WorldWideScience

Sample records for californium 237

  1. Californium-252 progress, report No. 7, April 1971

    Energy Technology Data Exchange (ETDEWEB)

    1971-12-31

    This report contains discusses of the following topics on Californium-252: First sales of californium-252; encapsulation services discussed; three new participants in market evaluation program; summer training programs to use californium; Californium-252 shipping casks available; Californium-252 questions and answers, radiotherapy; neutron radiography; natural resources exploration; nuclear safeguards; process control; dosimetry; neutron radiography; neutron shielding; and nuclear safeguards.

  2. Historical review of californium-252 discovery and development

    Science.gov (United States)

    Stoddard, D. H.

    This paper discusses the discovery and history of californium 252. This isotope may be synthesized by irradiating plutonium 239, plutonium 242, americium 243, or curium 244 with neutrons in a nuclear reactor. Various experiments and inventions involving (252)Cf conducted at the Savannah River Plant are discussed. The evolution of radiotherapy using californium 252 is reviewed.

  3. Californium-252: a remarkable versatile radioisotope

    Energy Technology Data Exchange (ETDEWEB)

    Osborne-Lee, I.W.; Alexander, C.W.

    1995-10-10

    A product of the nuclear age, Californium-252 ({sup 252}Cf) has found many applications in medicine, scientific research, industry, and nuclear science education. Californium-252 is unique as a neutron source in that it provides a highly concentrated flux and extremely reliable neutron spectrum from a very small assembly. During the past 40 years, {sup 252}Cf has been applied with great success to cancer therapy, neutron radiography of objects ranging from flowers to entire aircraft, startup sources for nuclear reactors, fission activation for quality analysis of all commercial nuclear fuel, and many other beneficial uses, some of which are now ready for further growth. Californium-252 is produced in the High Flux Isotope Reactor (HFIR) and processed in the Radiochemical Engineering Development Center (REDC), both of which are located at the Oak Ridge National Laboratory (ORNL) in Oak Ridge, Tennessee. The REDC/HFIR facility is virtually the sole supplier of {sup 252}Cf in the western world and is the major supplier worldwide. Extensive exploitation of this product was made possible through the {sup 252}Cf Market Evaluation Program, sponsored by the United States Department of Energy (DOE) [then the Atomic Energy Commission (AEC) and later the Energy Research and Development Administration (ERDA)]. This program included training series, demonstration centers, seminars, and a liberal loan policy for fabricated sources. The Market Evaluation Program was instituted, in part, to determine if large-quantity production capability was required at the Savannah River Laboratory (SRL). Because of the nature of the product and the means by which it is produced, {sup 252}Cf can be produced only in government-owned facilities. It is evident at this time that the Oak Ridge research facility can meet present and projected near-term requirements. The production, shipment, and sales history of {sup 252}Cf from ORNL is summarized herein.

  4. Production, Distribution, and Applications of Californium-252 Neutron Sources

    Energy Technology Data Exchange (ETDEWEB)

    Balo, P.A.; Knauer, J.B.; Martin, R.C.

    1999-10-03

    The radioisotope {sup 252}Cf is routinely encapsulated into compact, portable, intense neutron sources with a 2.6-year half-life. A source the size of a person's little finger can emit up to 10{sup 11} neutrons/s. Californium-252 is used commercially as a reliable, cost-effective neutron source for prompt gamma neutron activation analysis (PGNAA) of coal, cement, and minerals, as well as for detection and identification of explosives, laud mines, and unexploded military ordnance. Other uses are neutron radiography, nuclear waste assays, reactor start-up sources, calibration standards, and cancer therapy. The inherent safety of source encapsulations is demonstrated by 30 years of experience and by U.S. Bureau of Mines tests of source survivability during explosions. The production and distribution center for the U. S Department of Energy (DOE) Californium Program is the Radiochemical Engineering Development Center (REDC) at Oak Ridge National Laboratory (ORNL). DOE sells The radioisotope {sup 252}Cf is routinely encapsulated into compact, portable, intense neutron sources with a 2.6- year half-life. A source the size of a person's little finger can emit up to 10 neutrons/s. Californium-252 is used commercially as a reliable, cost-effective neutron source for prompt gamma neutron activation analysis (PGNAA) of coal, cement, and minerals, as well as for detection and identification of explosives, laud mines, and unexploded military ordnance. Other uses are neutron radiography, nuclear waste assays, reactor start-up sources, calibration standards, and cancer therapy. The inherent safety of source encapsulations is demonstrated by 30 years of experience and by U.S. Bureau of Mines tests of source survivability during explosions. The production and distribution center for the U. S Department of Energy (DOE) Californium Program is the Radiochemical Engineering Development Center (REDC) at Oak Ridge National Laboratory(ORNL). DOE sells {sup 252}Cf to commercial

