity thermal neutron fluxes, in view of proposing solutions to reduce the radiotoxicity of long-lived nuclear wastes. In this context, a Cm sample enriched in {sup 248}Cm ({approx}97 %) was irradiated in thermal neutron flux at the High Flux Reactor (HFR) of the Laue-Langevin Institute (ILL). This work describes a quadrupole ICP-MS (ICP-QMS) analytical procedure for precise and accurate isotopic composition determination of Cm before sample irradiation and of Cm and Cf after sample irradiation. The factors that affect the accuracy and reproducibility of isotopic ratio measurements by ICP-QMS, such as peak centre correction, detector dead time, mass bias, abundance sensitivity and hydrides formation, instrumental background, and memory blank were carefully evaluated and corrected. Uncertainties of the isotopic ratios, taking into account internal precision of isotope ratio measurements, peak tailing, and hydrides formations ranged from 0.3% to 1.3%. This uncertainties range is quite acceptable for the nuclear data to be used in transmutation studies.

  3. Radiological Characterization Technical Report on Californium-252 Sealed Source Transuranic Debris Waste for the Off-Site Source Recovery Project at Los Alamos National Laboratory

    Energy Technology Data Exchange (ETDEWEB)

    Feldman, Alexander [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2014-04-24

    This document describes the development and approach for the radiological characterization of Cf-252 sealed sources for shipment to the Waste Isolation Pilot Plant. The report combines information on the nuclear material content of each individual source (mass or activity and date of manufacture) with information and data on the radionuclide distributions within the originating nuclear material. This approach allows for complete and accurate characterization of the waste container without the need to take additional measurements. The radionuclide uncertainties, developed from acceptable knowledge (AK) information regarding the source material, are applied to the summed activities in the drum. The AK information used in the characterization of Cf-252 sealed sources has been qualified by the peer review process, which has been reviewed and accepted by the Environmental Protection Agency.

  4. Report to the DOE nuclear data committee. [EV RANGE 10-100; CROSS SECTIONS; PHOTONEUTRONS; NEUTRONS; GAMMA RADIATION; COUPLED CHANNEL THEORY; DIFFERENTIAL CROSS SECTIONS; MEV RANGE 01-10; ; CAPTURE; GAMMA SPECTRA; THERMAL NEUTRONS; COMPUTER CALCULATIONS; DECAY; FISSION PRODUCTS; FISSION YIELD; SHELL MODELS; NUCLEAR DATA COLLECTIONS

    Energy Technology Data Exchange (ETDEWEB)

    Struble, G.L.; Haight, R.C.

    1981-03-01

    Topics covered include: studies of (n, charged particle) reactions with 14 to 15 MeV neutrons; photoneutron cross sections for /sup 15/N; neutron radiative capture; Lane-model analysis of (p,p) and (n,n) scattering on the even tin isotopes; neutron scattering cross sections for /sup 181/Ta, /sup 197/Au, /sup 209/Bi, /sup 232/Th, and /sup 238/U inferred from proton scattering and charge exchange cross sections; neutron-induced fission cross sections of /sup 245/Cm and /sup 242/Am; fission neutron multiplicities for /sup 245/Cm and /sup 242/Am; the transport of 14 MeV neutrons through heavy materials 150 < A < 208; /sup 249/Cm energy levels from measurement of thermal neutron capture gamma rays; /sup 231/Th energy levels from neutron capture gamma ray and conversion electron spectroscopy; new measurements of conversion electron binding energies in berkelium and californium; nuclear level densities; relative importance of statistical vs. valence neutron capture in the mass-90 region; determination of properties of short-lived fission products; fission yield of /sup 87/Br and /sup 137/I from 15 nuclei ranging from /sup 232/Th to /sup 249/Cf; evaluation of charged particle data for the ECPL library; evaluation of secondary charged-particle energy and angular distributions for ENDL; and evaluated nuclear structure libraries derived from the table of isotopes. (GHT)

  5. 48 CFR 352.242-72 - Native American Graves Protection and Repatriation Act.

    Science.gov (United States)

    2010-10-01

    ... cultural patrimony), as defined in the Act during contract performance, the Contractor shall— (i... individuals and organizations when they discover Native American cultural items (including human remains) on Federal or Tribal lands. (b) In the event the Contractor discovers Native American cultural items...

  6. Uncrossability constraints in mesoscopic polymer melt simulations: Non-Rouse behavior of C120H242

    NARCIS (Netherlands)

    Padding, J.T.; Briels, Willem J.

    2001-01-01

    An important feature of a melt of long polymers is that the bonds of the chains cannot cross each other. This seemingly simple fact has a great impact on the long time dynamics and rheology of the material. In this paper an algorithm is described that explicitly detects and prevents bond crossings

  7. Tris{2-[4-(2-pyridylpyrimidin-2-ylsulfanyl]ethyl}amine

    Directory of Open Access Journals (Sweden)

    Jian-Quan Wang

    2009-08-01

    Full Text Available The tripodal character of the title compound, C33H30N10S3, arises from the three thioether arms surrounding a central amine N atom. The three arms have approximately the same conformation but distinct geometries in a trans–trans–cis conformation, resulting in a short pyridine–sulfanyl N...S distance of 4.320 (7 Å. The distances of the central N atom to the N atoms of three pyridine rings in the arms are 8.305 (7, 8.032 (7 and 5.076 (9Å. In the crystal, molecules are joined into a three-dimensional supramolecular network via effective π–π stacking between adjacent heterocycles [centroid–centroid distances of 3.700 (3–4.118 (4 Å between adjacent interlayer pyrimidine rings and 3.676 (4 Å between the pyridine rings].

  8. Redetermination of 2-[4-(2-hydroxyethylpiperazin-1-ium-1-yl]ethanesulfonate at 100 K

    Directory of Open Access Journals (Sweden)

    Maksymilian Chruszcz

    2009-12-01

    Full Text Available The crystal structure of the title compound (common name HEPES, C8H18N2O4S, has been redetermined at 100 K in order to properly elucidate the protonation state of the HEPES molecule. The piperazine ring has a chair conformation and one of the N atoms in the ring is protonated, which was not previously reported [Gao, Yin, Yang, & Xue (2004. Acta Cryst. E60, o1328–o1329]. The change of protonation state of the nitrogen atom significantly affects the intermolecular interactions in the HEPES crystal. The structure is stabilized by N—H...O and O—H...O hydrogen bonds and ionic interactions, as the title compound in solid state is a zwitterion. HEPES molecules pack in layers that are held together by ionic and weak interactions, while a hydrogen-bonded network connects the layers.

  9. Liu et al., Afr J Tradit Complement Altern Med. (2016) 13(3):230-242 ...

    African Journals Online (AJOL)

    hepatic tumors of murine hepatocarcinoma cell line H22, and could also promote the proliferation of splenocytes and the phagocytosis of .... the labeled carbohydrate was filtered through 0.22 µm nylon membranes. The filtrate (10 ..... Figure 4: Schematic diagram of the antitumor effects of four molecular communities in SCP ...

  10. Page 1 242 Sunny Mathew and K P Vijayakumar at 573 K. The film ...

    Indian Academy of Sciences (India)

    F from DAE is also acknowledged. IP. Financial support. References. Arita T. Hanafusa H Kitamura S and Takakura H 19. 3. 91 -. conſ, Las Vegas, USA, p. 946 Conf. Azzam R M A and B h - - - p. 288 ashara N M 1977 Ellipsometry and polarized light (Amsterdam. North Holland) Ch. 4. *cords of 22nd photovoltaic Specialist.

  11. 32 CFR 242a.7 - Transcripts, recordings, and minutes of closed meetings.

    Science.gov (United States)

    2010-07-01

    ... Board shall maintain a complete, verbatim copy of the transcript, a complete copy of the minutes, or a... transcript, or minutes, or a transcription of such recording disclosing the identity of each speaker, shall be available at the actual cost of duplication or transcription. (3) The determination of the...

  12. High level waste storage tanks 242-A evaporator standards/requirement identification document

    Energy Technology Data Exchange (ETDEWEB)

    Biebesheimer, E.

    1996-01-01

    This document, the Standards/Requirements Identification Document (S/RIDS) for the subject facility, represents the necessary and sufficient requirements to provide an adequate level of protection of the worker, public health and safety, and the environment. It lists those source documents from which requirements were extracted, and those requirements documents considered, but from which no requirements where taken. Documents considered as source documents included State and Federal Regulations, DOE Orders, and DOE Standards

  13. Comparative biokinetics of trivalent radionuclides with similar ionic dimensions: promethium-147, curium-242 and americium-241.

    Science.gov (United States)

    Priest, N D

    2007-09-01

    Data on the distribution and redistribution patterns in the laboratory rat of three trivalent elements with a similar ionic radius have been compared. This showed that these distributions for the two ions with the same ionic radius (111 pm), i.e., those of promethium (a lanthanoid) and curium (an actinoid), were indistinguishable and that americium, with a slightly larger ion size (111.5 pm), behaved similarly. The results are consistent with the suggestion that ion size is the only important factor controlling the deposition and redistribution patterns of trivalent lanthanoids and actinoids in rats. The result is important because it suggests that the same radiological protection dosimetry models should be used for trivalent actinoids and lanthanoids, that human volunteer data generated for lanthanoid isotopes can be used to predict the behavior of actinoids with the same ion size, and that appropriate pairs of beta-particle-emitting lanthanoid and alpha-particle-emitting actinoids could be used to study the relative toxicity of alpha and beta particles in experimental animals.

  14. Synthesis of novel 2-(4-(2-morpholinoethoxy)phenyl)-N ...

    Indian Academy of Sciences (India)

    Chemical shifts were reported in parts per mil- lion down field from tetramethyl silane. Mass spectra were recorded on a VG70-70 H mass spectrometer. 2.2 Synthesis of 2-(4-hydroxyphenyl)-N-phenyl acetamides. The synthetic sequence is outlined in scheme 1.13–17 A mixture of 2-(4-hydroxyphenyl)acetic acid (1.10 mmol).

  15. 17 CFR 242.502 - Certifications in connection with public appearances.

    Science.gov (United States)

    2010-04-01

    ... calendar quarter accurately reflected the research analyst's personal views at that time about any and all... part of the research analyst's compensation was, is, or will be, directly or indirectly, related to the... appearances. (a) If a broker or dealer publishes, circulates, or provides a research report prepared by a...

  16. Pilot Production of Powder Forged Steel Components for the 25-mm M242 Chain Gun

    Science.gov (United States)

    1989-03-31

    can contain small amounts of other hydrocarbons such as propane or inert gases such as nitrogen. Natural gas was added to the furnace atmosphere...way through the cycle, based on evaluation of in-process samples by the heat treater . 20 Heat Treating to Required Hardness. After the carbon

  17. Genetic variation at 16q24.2 is associated with small vessel stroke

    NARCIS (Netherlands)

    M. Traylor (Matthew); R. Malik (Rainer); M.A. Nalls (Michael); I. Cotlarciuc (Ioana); F. Radmanesh (Farid); G. Thorleifsson (Gudmar); Hanscombe, K.B. (Ken B.); C.D. Langefeld (Carl); Saleheen, D. (Danish); N. Rost (Natalia); I. Yet (Idil); T.D. Spector (Timothy); J.T. Bell (Jordana); Hannon, E. (Eilis); J. Mill (Jonathan); G. Chauhan (Ganesh); S. Debette (Stéphanie); J.C. Bis (Joshua); W.T. Longstreth Jr; M.K. Ikram (Kamran); L.J. Launer (Lenore); S. Seshadri (Sudha); Hamilton-Bruce, M.A. (Monica Anne); J. Jimenez-Conde (Jordi); J.W. Cole (John W.); R. Schmidt (Reinhold); A. Slowik (Agnieszka); R. Lemmens (Robin); A.G. Lindgren (Arne G.); O. Melander (Olle); Grewal, R.P. (Raji P.); R.L. Sacco (Ralph); T. Rundek (Tatjana); K. Rexrode (Kathryn); D.K. Arnett (Donna); Johnson, J.A. (Julie A.); Benavente, O.R. (Oscar R.); Wasssertheil-Smoller, S. (Sylvia); Lee, J.-M. (Jin-Moo); S.L. Pulit (Sara); Q. Wong (Quenna); S.S. Rich (Stephen); P.I.W. de Bakker (Paul); P.F. McArdle (Patrick); Woo, D. (Daniel); Anderson, C.D. (Christopher D.); Xu, H. (Huichun); Heitsch, L. (Laura); M. Fornage (Myriam); C. Jern (Christina); J-A. Zwart (John-Anker); U. Thorsteinsdottir (Unnur); S. Gretarsdottir (Solveig); C.M. Lewis (Cathryn); P. Sharma (Pankaj); C. Sudlow (Cathie); P.M. Rothwell (Peter); G. Boncoraglio (Giorgio Battista); V. Thijs (Vincent); C. Levi (Christopher); J.F. Meschia (James F.); J. Rosand (Jonathan); T. Kittner (Thomas); B.D. Mitchell (Braxton); C. Kubisch (Christian); B.B. Worrall (Bradford B.); H.S. Markus (Hugh)

    2017-01-01

    textabstractObjective: Genome-wide association studies (GWAS) have been successful at identifying associations with stroke and stroke subtypes, but have not yet identified any associations solely with small vessel stroke (SVS). SVS comprises one quarter of all ischemic stroke and is a major

  18. : tous les projets | Page 242 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Des normes de propriété intellectuelle strictes et leur application plus musclée poussent les fournisseurs de produits médiatiques et les fabricants de médicaments à fixer des prix hors de la portée de presque tous les segments de la population, mis à part les plus riches. Date de début : 12 mai 2011. End Date: 12 mai 2012.

  19. Options in Education. Paying for College, Parts One and Two, Program Nos. 242-243.

    Science.gov (United States)

    George Washington Univ., Washington, DC. Inst. for Educational Leadership.

    Scripts of public radio programs on the subject of paying for college are presented. They deal with various kinds of students and student financial aid, including work-study programs, state aid, Basic Grants, etc. The scripts are as follows: "Students Who Work and Go To College;""Student (Myra Burns) Describes Struggle to Pay for College;""Student…

  20. Page 1 242 V V Ranade 3. Formulation of mathematical model 3.1 ...

    Indian Academy of Sciences (India)

    of fiction and it rests on the ideas of averaging. These ideas are easier to grasp imaginatively than to set down rigorously (although rigour can be provided if demanded, Spalding 1978). Here the reader is asked to accept that it is meaningful to conceive that (Ishii 1975, 1986; Johansen 1988):. (i) any small volume of the ...

  1. Page 1 242 G M Phatak et al the high volatility and low melting point ...

    Indian Academy of Sciences (India)

    which the compound is expected to be formed, Tl2O3 was found to be lost even before the reaction was complete. To avoid this, the T1-2223 phase has been synthesized in this work using a precursor matrix method—with the precursor of composition. Ca,Ba2Cu, O (2* q<3.0 and n=2,3) heating with Tl2O3 at high ...

  2. Reliable determination of 237Np in environmental solid samples using 242Pu as a potential tracer

    DEFF Research Database (Denmark)

    Qiao, Jixin; Hou, Xiaolin; Roos, Per

    2011-01-01

    experimental conditions. Disulfite-8M HNO3 was selected as a redox pair for valence adjustment to Np(IV) and the tetravalent Np in the sample solution was demonstrated to be stabilized for up to 5 days under 3°C. The analytical results for reference materials showed a good agreement with the expected values...

  3. 2-[4-(2-Chloroacetylphenyl]-2-methyl-1-(pyrrolidin-1-ylpropan-1-one

    Directory of Open Access Journals (Sweden)

    Dong-mei Ren

    2013-08-01

    Full Text Available The asymmetric unit of the title compound, C16H20ClNO2, contains two molecules in which the dihedral angles between the benzene ring and the plane of the amide unit are 77.4 (1 and 81.1 (1°. In both molecules, the five-membered ring adopts an envelope conformation with one of the β-C atoms as the flap. In the crystal, molecules are connected via C—H...O hydrogen bonds, forming chains along the b-axis direction. These chains are further linked by C—H...π interactions, forming a three-dimensional network.

  4. 48 CFR 1252.242-70 - Dissemination of information-educational institutions.

    Science.gov (United States)

    2010-10-01

    ... provisions of the “Data Rights” and “Patent Rights” clauses of the contract) research results in professional... stating that the published material represents the position of the author(s) and not necessarily that of...

  5. 36 CFR 242.16 - Customary and traditional use determination process.

    Science.gov (United States)

    2010-07-01

    ... factors, which exemplify customary and traditional use. The Board shall make customary and traditional use determinations based on application of the following factors: (1) A long-term consistent pattern of use... fish and wildlife resources of the area and which provides substantial cultural, economic, social, and...

  6. Synthesis of novel 2-(4-(2-morpholinoethoxy) phenyl)-N ...

    Indian Academy of Sciences (India)

    phenylacetamides has been synthesized from hydroxyphenylacetic acid. The products were characterized through IR, 1H NMR, mass spectral studies and elemental analysis. The compounds were screened for antimicrobial activity by disc agar ...

  7. High level waste storage tanks 242-A evaporator S/RID phase II assessment report

    Energy Technology Data Exchange (ETDEWEB)

    Biebesheimer, E.

    1996-09-27

    This document, the Standards/Requirements Identification Document (S/RID) Phase 2 Assessment Report for the subject facility, represents the results of a Performance Assessment to determine whether procedures containing S/RID requirements are fully implemented by field personnel in the field. It contains a summary report and three attachments; an assessment schedule, performance objectives, and assessments for selected functional areas.

  8. 48 CFR 52.242-4 - Certification of Final Indirect Costs.

    Science.gov (United States)

    2010-10-01

    ... proposal to establish or modify final indirect cost rates; (2) Use the format in paragraph (c) of this... Indirect Costs This is to certify that I have reviewed this proposal to establish final indirect cost rates... and date) to establish final indirect cost rates for (identify period covered by rate) are allowable...

  9. MeteoIO 2.4.2: a preprocessing library for meteorological data

    Directory of Open Access Journals (Sweden)

    M. Bavay

    2014-12-01

    Full Text Available Using numerical models which require large meteorological data sets is sometimes difficult and problems can often be traced back to the Input/Output functionality. Complex models are usually developed by the environmental sciences community with a focus on the core modelling issues. As a consequence, the I/O routines that are costly to properly implement are often error-prone, lacking flexibility and robustness. With the increasing use of such models in operational applications, this situation ceases to be simply uncomfortable and becomes a major issue. The MeteoIO library has been designed for the specific needs of numerical models that require meteorological data. The whole task of data preprocessing has been delegated to this library, namely retrieving, filtering and resampling the data if necessary as well as providing spatial interpolations and parameterizations. The focus has been to design an Application Programming Interface (API that (i provides a uniform interface to meteorological data in the models, (ii hides the complexity of the processing taking place, and (iii guarantees a robust behaviour in the case of format errors, erroneous or missing data. Moreover, in an operational context, this error handling should avoid unnecessary interruptions in the simulation process. A strong emphasis has been put on simplicity and modularity in order to make it extremely easy to support new data formats or protocols and to allow contributors with diverse backgrounds to participate. This library is also regularly evaluated for computing performance and further optimized where necessary. Finally, it is released under an Open Source license and is available at http://models.slf.ch/p/meteoio. This paper gives an overview of the MeteoIO library from the point of view of conceptual design, architecture, features and computational performance. A scientific evaluation of the produced results is not given here since the scientific algorithms that are used have already been published elsewhere.

  10. High-level waste storage tank farms/242-A evaporator standards/requirements identification document (S/RID), Vol. 6

    Energy Technology Data Exchange (ETDEWEB)

    1994-04-01

    The scope of the Environmental Restoration and Waste Management (EM) Functional Area includes the programmatic controls associated with the management and operation of the Hanford Tank Farm Facility. The driving management organization implementing the programmatic controls is the Tank Farms Waste Management (WM)organization whose responsibilities are to ensure that performance objectives are established; and that measurable criteria for attaining objectives are defined and reflected in programs, policies and procedures. Objectives for the WM Program include waste minimization, establishment of effective waste segregation methods, waste treatment technology development, radioactive (low-level, high-level) hazardous and mixed waste transfer, treatment, and storage, applicability of a corrective action program, and management and applicability of a decontamination and decommissioning (D&D) program in future years.

  11. High-level waste storage tank farms/242-A evaporator standards/requirements identification document (S/RID), Vol. 1

    Energy Technology Data Exchange (ETDEWEB)

    1994-04-01

    The purpose of this Requirements Identification Document (RID) section is to identify, in one location, all of the facility specific requirements and good industry practices which are necessary or important to establish an effective Issues Management Program for the Tank Farm Facility. The Management Systems Functional Area includes the site management commitment to environmental safety and health (ES&H) policies and controls, to compliance management, to development and management of policy and procedures, to occurrence reporting and corrective actions, resource and issue management, and to the self-assessment process.

  12. 77 FR 52680 - Foreign-Trade Zone 242-Boundary County, ID, Notification of Proposed Production Activity, AREVA...

    Science.gov (United States)

    2012-08-30

    ... Activity, AREVA Enrichment Services, LLC, (Gas Centrifuge Production Equipment), Bonneville County, ID... AREVA Enrichment Services, LLC (AES), located in Bonneville County, Idaho. The notification conforming...

  13. High-level waste storage tank farms/242-A evaporator standards/requirements identification document (S/RID), Vol. 3

    Energy Technology Data Exchange (ETDEWEB)

    1994-04-01

    The Safeguards and Security (S&S) Functional Area address the programmatic and technical requirements, controls, and standards which assure compliance with applicable S&S laws and regulations. Numerous S&S responsibilities are performed on behalf of the Tank Farm Facility by site level organizations. Certain other responsibilities are shared, and the remainder are the sole responsibility of the Tank Farm Facility. This Requirements Identification Document describes a complete functional Safeguards and Security Program that is presumed to be the responsibility of the Tank Farm Facility. The following list identifies the programmatic elements in the S&S Functional Area: Program Management, Protection Program Scope and Evaluation, Personnel Security, Physical Security Systems, Protection Program Operations, Material Control and Accountability, Information Security, and Key Program Interfaces.

  14. SU-E-T-242: Design of a Novel Afterloader Clearance QA Device for Biliary HDR Therapy

    Energy Technology Data Exchange (ETDEWEB)

    Mullins, JP; Deufel, CL [Mayo Clinic, Rochester, MN (United States)

    2015-06-15

    Purpose: Bile duct cancer affects 2–3 thousand people annually in the United States. Radiation therapy has been shown to double median survival, with combined external beam and intraluminal high dose-rate (HDR) brachytherapy being most effective. Endoscopic retrograde cholangiopancreatography (ERCP) biliary HDR, a less-invasive alternative to trans-hepatic brachytherapy, is delivered through a catheter that travels a tortuous path from nose to bile duct, requiring wire drive force and dexterity beyond typical afterloader performance specifications. Thus, specific afterloader quality assurance(QA) is recommended for this procedure. Our aim was to create a device and process for Varisource afterloader clearance QA with objectives that it be quantitative and can monitor afterloader performance over time, compare performance between two distinct afterloaders and potentially Result in a predictive nomogram for patient-specific clearance. Methods: Based on retrospective reconstruction of 20 ERCP patient anatomies, we designed a phantom to test afterloader ability to drive the source wire along an intended treatment path. The ability of the afterloader to fully extend the intended treatment path is a function of number and diameters of turns. We have determined experimentally that relative position of the turns does not impact performance. Results: Both patient and QA paths involve three common turns/loops: a large turn representing the stomach(10.8cm±2.0cm), an elliptical loop representing the duodenum(7.3cm±1.5cmx4.8cm±0.7cm), and a final turn at the end of the bile duct that may be tight for some patient-specific anatomies and absent in others(3.7cm±0.7cm, where present). Our phantom design uses anatomical average turn diameters for the stomach and duodenum then terminates in a turn of quantitatively selectable diameter. The smallest final turn diameter that an afterloader can pass is recorded as the QA parameter. Conclusion: With this device and QA process, we have the ability to quantitatively evaluate and track our afterloader performance for a technically challenging ERCP brachytherapy procedure.

  15. 32 CFR 242a.4 - Grounds on which meetings may be closed, or information may be withheld.

    Science.gov (United States)

    2010-07-01

    ... security intelligence investigation, confidential information furnished only by the confidential source; (5... public interest requires otherwise, the open meeting requirement set forth in the second sentence of...) Disclose the identity of a confidential source and, in the case of a record compiled by a criminal law...

  16. High-level waste storage tank farms/242-A evaporator standards/requirements identification document (S/RID), Vol. 2

    Energy Technology Data Exchange (ETDEWEB)

    1994-04-01

    The Quality Assurance Functional Area Requirements Identification Document (RID), addresses the programmatic requirements that ensure risks and environmental impacts are minimized, ensure safety, reliability, and performance are maximized through the application of effective management systems commensurate with the risks posed by the Tank Farm Facility and its operation. This RID incorporates guidance intended to provide Tank Farms management with the necessary requirements information to develop, upgrade, or assess the effectiveness of a Quality Assurance Program in the performance of organizational and functional activities. Quality Assurance is defined as all those planned and systematic actions necessary to provide adequate confidence that a facility, structure, system, or component will perform satisfactorily and safely in service. This document will provide the specific requirements to meet DNFSB recommendations and the guidance provided in DOE Order 5700.6C, utilizing industry codes, standards, regulatory guidelines, and industry good practices that have proven to be essential elements for an effective and efficient Quality Assurance Program as the nuclear industry has matured over the last thirty years.

  17. Bradley Fighting Vehicle Gunnery: An Analysis of Engagement Strategies for the M242 25-mm Automatic Gun

    Science.gov (United States)

    1993-03-01

    to model in that it requires a %ange-in proceso Lco effectively 5ngige most targets. While this is not unique, given a similar requirement for most...three rounds have impacted on the target) the commander terminates the engagement. Figure 37 -.. . . . . . . . . 8 represents this portion of the

  18. 49 CFR 173.242 - Bulk packagings for certain medium hazard liquids and solids, including solids with dual hazards.

    Science.gov (United States)

    2010-10-01

    ... equipped with at least one pressure relief device, such as a spring-loaded valve or fusible plug... at less than 34.4 kPa (5 psig); (iv) If a fusible device is used for relieving pressure, the device...

  19. Giraut de Borneil, “Ben cove, pus ja bayssa·l ram” (BdT 242.25

    Directory of Open Access Journals (Sweden)

    Pietro G. Beltrami

    2009-01-01

    Full Text Available This paper will offer a revision, with a translation and commentary, of the text of “Ben cove, pus ja baissa·l ram” by Giraut de Borneil, with a new examination of the manuscript tradition after the monographic editions by Adolf Kolsen and Ruth Verity Sharman. In particular the paper will offer a new reading of l. 20, transmitted only by Chansonnier a, while the other manuscripts have a lacuna that seems to have been crudely corrected by Sg. The interpretation of “e leis s’embla, que a miralh” as ‘and she, who holds a mirror, is elusive’ restores an image of the lady filled with pride on seeing her own beauty reflected in a mirror that is also in Raimbaut d’Aurenga and Pons de Capduoill. In the Introduction the text is interpreted as an example of two different aspects of Giraut’s poetry, expressed through two different voices in the text, the author’s ‘self’ and the lover’s ‘self’. The former, who speaks in the first stanza, gives importance to his aiming for excellence; the latter, who speaks in the following stanzas, presents contents and forms belonging to a discourse on love. Finally, the point is made that where the two parts meet, at l. 9 “E per ma guerreira cui am” ‘and for my enemy whom I love’, the text is of great poetic intensity.

  20. High-level waste storage tank farms/242-A evaporator standards/requirements identification document (S/RID), Vol. 5

    Energy Technology Data Exchange (ETDEWEB)

    1994-04-01

    The Fire Protection functional area for the Hanford Site Tank Farm facilities and support structures is based on the application of relevant DOE orders, regulations, and industry codes and standards. The fire protection program defined in this document may be divided into three areas: (1) organizational, (2) administrative programmatic features, and (3) technical features. The information presented in each section is in the form of program elements and orders, regulations, industry codes, and standards that serve as the attributes of a fire protection program for the Tank Farm facilities. Upon completion this document will be utilized as the basis to evaluate compliance of the fire protection program being implemented for the Tank Farm facilities with the requirements of DOE orders and industry codes and standards.

  1. 32 CFR 242.8 - Academic, intellectual, and personal requirements for admission to the first-year class.

    Science.gov (United States)

    2010-07-01

    ... academic year including laboratory. (e) Biology. 1 academic year including laboratory. An academic year of... selection predicated on: (a) Evidence of sound character and high motivation for a career in the Medical... entrance are: (a) Chemistry (inorganic or general). 1 academic year including appropriate laboratory. (b...

  2. Mozart and aristocratic women performers in Salzburg : a study of the piano concertos K. 242 and K. 246

    OpenAIRE

    Portowitz, Adena

    2009-01-01

    Among recent approaches to Classic music, one of the most revealing is the investigation of expression via topoi. Pioneered by Leonard Ratner, and developed by leading musicologists specializing in 18th-century music, this system identifies characteristic figures and styles that conveyed specific meanings to 18th-century audiences via processes of association. These implications resulted from intimate contacts with everyday musical activities in worship, entertainment, dance ceremonies, the m...

  3. Abstract ID: 242 Simulation of a Fast Timing Micro-Pattern Gaseous Detector for TOF-PET.

    Science.gov (United States)

    Radogna, Raffaella; Verwilligen, Piet

    2018-01-01

    Micro-Pattern Gas Detectors (MPGDs) are a new generation of gaseous detectors that have been developed thanks to advances in micro-structure technology. The main features of the MPGDs are: high rate capability (>50 MHz/cm2); excellent spatial resolution (down to 50 μm); good time resolution (down to 3 ns); reduced radiation length, affordable costs, and possible flexible geometries. A new detector layout has been recently proposed that aims at combining both the high spatial resolution and high rate capability (100 MHz/cm2) of the current state-of-the-art MPGDs with a high time resolution. This new type of MPGD is named the Fast Timing MPGD (FTM) detector [1,2]. The FTM developed for detecting charged particles can potentially reach sub-millimeter spatial resolution and 100 ps time resolution. This contribution introduces a Fast Timing MPGD technology optimized to detect photons, as an innovative PET imaging detector concept and emphases the importance of full detector simulation to guide the design of the detector geometry. The design and development of a new FTM, combining excellent time and spatial resolution, while exploiting the advantages of a reasonable energy resolution, will be a boost for the design of affordable TOF-PET scanner with improved image contrast. The use of such an affordable gas detector allows to instrument large areas in a cost-effective way, and to increase in image contrast for shorter scanning times (lowering the risk for the patient) and better diagnosis of the disease. In this report a dedicated simulation study is performed to optimize the detector design in the contest of the INFN project MPGD-Fatima. Results are obtained with ANSYS, COMSOL, GARFIELD++ and GEANT4 simulation tools. The final detector layout will be trade-off between fast time and good energy resolution. Copyright © 2017.

  4. High-level waste storage tank farms/242-A evaporator standards/requirements identification document (S/RID), Vol. 7

    Energy Technology Data Exchange (ETDEWEB)

    1994-04-01

    This Requirements Identification Document (RID) describes an Occupational Health and Safety Program as defined through the Relevant DOE Orders, regulations, industry codes/standards, industry guidance documents and, as appropriate, good industry practice. The definition of an Occupational Health and Safety Program as specified by this document is intended to address Defense Nuclear Facilities Safety Board Recommendations 90-2 and 91-1, which call for the strengthening of DOE complex activities through the identification and application of relevant standards which supplement or exceed requirements mandated by DOE Orders. This RID applies to the activities, personnel, structures, systems, components, and programs involved in maintaining the facility and executing the mission of the High-Level Waste Storage Tank Farms.

  5. Handboek meetmethoden voor effectiviteit van activerend arbeidsmarktbeleid op persoonsniveau : een handvat voor beleidsmakers en onderzoekers voor het vaststellen van de (netto-)effectiviteit van activerend arbeidsmarktbeleid242

    NARCIS (Netherlands)

    Vos, E. de; Zwinkels, W.; Besseling, J.; Heyma, A.; Klaveren, C. van

    2008-01-01

    Nederland investeert vele miljoenen euro’s in de reïntegratie en activering van werklozen, gedeeltelijk arbeidsongeschikten en niet-uitkeringsgerechtigden (NUG’ers). Dit handboek geeft de state-of-the-art weer van methoden voor onderzoek naar de effectiviteit van investeringen in activerend

  6. A root hairless barley mutant for elucidating genetic of root hairs and phosphorus uptake (Correction in v. 242, 2002, p. 299)

    DEFF Research Database (Denmark)

    Gahoonia, T.S.; Nielsen, N.E.; Priyavadan, A.J.

    2001-01-01

    This paper reports a new barley mutant missing root hairs. The mutant was spontaneously discovered among the population of wild type (Pallas, a spring barley cultivar), producing normal, 0.8 mm long root hairs. We have called the mutant bald root barley (brb). Root anatomical studies confirmed...

  7. Spectrum of Class 242X-2007-027195-i1.gif"/> Operators

    OpenAIRE

    Yuan Jiangtao; Gao Zongsheng

    2007-01-01

    This paper discusses some spectral properties of class operators for , , , and . It is shown that if is a class operator, then the Riesz idempotent of with respect to each nonzero isolated point spectrum is selfadjoint and . Afterwards, we prove that every class operator has SVEP and property , and Weyl's theorem holds for when .

  8. catena-Poly[[[tetraaquacobalt(II]-μ-4,4′-bipyridine-κ2N:N′] 2-[4-(2-carboxylatoethylphenoxy]acetate

    Directory of Open Access Journals (Sweden)

    Xi-Fang Wang

    2009-07-01

    Full Text Available In the title complex, {[Co(C10H8N2(H2O4](C11H10O5}n, the unique CoII ion lies on an inversion center and is coordinated by two N atoms from two 4,4′-bipyridine ligands and four O atoms from four water molecules in a slightly distorted octahedral coordination geometry. The 4,4′-bipyridine ligands bridge CoII ions into a one-dimensional chain structure. In the crystal structure, intermolecular O—H...O hydrogen bonds link cations and anions into a three-dimensional network. The dianions are completely disordered about an inversion center.

  9. Multibeam collection for TN242: Multibeam data collected aboard Thomas G. Thompson from 2009-11-02 to 2009-11-06, Seattle, WA to Seattle, WA

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set is part of a larger set of data called the Multibeam Bathymetry Database (MBBDB) where other similar data can be found at...

  10. Thermodynamic Assessment of Hot Corrosion Mechanisms of Superalloys Hastelloy N and Haynes 242 in Eutectic Mixture of Molten Salts KF and ZrF4

    Energy Technology Data Exchange (ETDEWEB)

    Michael V. Glazoff

    2012-02-01

    The KF - ZrF4 system was considered for the application as a heat exchange agent in molten salt nuclear reactors (MSRs) beginning with the work carried out at ORNL in early fifties. Based on a combination of excellent properties such as thermal conductivity, viscosity in the molten state, and other thermo-physical and rheological properties, it was selected as one of possible candidates for the nuclear reactor secondary heat exchanger loop.

  11. Wide Band Gap Semiconductors Symposium Held in Boston, Massachusetts on 2-6 December 1991. Materials Research Society Symposium Proceedings. Volume 242

    Science.gov (United States)

    1992-01-01

    circular blotches on the Si-face. No circular features were observed. The AES data provided considerable chemical information about the contactfilm both...before the gas reaches the substrate. The soda lime glass subsrates were cleaned with a low sodium detergent and then rinsed with deioized water. The

  12. (385-388) Proposals to amend Art. 32.2, 23.5, and 24.2 to clarify the treatment of transcribed Greek terminations of epithets

    Science.gov (United States)

    The International Code of Nomenclature for algae, fungi and plants is revised every six years to incorporate decisions of the Nomenclature Section of successive International Botanical Congresses (IBC) on proposals to amend the Code. The proposals in this paper will be considered at the IBC in Shenz...

  13. Takotsubo cardiomyopathy associated with sepsis due to Pseudomonas aeruginosa pneumoniadoi: 10.12662/2317-3076jhbs.v3i4.169.p242-244.2015

    Directory of Open Access Journals (Sweden)

    Márcio da Silva Pereira

    2015-12-01

    Full Text Available The authors describe a case report of a 71 year-old female patient admitted at the emergency service due to severe precordial chest pain associated with dyspnea and sweating. The electrocardiogram performed on admission showed ST elevation on V2 and V3 leads and the ventriculography revealed left ventricular apical ballooning, denoting the diagnosis of Takotsubo Cardiomyopathy. At the eighth day of hospitalization, although the heart function was recovered, the patient died due the clinical complications of a septic shock.

  14. Complex Mosaic Ring Chromosome 11 Associated with Hemizygous Loss of 8.6 Mb of 11q24.2qter in Atypical Jacobsen Syndrome.

    Science.gov (United States)

    Galvão Gomes, Alexandra; Paiva Grangeiro, Carlos H; Silva, Luiz R; Oliveira-Gennaro, Flávia G; Pereira, Ciro S; Joaquim, Tatiana M; Panepucci, Rodrigo A; Squire, Jeremy A; Martelli, Lucia

    2017-01-01

    Jacobsen syndrome (JBS) is a contiguous gene deletion syndrome involving terminal chromosome 11q. The haploinsufficiency of multiple genes contributes to the overall clinical phenotype, which can include the variant Paris-Trousseau syndrome, a transient thrombocytopenia related to FLI1 hemizygous deletion. We investigated a boy with features of JBS using classic cytogenetic methods, FISH and high-resolution array CGH. The proband was found to have a mosaic ring chromosome 11 resulting in a hemizygous 11q terminal deletion of 8.6 Mb, leading to a copy number loss of 52 genes. The patient had a hemizygous deletion in the FLI1 gene region without apparent thrombocytopenia, and he developed diabetes mellitus type I, which has not previously been described in the spectrum of disorders associated with JBS. The relationship of some of the genes within the context of the phenotype caused by a partial deletion of 11q has provided insights concerning the developmental anomalies presented in this patient with atypical features of JBS.

  15. Interstitial 11q deletion derived from a maternal ins(4;11)(p14;q24.2q25): a patient report and review.

    Science.gov (United States)

    Van Zutven, Laura J C M; van Bever, Yolande; Van Nieuwland, Carolien C M; Huijbregts, Gido C M; Van Opstal, Diane; von Bergh, Anne R M; Corel, Linda J A; Tibboel, Dick; Wouters, Cokkie H; Poddighe, Pino J

    2009-07-01

    We present a family with multiple cytogenetic abnormalities, identified through a girl with several dysmorphic features and cardiac problems, suspected for Jacobsen syndrome. Cytogenetic analysis showed a 46,XX,del(11)(qter) karyotype, which was confirmed by fluorescence in situ hybridization (FISH). Cytogenetic investigation of the parents showed a chromosome aberration in both: the father had a t(11;12)(p13;q22) translocation and the mother was carrier of an ins(4;11)(p14;q24q25). FISH analysis with an 11q-subtelomeric probe from the second-generation telomere clone set and BACs from 11q24-q25 suggested a complex maternal rearrangement. However, subsequent array analysis showed a single interstitial deletion in the proband, derived from the maternal insertion. The aberrant karyotypes in both parents implicated an increased risk of unbalanced fetal chromosome composition, thus high risk for a child with multiple congenital abnormalities. Therefore, during the next pregnancy, the couple opted for prenatal diagnosis by means of amniocentesis. An interphase FISH strategy for uncultured amniotic fluid cells predicted two possible unbalanced fetal chromosome constitutions. Karyotyping of cultured amniotic cells confirmed one of the predicted unbalanced cytogenetic options, demonstrating the value of a fast interphase strategy for parents who both are carriers of a chromosomal abnormality. In addition, we present an overview of patients with Jacobsen syndrome and an interstitial 11q deletion reported thus far in literature.

  16. De novo 14q24.2q24.3 microdeletion including IFT43 is associated with intellectual disability, skeletal anomalies, cardiac anomalies, and myopia

    NARCIS (Netherlands)

    Stokman, M.F.; Oud, M.M.; Binsbergen, E. van; Slaats, G.G.; Nicolaou, N.; Renkema, K.Y.; Nijman, IJ; Roepman, R.; Giles, R.H.; Arts, H.H.; Knoers, N.V.A.M.; Haelst, M.M. van

    2016-01-01

    We report an 11-year-old girl with mild intellectual disability, skeletal anomalies, congenital heart defect, myopia, and facial dysmorphisms including an extra incisor, cup-shaped ears, and a preauricular skin tag. Array comparative genomic hybridization analysis identified a de novo 4.5-Mb

  17. Discovery of isotopes of the transuranium elements with 93≤Z≤98

    Energy Technology Data Exchange (ETDEWEB)

    Fry, C.; Thoennessen, M., E-mail: thoennessen@nscl.msu.edu

    2013-01-15

    One hundred and five isotopes of the transuranium elements neptunium, plutonium, americium, curium, berkelium, and californium have been observed so far; the discovery of these isotopes is described. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  18. Separation of Transplutonium Elements from Neutron Irradiated Americium-241

    National Research Council Canada - National Science Library

    UENO, Kaoru; WATANABE, Kenju; SAGAWA, Chiaki; ISHIMORI, Tomitaro

    1974-01-01

    .... The ratios of the amounts present of these isotopes were determined by mass spectrometry. It was not possible to identify 249Bk in the berkelium fraction owing to the interference from other β-ray emitting nuclides. In the californium fraction, both spontaneous fission and a-activities due to 250, 252 were observed.

  19. Neutron-Activated Gamma-Emission: Technology Review

    Science.gov (United States)

    2012-01-01

    flux sources developed for boron neutron capture therapy ( BNCT ), found to be an experimental success in cancer treatment (26). 30 Improved flux on...achievable Am americium API associated particle imaging B boron Be beryllium BNCT boron neutron capture therapy C carbon Cf californium Cl

  20. An upper bound for the 242X-2006-25020-i1.gif"/> norm of a GCD-related matrix

    OpenAIRE

    Haukkanen Pentti

    2006-01-01

    We find an upper bound for the norm of the matrix whose entry is , where and are the greatest common divisor and the least common multiple of and and where and are real numbers. In fact, we show that if and , then for all positive integers , where is the Riemann zeta function.

  1. A multi-ethnic genome-wide association study identifies novel loci for non-syndromic cleft lip with or without cleft palate on 2p24.2, 17q23 and 19q13

    DEFF Research Database (Denmark)

    Leslie, Elizabeth J; Carlson, Jenna C; Shaffer, John R

    2016-01-01

    Orofacial clefts (OFCs), which include non-syndromic cleft lip with or without cleft palate (CL/P), are among the most common birth defects in humans, affecting approximately 1 in 700 newborns. CL/P is phenotypically heterogeneous and has a complex etiology caused by genetic and environmental...... (P = 4.17 × 10(-8)). Other regions reaching genome-wide significance were 1p36 (PAX7), 1p22 (ARHGAP29), 1q32 (IRF6), 8q24 and 17p13 (NTN1), all reported in previous GWASs. Stratification by ancestry group revealed a novel association with a region on 17q23 (P = 2.92 × 10(-8)) among individuals...... with European ancestry. This region included several promising candidates including TANC2, an oncogene required for development, and DCAF7, a scaffolding protein required for craniofacial development. In the Central and South American ancestry group, significant associations with loci previously identified...

  2. In vitro biosynthesis, isolation, and identification of predominant metabolites of 2-(4-(2-hydroxyethoxy)-3,5-dimethylphenyl)-5,7-dimethoxyquinazolin-4(3H)-one (RVX-208).

    Science.gov (United States)

    Khmelnitsky, Yuri L; Mozhaev, Vadim V; Cotterill, Ian C; Michels, Peter C; Boudjabi, Sihem; Khlebnikov, Vladimir; Madhava Reddy, M; Wagner, Gregory S; Hansen, Henrik C

    2013-06-01

    The structures of the two predominant metabolites (M4 and M5) of RVX-208, observed both in in vitro human and animal liver microsomal incubations, as well as in plasma from animal in vivo studies, were determined. A panel of biocatalytic systems was tested to identify biocatalysts suitable for milligram scale production of metabolite M4 from RVX-208. Rabbit liver S9 fraction was selected as the most suitable system, primarily based on pragmatic metrics such as catalyst cost and estimated yield of M4 (∼55%). Glucuronidation of RVX-208 catalyzed by rabbit liver S9 fraction was optimized to produce M4 in amounts sufficient for structural characterization. Structural studies using LC/MS/MS analysis and (1)H NMR spectroscopy showed the formation of a glycosidic bond between the primary hydroxyl group of RVX-208 and glucuronic acid. NMR results suggested that the glycosidic bond has the β-anomeric configuration. A synthetic sample of M4 confirmed the proposed structure. Metabolite M5, hypothesized to be the carboxylate of RVX-208, was prepared using human liver microsomes, purified by HPLC, and characterized by LC/MS/MS and (1)H NMR. The structure was confirmed by comparison to a synthetic sample. Both samples confirmed M5 as a product of oxidation of primary hydroxyl group of RVX-208 to carboxylic acid. Copyright © 2013 Elsevier Masson SAS. All rights reserved.

  3. A de novo subtelomeric monosomy 11q (11q24.2-qter) and trisomy 20q (20q13.3-qter) in a girl with findings compatible with Jacobsen syndrome: case report and review.

    Science.gov (United States)

    Courtens, Winnie; Wauters, Jan; Wojciechowski, Marek; Reyniers, Edwin; Scheers, Stefan; van Luijk, Rob; Rooms, Liesbeth; Kooy, Frank; Wuyts, Wim

    2007-10-01

    We report on a 2-year-old dysmorphic girl with prenatal and postnatal growth deficiency, cardiopathy, left-sided hydronephrosis due to pyelourethral junction stenosis, frequent respiratory infections and psychomotor retardation, in whom a de novo unbalanced submicroscopic translocation (11q;20q) was detected by subtelomeric multiplex ligation-dependent probe amplification and fluorescence in situ hybridization analyses. Additional fluorescence in situ hybridization studies with locus-specific BAC probes and analyses with microsatellite markers revealed that this translocation resulted in a paternal chromosome 11q terminal deletion of approximately 8.9 Mb and a subtelomeric 20q duplication of approximately 3.7 Mb. A subtelomeric 20q trisomy has only been reported in four cases so far. A subtelomeric 11q deletion has been clinically reported in 18 patients. We review the clinical phenotype of these patients. We suggest that patients with a subterminal (11q24.2/25-qter) deletion may present with features of the well-known phenotype of terminal 11q deletion or Jacobsen syndrome.

  4. Komentovaný překlad: Kul'turnost', gigiena i gender: sovetizacija "materinstva" v Rossii v 1920-1930-je gody (Julija Gradskova, Moskva 2007, s. 242-258)

    OpenAIRE

    Čarnoká Kreuzová, Michaela

    2014-01-01

    The bachelor thesis has two parts. The first part is a translation of the essay Culturnosť, Hygiene and Gender: Sovetization of "Motherhood" in Russia in the 1920s-1930s by Ioulia Gradskova. The second part is an expert commentary on the translation, which has five parts: analysis of the source text, approach to translation, method of translation, problems of translation and typology of translation shifts.

  5. A multi-ethnic genome-wide association study identifies novel loci for non-syndromic cleft lip with or without cleft palate on 2p24.2, 17q23 and 19q13

    DEFF Research Database (Denmark)

    Leslie, Elizabeth J; Carlson, Jenna C; Shaffer, John R

    2016-01-01

    factors. Previous genome-wide association studies (GWASs) have identified at least 15 risk loci for CL/P. As these loci do not account for all of the genetic variance of CL/P, we hypothesized the existence of additional risk loci. We conducted a multiethnic GWAS in 6480 participants (823 unrelated cases...