  5. Unusual structure, bonding and properties in a californium borate

    Energy Technology Data Exchange (ETDEWEB)

    Polinski, Matthew J.; Garner, Edward B.; Maurice, Rémi; Planas, Nora; Stritzinger, Jared T.; Parker, T. Gannon; Cross, Justin N.; Green, Thomas D.; Alekseev, Evgeny V.; Van Cleve, Shelley M.; Depmeier, Wulf; Gagliardi, Laura; Shatruk, Michael; Knappenberger, Kenneth L.; Liu, Guokui; Skanthakumar, S.; Soderholm, Lynda; Dixon, David A.; Albrecht-Schmitt, Thomas E.

    2014-03-23

    The participation of the valence orbitals of actinides in bonding has been debated for decades. Recent experimental and computational investigations demonstrated the involvement of 6p, 6d and/or 5f orbitals in bonding. However, structural and spectroscopic data, as well as theory, indicate a decrease in covalency across the actinide series, and the evidence points to highly ionic, lanthanide-like bonding for late actinides. Here we show that chemical differentiation between californium and lanthanides can be achieved by using ligands that are both highly polarizable and substantially rearrange on complexation. A ligand that suits both of these desired properties is polyborate. We demonstrate that the 5f, 6d and 7p orbitals are all involved in bonding in a Cf(III) borate, and that large crystal-field effects are present. Synthetic, structural and spectroscopic data are complemented by quantum mechanical calculations to support these observations.

  6. 47 CFR 24.237 - Interference protection.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 2 2010-10-01 2010-10-01 false Interference protection. 24.237 Section 24.237... SERVICES Broadband PCS § 24.237 Interference protection. (a) All licensees are required to coordinate their... proposed facilities will not cause interference to existing OFS stations within the coordination distance...

  7. 48 CFR 252.237-7006 - Subcontracting.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Subcontracting. 252.237... Clauses 252.237-7006 Subcontracting. As prescribed in 237.7003(b), use the following clause: Subcontracting (DEC 1991) The Contractor shall not subcontract any work under this contract without the...

  8. 49 CFR 237.131 - Design.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Design. 237.131 Section 237.131 Transportation... TRANSPORTATION BRIDGE SAFETY STANDARDS Repair and Modification of Bridges § 237.131 Design. Each repair or... component of a bridge shall be designed by a railroad bridge engineer. The design shall specify the manner...

  9. 7 CFR 959.237 - Assessment rate.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 8 2010-01-01 2010-01-01 false Assessment rate. 959.237 Section 959.237 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Marketing Agreements and Orders; Fruits, Vegetables, Nuts), DEPARTMENT OF AGRICULTURE ONIONS GROWN IN SOUTH TEXAS Assessment Rates § 959.237 Assessment rate. On...