  6. A multi-ethnic genome-wide association study identifies novel loci for non-syndromic cleft lip with or without cleft palate on 2p24.2, 17q23 and 19q13

    Science.gov (United States)

    Leslie, Elizabeth J.; Carlson, Jenna C.; Shaffer, John R.; Feingold, Eleanor; Wehby, George; Laurie, Cecelia A.; Jain, Deepti; Laurie, Cathy C.; Doheny, Kimberly F.; McHenry, Toby; Resick, Judith; Sanchez, Carla; Jacobs, Jennifer; Emanuele, Beth; Vieira, Alexandre R.; Neiswanger, Katherine; Lidral, Andrew C.; Valencia-Ramirez, Luz Consuelo; Lopez-Palacio, Ana Maria; Valencia, Dora Rivera; Arcos-Burgos, Mauricio; Czeizel, Andrew E.; Field, L. Leigh; Padilla, Carmencita D.; Cutiongco-de la Paz, Eva Maria, C.; Deleyiannis, Frederic; Christensen, Kaare; Munger, Ronald G.; Lie, Rolv T.; Wilcox, Allen; Romitti, Paul A.; Castilla, Eduardo E.; Mereb, Juan C.; Poletta, Fernando A.; Orioli, Iêda M.; Carvalho, Flavia M.; Hecht, Jacqueline T.; Blanton, Susan H.; Buxó, Carmen J.; Butali, Azeez; Mossey, Peter A.; Adeyemo, Wasiu L.; James, Olutayo; Braimah, Ramat O.; Aregbesola, Babatunde S.; Eshete, Mekonen A.; Abate, Fikre; Koruyucu, Mine; Seymen, Figen; Ma, Lian; de Salamanca, Javier Enríquez; Weinberg, Seth M.; Moreno, Lina; Murray, Jeffrey C.; Marazita, Mary L.

    2016-01-01

    Orofacial clefts (OFCs), which include non-syndromic cleft lip with or without cleft palate (CL/P), are among the most common birth defects in humans, affecting approximately 1 in 700 newborns. CL/P is phenotypically heterogeneous and has a complex etiology caused by genetic and environmental factors. Previous genome-wide association studies (GWASs) have identified at least 15 risk loci for CL/P. As these loci do not account for all of the genetic variance of CL/P, we hypothesized the existence of additional risk loci. We conducted a multiethnic GWAS in 6480 participants (823 unrelated cases, 1700 unrelated controls and 1319 case–parent trios) with European, Asian, African and Central and South American ancestry. Our GWAS revealed novel associations on 2p24 near FAM49A, a gene of unknown function (P = 4.22 × 10−8), and 19q13 near RHPN2, a gene involved in organizing the actin cytoskeleton (P = 4.17 × 10−8). Other regions reaching genome-wide significance were 1p36 (PAX7), 1p22 (ARHGAP29), 1q32 (IRF6), 8q24 and 17p13 (NTN1), all reported in previous GWASs. Stratification by ancestry group revealed a novel association with a region on 17q23 (P = 2.92 × 10−8) among individuals with European ancestry. This region included several promising candidates including TANC2, an oncogene required for development, and DCAF7, a scaffolding protein required for craniofacial development. In the Central and South American ancestry group, significant associations with loci previously identified in Asian or European ancestry groups reflected their admixed ancestry. In summary, we have identified novel CL/P risk loci and suggest new genes involved in craniofacial development, confirming the highly heterogeneous etiology of OFCs. PMID:27033726

  7. Comment on ;Evolution of high-pressure mafic granulites and pelitic gneisses from NE Madagascar: Tectonic implications;. Tectonophysics, 662, 219-242 (2015) by Ishwar-Kumar et al.

    Science.gov (United States)

    Goncalves, Philippe; Brandt, Sönke; Nicollet, Christian; Tucker, Robert

    2017-05-01

    Determining the possible tectonic regimes active during the Neoproterozoic is crucial for the knowledge of the evolution of the super-continent Gondwana. In Madagascar, that occupies a key position in Gondwana, there is an on-going debate regarding the location of possible suture zones and the implications in terms of paleo-geography. Recognizing high-pressure to ultra-high pressure conditions in mafic rocks is commonly viewed as a strong argument for paleo-subduction zones. Ishwar-Kumar et al. (2015) report unusual high pressure conditions (24 kbar) in Neoproterozoic to Cambrian rocks from North-Central Madagascar (Andriamena Complex). They propose a geodynamic model in which exhumation of the high pressure terranes from up to 80 km to 40 km occurred via vertical extrusion during the collision of various crustal blocks after subduction and closure of an oceanic domain during the formation of Gondwana in the late Neoproterozoic to Cambrian. We question this model and in particular the (ultra-)high pressure conditions reported, because their estimation is based on a misinterpretation of the petrography and inaccurate thermodynamic modeling for the crucial metabasite sample. The authors suggest that garnet-quartz coronas around orthopyroxene and ilmenite coexist with clinopyroxene. The postulated garnet-clinopyroxene-quartz assemblage is interpreted to document an eclogite facies overprint. However, the presence of abundant plagioclase in the sample and the lack of high jadeite content in clinopyroxene clearly refute the postulated eclogite facies conditions. According to the presented photographs clinopyroxene is part of the rock matrix. We therefore suggest that the sample represents a common two-pyroxene granulite, formed at mid- to low-pressure granulite facies conditions of > 700 °C and Madagascar, this interpretation is not justified by the data presented by Ishwar-Kumar et al. (2015).

  8. Comida ritual em festas de Tambor de Mina no Maranhão (Ritual food in Maranhão’s Tambor De Mina festivities - DOI: 10.5752/P.2175-5841.2011v9n21p242

    Directory of Open Access Journals (Sweden)

    Sérgio Figueiredo Ferretti

    2011-07-01

    Full Text Available Resumo Tambor de Mina é o nome da religião afro-brasileira no Maranhão e na Amazônia estabelecida a partir de São Luís desde meados do século XIX. Existem duas casas fundadas por africanos que se continuam: a Casa das Minas Jeje, de origem daomeana e a Casa de Nagô, iorubana de onde derivam a maioria dos terreiros de Mina recentes e atuantes. Trata-se de religião muito ritualizada e discreta, envolvida em segredos e mistérios cuja mitologia é pouco comentada e os rituais muito desenvolvidos. As religiões afro-brasileiras se caracterizam pela realização de festas com transe, danças e comidas que atraem muitos participantes. A comida é bastante para oferecer a todos e distribuir as sobras. A fartura nas festas maiores constitui um dos elementos de prestígio das casas. O texto baseia-se em entrevistas com líderes de um terreiro antigo e de duas casas recentes, sobre comida de santo nas festas. Na linguagem de Mauss o sacrifício constitui obrigação que estabelece uma comunicação entre o mundo sagrado e o profano. O preparo e o consumo da comida de santo permitem conhecer aspectos do sincretismo e dos simbolismos nos rituais. Palavras-chave: Religiões afro-brasileiras; comida de santo; sincretismo; festas; ritual.   Abstract Tambor de Mina is the name of the Afro-Brazilian religion in Maranhão and Amazon established in São Luís (capital of Maranhão state since the mid-nineteenth century. There are two matrix-houses founded by Africans: Casa das Minas Jeje, a Dahomean origin house and Casa de Nagô, originally Yoruba and from which most of the Tambor de Mina's houses come from. It is a very ritualized and discrete religion, involved in secrets and mysteries whose mythology is not frequently commented upon and its rituals are highly developed. Afro-Brazilian religions are characterized by the performance of parties with trance, dance and food which attract many participants.  Food is enough to be offered to everyone and have the remains distributed. The abundance of food during the bigger festivities constitutes a prestige element to the houses. According to Mauss, sacrifice is an obligation that establishes communication between sacred and profane. The preparation and consumption of holy feast food allow us to know aspects of syncretism and symbolisms in rituals Keywords: Afro Brazilian religions; holy feast food; syncretism; festivals; ritual.

  9. ORF Alignment: NC_004757 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available RLDNLQALRTYIE 180 ... Query: 242 LVQAFHYEGLAHFDMRIDARDGKLYVIECNPRAWYTISASMWQGLNFIE 290 ... LVQAFHYEGLAHFDM...RIDARDGKLYVIECNPRAWYTISASMWQGLNFIE Sbjct: 241 LVQAFHYEGLAHFDMRIDARDGKLYVIECNPRAWYTISASMWQGLNFIE 289

  10. 40 CFR 52.1977 - Content of approved State submitted implementation plan.

    Science.gov (United States)

    2010-07-01

    ... Technology (7/1/01) 226-0140Additional Control Requirements for Stationary Sources of Air Contaminants (7/1... Testing Requirements (10/14/99) Spray Paint 242-0700Applicability (10/14/99) 242-0710Definitions (10/14/99) 242-0720Spray Paint Standards and Exemptions (10/14/99) 242-0730Requirements for Manufacture, Sale...

  11. ORF Alignment: NC_002977 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available YKPEDVT 180 ... Query: 242 NVDFPYLLAMLQNSFMSRHNSIVIPGGKMGLAMEIIFRPILERMMADR 289 ... NVDFPYLLAMLQNSFMSRHN...SIVIPGGKMGLAMEIIFRPILERMMADR Sbjct: 241 NVDFPYLLAMLQNSFMSRHNSIVIPGGKMGLAMEIIFRPILERMMADR 288

  12. Solid-State Neutron Multiplicity Counting System Using Commercial Off-the-Shelf Semiconductor Detectors

    Energy Technology Data Exchange (ETDEWEB)

    Rozhdestvenskyy, S. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

    2017-08-09

    This work iterates on the first demonstration of a solid-state neutron multiplicity counting system developed at Lawrence Livermore National Laboratory by using commercial off-the-shelf detectors. The system was demonstrated to determine the mass of a californium-252 neutron source within 20% error requiring only one-hour measurement time with 20 cm2 of active detector area.

  13. Cold valleys in the radioactive decay of 248−254Cf isotopes

    Indian Academy of Sciences (India)

    Geiger–Nuttal plots of log10(T1/2) vs. Q−1/2 for 48−52Ca emitting from various californium isotopes. Acknowledgement. One of the authors (KPS) would like to thank University Grants Commis- sion, Govt. of India for the financial support under project No. MRP(S)-. 352/2005(X Plan)/KLKA 002/UGC-SWRO. References.

  14. Directed evolution of the periodic table: probing the electronic structure of late actinides.

    Science.gov (United States)

    Marsh, M L; Albrecht-Schmitt, T E

    2017-07-25

    Recent investigations of the coordination chemistry and physical properties of berkelium (Z = 97) and californium (Z = 98) have revealed fundamental differences between post-curium elements and lighter members of the actinide series. This review highlights these developments and chronicles key findings and concepts from the last half-century that have helped usher in a new understanding of the evolution of electronic structure in the periodic table.

  15. Open Source: Potential in Latin America for Radiological Weapons

    Science.gov (United States)

    2010-03-01

    terrorist group would need to acquire a radioactive isotope with a relatively short half-life. 36,37 As an aside, the IAEA verified that depleted...cns.miis.edu/npr/pdfs/123salama.pdf (accessed March 3, 2010), Useful RDD isotopes include cobalt-60, strontium-90, yttrium-90, iridium-192, cesium-137...plutonium-238, radium -226, americium-241, and californium-252. 37 Hansell and Salama, “Does intent equal capability?,” 640-641. 38 Internation Atomic

  16. Dicty_cDB: [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VF (Link to library) VFC242 (Link to dictyBase) - - - Contig-U16280-1 VFC242F (Link... to Original site) VFC242F 431 - - - - - - Show VFC242 Library VF (Link to library) Clone ID VFC242 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16280-1 Original site URL http://dict...3( S18663 ) coronin - slime mold (Dictyostelium discoideum) ... 270 1e-71 AY52578...asmic 4.0 %: cytoskeletal 4.0 %: vesicles of secretory system >> prediction for VFC242 is nuc 5' end seq. ID

  17. ORF Alignment: NC_004315 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NNIAYAKAYNCDHQTELLIDASAMMADARF 242 ... CLWIDTEGTFRPERIVAIAKRYGLHPTDCLNNIAYAKAYNCDHQTELLIDASAMMADARF S...bjct: 121 CLWIDTEGTFRPERIVAIAKRYGLHPTDCLNNIAYAKAYNCDHQTELLIDASAMMADARF 180 ... Query... ... DLELLKEGGLQTVECVAYAPMRTLCAIKGISEQKAEKLKKACKELCNSGFCNAIDYHDAR 60 ... Query: 183 CLWIDTEGTFRPERIVAIAKRYGLHPTDCL

  18. GETDB: 103550 [GETDB

    Lifescience Database Archive (English)

    Full Text Available onal Institute of Genetics. FM7c Link to clone table - 1 242 Link to cluster table 242 1 Request - cns, mg, good driver...er table 242 Num of clusters 1 Stock Request Request - Embryonic Expression cns, mg, good driver Larval GFP

  19. The Majority of Library Clients Still Use Person-to-Person Interaction When Asking Reference Questions. A review of: De Groote, Sandra L. “Questions Asked at the Virtual and Physical Health Sciences Reference Desk: How Do They Compare and What Do They Tell Us?” Medical Reference Services Quarterly 24.2 (Summer 2005: 11-23.

    Directory of Open Access Journals (Sweden)

    Suzanne Pamela Lewis

    2006-03-01

    Full Text Available Objective - To identify similarities and difference in the questions asked at the virtual and physical refernece desks of a helath scienmces library, in order to better undertand user needs and highlight areas for service improvement. Also to retrospectively analyze reference statistics collected over the previous six years. Design - Use study; retrospective study of reference statistics for the period July 1997 to June 2003; literature review. Setting - Large academic helath sciences library in the United States. Subjects - All questions asked at the reference and information desks, plus questions submitted to the University-wide virtual reference service and answered by a health sciences librarian, over a period of one month. The questions were asked by faculty, staff, students and members of the public. Methods - A literature review was carried out to examine the types of information/reference questions typically asked in health sciences libraries both before and after the mass introduction of remote end-user searching of online resources and the establishment of virtual reference services. Next, the reference statistics collected at the University of Illinois at Chicage (UIC Library of the Health Sciences between July 1997 and June 2003 were examined. For most of this period a digital reference service was offered using a listserv address to which patrons would submit email queries. Beginning in March 2003, a formal virtual reference service (chat and email was provided using commercial software. Finally, data was gathered on questions answered by a health sciences librarians, and clients who asked the question, at either the physical or cirtual reference desk, during the month of November 2003 at the UIC Library of the Health Sciences. Library staff completed an online survey form for each question, and if a client asked more than one question, each question was coded individually. Data included: status of client using the service (faculty/staff. undergarduate student, graduate student, non0UIC, unknown; mode of submission (email, chat, phone, in person; and type of question asked (directional, ready reference, in-depth/mediated, instructional, technical, accounts/status and other. In subsequent analysis, the original seven types of questions were further broken down into 19 categories. Main results - It was not possible to undertake a meta-analysis or systematic review of the studies identified in the literature review because of differences in time frames, settings and the categories used to code reference questions. However the following trends emerged: directional questions accounted for between 30 and 35% of questions asked at both the physical and virtual reference desks; the remainder of questions were generally about known item searched, library policies and services, research, dadabase use and quick reference. The statistics collected at UIC Library of the Health Sciences over the period July 1997 to June 2003 were analyzed. Coded reference questions fell into one of four categories; ready reference, in-depth reference, mediated searched and digital reference. There was a noticeable drop in the number of reference questions received in 1999/2000 which reflects trends reported in some of the studies identified in the literature review. The number of mediated searches decreased from 154 in 1997-98 to 4 in 2002/2003, but the number of digital reference questions increased from 0 to 508 in the same period. Statistics were collected over the month of November 2003 for 939 questions asked at the reference and information desks which included: 38 email; 48 chat; 156 phone; and 697 in person. The major findings were as follows: - appoximately 55% of questions were reference questions (33.5% ready reference, 9.7% in-depth/mediated, 9.7% instructional; 30% were directional; and 10% were technical; it is not stated what the remaining 5% of questions were; - library clients who asked the questions comprised graduate students (26%, faculty (24%, undergraduate students (24% and non-UIC patrons (22%; - all groups were most likely to ask their reference questions in person; - graduate students were the largest group of email reference (34%, undergraduates were the largest group to use chat (35% and faculty/staff were the largest group to use the telephone (39%; - 28% of the questions were answered from the library's staff's general knowledge of the library; 22% using the online catalogue or electronic journals list; 22% by referrning the patron to, or using an online database or resource; 13% by referring the patron to another department in the library (such as circulation; 7% by consulting another individual; and 5% by using print resources. Conclusion - The results of the three parts of this study - literature review, study of 1997-2003 statistics, and in-depth collection of statistics for November 2003 - are difficult to compare with each other. However, the general trend emerging from the results is that some kinds of questions asked by health sciences library clients have remained very much the same regardless of the rise of remote end-user searching and the mode of transmission of the questions. These include questions about library policies and services, journal and book holdings, database searching and instructional support. Questions about citation verification and consumer health appear to be decreasing while technical questions and questions about accessing remote databases and online journals are increasing. The majority of reference questions are still asked in person.

  20. Slovenski pravopis, I. Pravila /Dictionnaire d'orthographe slovène. Première partie. Règles/. Comité de rédaction: Jože Toporišič et"alii. SAZU-Državna založba Slovenije, Ljubljana 1990, pags. 242.

    Directory of Open Access Journals (Sweden)

    Mitja Skubic

    1990-12-01

    Full Text Available L'Académie des Sciences et des Arts Slovène (SAZU est en train de publier le Dictionnaire d'orthographe dont Les Règles forment Ia partie d'introduction. Le volume n'est pas simplement un manuel de l'art d'écrire; il est aussi un manuel d'orthoépie et, sans être une grammaire, un panorama des points problématiques de morphologie et de composition slovène.

  1. Three independently deleted regions at chromosome arm 16q in human prostate cancer: allelic loss at 16q24.1?q24.2 is associated with aggressive behaviour of the disease, recurrent growth, poor differentiation of the tumour and poor prognosis for the patient

    OpenAIRE

    Elo, J P; H?rk?nen, P; Kyll?nen, A P; Lukkarinen, O.; Vihko, P

    1999-01-01

    Loss of heterozygosity at chromosome arm 16q is a frequent event in human prostate cancer. In this study, loss of heterozygosity at 16q was studied in 44 prostate cancer patients exhibiting various clinical features. Fifteen polymorphic polymerase chain reaction (PCR) markers were used to identify the separately deleted areas and the findings were compared with clinicopathological variables and 5-year survival of the patients. The results indicated that there are at least three independently ...

  2. PROCEEDINGS OF THE SYMPOSIUM COMMEMORATING THE 25th ANNIVERSARY OF ELEMENTS 97 and 98 HELD ON JAN. 20, 1975

    Energy Technology Data Exchange (ETDEWEB)

    Seaborg, Glenn T.; Street Jr., Kenneth; Thompson, Stanley G.; Ghiorso, Albert

    1976-07-01

    This volume includes the talks given on January 20, 1975, at a symposium in Berkeley on the occasion of the celebration of the 25th anniversary of the discovery of berkelium and californium. Talks were given at this symposium by the four people involved in the discovery of these elements and by a number of people who have made significant contributions in the intervening years to the investigation of their nuclear and chemical properties. The papers are being published here, without editing, in the form in which they were submitted by the authors in the months following the anniversary symposium, and they reflect rather faithfully the remarks made on that occasion.

  3. Composition containing transuranic elements for use in the homeopathic treatment of aids

    Energy Technology Data Exchange (ETDEWEB)

    Lustig, D.

    1996-04-18

    A homeopathic remedy consisting of a composition containing one or more transuranic elements, particularly plutonium, for preventing and treating acquired immunodeficiency syndrome (AIDS) in humans, as well as seropositivity for human immunodeficiency virus (HIV). Said composition is characterized in that it uses any chemical or isotopic form of one or more transuranic elements (neptunium, plutonium, americium, curium, berkelium, californium or einsteinium), particularly plutonium, said form being diluted and dynamized according to conventional homeopathic methods, particularly the so-called Hahnemann and Korsakov methods, and provided preferably but not exclusively in the form of lactose and/or saccharose globules or granules impregnated with the active principle of said composition. (author).

  4. Advanced development of the spectrum sciences Model 5005-TF, single-event test fixture

    Energy Technology Data Exchange (ETDEWEB)

    Ackermann, M.R.; Browning, J.S. (Sandia National Labs., Albuquerque, NM (USA)); Hughlock, B.W. (Boeing Aerospace and Electronics Co., Seattle, WA (USA)); Lum, G.K. (Lockheed Missiles and Space Co., Sunnyvale, CA (USA)); Tsacoyeanes, W.C. (Draper (Charles Stark) Lab., Inc., Cambridge, MA (USA)); Weeks, M.D. (Spectrum Sciences, Inc., Santa Clara, CA (USA))

    1990-09-01

    This report summarizes the advanced development of the Spectrum Sciences Model 5005-TF, Single-Event Test Fixture. The Model 5005-TF uses a Californium-252 (Cf-252) fission-fragment source to test integrated circuits and other devices for the effects of single-event phenomena. Particle identification methods commonly used in high-energy physics research and nuclear engineering have been incorporated into the Model 5005-TF for estimating the particle charge, mass, and energy parameters. All single-event phenomena observed in a device under test (DUT) are correlated with an identified fission fragment, and its linear energy transfer (LET) and range in the semiconductor material of the DUT.

  5. TOWARD AN IMPROVED UNDERSTANDING OF STRUCTURE AND MAGNETISM IN NEPTUNIUM AND PLUTONIUM PHOSPHONATES AND SULFONATES

    Energy Technology Data Exchange (ETDEWEB)

    Albrecht-Schmitt, Thomas

    2012-03-01

    This grant supported the exploratory synthesis of new actinide materials with all of the actinides from thorium to californium with the exceptions of protactinium and berkelium. We developed detailed structure-property relationships that allowed for the identification of novel materials with selective ion-exchange, selective oxidation, and long-range magnetic ordering. We found novel bonding motifs and identified periodic trends across the actinide series. We identified structural building units that would lead to desired structural features and novel topologies. We also characterized many different spectroscopic trends across the actinide series. The grant support the preparation of approximately 1200 new compounds all of which were structurally characterized.

  6. Detection of rare earth elements in Powder River Basin sub-bituminous coal ash using laser-induced breakdown spectroscopy (LIBS)

    Energy Technology Data Exchange (ETDEWEB)

    Tran, Phuoc [National Energy Technology Lab. (NETL), Pittsburgh, PA, (United State; Mcintyre, Dustin [National Energy Technology Lab. (NETL), Pittsburgh, PA, (United State

    2015-10-01

    We reported our preliminary results on the use of laser-induced breakdown spectroscopy to analyze the rare earth elements contained in ash samples from Powder River Basin sub-bituminous coal (PRB-coal). We have identified many elements in the lanthanide series (cerium, europium, holmium, lanthanum, lutetium, praseodymium, promethium, samarium, terbium, ytterbium) and some elements in the actinide series (actinium, thorium, uranium, plutonium, berkelium, californium) in the ash samples. In addition, various metals were also seen to present in the ash samples

  7. Plate Tectonics: A Paradigm under Threat.

    Science.gov (United States)

    Pratt, David

    2000-01-01

    Discusses the challenges confronting plate tectonics. Presents evidence that contradicts continental drift, seafloor spreading, and subduction. Reviews problems posed by vertical tectonic movements. (Contains 242 references.) (DDR)

  8. Dicty_cDB: Contig-U13204-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available (81), Expect = 0.48 Identities = 17/69 (24%), Positives = 26/69 (37%) Frame = -3 Query: 242 YYFYYSHY...(81), Expect = 0.48 Identities = 17/69 (24%), Positives = 26/69 (37%) Frame = -3 Query: 242 YYFYYSHY...(79), Expect = 0.82 Identities = 17/70 (24%), Positives = 27/70 (38%) Frame = -3 Query: 242 YYFYYSHY...bits (78), Expect = 1.1 Identities = 17/69 (24%), Positives = 26/69 (37%) Frame = -3 Query: 242 YYFYYSHY

  9. Comparison of fission and capture cross sections of minor actinides

    CERN Document Server

    Nakagawa, T

    2003-01-01

    The fission and capture cross sections of minor actinides given in JENDL-3.3 are compared with other evaluated data and experimental data. The comparison was made for 32 nuclides of Th-227, 228, 229, 230, 233, 234, Pa-231, 232, 233, U-232, 234, 236, 237, Np-236, 237, 238, Pu-236, 237, 238, 242, 244, Am-241, 242, 242m, 243, Cm-242, 243, 244, 245, 246, 247 and 248. Given in the present report are figures of these cross sections and tables of cross sections at 0.0253 eV and resonance integrals.

  10. ORF Alignment: NC_003413 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available TVLIRRECFKKAGLFDPKLPSSQDWDM 183 ... VSQQNERIIGKRLPRFRGNVYGELLKENFIGSPTVLIRRECFKKAGLFDPKLPSSQDWDM Sbjc...t: 121 VSQQNERIIGKRLPRFRGNVYGELLKENFIGSPTVLIRRECFKKAGLFDPKLPSSQDWDM 180 ... Query: 244 GL 245 ... GL Sbjct: 241 GL 242 ...TVSVIIPTHNRAKLLKRAIISVLNQTFEDFEIIVVDDASSDNTPNIIESIKDSRIRYIR 60 ... Query: 124 VSQQNERIIGKRLPRFRGNVYGELLKENFIGSP

  11. ORF Alignment: NC_003155 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available VQSGVSAAIRSLERELGCALFERTSQQVRLTGAG 60 ... Query: 122 VRLRLATTGSAGLAHALLSGDLDVAFLSLPEHKPAGIDARELATVPLVLVVSADHPLA...QR 181 ... VRLRLATTGSAGLAHALLSGDLDVAFLSLPEHKPAGIDARELATVPLVLVVSADHPLAQR Sb...jct: 121 VRLRLATTGSAGLAHALLSGDLDVAFLSLPEHKPAGIDARELATVPLVLVVSADHPLAQR 180 ... Query: 242 FLPAFAVARTPGLHVLDVHGTM

  12. Radiochemical determination of the neutron capture cross sections of {sup 241}Am irradiated in the JMTR reactor

    Energy Technology Data Exchange (ETDEWEB)

    Shinohara, N.; Hatsukawa, Y.; Hata, K.; Kohno, N. [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment

    1997-03-01

    The thermal neutron capture cross section {sigma}{sub 0} and Resonance integral I{sub 0} of {sup 241}Am leading to the production of {sup 242m}Am and {sup 242g}Am were measured by radiochemical method. The cross sections obtained in this study are {sigma}{sub 0}=60.9 {+-} 2.6 barn, I{sub 0}=213 {+-} 13 barn for {sup 241}Am(n,{gamma}){sup 242m}Am and {sigma}{sub 0}=736 {+-} 31 barn, I{sub 0}=1684 {+-} 92 barn for {sup 241}Am(n,{gamma}){sup 242g}Am. (author)

  13. Gclust Server: 14885 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available 08 Cluster Sequences Related Sequences(29) 242 basic helix-loop-helix (bHLH) family protein 7 1.00e-35...Sequences(29) Sequence length 242 Representative annotation basic helix-loop-helix (bHLH) family protein Number of

  14. 75 FR 71564 - Defense Federal Acquisition Regulation Supplement; Contractor Insurance/Pension Review (DFARS...

    Science.gov (United States)

    2010-11-24

    ... Regulation Supplement; Contractor Insurance/Pension Review (DFARS Case 2009-D025) AGENCY: Defense Acquisition.../Pension Review from Procedures, Guidance, and Information (PGI) to the Defense Federal Acquisition... requirements for Contractor Insurance/ Pension Review to DFARS 242.7302 from PGI 242.7302. DoD published a...

  15. Dicty_cDB: SLB321 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available . 242 6e-63 S26582( S26582 ) chaperonin hsp60 - maize &Z12114_1(Z12114|pid:no... 242 6e-63 S20875( S20875...S20875 ;S34488;S19844) chaperonin hsp60 precursor - maize ... 241 1e-62 L21007_1( L21007 |pid:none) Corn

  16. Summary of a Workshop on Plant Canopy Structure, 27-30 April 1981, Oak Ridge, Tennessee.

    Science.gov (United States)

    1982-08-01

    Forest Experiment Station Leslie Morrisey USFS NASA P.O. Box 898 V Ames Research Center Rhinelander, WI 54501 Mail Stop 242-4 Moffitt Field, CA 49035...Research Center Oak Ridge, TN 37830 Mail Stop 242-4 Moffitt Field, CA 49035 Dr. Paul Jarvis Dept. of Forestry and Natural Dr. John M. Norman Resources

  17. Methods and Procedures in Screening Gifted Mayan Students

    Science.gov (United States)

    Escobedo, Pedro Sanchez

    2008-01-01

    Instruments, procedures, and criteria for the screening of Mayan students in Yucatan, Mexico are depicted and evaluated by analyzing the results of their use on 242 students in five different regions of Yucatan. These 242, 8th grade students were selected from a pool of 1,530 potentially gifted students. Participants responded to a variety of…

  18. Drug: D04002 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D04002 Drug Enofelast (USAN/INN) C16H15FO 242.1107 242.2881 D04002.gif Anti-asthmat...ic CAS: 127035-60-3 PubChem: 17397997 LigandBox: D04002 NIKKAJI: J328.571E ATOM 18 1 C8y C 27.3895 -19.4789

  19. Dicty_cDB: Contig-U11690-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available = 190/190 (100%) Strand = Plus / Plus Query: 182 gatgnagatatcnttcaaagatttaatccnattagnntggtcntttcnatnaaaccna...aa 241 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 182 gatgnagatatcnttcaaagatttaatccna...ttagnntggtcntttcnatnaaaccnaaa 241 Query: 242 tnggattnntcnattaggccatatnttttnaaan... = 9e-41 Identities = 189/189 (100%) Strand = Plus / Minus Query: 183 atgnagatatcnttcaaagatttaatccna...ttagnntggtcntttcnatnaaaccnaaat 242 ||||||||||||||||||||||||||||||||||||||||||||||||||||||

  20. 75 FR 71479 - Self-Regulatory Organizations; Financial Industry Regulatory Authority, Inc.; Notice of Filing of...

    Science.gov (United States)

    2010-11-23

    ... in FINRA Rule 2090 encompasses the main ethical standard of NYSE Rule 405(1). As proposed, the rule... strategies they recommend. \\10\\ See, e.g., SEC Regulation NMS (National Market System), 17 CFR 242.600-242... products (such as options, futures or penny stocks) or engage in certain strategies (such as day trading...

  1. Browse Title Index

    African Journals Online (AJOL)

    Items 201 - 242 of 242 ... NE Ngim, IA Ikpeme, AM Udosen. Vol 9, No 1 (2010), Treatment of femoral neck fracture by Moore Prosthesis in Cotonou, Abstract. AHM Akue, M Lawson, S Madougou, R Zannou, J Padonou. Vol 11, No 2 (2012), Treatment of Forefoot Plantar Ulcers in Leprosy: Our Experience, Abstract. JN Kortor, ET ...

  2. Zebrafish model of tuberous sclerosis complex reveals cell-autonomous and non-cell-autonomous functions of mutant tuberin

    Directory of Open Access Journals (Sweden)

    Seok-Hyung Kim

    2011-03-01

    Tuberous sclerosis complex (TSC is an autosomal dominant disease caused by mutations in either the TSC1 (encodes hamartin or TSC2 (encodes tuberin genes. Patients with TSC have hamartomas in various organs throughout the whole body, most notably in the brain, skin, eye, heart, kidney and lung. To study the development of hamartomas, we generated a zebrafish model of TSC featuring a nonsense mutation (vu242 in the tsc2 gene. This tsc2vu242 allele encodes a truncated Tuberin protein lacking the GAP domain, which is required for inhibition of Rheb and of the TOR kinase within TORC1. We show that tsc2vu242 is a recessive larval-lethal mutation that causes increased cell size in the brain and liver. Greatly elevated TORC1 signaling is observed in tsc2vu242/vu242 homozygous zebrafish, and is moderately increased in tsc2vu242/+ heterozygotes. Forebrain neurons are poorly organized in tsc2vu242/vu242 homozygous mutants, which have extensive gray and white matter disorganization and ectopically positioned cells. Genetic mosaic analyses demonstrate that tsc2 limits TORC1 signaling in a cell-autonomous manner. However, in chimeric animals, tsc2vu242/vu242 mutant cells also mislocalize wild-type host cells in the forebrain in a non-cell-autonomous manner. These results demonstrate a highly conserved role of tsc2 in zebrafish and establish a new animal model for studies of TSC. The finding of a non-cell-autonomous function of mutant cells might help explain the formation of brain hamartomas and cortical malformations in human TSC.

  3. Measurements of the neutron capture cross sections and incineration potentials of minor-actinides in high thermal neutron fluxes: Impact on the transmutation of nuclear wastes; Mesures des sections efficaces de capture et potentiels d'incineration des actinides mineurs dans les hauts flux de neutrons: Impact sur la transmutation des dechets

    Energy Technology Data Exchange (ETDEWEB)

    Bringer, O

    2007-10-15

    This thesis comes within the framework of minor-actinide nuclear transmutation studies. First of all, we have evaluated the impact of minor actinide nuclear data uncertainties within the cases of {sup 241}Am and {sup 237}Np incineration in three different reactor spectra: EFR (fast), GT-MHR (epithermal) and HI-HWR (thermal). The nuclear parameters which give the highest uncertainties were thus highlighted. As a result of fact, we have tried to reduce data uncertainties, in the thermal energy region, for one part of them through experimental campaigns in the moderated high intensity neutron fluxes of ILL reactor (Grenoble). These measurements were focused onto the incineration and transmutation of the americium-241, the curium-244 and the californium-249 isotopes. Finally, the values of 12 different cross sections and the {sup 241}Am isomeric branching ratio were precisely measured at thermal energy point. (author)

  4. A gas secondary electron detector

    CERN Document Server

    Drouart, A; Alamanos, N; Auger, F; Besson, P; Bougamont, E; Bourgeois, P; Lobo, G; Pollacco, E C; Riallot, M

    2002-01-01

    A new Secondary Electron gas Detector (SED) is under development to be used in conjunction with an emissive foil to detect low energy heavy ions as an alternative to micro-channel plates. It could measure position and time of flight. Secondary electrons are accelerated to 10 keV so that they can cross through the 0.9 mu m Mylar entrance window. The electrons then are multiplied in the isobutane gas of the detector at 4-10 Torr. A time resolution of 150 ps and a spatial resolution of 3 mm have been obtained by using californium fission fragments on a prototype detector of 7x7 cm sup 2. The advantage of the SED against MCP is that its size is not limited. Our final goal is to build a large size detector (15x40 cm sup 2) that will operate at the focal plane of the VAMOS magnetic spectrometer at GANIL.

  5. Environmental assessment of the thermal neutron activation explosive detection system for concourse use at US airports

    Energy Technology Data Exchange (ETDEWEB)

    Jones, C.G.

    1990-08-01

    This document is an environmental assessment of a system designed to detect the presence of explosives in checked airline baggage or cargo. The system is meant to be installed at the concourse or lobby ticketing areas of US commercial airports and uses a sealed radioactive source of californium-252 to irradiate baggage items. The major impact of the use of this system arises from direct exposure of the public to scattered or leakage radiation from the source and to induced radioactivity in baggage items. Under normal operation and the most likely accident scenarios, the environmental impacts that would be created by the proposed licensing action would not be significant. 44 refs., 19 figs., 18 tabs.

  6. Chelation and stabilization of berkelium in oxidation state +IV

    Science.gov (United States)

    Deblonde, Gauthier J.-P.; Sturzbecher-Hoehne, Manuel; Rupert, Peter B.; An, Dahlia D.; Illy, Marie-Claire; Ralston, Corie Y.; Brabec, Jiri; de Jong, Wibe A.; Strong, Roland K.; Abergel, Rebecca J.

    2017-09-01

    Berkelium (Bk) has been predicted to be the only transplutonium element able to exhibit both +III and +IV oxidation states in solution, but evidence of a stable oxidized Bk chelate has so far remained elusive. Here we describe the stabilization of the heaviest 4+ ion of the periodic table, under mild aqueous conditions, using a siderophore derivative. The resulting Bk(IV) complex exhibits luminescence via sensitization through an intramolecular antenna effect. This neutral Bk(IV) coordination compound is not sequestered by the protein siderocalin—a mammalian metal transporter—in contrast to the negatively charged species obtained with neighbouring trivalent actinides americium, curium and californium (Cf). The corresponding Cf(III)-ligand-protein ternary adduct was characterized by X-ray diffraction analysis. Combined with theoretical predictions, these data add significant insight to the field of transplutonium chemistry, and may lead to innovative Bk separation and purification processes.

  7. The CARIBU EBIS control and synchronization system

    Science.gov (United States)

    Dickerson, Clayton; Peters, Christopher

    2015-01-01

    The Californium Rare Isotope Breeder Upgrade (CARIBU) Electron Beam Ion Source (EBIS) charge breeder has been built and tested. The bases of the CARIBU EBIS electrical system are four voltage platforms on which both DC and pulsed high voltage outputs are controlled. The high voltage output pulses are created with either a combination of a function generator and a high voltage amplifier, or two high voltage DC power supplies and a high voltage solid state switch. Proper synchronization of the pulsed voltages, fundamental to optimizing the charge breeding performance, is achieved with triggering from a digital delay pulse generator. The control system is based on National Instruments realtime controllers and LabVIEW software implementing Functional Global Variables (FGV) to store and access instrument parameters. Fiber optic converters enable network communication and triggering across the platforms.

  8. Off-line commissioning of EBIS and plans for its integration into ATLAS and CARIBU

    Energy Technology Data Exchange (ETDEWEB)

    Ostroumov, P. N., E-mail: ostroumov@anl.gov; Barcikowski, A.; Dickerson, C. A.; Mustapha, B.; Perry, A.; Sharamentov, S. I.; Vondrasek, R. C.; Zinkann, G. [Argonne National Laboratory, Argonne, Illinois 60439 (United States)

    2016-02-15

    An Electron Beam Ion Source Charge Breeder (EBIS-CB) has been developed at Argonne to breed radioactive beams from the CAlifornium Rare Isotope Breeder Upgrade (CARIBU) facility at Argonne Tandem Linac Accelerator System (ATLAS). The EBIS-CB will replace the existing ECR charge breeder to increase the intensity and significantly improve the purity of reaccelerated radioactive ion beams. The CARIBU EBIS-CB has been successfully commissioned offline with an external singly charged cesium ion source. The performance of the EBIS fully meets the specifications to breed rare isotope beams delivered from CARIBU. The EBIS is being relocated and integrated into ATLAS and CARIBU. A long electrostatic beam transport system including two 180° bends in the vertical plane has been designed. The commissioning of the EBIS and the beam transport system in their permanent location will start at the end of this year.

  9. Populations of selected microbial and fungal species growing on the surface of rape seeds following treatment with desiccants or plant growth regulators.

    Science.gov (United States)

    Frac, Magdalena; Jezierska-Tys, Stefania; Tys, Jerzy

    2010-01-01

    The aim of this study was to determine the effects of desiccants and plant growth regulators on selected microbial species affecting rape seeds, with special emphasis on the growth of fungi and identification of the genus and species composition. The experimental material in the study was seeds of winter rape cv. Californium that were collected from the field during combine harvest. The chemical agents applied, both desiccants and growth regulators, generally decreased the populations of bacteria occurring on the surface of rape seeds. The responses of fungi depended upon the type of agent applied and were manifested as either stimulation or inhibition of the growth of the fungal species. The fungi isolated from the surface of rape seeds were characteristic of those found in the field environment (Cladosporium and Penicillium) and typical for those present on the surface of rape seeds (Alternaria).

  10. Reliability of semiconductor and gas-filled diodes for over-voltage protection exposed to ionizing radiation

    Directory of Open Access Journals (Sweden)

    Stanković Koviljka

    2009-01-01

    Full Text Available The wide-spread use of semiconductor and gas-filled diodes for non-linear over-voltage protection results in a variety of possible working conditions. It is therefore essential to have a thorough insight into their reliability in exploitation environments which imply exposure to ionizing radiation. The aim of this paper is to investigate the influence of irradiation on over-voltage diode characteristics by exposing the diodes to californium-252 combined neutron/gamma radiation field. The irradiation of semiconductor over-voltage diodes causes severe degradation of their protection characteristics. On the other hand, gas-filled over-voltage diodes exhibit a temporal improvement of performance. The results are presented with the accompanying theoretical interpretations of the observed changes in over-voltage diode behaviour, based on the interaction of radiation with materials constituting the diodes.

  11. Triton and alpha-particle contribution from LiF converter for neutron dosimeter

    CERN Document Server

    Camacho, M E; Balcazar, M

    1999-01-01

    A personnel neutron dosimeter prototype based on chemical and electrochemical etched CR-39 detector, combined with LiF converter, has been calibrated using an ICRP-like phantom, under a heavy-water moderated Californium source neutron spectra; A conversion factor of 1.052+-126 spots cm sup - sup 2 mSv sup - sup 1 was obtained. The sealing properties of the detector holder showed a ten-fold reduction in radon background when it was tested in a high radon atmosphere. A convenient mechanical shock resistance was achieved in LiF converters by sintering to 11 tons pressure LiF powder at 650 deg. C, during one hour.

  12. Multiple introductions and onward transmission of HIV-1 subtype B strains in Shanghai, China.

    Science.gov (United States)

    Li, Xiaoshan; Zhu, Kexin; Xue, Yile; Wei, Feiran; Gao, Rong; Duerr, Ralf; Fang, Kun; Li, Wei; Song, Yue; Du, Guoping; Yan, Wenjuan; Musa, Taha Hussein; Ge, You; Ji, Yu; Zhong, Ping; Wei, Pingmin

    2017-08-01

    To investigate the viral genetic evolution, spatial origins and patterns of transmission of HIV-1 subtype B in Shanghai, China. A total of 242 Shanghai subtype B and 1519 reference pol sequences were subjected to phylogenetic inference and genetic transmission network analyses. Phylogenetic analysis revealed that subtype B strains circulating in Shanghai were genetically diverse and closely associated with viral sequence lineages in Beijing (76 of 242 [31.4%]), Central China (Henan/Hebei/Hunan/Hubei) (43 of 242 [17.8%]), Chinese Taiwan (20 of 242 [8.3%]), Japan (6 of 242 [2.5%]), and Korea (7 of 242 [2.9%]), suggesting multiple introductions into Shanghai from mainland China and Taiwan, Japan, and Korea. Interestingly, a monophyletic Shanghai lineage (SH-L) (36 of 242 [14.9%]) of HIV-1 subtype B most likely originated from an Argentine strain, transferred through Liaoning infected individuals. In-depth analyses of 195 Shanghai subtype B sequences revealed that a total of 37.9% (n = 74) sequences contributed to 35 transmission networks, whereof 33.8% (n = 25) of the sequences associated with infected individuals from other provinces. Our new findings reflect the evolution complexity and transmission dynamics of HIV-1 subtype B in Shanghai, which would provide critical information for the design of effective prevention measures against HIV transmission. Copyright © 2017 The British Infection Association. Published by Elsevier Ltd. All rights reserved.

  13. Cyclin B Translation Depends on mTOR Activity after Fertilization in Sea Urchin Embryos

    Science.gov (United States)

    Boulben, Sandrine; Glippa, Virginie; Morales, Julia; Cormier, Patrick

    2016-01-01

    The cyclin B/CDK1 complex is a key regulator of mitotic entry. Using PP242, a specific ATP-competitive inhibitor of mTOR kinase, we provide evidence that the mTOR signalling pathway controls cyclin B mRNA translation following fertilization in Sphaerechinus granularis and Paracentrotus lividus. We show that PP242 inhibits the degradation of the cap-dependent translation repressor 4E-BP (eukaryotic initiation factor 4E-Binding Protein). PP242 inhibits global protein synthesis, delays cyclin B accumulation, cyclin B/CDK1 complex activation and consequently entry into the mitotic phase of the cell cycle triggered by fertilization. PP242 inhibits cyclin B mRNA recruitment into active polysomes triggered by fertilization. An amount of cyclin B mRNA present in active polysomes appears to be insensitive to PP242 treatment. Taken together, our results suggest that, following sea urchin egg fertilization, cyclin B mRNA translation is controlled by two independent mechanisms: a PP242-sensitive and an additional PP242-insentitive mechanism. PMID:26962866

  14. Study of reproducibility of measurements with the spectrometer of Bonner multispheres

    Energy Technology Data Exchange (ETDEWEB)

    Azevedo, G.A.; Pereira, W.W.; Patrao, K.C.S.; Fonseca, E.S., E-mail: geisadeazevedo@gmail.com, E-mail: walsan@ird.gov.br, E-mail: karla@ird.gov.br, E-mail: evaldo@ird.gov.br [Instituto de Radionprotecao e Dosimetria (IRD/CNEN-RJ), Rio de Janeiro, RJ (Brazil)

    2013-07-01

    This work aims to study the metrological behavior of the Bonner Multisphere Spectrometer (BMS) of the LN / LNMRI / IRD - Laboratorio Metrologia de Neutrons / Laboratorio Nacional de Metrologia e Radiacao Ionizante / Instituto de Radioprotecao e Dosimetria, for measurements in repeatability and reproducibility conditions. Initially, a simulation was done by applying the Monte Carlo method, using the MCNP code and respecting the ISO 8529-1 (2001), using the sources of Californium ({sup 252} Cf), Americium-Beryllium ({sup 241} AmBe) and californium in heavy water (Cf + D{sub 2}O), all located at a distance of 100 cm from the neutron detector ({sup 6}Li (Eu) - crystal scintillator). In this program, the counting of neutrons that are captured by the detector was made. The source is located in the center of a sphere of radius 300 cm. Analyzes the impact of these neutrons in a point of the sphere wall, which in this case acted as a neutron detector and from there, it is estimated the number of neutrons that collide in the whole sphere. The purpose is to obtain the neutron count for different energy bands in a solid field of neutrons, since they have a spectrum ranging from a low to a high energy that can also vary within a particular environment. Wishes to obtain new fields with different sources and moderators materials to be used as new reference fields. Measurements are being conducted for these fields, with the aim of analyzing the variability conditions of the measurement (repeatability and reproducibility) in LEN - Laboratorio de Espectrometria de Neutrons of the LN/LMNRI/IRD. Thus, the spectrometer will be used to improve both the knowledge of the spectrum as the standard of neutrons of the lab, proving that a spectrometry is essential for correct measurement.

  15. 10 CFR Appendix E to Part 835 - Values for Establishing Sealed Radioactive Source Accountability and Radioactive Material Posting...

    Science.gov (United States)

    2010-01-01

    ...+01 Pu-236 2.0E+02 Pu-237 3.3E+02 Pu-238 9.0E+01 Pu-239 8.4E+01 Pu-240 8.4E+01 Pu-241 4.6E+03 Pu-242 8.7E+01 Pu-244 9.0E+01 Am-241 7.2E+01 Am-242m 1.1E+02 Am-243 7.3E+01 Cm-241 1.0E+05 Cm-242 6.2E+02 Cm...

  16. Toward Reanalysis of the Tight-Pitch HCLWR-PROTEUS Phase II Experiments

    Directory of Open Access Journals (Sweden)

    Perret Grégory

    2016-01-01

    Spectral index predictions using the three nuclear data libraries agreed within two standard deviations with the measured values. The only exception is the Pu-242-capture-to-Pu-239-fission ratio, which was overestimated with all libraries by more than four standard deviations, i.e. 13%, in the non-moderated configuration. In this configuration, Pu-242 captures are few since the flux spectrum in the Pu-242 capture resonance region (between 1eV and 1keV is small making this spectral index hard to measure. Sensitivity coefficient predictions with both MCNP6 and SERPENT2 were in good agreement.

  17. Disease: H01309 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available H, Tanizaki H, Heike T, Miyachi Y, Nakahata T Role of the NOD2 genotype in the clinical phenotype of Blau syndrome and early-onset sarcoidosis. Arthritis Rheum 60:242-50 (2009) ...

  18. A numerical study of two different specimen fixtures for the modified compact tension test – their influence on concrete fracture parameters

    Czech Academy of Sciences Publication Activity Database

    Holušová, Táňa; Seitl, Stanislav; Cifuentes, H.; Canteli, A.