  10. Biomedical neutron research at the Californium User Facility for neutron science

    Energy Technology Data Exchange (ETDEWEB)

    Martin, R.C. [Oak Ridge National Lab., TN (United States); Byrne, T.E. [Roane State Community College, Harriman, TN (United States); Miller, L.F. [Univ. of Tennessee, Knoxville, TN (United States)

    1997-04-01

    The Californium User Facility for Neutron Science has been established at Oak Ridge National Laboratory (ORNL). The Californium User Facility (CUF) is a part of the larger Californium Facility, which fabricates and stores compact {sup 252}Cf neutron sources for worldwide distribution. The CUF can provide a cost-effective option for research with {sup 252}Cf sources. Three projects at the CUF that demonstrate the versatility of {sup 252}Cf for biological and biomedical neutron-based research are described: future establishment of a {sup 252}Cf-based neutron activation analysis system, ongoing work to produce miniature high-intensity, remotely afterloaded {sup 252}Cf sources for tumor therapy, and a recent experiment that irradiated living human lung cancer cells impregnated with experimental boron compounds to test their effectiveness for boron neutron capture therapy.

  11. 7 CFR 205.237 - Livestock feed.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Livestock feed. 205.237 Section 205.237 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Standards, Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE (CONTINUED) ORGANIC FOODS PRODUCTION ACT PROVISIONS NATIONAL ORGANIC PROGRAM Organic...

  12. Apparatus for the measurement of total body nitrogen using prompt neutron activation analysis with californium-252.

    Science.gov (United States)

    Mackie, A; Hannan, W J; Smith, M A; Tothill, P

    1988-01-01

    Details of clinical apparatus designed for the measurement of total body nitrogen (as an indicator of body protein), suitable for the critically ill, intensive-care patient are presented. Californium-252 radio-isotopic neutron sources are used, enabling a nitrogen measurement by prompt neutron activation analysis to be made in 40 min with a precision of +/- 3.2% for a whole body dose equivalent of 0.145 mSv. The advantages of Californium-252 over alternative neutron sources are discussed. A comparison between two irradiation/detection geometries is made, leading to an explanation of the geometry adopted for the apparatus. The choice of construction and shielding materials to reduce the count rate at the detectors and consequently to reduce the pile-up contribution to the nitrogen background is discussed. Salient features of the gamma ray spectroscopy system to reduce spectral distortion from pulse pile-up are presented.

  13. Safety Analysis Report for Packaging (SARP) of the Oak Ridge National Laboratory TRU Californium Shipping Container

    Energy Technology Data Exchange (ETDEWEB)

    Box, W.D.; Shappert, L.B.; Seagren, R.D.; Klima, B.B.; Jurgensen, M.C.; Hammond, C.R.; Watson, C.D.

    1980-01-01

    An analytical evaluation of the Oak Ridge National Laboratory TRU Californium Shipping Container was made in order to demonstrate its compliance with the regulations governing off-site shipment of packages that contain radioactive material. The evaluation encompassed five primary categories: structural integrity, thermal resistance, radiation shielding, nuclear criticality safety, and quality assurance. The results of this evaluation demonstrate that the container complies with the applicable regulations.

  14. 49 CFR 213.237 - Inspection of rail.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Inspection of rail. 213.237 Section 213.237..., DEPARTMENT OF TRANSPORTATION TRACK SAFETY STANDARDS Inspection § 213.237 Inspection of rail. (a) In addition... made of all rail in Classes 4 through 5 track, and Class 3 track over which passenger trains operate...

  15. Np-237 in peat and lichen in Finland

    DEFF Research Database (Denmark)

    Salminen, S.; Paatero, J.; Roos, Per

    2009-01-01

    Activity concentrations of 237Np in peat and lichen samples in Finland were determined and contributions from nuclear weapons testing in 1950–1960s and the Chernobyl accident were estimated. 237Np was determined with ICP-MS using 235Np as a tracer. Activity concentrations of 237Np in peat samples...

  16. 34 CFR 237.7 - What regulations apply?

    Science.gov (United States)

    2010-07-01

    ... 34 Education 1 2010-07-01 2010-07-01 false What regulations apply? 237.7 Section 237.7 Education..., DEPARTMENT OF EDUCATION CHRISTA MCAULIFFE FELLOWSHIP PROGRAM General § 237.7 What regulations apply? The following regulations apply to the Christa McAuliffe Fellowship Program: (a) The Education Department...