    2016-01-01

    Roč. 10, č. 35 (2016), s. 242-249 ISSN 1971-8993 Institutional support: RVO:68081723 Keywords : Modified Compact Tension Test * Fracture Parameters * Cementitious Composites * FEM Subject RIV: JL - Materials Fatigue, Friction Mechanics

  19. Socialization Values and Parenting Practices as Predictors of Parental Involvement in Their Children's Educational Process

    NARCIS (Netherlands)

    Kikas, Eve; Tulviste, Tiia; Peets, Kätlin

    2014-01-01

    Research Findings: The purpose of this study was to examine associations between parental socialization values (including inconsistency in values), parenting practices, and parental involvement in their children's education. Altogether 242 Estonian mothers and fathers of first-grade children

  20. ORF Alignment: NC_005085 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available is MR-1] ... Length = 125 ... Query: 183 YIFFVDDSVVARKEITGVLEKMGIKFQQATNGREAWDRLQVLAGRNWADGECLHDYLKII 242 ... +I ... +DDS VAR...K+I ... LE + ++ ... A +GREA D+L+ +A ... ++ ... + D + +I Sbjct: 1 ... HIMVIDDSAVARK

  1. African Journal of Urology - Vol 13, No 4 (2007)

    African Journals Online (AJOL)

    Pediatric Urinary Tract Infections and Vesicoureteral Refl ux: What Have We Learned? EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. A A Cadamone, M A Koyle, 242-254 ...

  2. Dicty_cDB: Contig-U14088-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 0 Length of query: 109 Length of database: 95,242,211,685 Length adjustment: 22 ...er of HSP's successfully gapped: 0 Length of query: 36 Length of database: 1,051,180,864 Length adjustment:

  3. Dicty_cDB: Contig-U10659-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available th of query: 141 Length of database: 95,242,211,685 Length adjustment: 22 Effective length of query: 119 Eff...atabase: 1,040,966,779 Length adjustment: 20 Effective length of query: 27 Effect

  4. Dicty_cDB: Contig-U07028-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available of query: 105 Length of database: 95,242,211,685 Length adjustment: 22 Effective...uery: 35 Length of database: 1,040,966,779 Length adjustment: 9 Effective length of query: 26 Effective leng

  5. Dicty_cDB: Contig-U13300-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available e: 95,242,211,685 Length adjustment: 23 Effective length of query: 183 Effective length of database: 93,106,... database: 1,051,180,864 Length adjustment: 40 Effective length of query: 28 Effe

  6. Dicty_cDB: Contig-U10494-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Length of database: 95,242,211,685 Length adjustment: 22 Effective length of query: 112 Effective length of...uery: 44 Length of database: 1,040,966,779 Length adjustment: 18 Effective length

  7. Dicty_cDB: Contig-U06383-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available query: 212 Length of database: 95,242,211,685 Length adjustment: 23 Effective len...'s successfully gapped: 0 Length of query: 70 Length of database: 1,040,966,779 Length adjustment: 41 Effect

  8. Dicty_cDB: Contig-U14375-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available of query: 140 Length of database: 95,242,211,685 Length adjustment: 22 Effective length of query: 118 Effec...0 Length of query: 46 Length of database: 1,051,180,864 Length adjustment: 20 Eff

  9. Dicty_cDB: Contig-U14528-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available h of database: 95,242,211,685 Length adjustment: 22 Effective length of query: 94 Effective length of databa...8 Length of database: 1,051,180,864 Length adjustment: 12 Effective length of que

  10. Genome-Wide Association Study of Down Syndrome-Associated Atrioventricular Septal Defects

    National Research Council Canada - National Science Library

    Ramachandran, Dhanya; Zeng, Zhen; Locke, Adam E; Mulle, Jennifer G; Bean, Lora J H; Rosser, Tracie C; Dooley, Kenneth J; Cua, Clifford L; Capone, George T; Reeves, Roger H; Maslen, Cheryl L; Cutler, David J; Feingold, Eleanor; Sherman, Stephanie L; Zwick, Michael E

    2015-01-01

    .... We performed a genome-wide association study using logistic regression analysis on 452 individuals with Down syndrome, consisting of 210 cases with complete atrioventricular septal defects and 242...

  11. 47 CFR 15.205 - Restricted bands of operation.

    Science.gov (United States)

    2010-10-01

    ... limits in § 15.209 shall be demonstrated using measurement instrumentation employing a CISPR quasi-peak...) Biomedical telemetry devices operating under the provisions of § 15.242 of this part are not subject to the...

  12. Actinide transmutation in nuclear reactors

    Energy Technology Data Exchange (ETDEWEB)

    Ganev, I.K.; Lopatkin, A.V.; Naumov, V.V.; Tocheny, L.V.

    1993-12-31

    Of some interest is the comparison between the actinide nuclide burning up (fission) rates such as americium 241, americium 242, curium 244, and neptunium 237, in the reactors with fast or thermal neutron spectra.

  13. ORF Alignment: NC_006361 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available VVHSSYQ Sbjct: 1 ... RIGAHVRLDSDPIGFGEKLGADVIQMFVVDPQSWDKPVPHPRTEEILASPIDVVVHSSYQ 60 ... Query: 122 QDKGGFAVPILIENTAGGNHAMARHFDM...IGRLWDAVGEFGAGFCLDTCHAWAGGEDLVGV 181 ... QDKGGFAVPILIENTAGGNHAMARHFDMIGRLWDAVGEFGAGFCL...DTCHAWAGGEDLVGV Sbjct: 121 QDKGGFAVPILIENTAGGNHAMARHFDMIGRLWDAVGEFGAGFCLDTCHAWAGGEDLVGV 180 ... Query: 242 EGVADD 247 ... EGVADD Sbjct: 241 EGVADD 246

  14. 78 FR 15711 - Submission for OMB Review; Comment Request

    Science.gov (United States)

    2013-03-12

    ... bills of lading to contractors. This requirement was previously addressed at DFARS 242.1404-2-70, and... provided. To confirm receipt of your comment(s), please check http://www.regulations.gov approximately two...

  15. Self-reported early trauma as a predictor of adult personality : A study in a military sample

    NARCIS (Netherlands)

    Rademaker, Arthur R.; Vermetten, Eric; Geuze, Elbert; Muilwilk, Anne; Kleber, Rolf J.

    Exposure to early trauma has frequently been linked to adult psychopathology, including personality disorders. This cross-sectional study explored the relationship between personality and retrospectively rated levels of early trauma in 242 soldiers. Multiple regression analyses showed a significant

  16. 78 FR 75304 - Medicare Program; Medicare Secondary Payer and Certain Civil Money Penalties

    Science.gov (United States)

    2013-12-11

    ... ``Office of Inspector General; Health Care Financing Administration; Statement of Organization, Functions... Repaying Taxpayers Act of 2012 (SMART Act) was enacted (Pub. L. 112-242). The SMART Act amended section...

  17. Moderna mimo centra

    Czech Academy of Sciences Publication Activity Database

    Hnídková, Vendula

    2017-01-01

    Roč. 96, č. 4 (2017), s. 242-244 ISSN 0042-4544 Institutional support: RVO:68378033 Keywords : modern architecture * Josep Lluis Sert * Fondation Maeght Subject RIV: AL - Art, Architecture , Cultural Heritage

  18. MINERALOGICAL MAPPING IN THE PART OF A GOLD PROSPECT USING EO-1 HYPERION DATA

    National Research Council Canada - National Science Library

    V. K. Sengar; A. S. Venkatesh; P. K. Champaty Ray; S. L. Chattoraj; R. U. Sharma

    2016-01-01

    .... EO-1 Hyperion sensor contains 196 unique channels out of 242 bands (L1R product) covering 0.4-2.5 μm range has also been proved significant in the field of spaceborne mineral potential mapping...

  19. GETDB: 112973 [GETDB

    Lifescience Database Archive (English)

    Full Text Available rsal, ventral) tr, fb tarsal ring, al, eye, tarsas - - comment1:A, comment2:42F2-...l tarsal ring, al, Adult GFP eye, tarsas Lethality - Also known as - Original Comments comment1:A, comment2:

  20. Gclust Server: 92373 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available Sequences Related Sequences(242) 703 NP_031385.2 cancer susceptibility candidate 3 ; no annotation 1 1...length 703 Representative annotation NP_031385.2 cancer susceptibility candidate 3 ; no annotation Number

  1. Inorganic nanoprobes for biological sensing and imaging

    National Research Council Canada - National Science Library

    Mattoussi, Hedi; Cheon, Jinwoo

    2009-01-01

    ... and Nickel Nanoparticles Metal Alloy Nanoparticles 2.3.1 FePt Nanoparticles 2.3.2 Other Metal Alloy Nanoparticles Metal Oxide Nanoparticles 2.4.1 Monometallic Oxide Nanoparticles 2.4.2 Bimetall...

  2. Gravity Data for the State of New Mexico

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The gravity station data (21,242 records) were compiled by the University of Texas at El Paso. This data base was received in October 1984. Principal gravity...

  3. Plány Vyšehradu v Národní knihovně v Paříži

    Czech Academy of Sciences Publication Activity Database

    Nechvátal, Bořivoj

    2016-01-01

    Roč. 41, č. 2 (2016), s. 229-242 ISSN 0231-5823 Institutional support: RVO:67985912 Keywords : defence system * palisades * bastion * ravelin * Vyšehrad Subject RIV: AC - Archeology, Anthropology, Ethnology

  4. 28 CFR 0.50 - General functions.

    Science.gov (United States)

    2010-07-01

    ... title 18, U.S. Code, relating to elections and political activities; (2) Sections 241, 242, and 594 of... legislation relating thereto. (g) Representation of Federal officials in private litigation arising under 42 U...

  5. Dicty_cDB: VHD416 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 5 (VSB825Q) /CSM/VS/VSB8-B/VSB825Q.Seq.d/ 242 6e-63 VHD416 (VHD416Q) /CSM/VH/VHD4-A/VHD416Q.Seq.d/ 242 6e-63 SLE471 (SLE471...Q) /CSM/SL/SLE4-C/SLE471Q.Seq.d/ 240 3e-62 VSG893 (VSG893Q) /CSM/V

  6. MURI: Adaptive Waveform Design for Full Spectral Dominance

    Science.gov (United States)

    2011-03-11

    bats or dolphins for echo-location, for use in waveform-agile tracking [14]-[16]. We developed a sequential Bayesian algorithm for estimating the...2.4.2 Cognitive Radar for Target Tracking in Multipath Scenarios . . . . . . . . . . . . . . . 10 2.4.3 Sparsity-Based Multi-Target Tracking Using OFDM...jamming. 2.4.2 Cognitive Radar for Target Tracking in Multipath Scenarios Problem Description In [37], we addressed the problem of target tracking in a

  7. Preexisting compensatory amino acids compromise fitness costs of a HIV-1 T cell escape mutation.

    Science.gov (United States)

    Liu, Donglai; Zuo, Tao; Hora, Bhavna; Song, Hongshuo; Kong, Wei; Yu, Xianghui; Goonetilleke, Nilu; Bhattacharya, Tanmoy; Perelson, Alan S; Haynes, Barton F; McMichael, Andrew J; Gao, Feng

    2014-11-19

    Fitness costs and slower disease progression are associated with a cytolytic T lymphocyte (CTL) escape mutation T242N in Gag in HIV-1-infected individuals carrying HLA-B*57/5801 alleles. However, the impact of different context in diverse HIV-1 strains on the fitness costs due to the T242N mutation has not been well characterized. To better understand the extent of fitness costs of the T242N mutation and the repair of fitness loss through compensatory amino acids, we investigated its fitness impact in different transmitted/founder (T/F) viruses. The T242N mutation resulted in various levels of fitness loss in four different T/F viruses. However, the fitness costs were significantly compromised by preexisting compensatory amino acids in (Isoleucine at position 247) or outside (glutamine at position 219) the CTL epitope. Moreover, the transmitted T242N escape mutant in subject CH131 was as fit as the revertant N242T mutant and the elimination of the compensatory amino acid I247 in the T/F viral genome resulted in significant fitness cost, suggesting the fitness loss caused by the T242N mutation had been fully repaired in the donor at transmission. Analysis of the global circulating HIV-1 sequences in the Los Alamos HIV Sequence Database showed a high prevalence of compensatory amino acids for the T242N mutation and other T cell escape mutations. Our results show that the preexisting compensatory amino acids in the majority of circulating HIV-1 strains could significantly compromise the fitness loss due to CTL escape mutations and thus increase challenges for T cell based vaccines.

  8. Pharmacological TLR4 Inhibition Protects against Acute and Chronic Fat-Induced Insulin Resistance in Rats.

    Directory of Open Access Journals (Sweden)

    Ning Zhang

    Full Text Available To evaluate whether pharmacological TLR4 inhibition protects against acute and chronic fat-induced insulin resistance in rats.For the acute experiment, rats received a TLR4 inhibitor [TAK-242 or E5564 (2x5 mg/kg i.v. bolus] or vehicle, and an 8-h Intralipid (20%, 8.5 mg/kg/min or saline infusion, followed by a two-step hyperinsulinemic-euglycemic clamp. For the chronic experiment, rats were subcutaneously implanted with a slow-release pellet of TAK-242 (1.5 mg/d or placebo. Rats then received a high fat diet (HFD or a low fat control diet (LFD for 10 weeks, followed by a two-step insulin clamp.Acute experiment; the lipid-induced reduction (18% in insulin-stimulated glucose disposal (Rd was attenuated by TAK-242 and E5564 (the effect of E5564 was more robust, suggesting improved peripheral insulin action. Insulin was able to suppress hepatic glucose production (HGP in saline- but not lipid-treated rats. TAK-242, but not E5564, partially restored this effect, suggesting improved HGP. Chronic experiment; insulin-stimulated Rd was reduced ~30% by the HFD, but completely restored by TAK-242. Insulin could not suppress HGP in rats fed a HFD and TAK-242 had no effect on HGP.Pharmacological TLR4 inhibition provides partial protection against acute and chronic fat-induced insulin resistance in vivo.

  9. Site-Specific Recombination at XerC/D Sites Mediates the Formation and Resolution of Plasmid Co-integrates Carrying a blaOXA-58- and TnaphA6-Resistance Module in Acinetobacter baumannii

    Directory of Open Access Journals (Sweden)

    María M. Cameranesi

    2018-01-01

    Full Text Available Members of the genus Acinetobacter possess distinct plasmid types which provide effective platforms for the acquisition, evolution, and dissemination of antimicrobial resistance structures. Many plasmid-borne resistance structures are bordered by short DNA sequences providing potential recognition sites for the host XerC and XerD site-specific tyrosine recombinases (XerC/D-like sites. However, whether these sites are active in recombination and how they assist the mobilization of associated resistance structures is still poorly understood. Here we characterized the plasmids carried by Acinetobacter baumannii Ab242, a multidrug-resistant clinical strain belonging to the ST104 (Oxford scheme which produces an OXA-58 carbapenem-hydrolyzing class-D β-lactamase (CHDL. Plasmid sequencing and characterization of replication, stability, and adaptive modules revealed the presence in Ab242 of three novel plasmids lacking self-transferability functions which were designated pAb242_9, pAb242_12, and pAb242_25, respectively. Among them, only pAb242_25 was found to carry an adaptive module encompassing an ISAba825-blaOXA-58 arrangement accompanied by a TnaphA6 transposon, the whole structure conferring simultaneous resistance to carbapenems and aminoglycosides. Ab242 plasmids harbor several XerC/D-like sites, with most sites found in pAb242_25 located in the vicinity or within the adaptive module described above. Electrotransformation of susceptible A. nosocomialis cells with Ab242 plasmids followed by imipenem selection indicated that the transforming plasmid form was a co-integrate resulting from the fusion of pAb242_25 and pAb242_12. Further characterization by cloning and sequencing studies indicated that a XerC/D site in pAb242_25 and another in pAb242_12 provided the active sister pair for the inter-molecular site-specific recombination reaction mediating the fusion of these two plasmids. Moreover, the resulting co-integrate was found also to undergo

  10. Validation of a colistin plasma concentration breakpoint as a predictor of nephrotoxicity in patients treated with colistin methanesulfonate.

    Science.gov (United States)

    Horcajada, Juan P; Sorlí, Luisa; Luque, Sonia; Benito, Natividad; Segura, Concepción; Campillo, Nuria; Montero, Milagro; Esteve, Erika; Mirelis, Beatriz; Pomar, Virginia; Cuquet, Jordi; Martí, Carmina; Garro, Pau; Grau, Santiago

    2016-12-01

    Nephrotoxicity limits the effective use of colistin for the treatment of multidrug-resistant Gram-negative bacteria (MDR-GNB) infections. We previously defined a steady-state colistin plasma concentration (Css) of 2.42 mg/L that predicted nephrotoxicity at end of treatment (EOT). The objective of this study was to validate this breakpoint in a prospective cohort. This was a multicentre, prospective, observational study conducted at three hospitals with a cohort of patients treated for MDR-GNB infection with colistin methanesulfonate from September 2011 until January 2015. Nephrotoxicity was evaluated at Day 7 and at EOT using the RIFLE criteria. Css values were measured and analysed using HPLC. Taking the previously defined breakpoint for colistin concentration as a criterion, patients were divided into two groups (Css, ≤2.42 mg/L vs. >2.42 mg/L). Sixty-four patients were included. Seven patients (10.9%) had a Css > 2.42 mg/L and were compared with the remaining patients. Bivariate analysis showed that patients with a Css > 2.42 mg/L were older and had a significantly higher incidence of nephrotoxicity at Day 7 and EOT. Although not statistically significant, nephrotoxicity occurred earlier in these patients (6.2 days vs. 9.2 days in patients with lower Css; P = 0.091). Multivariate analysis of nephrotoxicity showed that Css > 2.42 mg/L was the only predictive factor. Nephrotoxicity was more frequent and occurred earlier in patients with colistin plasma concentrations higher than the previously defined breakpoint (2.42 mg/L). Colistin therapeutic drug monitoring should be routinely considered to avoid reaching this toxicity threshold and potential clinical consequences. Copyright © 2016 Elsevier B.V. and International Society of Chemotherapy. All rights reserved.

  11. Gclust Server: 100 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available 100 Bja_blr7173 Cluster Sequences Related Sequences(824) 706 putative methyl accept...ing chemotaxis protein 242 1.00e-45 14.29 0.0 4.0 46.67 41.94 0.0 Show 100 Cluster ID 100 Sequence ID Bja_blr7173 Link to clus...ter sequences Cluster Sequences Link to related sequences Related Sequences(824) Sequence ... Number of Sequences 242 Homologs 242 Clustering threshold 1.00e-45 Plants and algae (7species) (%) 14.29 Ot...u: 1 Rso: 1 Cvi: 1 Bma: 1 Bpe: 1 Hal: 3 Species not appearing in this cluster ATH

  12. AcEST: BP916184 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000084_C08 242 Adiantum capillus-veneris mRNA. clone: YMU001_000084_C08. BP916184... CL2444Contig1 Show BP916184 Clone id YMU001_000084_C08 Library YMU01 Length 242 Definition Adiantum ca...pillus-veneris mRNA. clone: YMU001_000084_C08. Accession BP916184 Tissue type prothallium Developmental stag...tein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP916184|Adiantum capillus-veneris mR... Acids Res. 25:3389-3402. Query= BP916184|Adiantum capillus-veneris mRNA, clone: YMU001_000084_C08. (242 let

  13. Two small heat shock protein genes in Apis cerana cerana: characterization, regulation, and developmental expression.

    Science.gov (United States)

    Liu, Zhaohua; Yao, Pengbo; Guo, Xingqi; Xu, Baohua

    2014-07-25

    In the present study, we identified and characterized two small heat shock protein genes from Apis cerana cerana, named AccHsp24.2 and AccHsp23.0. An alignment analysis showed that AccHsp24.2 and AccHsp23.0 share high similarity with other members of the α-crystallin/sHSP family, all of which contain the conserved α-crystallin domain. The recombinant AccHsp24.2 and AccHsp23.0 proteins were shown to have molecular chaperone activity by the malate dehydrogenase thermal aggregation assay. Three heat shock elements were detected in the 5'-flanking region of AccHsp24.2 and eleven in AccHsp23.0, and two Drosophila Broad-Complex genes for ecdysone steroid response sites were found in each of the genes. The presence of these elements suggests that the expression of these genes might be regulated by heat shock and ecdysone, which was confirmed by quantitative RT-PCR (RT-qPCR). The results revealed that the expression of the two genes could be induced by cold shock (4°C) and heat shock (37°C and 43°C) in an analogous manner, and AccHsp24.2 was more susceptible than AccHsp23.0. In addition, the expression of the two genes was induced by high concentrations of ecdysone in vitro and in vivo. The accumulation of AccHsp24.2 and AccHsp23.0 mRNA was also detected in different developmental stages and tissues. In spite of the differential expression at the same stage, these genes shared similar developmental patterns, suggesting that they are regulated by similar mechanisms. Copyright © 2014 Elsevier B.V. All rights reserved.

  14. Compensated bismuth-loaded plastic scintillators for neutron detection using low-energy pseudo-spectroscopy

    Energy Technology Data Exchange (ETDEWEB)

    Dumazert, Jonathan, E-mail: jonathan.dumazert@cea.fr [CEA, LIST, Laboratoire Capteurs Architectures Electroniques, 91191 Gif-sur-Yvette (France); Coulon, Romain; Bertrand, Guillaume H.V.; Normand, Stéphane [CEA, LIST, Laboratoire Capteurs Architectures Electroniques, 91191 Gif-sur-Yvette (France); Méchin, Laurence [CNRS, UCBN, Groupe de Recherche en Informatique, Image, Automatique et Instrumentation de Caen, 14050 Caen (France); Hamel, Matthieu [CEA, LIST, Laboratoire Capteurs Architectures Electroniques, 91191 Gif-sur-Yvette (France)

    2016-05-21

    Gadolinium-covered modified plastic scintillators show a high potential for the deployment of cost-effective neutron detectors. Taking advantage of the low-energy photon and electron signature of thermal neutron captures in gadolinium-155 and gadolinium-157 however requires a background correction. In order to display a trustable rate, dual compensation schemes appear as an alternative to Pulse Shape Discrimination. This paper presents the application of such a compensation scheme to a two-bismuth loaded plastic scintillator system. A detection scintillator interacts with incident photon and fast neutron radiations and is covered with a gadolinium converter to become thermal neutron-sensitive as well. In the meantime, an identical compensation scintillator, covered with terbium, solely interacts with the photon and fast neutron part of incident radiations. After the acquisition and the treatment of the counting signals from both sensors, a hypothesis test determines whether the resulting count rate after subtraction falls into statistical fluctuations or provides a robust image of neutron activity. A laboratory prototype is tested under both photon and neutron radiations, allowing us to investigate the performance of the overall compensation system. The study reveals satisfactory results in terms of robustness to a cesium-137 background and in terms of sensitivity in presence of a californium-252 source.

  15. Systematic studies of the fundamental chemistry of pyrochlore oxides. An{sub 2}Zr{sub 2}O{sub 7} [An=Pu, Am, Cm, Bk and Cf

    Energy Technology Data Exchange (ETDEWEB)

    Haire, R.G.; Assefa, Z. [Oak Ridge National Laboratory, Oak Ridge, TN (United States); Raison, P.E. [Commissariat a l' Energie Atomique, CEA-Cadarache DRN/DEC/SPUA/LACA (France)

    2002-11-01

    Our efforts to pursue the fundamental science of actinide pyrochlore oxides, An{sub 2}Zr{sub 2}O{sub 7}, (An=plutonium through californium), are presented. We have addressed their structural and chemical behavior via X-ray diffraction, Raman spectroscopy and by considering the pseudo-oxidation potentials of the actinides. The structure, fundamental chemistry, ionic radii and the electronic configuration of the specific actinide involved in these oxide systems all have a significant impact on their science. We are also exploring a calculational approach based on valence-bond relationships to assess the position of the oxygen atoms located at the general crystallographic position. The oxygen position is important regarding the chemical behavior and thermal stability of these materials. Also considered is the structural stability of the materials regarding self-irradiation, and with some compounds, their resistance towards oxidation. These aspects will be discussed using a systematic evaluation of the five-actinide systems together with comparable lanthanide systems studied. (author)

  16. 1982 US-CEC neutron personnel dosimetry intercomparison study

    Energy Technology Data Exchange (ETDEWEB)

    Swaja, R.E.; Sims, C.S.; Greene, R.T.; Schraube, H.; Burger, G.