  17. 34 CFR 237.8 - What definitions apply?

    Science.gov (United States)

    2010-07-01

    ... 34 Education 1 2010-07-01 2010-07-01 false What definitions apply? 237.8 Section 237.8 Education..., DEPARTMENT OF EDUCATION CHRISTA MCAULIFFE FELLOWSHIP PROGRAM General § 237.8 What definitions apply? (a) The following definitions apply to terms used in this part: Act means the Higher Education Act of 1965, as...

  18. 37 CFR 2.37 - Description of mark.

    Science.gov (United States)

    2010-07-01

    ... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Description of mark. 2.37 Section 2.37 Patents, Trademarks, and Copyrights UNITED STATES PATENT AND TRADEMARK OFFICE, DEPARTMENT OF COMMERCE RULES OF PRACTICE IN TRADEMARK CASES The Written Application § 2.37 Description of mark. A...

  19. 14 CFR 23.237 - Operation on water.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Operation on water. 23.237 Section 23.237... STANDARDS: NORMAL, UTILITY, ACROBATIC, AND COMMUTER CATEGORY AIRPLANES Flight Ground and Water Handling Characteristics § 23.237 Operation on water. A wave height, demonstrated to be safe for operation, and any...

  20. 49 CFR 1544.237 - Flight deck privileges.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 9 2010-10-01 2010-10-01 false Flight deck privileges. 1544.237 Section 1544.237... COMMERCIAL OPERATORS Operations § 1544.237 Flight deck privileges. (a) For each aircraft that has a door to the flight deck, each aircraft operator must restrict access to the flight deck as provided in its...

  1. Analysis list: nhr-237 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available nhr-237 Embryo,Larvae + ce10 http://dbarchive.biosciencedbc.jp/kyushu-u/ce10/target.../nhr-237.1.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/ce10/target/nhr-237.5.tsv http://dbarchive.bioscience...dbc.jp/kyushu-u/ce10/target/nhr-237.10.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/ce10/colo/nhr-237.E...mbryo.tsv,http://dbarchive.biosciencedbc.jp/kyushu-u/ce10/colo/nhr-237.Larvae.tsv http://dbarchive.bioscie...ncedbc.jp/kyushu-u/ce10/colo/Embryo.gml,http://dbarchive.biosciencedbc.jp/kyushu-u/ce10/colo/Larvae.gml ...

  2. 29 CFR 1952.237 - Changes to approved plans.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 9 2010-07-01 2010-07-01 false Changes to approved plans. 1952.237 Section 1952.237 Labor Regulations Relating to Labor (Continued) OCCUPATIONAL SAFETY AND HEALTH ADMINISTRATION, DEPARTMENT OF LABOR... plans. (a) Legislation. (1) On March 29, 1994, the Assistant Secretary approved Kentucky's revised...

  3. 46 CFR 67.237 - Requirements for assignments of mortgages.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 2 2010-10-01 2010-10-01 false Requirements for assignments of mortgages. 67.237... MEASUREMENT OF VESSELS DOCUMENTATION OF VESSELS Filing and Recording of Instruments-Mortgages, Preferred Mortgages, and Related Instruments § 67.237 Requirements for assignments of mortgages. An assignment of...

  4. 48 CFR 252.237-7011 - Preparation history.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Preparation history. 252... Provisions And Clauses 252.237-7011 Preparation history. As prescribed in 237.7003(b), use the following clause: Preparation History (DEC 1991) For each body prepared, or for each casket handled in a group...

  5. 48 CFR 252.237-7007 - Termination for default.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Termination for default. 252.237-7007 Section 252.237-7007 Federal Acquisition Regulations System DEFENSE ACQUISITION..., solicits relatives or friends of the deceased to purchase supplies or services not under this contract...

  6. 48 CFR 1452.237-71 - Utilization of Woody Biomass.

    Science.gov (United States)

    2010-10-01

    ... Biomass. 1452.237-71 Section 1452.237-71 Federal Acquisition Regulations System DEPARTMENT OF THE INTERIOR... Utilization of Woody Biomass. As prescribed in § 1437.7202, insert the following clause: Utilization of Woody Biomass (MAY 2005) (a) The contractor may remove and utilize woody biomass, if: (1) Project work is...

  7. Application of TSH bioindicator for studying the biological efficiency of neutrons from californium-252 source

    Energy Technology Data Exchange (ETDEWEB)

    Cebulska-Wasilewska, A.; Rekas, K. [Institute of Nuclear Physics, Cracow (Poland); Kim, J.K. [Korea Atomic Energy Research Inst., Taejon (Korea, Republic of)

    1997-12-31

    The effectiveness of neutrons from a Californium-252 source in the induction of various abnormalities in the Tradescantia clone 4430 stamen hair cells (TSH-assay) was studied. The special attention was paid to check whether any enhancement in effects caused by process of boron neutron capture is visible in the cells enriched with boron ions. Two chemicals (borax and BSH) were applied to introduce boron-10 ions into cells. Inflorescence, normal or pretreated with chemicals containing boron, were irradiated in the air with neutrons from a Cf-252 source at KAERI, Taejon, Korea. To estimate the relative biological effectiveness (RBE) in the induction of gene mutations of the neutron beam under the study, Tradescantia inflorescences, without any chemical pretreatment, were irradiated with various doses of X-rays. The ranges of radiation doses used were 0-0.1 Gy in neutrons and 0-0.5 Gy in X-rays. After the time needed to complete the postirradiation repair Tradescantia cuttings were transferred to Cracow, where screening of gene and lethal; mutations, cell cycle alterations in somatic cells have been done, and dose response relationships were figured. The maximal RBE values were estimated in the range of 4.6-6.8. Alterations of RBE value were observed; from 6.8 to 7.8 in the case of plants pretreated with 240 ppm of B-10 from borax, and 4.6 to 6.1 in the case of 400 ppm of B-10 from BSH. Results showed a slight, although statistically insignificant increase in biological efficacy of radiation from the Cf-252 source in samples pretreated with boron containing chemicals. (author)

  8. Study of the shielding for spontaneous fission sources of Californium-252; Estudio de blindaje para fuentes de fision espontanea de Californio-252

    Energy Technology Data Exchange (ETDEWEB)

    Davila R, I

    1991-06-15

    A shielding study is made to attenuate, until maximum permissible levels, the neutrons radiation and photons emitted by spontaneous fission coming from a source of Californium-252. The compound package by a database (Library DLC-23) and the ANISNW code is used, in it version for personal computer. (Author)

  9. 48 CFR 237.109 - Services of quasi-military armed forces.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Services of quasi-military armed forces. 237.109 Section 237.109 Federal Acquisition Regulations System DEFENSE ACQUISITION... Contracts-General 237.109 Services of quasi-military armed forces. See 237.102-70b for prohibition on...

  10. Simulation and design of an electron beam ion source charge breeder for the californium rare isotope breeder upgrade

    Directory of Open Access Journals (Sweden)

    Clayton Dickerson

    2013-02-01

    Full Text Available An electron beam ion source (EBIS will be constructed and used to charge breed ions from the californium rare isotope breeder upgrade (CARIBU for postacceleration into the Argonne tandem linear accelerator system (ATLAS. Simulations of the EBIS charge breeder performance and the related ion transport systems are reported. Propagation of the electron beam through the EBIS was verified, and the anticipated incident power density within the electron collector was identified. The full normalized acceptance of the charge breeder with a 2 A electron beam, 0.024π  mm mrad for nominal operating parameters, was determined by simulating ion injection into the EBIS. The optics of the ion transport lines were carefully optimized to achieve well-matched ion injection, to minimize emittance growth of the injected and extracted ion beams, and to enable adequate testing of the charge bred ions prior to installation in ATLAS.