    1983-11-01

    A neutron personnel dosimetry intercomparison study was conducted during April 19-23, 1982, as a joint effort between the United States and the Commission of European Communities. Dosimeters from 48 participating agencies were mounted on cylindrical phantoms and exposed to a range of low-level dose equivalents (0.48-13.91 mSv neutron and 0.02-1.32 mSv gamma) in nine different radiation fields. Exposure conditions considered in this study included four mixed-field spectra produced using the Health Physics Research Reactor, four monoenergetic neutron fields generated by accelerators, and one 15-cm D/sub 2/O-moderated californium source spectrum. In general, neutron results reported by the participating agencies were consistent with expected dosimeter performance based on energy response characteristics of the detection systems. Albedo dosimeters, which were the most popular neutron monitoring systems used in this study, provided the best overall accuracy for all exposure conditions. Film, Cr-39 recoil track, and Th-232 fission track systems generally underestimated dose equivalents relative to reference values. Associated gamma measurements showed that TLD monitors produced more accurate results than film dosimeters although both systems overestimated gamma dose equivalents in mixed radiation fields. 24 references, 10 figures, 19 tables.

  17. Application of the backward extrapolation method to pulsed neutron sources

    Energy Technology Data Exchange (ETDEWEB)

    Talamo, Alberto; Gohar, Yousry

    2018-01-01

    Particle detectors operated in pulse mode are subjected to the dead-time effect. When the average of the detector counts is constant over time, correcting for the dead-time effect is simple and can be accomplished by analytical formulas. However, when the average of the detector counts changes over time it is more difficult to take into account the dead-time effect. When a subcritical nuclear assembly is driven by a pulsed neutron source, simple analytical formulas cannot be applied to the measured detector counts to correct for the dead-time effect because of the sharp change of the detector counts over time. This work addresses this issue by using the backward extrapolation method. The latter can be applied not only to a continuous (e.g. californium) external neutron source but also to a pulsed external neutron source (e.g. by a particle accelerator) driving a subcritical nuclear assembly. The backward extrapolation method allows to obtain from the measured detector counts both the dead-time value and the real detector counts.

  18. The cross sections of fusion-evaporation reactions: the most promising route to superheavy elements beyond Z=118

    Science.gov (United States)

    Jadambaa, Khuyagbaatar

    2017-11-01

    The synthesis of superheavy elements beyond oganesson (Og), which has atomic number Z = 118, is currently one of the main topics in nuclear physics. An absence of sufficient amounts of target material with atomic numbers heavier than californium (Z = 98) forces the use of projectiles heavier than 48Ca (Z = 20), which has been successfully used for the discoveries of elements with Z = 114 - 118 in complete fusion reactions. Experimental cross sections of 48Ca with actinide targets behave very differently to "cold" and "hot" fusion-evaporation reactions, where doubly-magic lead and deformed actinides are used as targets, respectively. The known cross sections of these reactions have been analysed compared to calculated fission barriers. It has been suggested that observed discrepancies between the cross sections of 48Ca-induced and other fusionevaporation reactions originate from the shell structure of the compound nucleus, which lies in the island of the stability. Besides scarcely known data on other reactions involving heavier projectiles, the most promising projectile for the synthesis of the elements beyond Og seems to be 50Ti. However, detailed studies of 50Ti, 54Cr, 58Fe and 64Ni-induced reactions are necessary to be performed in order to fully understand the complexities of superheavy element formation.

  19. Activation analysis of ITER blanket first wall

    Energy Technology Data Exchange (ETDEWEB)

    Lopatkin, A.; Muratov, V. [RDIPE (NIKIET), Moscow (Russian Federation)

    1998-09-01

    To analyze the activation of ITER blanket structural components, the authors have prepared the AUCDAS code that calculates changes in nuclide concentrations and radioactivity characteristics during neutron irradiation and during cooling. UCDAS takes into account all neutron reactions and decay types, the prepared library of constants contains nuclear data of nuclides from hydrogen to californium. A comparative analysis of the results as obtained using UCDAS code and the widely known FISPACT code is given. The analysis of decay heat, gas generation and activity of ITER blanket first wall`s structural components was carried out. The beryllium coating, copper alloy and stainless steel were analysed. Calculations were performed for the first plasma burning pulse, 6 months and 1 year of operation in accordance with the ITER scenario. The materials recommended by ITER central team and their Russian analogs were considered: TGR and B1 (beryllium coating), GlidCop AL-25 Ds and Br-MKX (copper alloy), 316LN-IG and 12Cr18Ni10Ti (stainless steel). It has been demonstrated that there is a difference in all of the considered characteristics between the above materials. It is caused by impurities which are present in the materials. The report also considers the accumulation of gases (H, D, T, He{sup 3}, He{sup 4}) in the above materials. Besides, the change in the activity of irradiated materials during the cooling of up to 10{sup 7} years was calculated. (orig.) 7 refs.

  20. Toward achieving flexible and high sensitivity hexagonal boron nitride neutron detectors

    Science.gov (United States)

    Maity, A.; Grenadier, S. J.; Li, J.; Lin, J. Y.; Jiang, H. X.

    2017-07-01

    Hexagonal boron nitride (h-BN) detectors have demonstrated the highest thermal neutron detection efficiency to date among solid-state neutron detectors at about 51%. We report here the realization of h-BN neutron detectors possessing one order of magnitude enhancement in the detection area but maintaining an equal level of detection efficiency of previous achievement. These 3 mm × 3 mm detectors were fabricated from 50 μm thick freestanding and flexible 10B enriched h-BN (h-10BN) films, grown by metal organic chemical vapor deposition followed by mechanical separation from sapphire substrates. Mobility-lifetime results suggested that holes are the majority carriers in unintentionally doped h-BN. The detectors were tested under thermal neutron irradiation from californium-252 (252Cf) moderated by a high density polyethylene moderator. A thermal neutron detection efficiency of ˜53% was achieved at a bias voltage of 200 V. Conforming to traditional solid-state detectors, the realization of h-BN epilayers with enhanced electrical transport properties is the key to enable scaling up the device sizes. More specifically, the present results revealed that achieving an electrical resistivity of greater than 1014 Ωṡcm and a leakage current density of below 3 × 10-10 A/cm2 is needed to fabricate large area h-BN detectors and provided guidance for achieving high sensitivity solid state neutron detectors based on h-BN.

  1. Design of the low energy beam transport line between CARIBU and the EBIS charge breeder

    Energy Technology Data Exchange (ETDEWEB)

    Perry, A., E-mail: aperry4@hawk.iit.edu [Argonne National Laboratory, Argonne, IL 60439, USA and Illinois Institute of Technology, Chicago, IL 60616 (United States); Ostroumov, P. N.; Barcikowski, A.; Dickerson, C.; Kondrashev, S. A.; Mustapha, B.; Savard, G. [Argonne National Laboratory, Argonne, IL 60439 (United States)

    2015-01-09

    An Electron Beam Ion Source Charge Breeder (EBIS-CB) has been developed to breed radioactive beams from the CAlifornium Rare Isotope Breeder Upgrade (CARIBU) facility at ATLAS. The EBIS-CB will replace the existing ECR charge breeder to increase the intensity and improve the purity of reaccelerated radioactive ion beams. The EBIS-CB is in the final stage of off-line commissioning. Currently, we are developing a low energy beam transport (LEBT) system to transfer CARIBU beams to the EBIS-CB. As was originally planned, an RFQ cooler-buncher will precede the EBIS-CB. Recently, it was decided to include a multi-reflection time-of-flight (MR-TOF) mass-spectrometer following the RFQ. MR-TOF is a relatively new technology used to purify beams with a mass-resolving power up to 3×10{sup 5} as was demonstrated in experiments at CERN/ISOLDE. Very high purity singly-charged radioactive ion beams will be injected into the EBIS for charge breeding and due to its inherent properties, the EBIS-CB will maintain the purity of the charge bred beams. Possible contamination of residual gas ions will be greatly suppressed by achieving ultra-high vacuum in the EBIS trap. This paper will present and discuss the design of the LEBT and the overall integration of the EBIS-CB into ATLAS.

  2. Analysis of patents on mining technology

    Energy Technology Data Exchange (ETDEWEB)

    Menyailo, N.I.; Grishchenko, A.N.; Ratner, M.V.; Kobylyanskii, A.Ya.; Tyshlek, E.G.

    1987-09-01

    Analyses the current work being carried out with the aim of developing and perfecting coal mining technology with regard to improving safety and working conditions (equipment is currently responsible for 6.3% of all hazards in coal mines) by examining patents of class ES 21 S produced in the USSR, USA, UK, FRG, Japan and France between 1970-1984. By far the majority of patents is concerned with improving technology and productivity and a disappointing number deals with safety matters (only 7.2% of the patents for new cutter loader designs deal with dust suppression systems and most of these come from the FRG; no patents for powered mining complexes deal with the problem of noise and vibration reduction). The patents with the most direct relevance to health and safety concern remote control devices for mining equipment, in particular, devices based on radioactive isotopes (e.g. cesium-137, americum-241, selenium-75, californium-252) but measures for monitoring them and protecting against them are not found.

  3. MinT: Middleware for Cooperative Interaction of Things

    Directory of Open Access Journals (Sweden)

    Soobin Jeon

    2017-06-01

    Full Text Available This paper proposes an Internet of Things (IoT middleware called Middleware for Cooperative Interaction of Things (MinT. MinT supports a fully distributed IoT environment in which IoT devices directly connect to peripheral devices easily construct a local or global network, and share their data in an energy efficient manner. MinT provides a sensor abstract layer, a system layer and an interaction layer. These enable integrated sensing device operations, efficient resource management, and active interconnection between peripheral IoT devices. In addition, MinT provides a high-level API to develop IoT devices easily for IoT device developers. We aim to enhance the energy efficiency and performance of IoT devices through the performance improvements offered by MinT resource management and request processing. The experimental results show that the average request rate increased by 25% compared to Californium, which is a middleware for efficient interaction in IoT environments with powerful performance, an average response time decrease of 90% when resource management was used, and power consumption decreased by up to 68%. Finally, the proposed platform can reduce the latency and power consumption of IoT devices.

  4. MinT: Middleware for Cooperative Interaction of Things

    Science.gov (United States)

    Jeon, Soobin; Jung, Inbum

    2017-01-01

    This paper proposes an Internet of Things (IoT) middleware called Middleware for Cooperative Interaction of Things (MinT). MinT supports a fully distributed IoT environment in which IoT devices directly connect to peripheral devices easily construct a local or global network, and share their data in an energy efficient manner. MinT provides a sensor abstract layer, a system layer and an interaction layer. These enable integrated sensing device operations, efficient resource management, and active interconnection between peripheral IoT devices. In addition, MinT provides a high-level API to develop IoT devices easily for IoT device developers. We aim to enhance the energy efficiency and performance of IoT devices through the performance improvements offered by MinT resource management and request processing. The experimental results show that the average request rate increased by 25% compared to Californium, which is a middleware for efficient interaction in IoT environments with powerful performance, an average response time decrease of 90% when resource management was used, and power consumption decreased by up to 68%. Finally, the proposed platform can reduce the latency and power consumption of IoT devices. PMID:28632182

  5. An Account of Oak Ridge National Laboratory's Thirteen Research Reactors

    Energy Technology Data Exchange (ETDEWEB)

    Rosenthal, Murray Wilford [ORNL

    2009-08-01

    The Oak Ridge National Laboratory has built and operated 13 nuclear reactors in its 66-year history. The first was the graphite reactor, the world's first operational nuclear reactor, which served as a plutonium production pilot plant during World War II. It was followed by two aqueous-homogeneous reactors and two red-hot molten-salt reactors that were parts of power-reactor development programs and by eight others designed for research and radioisotope production. One of the eight was an all-metal fast burst reactor used for health physics studies. All of the others were light-water cooled and moderated, including the famous swimming-pool reactor that was copied dozens of times around the world. Two of the reactors were hoisted 200 feet into the air to study the shielding needs of proposed nuclear-powered aircraft. The final reactor, and the only one still operating today, is the High Flux Isotope Reactor (HFIR) that was built particularly for the production of californium and other heavy elements. With the world's highest flux and recent upgrades that include the addition of a cold neutron source, the 44-year-old HFIR continues to be a valuable tool for research and isotope production, attracting some 500 scientific visitors and guests to Oak Ridge each year. This report describes all of the reactors and their histories.

  6. Neutron Detector Signal Processing to Calculate the Effective Neutron Multiplication Factor of Subcritical Assemblies

    Energy Technology Data Exchange (ETDEWEB)

    Talamo, Alberto [Argonne National Lab. (ANL), Argonne, IL (United States). Nuclear Engineering Division; Gohar, Yousry [Argonne National Lab. (ANL), Argonne, IL (United States). Nuclear Engineering Division

    2016-06-01

    This report describes different methodologies to calculate the effective neutron multiplication factor of subcritical assemblies by processing the neutron detector signals using MATLAB scripts. The subcritical assembly can be driven either by a spontaneous fission neutron source (e.g. californium) or by a neutron source generated from the interactions of accelerated particles with target materials. In the latter case, when the particle accelerator operates in a pulsed mode, the signals are typically stored into two files. One file contains the time when neutron reactions occur and the other contains the times when the neutron pulses start. In both files, the time is given by an integer representing the number of time bins since the start of the counting. These signal files are used to construct the neutron count distribution from a single neutron pulse. The built-in functions of MATLAB are used to calculate the effective neutron multiplication factor through the application of the prompt decay fitting or the area method to the neutron count distribution. If the subcritical assembly is driven by a spontaneous fission neutron source, then the effective multiplication factor can be evaluated either using the prompt neutron decay constant obtained from Rossi or Feynman distributions or the Modified Source Multiplication (MSM) method.

  7. Fast neutron tomography with real-time pulse-shape discrimination in organic scintillation detectors

    Energy Technology Data Exchange (ETDEWEB)

    Joyce, Malcolm J., E-mail: m.joyce@lancaster.ac.uk [Department of Engineering, Lancaster University, Lancaster, Lancashire LA1 4YW (United Kingdom); Agar, Stewart [Department of Engineering, Lancaster University, Lancaster, Lancashire LA1 4YW (United Kingdom); Aspinall, Michael D. [Hybrid Instruments Ltd., Gordon Manley Building, Lancaster Environment Centre, Lancaster University, Lancaster LA1 4YW (United Kingdom); Beaumont, Jonathan S.; Colley, Edmund; Colling, Miriam; Dykes, Joseph; Kardasopoulos, Phoevos; Mitton, Katie [Department of Engineering, Lancaster University, Lancaster, Lancashire LA1 4YW (United Kingdom)

    2016-10-21

    A fast neutron tomography system based on the use of real-time pulse-shape discrimination in 7 organic liquid scintillation detectors is described. The system has been tested with a californium-252 source of dose rate 163 μSv/h at 1 m and neutron emission rate of 1.5×10{sup 7} per second into 4π and a maximum acquisition time of 2 h, to characterize two 100×100×100 mm{sup 3} concrete samples. The first of these was a solid sample and the second has a vertical, cylindrical void. The experimental data, supported by simulations with both Monte Carlo methods and MATLAB®, indicate that the presence of the internal cylindrical void, corners and inhomogeneities in the samples can be discerned. The potential for fast neutron assay of this type with the capability to probe hydrogenous features in large low-Z samples is discussed. Neutron tomography of bulk porous samples is achieved that combines effective penetration not possible with thermal neutrons in the absence of beam hardening.

  8. Report on the workshop "Decay spectroscopy at CARIBU: advanced fuel cycle applications, nuclear structure and astrophysics". 14-16 April 2011, Argonne National Laboratory, USA.

    Energy Technology Data Exchange (ETDEWEB)

    Kondev, F.; Carpenter, M.P.; Chowdhury, P.; Clark, J.A.; Lister, C.J.; Nichols, A.L.; Swewryniak, D. (Nuclear Engineering Division); (Univ. of Massachusetts); (Univ. of Surrey)

    2011-10-06

    A workshop on 'Decay Spectroscopy at CARIBU: Advanced Fuel Cycle Applications, Nuclear Structure and Astrophysics' will be held at Argonne National Laboratory on April 14-16, 2011. The aim of the workshop is to discuss opportunities for decay studies at the Californium Rare Isotope Breeder Upgrade (CARIBU) of the ATLAS facility with emphasis on advanced fuel cycle (AFC) applications, nuclear structure and astrophysics research. The workshop will consist of review and contributed talks. Presentations by members of the local groups, outlining the status of relevant in-house projects and availabile equipment, will also be organized. time will also be set aside to discuss and develop working collaborations for future decay studies at CARIBU. Topics of interest include: (1) Decay data of relevance to AFC applications with emphasis on reactor decay heat; (2) Discrete high-resolution gamma-ray spectroscopy following radioactive decya and related topics; (3) Calorimetric studies of neutron-rich fission framgents using Total ABsorption Gamma-Ray Spectrometry (TAGS) technique; (4) Beta-delayed neutron emissions and related topics; and (5) Decay data needs for nuclear astrophysics.

  9. The cross sections of fusion-evaporation reactions: the most promising route to superheavy elements beyond Z=118

    Directory of Open Access Journals (Sweden)

    Jadambaa Khuyagbaatar

    2017-01-01

    Full Text Available The synthesis of superheavy elements beyond oganesson (Og, which has atomic number Z = 118, is currently one of the main topics in nuclear physics. An absence of sufficient amounts of target material with atomic numbers heavier than californium (Z = 98 forces the use of projectiles heavier than 48Ca (Z = 20, which has been successfully used for the discoveries of elements with Z = 114 - 118 in complete fusion reactions. Experimental cross sections of 48Ca with actinide targets behave very differently to “cold” and “hot” fusion-evaporation reactions, where doubly-magic lead and deformed actinides are used as targets, respectively. The known cross sections of these reactions have been analysed compared to calculated fission barriers. It has been suggested that observed discrepancies between the cross sections of 48Ca-induced and other fusionevaporation reactions originate from the shell structure of the compound nucleus, which lies in the island of the stability. Besides scarcely known data on other reactions involving heavier projectiles, the most promising projectile for the synthesis of the elements beyond Og seems to be 50Ti. However, detailed studies of 50Ti, 54Cr, 58Fe and 64Ni-induced reactions are necessary to be performed in order to fully understand the complexities of superheavy element formation.

  10. Intracavitary moderator balloon combined with (252)Cf brachytherapy and boron neutron capture therapy, improving dosimetry in brain tumour and infiltrations.

    Science.gov (United States)

    Brandão, S F; Campos, T P R

    2015-07-01

    This article proposes a combination of californium-252 ((252)Cf) brachytherapy, boron neutron capture therapy (BNCT) and an intracavitary moderator balloon catheter applied to brain tumour and infiltrations. Dosimetric evaluations were performed on three protocol set-ups: (252)Cf brachytherapy combined with BNCT (Cf-BNCT); Cf-BNCT with a balloon catheter filled with light water (LWB) and the same set-up with heavy water (HWB). Cf-BNCT-HWB has presented dosimetric advantages to Cf-BNCT-LWB and Cf-BNCT in infiltrations at 2.0-5.0 cm from the balloon surface. However, Cf-BNCT-LWB has shown superior dosimetry up to 2.0 cm from the balloon surface. Cf-BNCT-HWB and Cf-BNCT-LWB protocols provide a selective dose distribution for brain tumour and infiltrations, mainly further from the (252)Cf source, sparing the normal brain tissue. Malignant brain tumours grow rapidly and often spread to adjacent brain tissues, leading to death. Improvements in brain radiation protocols have been continuously achieved; however, brain tumour recurrence is observed in most cases. Cf-BNCT-LWB and Cf-BNCT-HWB represent new modalities for selectively combating brain tumour infiltrations and metastasis.

  11. Intracavitary moderator balloon combined with 252Cf brachytherapy and boron neutron capture therapy, improving dosimetry in brain tumour and infiltrations

    Science.gov (United States)

    Brandão, S F

    2015-01-01

    Objective: This article proposes a combination of californium-252 (252Cf) brachytherapy, boron neutron capture therapy (BNCT) and an intracavitary moderator balloon catheter applied to brain tumour and infiltrations. Methods: Dosimetric evaluations were performed on three protocol set-ups: 252Cf brachytherapy combined with BNCT (Cf-BNCT); Cf-BNCT with a balloon catheter filled with light water (LWB) and the same set-up with heavy water (HWB). Results: Cf-BNCT-HWB has presented dosimetric advantages to Cf-BNCT-LWB and Cf-BNCT in infiltrations at 2.0–5.0 cm from the balloon surface. However, Cf-BNCT-LWB has shown superior dosimetry up to 2.0 cm from the balloon surface. Conclusion: Cf-BNCT-HWB and Cf-BNCT-LWB protocols provide a selective dose distribution for brain tumour and infiltrations, mainly further from the 252Cf source, sparing the normal brain tissue. Advances in knowledge: Malignant brain tumours grow rapidly and often spread to adjacent brain tissues, leading to death. Improvements in brain radiation protocols have been continuously achieved; however, brain tumour recurrence is observed in most cases. Cf-BNCT-LWB and Cf-BNCT-HWB represent new modalities for selectively combating brain tumour infiltrations and metastasis. PMID:25927876

  12. Investigation of Workplace-like Calibration Fields via a Deuterium-Tritium (D-T) Neutron Generator.

    Science.gov (United States)

    Mozhayev, Andrey V; Piper, Roman K; Rathbone, Bruce A; McDonald, Joseph C

    2017-04-01

    Radiation survey meters and personal dosimeters are typically calibrated in reference neutron fields based on conventional radionuclide sources, such as americium-beryllium (Am-Be) or californium-252 (Cf), either unmodified or heavy-water moderated. However, these calibration neutron fields differ significantly from the workplace fields in which most of these survey meters and dosimeters are being used. Although some detectors are designed to yield an approximately dose-equivalent response over a particular neutron energy range, the response of other detectors is highly dependent upon neutron energy. This, in turn, can result in significant over- or underestimation of the intensity of neutron radiation and/or personal dose equivalent determined in the work environment. The use of simulated workplace neutron calibration fields that more closely match those present at the workplace could improve the accuracy of worker, and workplace, neutron dose assessment. This work provides an overview of the neutron fields found around nuclear power reactors and interim spent fuel storage installations based on available data. The feasibility of producing workplace-like calibration fields in an existing calibration facility has been investigated via Monte Carlo simulations. Several moderating assembly configurations, paired with a neutron generator using the deuterium tritium (D-T) fusion reaction, were explored.

  13. Production of medical radioisotopes in the ORNL High Flux Isotope Reactor (HFIR) for cancer treatment and arterial restenosis therapy after PTCA

    Energy Technology Data Exchange (ETDEWEB)

    Knapp, F.F. Jr.; Beets, A.L.; Mirzadeh, S.; Alexander, C.W.; Hobbs, R.L.

    1998-06-01

    The High Flux Isotope Reactor (HFIR) at the Oak Ridge National Laboratory (ORNL) represents an important resource for the production of a wide variety of medical radioisotopes. In addition to serving as a key production site for californium-252 and other transuranic elements, important examples of therapeutic radioisotopes which are currently routinely produced in the HFIR for distribution include dysprosium-166 (parent of holmium-166), rhenium-186, tin-117m and tungsten-188 (parent of rhenium-188). The nine hydraulic tube (HT) positions in the central high flux region permit the insertion and removal of targets at any time during the operating cycle and have traditionally represented a major site for production of medical radioisotopes. To increase the irradiation capabilities of the HFIR, special target holders have recently been designed and fabricated which will be installed in the six Peripheral Target Positions (PTP), which are also located in the high flux region. These positions are only accessible during reactor refueling and will be used for long-term irradiations, such as required for the production of tin-117m and tungsten-188. Each of the PTP tubes will be capable of housing a maximum of eight HT targets, thus increasing the total maximum number of HT targets from the current nine, to a total of 57. In this paper the therapeutic use of reactor-produced radioisotopes for bone pain palliation and vascular brachytherapy and the therapeutic medical radioisotope production capabilities of the ORNL HFIR are briefly discussed.

  14. AcEST: DK946220 [AcEST

    Lifescience Database Archive (English)

    Full Text Available xpect(2) = 5e-79 Identities = 80/96 (83%), Positives = 89/96 (92%) Frame = +2 Query: 230 KFFSIREAAANNLKRLAEE...3/77 (94%), Positives = 76/77 (98%) Frame = +1 Query: 4 DVRLNIISKLDQVNQVIGIDLLSQSLLPAIVELAEDKHWRVRLAIIEYIPLL...31%), Positives = 51/90 (56%) Frame = +2 Query: 242 IREAAANNLKRLAEEFGPEWAMQHIIPQVLEMINNSHYLYRMTILNAISLLAPVMG...ntities = 13/34 (38%), Positives = 19/34 (55%) Frame = +1 Query: 73 QSLLPAIVELAEDKHWRVRLAIIEYIPLLASQLG 174 Q...e = 43.5 bits (101), Expect = 6e-04 Identities = 20/90 (22%), Positives = 49/90 (54%) Frame = +2 Query: 242

  15. Dicty_cDB: CHS418 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 242 1e-86 5 AY954892 |AY954892.1 Cryptosporidium andersoni strain HenanZhzhca heat shock protein 70 gene...242 1e-78 9 AY954893 |AY954893.1 Cryptosporidium andersoni strain changchunca heat shock protein 70 gene...129 5e-78 8 DQ060426 |DQ060426.1 Cryptosporidium andersoni strain zzca heat shock protein 70-like gene,...127 1e-77 7 AY954894 |AY954894.1 Cryptosporidium andersoni strain bjcm heat shock protein 70 gene, partial

  16. Fission cross section calculations of actinides with EMPIRE code

    Energy Technology Data Exchange (ETDEWEB)

    Sin, M.; Oblozinsky, P.; Herman,M.; Capote,R.

    2010-04-30

    The cross sections of the neutron induced reactions on {sup 233,234,236}U, {sup 237}Np, {sup 238,242}Pu, {sup 241,243}Am, {sup 242,246}Cm carried out in the energy range 1 keV-20 MeV with EMPIRE code are presented, emphasizing the fission channel. Beside a consistent, accurate set of evaluations, the paper contains arguments supporting the choice of the reaction models and input parameters. A special attention is paid to the fission parameters and their uncertainties.

  17. Dicty_cDB: Contig-U13161-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available umber of successful extensions: 0 Number of sequences better than 10.0: 0 length of query: 115 length of dat...abase: 5,674,871 effective HSP length: 14 effective length of query: 101 effective length of database: 5,578...76 Number of successful extensions: 2 Number of sequences better than 10.0: 0 Length of query: 115 Length of... database: 95,242,211,685 Length adjustment: 22 Effective length of query: 93 Eff...s: 242 Number of sequences better than 10.0: 0 Number of HSP's gapped: 236 Number of HSP's successfully gapped: 0 Length of query

  18. GETDB: 112279 [GETDB

    Lifescience Database Archive (English)

    Full Text Available Received from the National Institute of Genetics. P/CyO;PrDr/TM3 - 2 - - 0 - cns, a small # of cells - sg - semi lethal - comment...1:A, D, comment2:42C2-C3, P on 2nd Ch (viable), lethal on 3rd Ch - - - - Show 112279 D...cns, a small # of cells Larval GFP - Larval X-gal sg Adult GFP - Lethality semi lethal Also known as - Original Comments comment...1:A, D, comment2:42C2-C3, P on 2nd Ch (viable), lethal on 3rd Ch Disc (Image) - Disc (nu

  19. Dicty_cDB: Contig-U12672-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Danio rerio slow myosin heavy chai... 242 1e-69 AY921649_1( AY921649 |pid:none) Danio rerio slow myosin heavy...Danio rerio slow myosin heavy chai... 242 1e-69 BC134998_1( BC134998 |pid:none) Danio rerio slow myosin heavy...7e-69 BC095380_1( BC095380 |pid:none) Danio rerio slow myosin heavy chai... 239 7e-69 AY116218_1( AY116218...AJ243769 |pid:none) Notothenia coriiceps mRNA for slow... 235 2e-67 EU367967_1( EU367967 |pid:none) Ctenopharyngodon

  20. Dicty_cDB: SLE328 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available (bits) Value (Q8R242) RecName: Full=Di-N-acetylchitobiase; EC=3.2.1.... 256 1e-66 BC088895_1( BC088895 |pid:none)...rerio chitobiase, di-N-acety... 242 2e-62 BC095064_1( BC095064 |pid:none) Danio rerio chitobiase, di-N-acety...rerio chitobiase, di-N-acety... 240 8e-62 BC022594_1( BC022594 |pid:none) Mus musculus chitobiase, di-N-acet

  1. Helicopter Model Studies for On-Board Electrostatic Sensors

    Science.gov (United States)

    1981-09-01

    was accomplished at the wall tesi point as used in the previous experiments. S.6.4.2 Shorted Ground Planes Figure 45 shows the test chamber model...242. Muhleisen, R., Holl, W., "A New Method for Measuring the Density of the Space Charge in the Air," Geofisica pura e applicata, Vol. 22, pp. 3-8

  2. Semantic Integration of Verbal Information Into a Visual Memory

    Science.gov (United States)

    Loftus, Elizabeth F.; And Others

    1978-01-01

    1,242 subjects, in five experiments plus a pilot study, saw a series of slides depicting a single auto-pedestrian accident. These experiments investigate how information supplied after an event influences a witness's memory for that event. Results suggest that information supplied a witness after an event, whether inconsistent or misleading, is…

  3. STI Handbook: Guidelines for Producing, Using, and Managing Scientific and Technical Information at NOSC

    Science.gov (United States)

    1989-09-01

    PRODUCTION PERSONNEL USE ONLY PROCESS PRODUCTIONIBILLING ! NOFTITLE EUNIlSI AMOAUNT I N COPY PREP Y 6l S11$ FORMS UNI IS C~O•H l # • 21STRIP/RFFFLAT 8...thein Pbicataionsbrac.Aleehialmna efforts at NOSC must be coordinated through this group, e.g., assignment S~242 VIH . Logistics Data of numbers, liaison

  4. Componential Skills of Beginning Writing: An Exploratory Study

    Science.gov (United States)

    Kim, Young-Suk; Al Otaiba, Stephanie; Puranik, Cynthia; Folsom, Jessica Sidler; Greulich, Luana; Wagner, Richard K.

    2011-01-01

    The present study examined the components of end of kindergarten writing, using data from 242 kindergartners. Specifically of interest was the importance of spelling, letter writing fluency, reading, and word- and syntax-level oral language skills in writing. The results from structural equation modeling revealed that oral language, spelling, and…

  5. 77 FR 76602 - Office of Hazardous Materials Safety; Actions on Special Permit Applications

    Science.gov (United States)

    2012-12-28

    ... Regulation(s) permit thereof Modification Special Permit Granted 15540-M......... Andrew Airways, 49 CFR To... materials from damaged or stucturally- impaired retail stores impacted by Hurricane Sandy to a temporary... on the truck. (mode 1) 15752-N......... Hurricane Sandy 49 CFR 173.242 To authorize the Response. and...

  6. ASASSN-15lu is a Type Ia Supernova

    NARCIS (Netherlands)

    Leonard, D.C.; Sheehan, P.; McCarthy, D.; Follette, K.; Moustakas, J.; Cantillo, D.; Cazares-Kelly, A.; Cazares-Kelly, S.; Cendes, Y.; Damm, N.; Donati, A.; Douglas, E.; Ferrell, L.; Fosbinder-Elkins, H.; Fox, C.; Greenberg, M.; Hart, K.; Hensley, H.; Holt, A.; Hooper, E.; Juran, C.; Keane, J.; Key, K.; Korus, L.; Lee, T.; Leidig, K.; Merchak, E.; Nessmann, K.; Pendyala, S.; Pirkl, S.; Reeder, J.; Roos, A.; Rounseville, S.; Ruddy, E.; Schlingman, A.; Schlingman, W.; Schwartzman, E.; Shanmugam, V.; Silver, E.; Stein, A.; Stock, N.; Svoboda, B.; Thomas, B.; Thomas, N.; Thompson-Taylor, K.; Walton, H.

    2015-01-01

    We report spectroscopic classification of ASASSN-15lu (ATel #7698) in SDSS J132112.88+401556.7 (z=0.035037, via NED) through inspection of an optical spectrum (range 370-680 nm, resolution 0.8 nm), obtained with the 2.3-m Bok telescope (+ Boller & Chivens spectrograph) at Kitt Peak on 2015 June 24.2

  7. Effects of cadmium exposure on growth and metabolic profile of bermudagrass [Cynodon dactylon (L. Pers].

    Directory of Open Access Journals (Sweden)

    Yan Xie

    Full Text Available Metabolic responses to cadmium (Cd may be associated with variations in Cd tolerance in plants. The objectives of this study were to examine changes in metabolic profiles in bermudagrass in response to Cd stress and to identify predominant metabolites associated with differential Cd tolerance using gas chromatography-mass spectrometry. Two genotypes of bermudagrass with contrasting Cd tolerance were exposed to 0 and 1.5 mM CdSO4 for 14 days in hydroponics. Physiological responses to Cd were evaluated by determining turf quality, growth rate, chlorophyll content and normalized relative transpiration. All these parameters exhibited higher tolerance in WB242 than in WB144. Cd treated WB144 transported more Cd to the shoot than in WB242. The metabolite analysis of leaf polar extracts revealed 39 Cd responsive metabolites in both genotypes, mainly consisting of amino acids, organic acids, sugars, fatty acids and others. A difference in the metabolic profiles was observed between the two bermudagrass genotypes exposed to Cd stress. Seven amino acids (norvaline, glycine, proline, serine, threonine, glutamic acid and gulonic acid, four organic acids (glyceric acid, oxoglutaric acid, citric acid and malic acid, and three sugars (xylulose, galactose and talose accumulated more in WB242 than WB144. However, compared to the control, WB144 accumulated higher quantities of sugars than WB242 in the Cd regime. The differential accumulation of these metabolites could be associated with the differential Cd tolerance in bermudagrass.

  8. Book Review Microfinance: Perils and Prospects

    African Journals Online (AJOL)

    Book Review. Microfinance: Perils and Prospects. Jude L. Fernando (ed), 2012Routledge, London and New York, 242 pp. ISBN - 978 04156 5012 0 Paperback. Reviewed by Kim Shanna Neverson. Aboriginal Health Service Organisation, Montreal, Canada. Microfinance gained tremendous popularity in the 90's, following ...

  9. Gender Equality in Southeast Asia: A Comparative Study of Indonesia and the Philippines

    Science.gov (United States)

    2017-09-01

    in defining and eradicating gender discrimination in the Philippines, but are still awaiting publication. This is a concern for the CEDAW the...fully to all citizens, without discrimination on grounds of ethnicity, religion, race, group, gender , region, occupation and social status.”242 Now...NAVAL POSTGRADUATE SCHOOL MONTEREY, CALIFORNIA THESIS Approved for public release. Distribution is unlimited. GENDER EQUALITY

  10. A mascon approach to assess ice sheet and glacier mass balances and their uncertainties from GRACE data

    NARCIS (Netherlands)

    Schrama, E.J.O.; Wouters, B.; Rietbroek, R.

    2014-01-01

    The purpose of this paper is to assess the mass changes of the Greenland Ice Sheet (GrIS), Ice Sheets over Antarctica, and Land glaciers and Ice Caps with a global mascon method that yields monthly mass variations at 10,242 mascons. Input for this method are level 2 data from the Gravity Recovery

  11. 77 FR 50114 - Food and Drug Administration Modernization Act of 1997: Modifications to the List of Recognized...

    Science.gov (United States)

    2012-08-20

    .... injection systems for medical use--Requirements and test methods--Part 1: Needle-based injection systems. 6.... injection systems for medical use--Requirements and test methods--Part 2: Needles. 6-117 ASTM F2172-02...\\. Medical Bone Screws. 11-242 Standard Specification for ASTM F1839-08 Rigid Polyurethane Foam \\2\\. for Use...

  12. Understanding Gender Differences in Thinking Styles of Gifted Children

    Science.gov (United States)

    Kohan-Mass, Judy

    2016-01-01

    The main purpose of the study was to characterize gender patterns regarding ways of thinking and learning among 242 fifth- and sixth-grade young gifted students in Israel. A written questionnaire was developed to assess ways of thinking as either connected (empathic) or separate (critical, detached). Findings showed that boys consistently rated…

  13. Sadhana | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Sadhana. K K Mishra. Articles written in Sadhana. Volume 32 Issue 3 June 2007 pp 235-242. Design and performance characteristics of an electromagnetic interference shielded enclosure for high voltage Pockels cell switching system · A K Sharma K K Mishra M Raghuramaiah P A Naik P D Gupta.

  14. Browse Title Index

    African Journals Online (AJOL)

    Items 1 - 50 of 242 ... Vol 11, No 2 (2012), Background: Madelung's deformity is a congenital abnormality of the wrist caused by a disturbance of growth that retards the development of ... Vol 9, No 1 (2010), Cobb angle changes in thoracic and lumbar spine fractures following road traffic injuries in Gwagwalada, Abuja, Abstract.

  15. Drug Utilization Study in Ophthalmology Out‑patient Department of a ...

    African Journals Online (AJOL)

    The frequency of drug administration and duration of treatment was recorded in 96% (614/640) and 75% (480/640) of all prescriptions respectively. Antimicrobials were most commonly prescribed (36.4% [552/1516]) followed by anti‑inflammatory and anti‑allergic (24.2% [367/1516]), anti‑glaucoma medications (21.4% ...

  16. Technology basis for the Liquid Effluent Retention Facility Operating Specifications. Revision 3

    Energy Technology Data Exchange (ETDEWEB)

    Johnson, P.G.

    1995-05-17

    The Liquid Effluent Retention Facility (LERF) consists of three retention basins, each with a nominal storage capacity of 6.5 million gallons. LERF serves as interim storage of 242-A Evaporator process condensate for treatment in the Effluent Treatment Facility. This document provides the technical basis for the LERF Operating Specifications, OSD-T-151-00029.

  17. Global Jihad: The Role of Europe’s Radical Muslims

    Science.gov (United States)

    2007-12-01

    Instituto Nacional de Estadistica , Population and Housing Census 2001, (Madrid, Spain: Instituto Nacional de Estadistica , 2001), http://www.ine.es...accessed October 2007). Instituto Nacional de Estadistica . Population and Housing Census 2001. http://www.ine.es/inebase/cgi/um?M=%2Ft20%2Fe242&O= inebase

  18. Uvulectomy - the making of a ritual

    African Journals Online (AJOL)

    Owerri: Conch Magazine Umited. 1977; 52-64. 5. Rubinstein A. Absence of uvula in south Sinai Bedouins. JAMA 1979; 242: 323. 6. Brescia NJ. Anatomy of the lip and palate. In: Grabb WC, Rosenstein SW, Broch. KR, eds. Cleft Up and Palate: Surgical, Dental and Speech Aspects. Boston: Uttle,. Brown & Co, 197t; 373-392.

  19. EST Table: FS904867 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available milar to Ventricular zone-expressed PH domain-containing protein homolog 1 (Protein melted) [Acyrthosiphon p...isum] 10/09/12 48 %/242 aa FBpp0291254|melt-PC 10/08/29 32 %/245 aa K10B4.3#CE35995#WBGene00019615#status:Pa

  20. Georgia's forests, 2004

    Science.gov (United States)

    Richard A. Harper; Nathan D. McClure; Tony G. Johnson; J. Frank Green; James K. Johnson; David B. Dickinson; James L. Chamerlain; KaDonna C. Randolph; Sonja N. Oswalt

    2009-01-01

    Between 1997 and 2004, the Forest Service, Forest Inventory and Analysis Program conducted the eighth inventory of Georgia forests. Forest land area remained stable at 24.8 million acres, and covered about two-thirds of the land area in Georgia. About 24.2 million acres of forest land was considered timberland and 92 percent of that was privately owned. Family forest...

  1. Pu oxidation state distributions in suspensions of the Mont Terri Opalinus Clay isolate Sporomusa sp. MT-2.99

    Energy Technology Data Exchange (ETDEWEB)

    Moll, Henry [Helmholtz-Zentrum Dresden-Rossendorf e.V., Dresden (Germany). Biogeochemistry; Cherkouk, Andrea [Helmholtz-Zentrum Dresden-Rossendorf e.V., Dresden (Germany). HZDR Young Investigator Group; Bok, Frank [Helmholtz-Zentrum Dresden-Rossendorf e.V., Dresden (Germany). Surface Processes

    2017-06-01

    The time-dependent {sup 242}Pu oxidation state distribution in the presence of Sporomusa sp. cells as a function of pH with or without Na-pyruvate was analyzed. In all cases, the presence of bacterial cells enhanced removal of Pu from solution and accelerated Pu interaction reactions, e.g. biosorption and bioreduction.

  2. Vedení akademických pracovníků: Teoretické přístupy a aktuální problémy

    Czech Academy of Sciences Publication Activity Database

    Machovcová, Kateřina; Zábrodská, Kateřina

    2016-01-01

    Roč. 60, č. 2 (2016), s. 137-152 ISSN 0009-062X R&D Projects: GA ČR GA14-02098S Institutional support: RVO:68081740 Keywords : leadership * higher education * academic governance * work environment * organizational psychology Subject RIV: AN - Psychology Impact factor: 0.242, year: 2016

  3. Über einige von Edw. Jacobson auf Java gesammelte Trichopteren

    NARCIS (Netherlands)

    Ulmer, Georg

    1913-01-01

    Seit ich das letzte Verzeichniss der javanischen Triphopteren gab (Notes Leyden Mus. 32. 1910, pp. 64—66) beschrieb Cornelius Betten („Notes on the Trichoptera in the collection of the Indian Museum.” Records of the Indian Museum. Calcutta, Oct. 1909, pp. 231—242 t. 14—18) unter andern indischen

  4. Measurement Structure of the Trait Hope Scale in Persons with Spinal Cord Injury: A Confirmatory Factor Analysis

    Science.gov (United States)

    Smedema, Susan Miller; Pfaller, Joseph; Moser, Erin; Tu, Wei-Mo; Chan, Fong

    2013-01-01

    Objective: To evaluate the measurement structure of the Trait Hope Scale (THS) among individuals with spinal cord injury. Design: Confirmatory factor analysis and reliability and validity analyses were performed. Participants: 242 individuals with spinal cord injury. Results: Results support the two-factor measurement model for the THS with agency…

  5. Věda o well-being - několik (více méně kritických) poznámek

    Czech Academy of Sciences Publication Activity Database

    Urban, Petr

    2016-01-01

    Roč. 60, Suppl. 1 (2016), s. 13-21 ISSN 0009-062X R&D Projects: GA ČR GPP401/12/P544 Institutional support: RVO:67985955 Keywords : well - being * optimal development * happiness * politics * social relations Subject RIV: AA - Philosophy ; Religion Impact factor: 0.242, year: 2016

  6. Zdařilost, zvládání, teritorium: úvaha k étosu hranice

    Czech Academy of Sciences Publication Activity Database

    Pokorný, Vít

    2016-01-01

    Roč. 60, Suppl. 1 (2016), s. 41-52 ISSN 0009-062X R&D Projects: GA ČR(CZ) GA14-22586S Institutional support: RVO:67985955 Keywords : well - being * ill- being * boundary * territory * ethos * childbirth * growth * pain Subject RIV: AA - Philosophy ; Religion Impact factor: 0.242, year: 2016

  7. Osobnostní předpoklady osobní pohody

    Czech Academy of Sciences Publication Activity Database

    Blatný, Marek; Šolcová, Iva

    2016-01-01

    Roč. 60, Supplement 1 (2016), s. 2-12 ISSN 0009-062X R&D Projects: GA ČR GA15-22474S Institutional support: RVO:68081740 Keywords : personality * subjective well - being * psychological well - being * personality traits * characteristic adaptations * personal narratives Subject RIV: AN - Psychology Impact factor: 0.242, year: 2016

  8. Generativita v současném empirickém výzkumu

    Czech Academy of Sciences Publication Activity Database

    Millová, Katarína; Blatný, Marek

    2016-01-01

    Roč. 60, č. 6 (2016), s. 609-621 ISSN 0009-062X R&D Projects: GA ČR GA15-22474S Institutional support: RVO:68081740 Keywords : generativity * personality * well - being * parenting * family * work Subject RIV: AN - Psychology Impact factor: 0.242, year: 2016

  9. Feasibility Study of Commercial Sorbent in Coal-derived Syngas Desulfurization Field.

    Czech Academy of Sciences Publication Activity Database

    Chien, H.-Y.; Chyou, Y.-P.; Svoboda, Karel

    2015-01-01

    Roč. 6, č. 4 (2015), s. 236-242 ISSN 2078-0737 R&D Projects: GA ČR GC14-09692J Grant - others:MOST(TW) NSC 103-2923-E-042A-001 -MY3 Institutional support: RVO:67985858 Keywords : gasification * desulfurization * sorbent Subject RIV: CI - Industrial Chemistry, Chemical Engineering

  10. The Diagnosis of Dementia: Demographic Characteristics.

    Science.gov (United States)

    Coyne, Andrew C.; And Others

    1990-01-01

    Examined demographic characteristics of 242 clinic outpatients evaluated for dementia. Each individual received comprehensive assessment of medical status, psychological functioning, and social abilities. Results add to knowledge of characteristics of individuals with Alzheimer's disease, multi-infarct dementia, or other related disorders.…

  11. Clean Hands Count

    Medline Plus

    Full Text Available ... Wash your Hands - it just makes sense. - Duration: 1:36. Seema Marwaha 353,242 views 1:36 Wash 'Em - Hand Hygiene Music Video - Duration: ... 3:10 Hand Washing Technique - WHO Approved - Duration: 1:19. AllYouWantTV 632,779 views 1:19 5 ...

  12. Evaluation of cryogenic procedures for cryopreservation of Cassava genotypes

    Science.gov (United States)

    Cassava (Manihot esculent Crantz) is a perennial plant widely grown in many tropical countries as one of the most important commercial crops. The global cassava production in 2009 was at 242 million tons. Because of its economic importance to a large number of developing world, the application of ad...

  13. hydromedusae off the orange river mouth, southern africa

    African Journals Online (AJOL)

    A total of 242 zooplankton samples from the upper 100 m of the water column was collected discontinuously from March 1997 to January 1999 off the Orange River mouth on the west coast of southern Africa. Six species of hydromedusae were recovered at generally low abundance, of which Euphysa aurata, Leuckartia ...

  14. Early rebleeding and death at 6 weeks in alcoholic cirrhotic patients ...

    African Journals Online (AJOL)

    Background. This study evaluated the incidence of rebleeding and death at 6 weeks after a first episode of acute variceal haemorrhage (AVH) treated by emergency endoscopic sclerotherapy in a large cohort of alcoholic cirrhotic patients. Methods. From January 1984 to December 2006, 310 alcoholic cirrhotic patients (242 ...

  15. Growth Studies of Probiotic Bacteria on Short Chain Glucomannan, a Potential Prebiotic Substrate

    Science.gov (United States)

    2012-12-05

    hydrolysates promoted the growth of anaerobes and Lactobacilli while reducing the population of Clostridium perfringens and Esherichia coli. Connolly et...were Aerobacter mannanolyticus QMB 161 and Clostridium butyricum 859. 2.4.2 Media Used in Growth of Bacteria The GMc powder and the GMβ powder...TECHNICAL REPORT AD ________________ NATICK/TR-13/009 GROWTH STUDIES OF

  16. Altitudinal and seasonal differences of tick communities in dogs from pastoralist tribes of Northern Kenya

    Czech Academy of Sciences Publication Activity Database

    D'Amico, G.; Dumitrache, M.O.; Široký, P.; Albrechtová, K.; Sloboda, M.; Domsa, C.; Sándor, A.D.; Balázsi, R.; Kanyari, P. W. N.; Modrý, David; Mihalca, A. D.