  11. Extraction of Trivalent Actinides and Lanthanides from Californium Campaign Rework Solution Using TODGA-based Solvent Extraction System

    Energy Technology Data Exchange (ETDEWEB)

    Benker, Dennis [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Delmau, Laetitia Helene [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Dryman, Joshua Cory [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States)

    2017-07-01

    This report presents the studies carried out to demonstrate the possibility of quantitatively extracting trivalent actinides and lanthanides from highly acidic solutions using a neutral ligand-based solvent extraction system. These studies stemmed from the perceived advantage of such systems over cationexchange- based solvent extraction systems that require an extensive feed adjustment to make a low-acid feed. The targeted feed solutions are highly acidic aqueous phases obtained after the dissolution of curium targets during a californium (Cf) campaign. Results obtained with actual Cf campaign solutions, but highly diluted to be manageable in a glove box, are presented, followed by results of tests run in the hot cells with Cf campaign rework solutions. It was demonstrated that a solvent extraction system based on the tetraoctyl diglycolamide molecule is capable of quantitatively extracting trivalent actinides from highly acidic solutions. This system was validated using actual feeds from a Cf campaign.

  12. Beyond Californium-A Neutron Generator Alternative for Dosimetry and Instrument Calibration in the U.S.

    Science.gov (United States)

    Piper, Roman K; Mozhayev, Andrey V; Murphy, Mark K; Thompson, Alan K

    2017-09-01

    Evaluations of neutron survey instruments, area monitors, and personal dosimeters rely on reference neutron radiations, which have evolved from the heavy reliance on (α,n) sources to a shared reliance on (α,n) and the spontaneous fission neutrons of californium-252 (Cf). Capable of producing high dose equivalent rates from an almost point source geometry, the characteristics of Cf are generally more favorable when compared to the use of (α,n) and (γ,n) sources or reactor-produced reference neutron radiations. Californium-252 is typically used in two standardized configurations: unmoderated, to yield a fission energy spectrum; or with the capsule placed within a heavy-water moderating sphere to produce a softened spectrum that is generally considered more appropriate for evaluating devices used in nuclear power plant work environments. The U.S. Department of Energy Cf Loan/Lease Program, a longtime origin of affordable Cf sources for research, testing and calibration, was terminated in 2009. Since then, high-activity sources have become increasingly cost-prohibitive for laboratories that formerly benefited from that program. Neutron generators, based on the D-T and D-D fusion reactions, have become economically competitive with Cf and are recognized internationally as important calibration and test standards. Researchers from the National Institute of Standards and Technology and the Pacific Northwest National Laboratory are jointly considering the practicality and technical challenges of implementing neutron generators as calibration standards in the U.S. This article reviews the characteristics of isotope-based neutron sources, possible isotope alternatives to Cf, and the rationale behind the increasing favor of electronically generated neutron options. The evaluation of a D-T system at PNNL has revealed characteristics that must be considered in adapting generators to the task of calibration and testing where accurate determination of a dosimetric quantity is

  13. Californium-252 Brachytherapy Combined With External-Beam Radiotherapy for Cervical Cancer: Long-Term Treatment Results

    Energy Technology Data Exchange (ETDEWEB)

    Lei Xin; Qian Chengyuan; Qing Yi; Zhao Kewei; Yang Zhengzhou; Dai Nan; Zhong Zhaoyang; Tang Cheng; Li Zheng; Gu Xianqing; Zhou Qian; Feng Yan; Xiong Yanli; Shan Jinlu [Cancer Center, Research Institute of Surgery and Daping Hospital, Third Military Medical University, Chongqing (China); Wang Dong, E-mail: dongwang64@hotmail.com [Cancer Center, Research Institute of Surgery and Daping Hospital, Third Military Medical University, Chongqing (China)

    2011-12-01

    Purpose: To observe, by retrospective analysis