    2015-01-01

    Roč. 212, 3-4 (2015), s. 318-323 ISSN 0304-4017 Institutional support: RVO:60077344 Keywords : Altitudinal distribution * Rhipicephalus sanguineus * Rhipicephalus pulchellus * Rhipicephalus armatus Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 2.242, year: 2015

  17. Assessing the vegetation canopy influences on wind flow using wind ...

    Indian Academy of Sciences (India)

    1 Gwanak-ro, Gwanak-gu, Seoul 08826, Republic of Korea. 2Division of Forest ... Seoul 02455, Republic of Korea. 3Present address: GimpoJeil High School, 242, Gimpohangang 11-ro, Gimpo-si, Gyeonggi-do 10073,. Republic of Korea. ∗. Corresponding ..... Gillette D A and Pitchford A M 2004 Sand flux in the north-.

  18. Bryozoa from the Tertiary sediments of Western Kachchh, Gujarat ...

    Indian Academy of Sciences (India)

    succession of Jabal Hafit, Al Ain, United Arab Emi- rates and Arabian Peninsula; Bullettino della Societ`a. Palaeontologica Italiana 42(3) 242–265. Canu F and Bassler R S 1920 North American early Tertiary. Bryozoa; United States National Museum Bulletin 106. 1–879. Canu F and Bassler R S 1929 Contribution to the ...

  19. Caught in the Crossfire: A Report on Gun Violence in Our Nation's Schools.

    Science.gov (United States)

    Center To Prevent Handgun Violence, Washington, DC.

    Based on news stories from U.S. newspapers, this report examines the prevalence of gun violence in American schools. During the past 4 years, beginning with September 1986, at least 71 people (65 students and 6 employees) have been killed with guns at school. Another 201 were severely wounded, and 242 individuals were held hostage at gunpoint.…

  20. Climate Change and Maize Production: Empirical Evidence from ...

    African Journals Online (AJOL)

    Michael Madukwe

    cultivated(2.70), weather forecast technology(2.66) were also shown to be significant adaptation measures used by fluted pumpkin producers while drought tolerant species(2.42) and information from extension agents(2.22) were identified as non significant adaptation measures used by fluted pumpkin producers. TABLE 4.

  1. 77 FR 16249 - National Institute of Mental Health; Notice of Closed Meeting

    Science.gov (United States)

    2012-03-20

    ... From the Federal Register Online via the Government Publishing Office DEPARTMENT OF HEALTH AND... published less than 15 days prior to the meeting due to the timing limitations imposed by the review and funding cycle. (Catalogue of Federal Domestic Assistance Program Nos. 93.242, Mental Health Research...

  2. 77 FR 12603 - National Institute of Mental Health; Notice of Closed Meeting

    Science.gov (United States)

    2012-03-01

    ... From the Federal Register Online via the Government Publishing Office DEPARTMENT OF HEALTH AND... limitations imposed by the review and funding cycle. (Catalogue of Federal Domestic Assistance Program Nos. 93.242, Mental Health Research Grants; 93.281, Scientist Development Award, Scientist Development Award...

  3. the relevance of continental philosophy of religion for theology in ...

    African Journals Online (AJOL)

    4 One should take note that there is a move in contemporary European philosophy to question whether Kant was “genuinely able to deduce categories instead of imposing them” (Malabou 2014:242). This potential break with Kant has not developed fully yet, but it can have huge implications for rethinking religion if.

  4. CHARACTERIZATION AND CHROMOSOMAL ASSIGNMENT OF YEAST ARTIFICIAL CHROMOSOMES CONTAINING HUMAN 3P13-P21-SPECIFIC SEQUENCE-TAGGED SITES

    NARCIS (Netherlands)

    MICHAELIS, SC; BARDENHEUER, W; LUX, A; SCHRAMM, A; GOCKEL, A; SIEBERT, R; WILLERS, C; SCHMIDTKE, K; TODT, B; VANDERHOUT, AH; BUYS, CHCM; HEPPELLPARTON, AC; RABBITTS, PH; UNGAR, S; SMITH, D; LEPASLIER, D; COHEN, D; OPALKA, B; SCHUTTE, J

    Human chromosomal region 3p12-p23 is proposed to harbor at least three tumor suppressor genes involved in the development of lung cancer, renal cell carcinoma, and other neoplasias. In order to identify one of these genes we defined sequence tagged sites (STSs) specific for 3p13-p24.2 by analyzing a

  5. Clinical Perspective Level of depression among adolescents of ...

    African Journals Online (AJOL)

    ... or differences between these two groups. Conclusions: The findings of the study suggest that religious minority adolescents (Christians and Hindus) in Pakistan are inclined to have higher levels of depression than their dominant counterparts (Muslim adolescents). Journal of Child & Adolescent Mental Health 2012, 24(2): ...

  6. Integrated morphological and molecular identification of cat fleas (Ctenocephalides felis) and dog fleas (Ctenocephalides canis) vectoring Rickettsia felis in central Europe

    Czech Academy of Sciences Publication Activity Database

    Lawrence, A.L.; Hii, S.-F.; Jirsová, D.; Panáková, L.; Ionică, A.M.; Gilchrist, K.; Modrý, David; Mihalca, A. D.; Webb, C.E.; Traub, R.J.; Šlapeta, J.

    2015-01-01

    Roč. 210, 3-4 (2015), s. 215-223 ISSN 0304-4017 Institutional support: RVO:60077344 Keywords : Arthropod * Siphonaptera * Zoonosis * Bartonella * Taxonomy * cox1 Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 2.242, year: 2015

  7. Web-Searching to Learn: The Role of Internet Self-Efficacy in Pre-School Educators' Conceptions and Approaches

    Science.gov (United States)

    Kao, Chia-Pin; Chien, Hui-Min

    2017-01-01

    This study was conducted to explore the relationships between pre-school educators' conceptions of and approaches to learning by web-searching through Internet Self-efficacy. Based on data from 242 pre-school educators who had prior experience of participating in web-searching in Taiwan for path analyses, it was found in this study that…

  8. Journal of Biosciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Biosciences. K Lalitha. Articles written in Journal of Biosciences. Volume 28 Issue 2 March 2003 pp 235-242 Articles. Metabolic characteristics of an aerobe isolated from a methylotrophic methanogenic enrichment culture · Stephen V Rapheal K R Swaminathan K Lalitha · More Details Abstract ...

  9. LMC X-1 のX 線観測によるブラックホール降着円盤の研究

    OpenAIRE

    小山, 志勇

    2015-01-01

    1 Introduction 132 Review 172.1 Fundamental Properties of Black Hole . . . . . . . . . . . . . . . . . . . . . 182.2 Observation of Black Hole Binaries . . . . . . . . . . . . . . . . . . . . . . . 202.2.1 Discovery of Black Hole Binaries . . . . . . . . . . . . . . . . . . . . 202.2.2 X-ray Properties of Black Hole Binaries . . . . . . . . . . . . . . . . . 212.2.3 Spectral States Evolution . . . . . . . . . . . . . . . . . . . . . . . . 242.3 Physics and Models of Accretion Disks . . . . . ...

  10. Loss of the BMP antagonist, SMOC-1, causes Ophthalmo-acromelic (Waardenburg Anophthalmia) syndrome in humans and mice

    NARCIS (Netherlands)

    Rainger, Joe; van Beusekom, Ellen; Ramsay, Jacqueline K.; McKie, Lisa; Al-Gazali, Lihadh; Pallotta, Rosanna; Saponari, Anita; Branney, Peter; Fisher, Malcolm; Morrison, Harris; Bicknell, Louise; Gautier, Philippe; Perry, Paul; Sokhi, Kishan; Sexton, David; Bardakjian, Tanya M.; Schneider, Adele S.; Elcioglu, Nursel; Ozkinay, Ferda; Koenig, Rainer; Mégarbané, Andre; Semerci, C. Nur; Khan, Ayesha; Zafar, Saemah; Hennekam, Raoul; Sousa, Sérgio B.; Ramos, Lina; Garavelli, Livia; Furga, Andrea Superti; Wischmeijer, Anita; Jackson, Ian J.; Gillessen-Kaesbach, Gabriele; Brunner, Han G.; Wieczorek, Dagmar; van Bokhoven, Hans; Fitzpatrick, David R.

    2011-01-01

    Ophthalmo-acromelic syndrome (OAS), also known as Waardenburg Anophthalmia syndrome, is defined by the combination of eye malformations, most commonly bilateral anophthalmia, with post-axial oligosyndactyly. Homozygosity mapping and subsequent targeted mutation analysis of a locus on 14q24.2

  11. Loss of the BMP Antagonist, SMOC-1, Causes Ophthalmo-Acromelic (Waardenburg Anophthalmia) Syndrome in Humans and Mice

    NARCIS (Netherlands)

    Rainger, J.; van Beusekom, E.; Ramsay, J.K.; McKie, L.; Al-Gazali, L.; Pallotta, R.; Saponari, A.; Branney, P.; Fisher, M.; Morrison, H.; Bicknell, L.; Gautier, P.; Perry, P.; Sokhi, K.; Sexton, D.; Bardakjian, T.M.; Schneider, A.S.; Elcioglu, N.; Ozkinay, F.; Koenig, R.; Megarbane, A.; Semerci, C.N.; Khan, A.; Zafar, S.; Hennekam, R.; Sousa, S.B.; Ramos, L.; Garavelli, L.; Furga, A.S.; Wischmeijer, A.; Jackson, I.J.; Gillessen-Kaesbach, G.; Brunner, H.G.; Wieczorek, D; van Bokhoven, H.; Fitzpatrick, D.R.

    2011-01-01

    Ophthalmo-acromelic syndrome (OAS), also known as Waardenburg Anophthalmia syndrome, is defined by the combination of eye malformations, most commonly bilateral anophthalmia, with post-axial oligosyndactyly. Homozygosity mapping and subsequent targeted mutation analysis of a locus on 14q24.2

  12. What we should know about genetically modified foods | Akromah ...

    African Journals Online (AJOL)

    ... informed to be able to take decisions on whether or not to allow GM foods into the food chain. In this paper, I present basic facts for the general public and invite other opinions on the topic and suggestions for the Way Forward in a developing country like Ghana. Journal of Science and Technology Vol.24(2) 2004: 8-12 ...

  13. Problems in Quantum Mechanics with Solutions

    CERN Document Server

    d'Emilio, Emilio

    2011-01-01

    242 solved problems of several degrees of difficulty in nonrelativistic Quantum Mechanics, ranging from the themes of the crisis of classical physics, through the achievements in the framework of modern atomic physics, down to the still alive, more intriguing aspects connected e.g. with the EPR paradox, the Aharonov--Bohm effect, quantum teleportation.

  14. Early Temperamental and Family Predictors of Shyness and Anxiety

    Science.gov (United States)

    Volbrecht, Michele M.; Goldsmith, H. Hill

    2010-01-01

    With a sample of 242 twins (135 girls, 107 boys) studied longitudinally, behavioral inhibition (BI) and inhibitory control (IC) measured at 3 years, as well as early and concurrent family process variables, were examined as predictors of shyness and of anxiety symptoms approximately 4 years later. Structured observational data from laboratory and…

  15. Education Returns of Wage Earners and Self-Employed Workers: Comment

    Science.gov (United States)

    Jordahl, Henrik; Poutvaara, Panu; Tuomala, Juha

    2009-01-01

    In a recent paper, Garcia-Mainar and Montuenga-Gomez [Garcia-Mainar, I. & Montuenga-Gomez, V. M. (2005). Education returns of wage earners and self-employed workers: Portugal vs. Spain. "Economics of Education Review, 24"(2), 161-170] apply the generalized IV model of Hausman and Taylor to estimate education returns of wage earners…

  16. The Pattern of Cardiac Diseases at the Cardiac Clinic of Jimma ...

    African Journals Online (AJOL)

    RESULTS: Rheumatic heart disease was the diagnosis in 256 (32.8%) of the cardiac cases on follow-up followed by hypertensive heart disease and cardiomyopathy accounting for 189 (24.2%) and 158 (20.2%) of cases, respectively. Among Rheumatic heart disease patients; male to female ratio was 0.86:1 and the mean ...

  17. Socialization Values and Parenting Practices as Predictors of Parental Involvement in Their Children's Educational Process

    Science.gov (United States)

    Kikas, Eve; Tulviste, Tiia; Peets, Kätlin

    2014-01-01

    Research Findings: The purpose of this study was to examine associations between parental socialization values (including inconsistency in values), parenting practices, and parental involvement in their children's education. Altogether 242 Estonian mothers and fathers of first-grade children participated in the study. We found that mothers were…

  18. 76 FR 78671 - National Institute of Mental Health; Notice of Closed Meeting

    Science.gov (United States)

    2011-12-19

    ...: National Institutes of Health, Neuroscience Center, 6001 Executive Boulevard Rockville, MD 20852 (Telephone... Extramural Activities, National Institute of Mental Health, NIH, Neuroscience Center/Room 6138/MSC 9608, 6001... Domestic Assistance Program Nos. 93.242, Mental Health Research Grants; 93.281, Scientist Development Award...

  19. 76 FR 15989 - National Institute of Mental Health; Notice of Closed Meeting

    Science.gov (United States)

    2011-03-22

    ..., Neuroscience Center, 6001 Executive Boulevard, Rockville, MD 20852, (Telephone Conference Call). Contact Person... of Mental Health, NIH, Neuroscience Center, 6001 Executive Blvd., Room 6142, MSC 9606, Bethesda, MD.... 93.242, Mental Health Research Grants; 93.281, Scientist Development Award, Scientist Development...

  20. 78 FR 22272 - National Institute of Mental Health; Notice of Closed Meeting

    Science.gov (United States)

    2013-04-15

    ... Health, Neuroscience Center, 6001 Executive Boulevard, Rockville, MD 20852, (Telephone Conference Call..., National Institute of Mental Health, NIH, Neuroscience Center, 6001 Executive Blvd., Room 6140, MSC 9608... Program Nos. 93.242, Mental Health Research Grants; 93.281, Scientist Development Award, Scientist...

  1. 77 FR 14534 - National Institute of Mental Health; Notice of Closed Meeting

    Science.gov (United States)

    2012-03-12

    ... Institutes of Health, Neuroscience Center, 6001 Executive Boulevard, Rockville, MD 20852, (Telephone... Extramural Activities, National Institute of Mental Health, NIH, Neuroscience Center/Room 6138/MSC 9608, 6001... Domestic Assistance Program Nos. 93.242, Mental Health Research Grants; 93.281, Scientist Development Award...

  2. 75 FR 31799 - National Institute of Mental Health; Notice of Closed Meeting

    Science.gov (United States)

    2010-06-04

    .... Place: National Institutes of Health, Neuroscience Center, 6001 Executive Boulevard, Rockville, MD 20852... Extramural Activities, National Institute of Mental Health, NIH, Neuroscience Center, 6001 Executive Blvd... Domestic Assistance Program Nos. 93.242, Mental Health Research Grants; 93.281, Scientist Development Award...

  3. A Longitudinal Investigation of Peer Sexual Harassment Victimization in Adolescence

    Science.gov (United States)

    Petersen, Jennifer L.; Hyde, Janet Shibley

    2009-01-01

    The current study describes longitudinal trends in sexual harassment by adolescent peers and highlights gender, pubertal status, attractiveness, and power as predictors of harassment victimization. At the end of 5th, 7th, and 9th grades, 242 adolescents completed questionnaires about sexual harassment victimization, pubertal status, and perceived…

  4. The contribution of risk factors to the higher incidence of invasive and in situ breast cancers in women with higher levels of education in the European prospective investigation into cancer and nutrition

    NARCIS (Netherlands)

    G. Menvielle (Gwenn); A.E. Kunst (Anton); C.H. van Gils (Carla); P.H.M. Peeters (Petra); H.C. Boshuizen (Hendriek); K. Overvad (Kim); A. Olsen (Anja); A. Tjonneland (Anne); S. Hermann (Silke); R. Kaaks (Rudolf); M.M. Bergmann (Manuela); A.-K. Illner (Anne-Kathrin); P. Lagiou (Pagona); D. Trichopoulos (Dimitrios); A. Trichopoulou (Antonia); D. Palli (Domenico); F. Berrino (Franco); A. Mattiello (Amelia); R. Tumino (Rosario); C. Sacerdote (Carlotta); A.M. May (Anne); E. Monninkhof (Evelyn); T. Braaten (Tonje); E. Lund (Eiliv); J.R. Quirós; E.J. Duell (Eric); M.J. Sánchez; C. Navarro (Carmen); S. Borgquist (Signe); J. Manjer (Jonas); K-T. Khaw (Kay-Tee); G.K. Reeves (Gillian); V. Chajes (Véronique); S. Rinaldi (Sabina); N. Slimani (Nadia); V. Gallo (Valentina); P. Vineis (Paolo); E. Riboli (Elio); H.B. Bueno-De-Mesquita (Bas); N.E. Allen (Naomi); E. Ardanaz (Eva)

    2011-01-01

    textabstractThe authors investigated the role of known risk factors in educational differences in breast cancer incidence. Analyses were based on the European Prospective Investigation Into Cancer and Nutrition and included 242,095 women, 433 cases of in situ breast cancer, and 4,469 cases of

  5. Visual Problems in Night Operations (Problemes de Vision dans les Operations de Nuit)

    Science.gov (United States)

    1992-05-01

    Imagery and verbal processes, Holt, Rinehart, Winston eds, NY PIAGETJ. INHELDER B. (1966) Les images mentales, in Fraisse et Piaget, eds, Tralte de...environment. ENG Publication en serbe BERNARD E. VOL 24; pp. 237-242; 2 Fig.; 6 Phot. ;OP. 1991/03 C-91-007480 Cot article est entidrement consacr6 aux

  6. Board meetings

    International Development Research Centre (IDRC) Digital Library (Canada)

    Ruxandra Staicu

    Purpose: Board meetings. Date(s):. 2015-07-13 to 2015-07-14. Destination(s):. Ottawa. Airfare: $5,687.53. Other Transportation: $60.14. Accommodation: $344.56. Meals and. Incidentals: $150.00. Other: Total: $6,242.23. Comments: 2015-2016 Travel and Hospitality Expense. Reports for Shainoor Khoja, Governor.

  7. 78 FR 64228 - National Institute of Mental Health; Notice of Closed Meetings

    Science.gov (United States)

    2013-10-28

    ... Special Emphasis Panel; Silvio O. Conte Centers for Basic or Translational Mental Health Research. Date... of Committee: National Institute of Mental Health Special Emphasis Panel; NRSA Institutional Research[email protected] . (Catalogue of Federal Domestic Assistance Program No. 93.242, Mental Health Research...

  8. Executive self, self-esteem, and negative affectivity: Relations at the phenotypic and genotypic level

    NARCIS (Netherlands)

    Neiss, M.B.; Stevenson, J.; Sedikides, C.; Kumashiro, M.; Finkel, E.J.; Rusbult, C.E.

    2005-01-01

    Complementary approaches examined the relations among executive self, self-esteem, and negative affectivity. A cross-sectional (N = 4,242) and a longitudinal (N = 158) study established that self-esteem mediated the relation between executive self and negative affectivity. A 3rd study (N = 878 twin

  9. A Comparison Study of 9th Graders in the U.S. and Albania

    Science.gov (United States)

    Garo, Sofokli

    2008-01-01

    The purpose of this research is to compare American and Albanian students' achievement in Algebra 1 and to identify the educational practices that influence students' achievement in each country. The study compared algebraic solving abilities of 242 ninth-grade American students in Grand Forks (U.S.) and 219 students in Durres (Albania). The data…

  10. How Christian Spiritual and Religious Beliefs Help and Hinder Counselors' Empathy toward Clients

    Science.gov (United States)

    Morrison, Marie; Borgen, William A.

    2010-01-01

    The critical incident technique was used to examine how counselors' religion and spirituality help and hinder counselor empathy toward clients. Twelve counselors holding Christian beliefs identified 242 helping and 25 hindering incidents that formed 14 helping and 3 hindering categories. Categories reflected counselors relying on a natural…

  11. Indexes to Volume 59

    Indian Academy of Sciences (India)

    221–228. Generic entangling through quantum indistinguishability. Sougato Bose and Dipankar Home. 229–234. Decoherence control in quantum computing with simple chirped pulses. Debabrata Goswami. 235–242. 1081 .... A high resolution AMS-injector for the Pelletron in Lund. R Hellborg,. S Bazhal, M Faarinen, K H ...

  12. Metodologické srovnání práce s fenomenálními poli ve fenomenologické topologii a ve fenomenologické psychologii osobnosti

    Czech Academy of Sciences Publication Activity Database

    Nitsche, Martin

    2016-01-01

    Roč. 60, Suppl. 1 (2016), s. 22-30 ISSN 0009-062X R&D Projects: GA ČR(CZ) GA14-22586S Institutional support: RVO:67985955 Keywords : phenomenal field * phenomenology * phenomenological topology * phenomenal field theory * Husserl * Merleau-Ponty * Snygg – Combs Subject RIV: AA - Philosophy ; Religion Impact factor: 0.242, year: 2016

  13. Pracovní gerontologie: obor s budoucností

    Czech Academy of Sciences Publication Activity Database

    Šolcová, Iva

    2017-01-01

    Roč. 61, č. 4 (2017), s. 396-400 ISSN 0009-062X R&D Projects: GA ČR GA17-02634S Institutional support: RVO:68081740 Keywords : worforce aging * older worker * retirement age * stereotypes * work ability Subject RIV: AN - Psychology OBOR OECD: Psychology (including human - machine relations) Impact factor: 0.242, year: 2016

  14. Provinciale verschillen in perinatale sterfte en reistijd tot ziekenhuis

    NARCIS (Netherlands)

    Ravelli, A.C.; Rijninks-van Driel, G.C.; Erwich, J.J.; Mol, B.W.; Brouwers, H.A.; Abu, Hanna A.; Eskes, M.

    2011-01-01

    OBJECTIVE: To investigate differences in perinatal mortality between Dutch provinces and to determine the significance of risk factors including travel time from home to the hospital during labour. DESIGN: Cohort study. METHOD: The study was based on 1,242,725 singleton births in 2000-2006 as

  15. Download this PDF file

    African Journals Online (AJOL)

    Administrator

    Abstract. Background: Information on lymphocyte populations (T, B, and Natural killer cells) and subpopulations (CD4 and CD8) in Morocco is scarce if not inexistent. Objective: To establish a reference value of these cells in 242 Moroccan young adult blood donors by flow cytometry. Results: Smokers had significantly ...

  16. 76 FR 64082 - Mandatory Reliability Standards for the Bulk-Power System; Notice of Staff Meeting

    Science.gov (United States)

    2011-10-17

    ... Energy Regulatory Commission Mandatory Reliability Standards for the Bulk-Power System; Notice of Staff...\\ Mandatory Reliability Standards for the Bulk-Power System, Order No. 693, FERC Stats. & Regs. ] 31,242... Discussion on the reliability issues relating to ``Single Point of Failure on Protection Systems,'' on Monday...

  17. Dicty_cDB: Contig-U10778-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 255 e-128 DQ980509_1( DQ980509 |pid:none) Thaumatomonas sp. TMT002 alpha tub... 242 e-128 AY818731_1( AY8187... e-122 DQ980537_1( DQ980537 |pid:none) Leucocryptos marina clone lmtua10 ... 245 e-122 EF455794_1( EF455794 |pid:none) Thaumatomo

  18. Dicty_cDB: Contig-U12954-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available better than 10.0: 0 Length of query: 117 Length of database: 95,242,211,685 Length adjustment...'s gapped: 6 Number of HSP's successfully gapped: 0 Length of query: 39 Length of database: 1,051,180,864 Length adjustment

  19. Dicty_cDB: Contig-U06722-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available query: 184 Length of database: 95,242,211,685 Length adjustment: 22 Effective length of query: 162 Effectiv...uery: 61 Length of database: 1,040,966,779 Length adjustment: 33 Effective length of query: 28 Effective len

  20. Dicty_cDB: Contig-U13178-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available DB: 0 Number of sequences better than 10.0: 0 Length of query: 152 Length of database: 95,242,211,685 Length adjustment... of database: 1,051,180,864 Length adjustment: 0 Effective length of query: 50 Effective length of database: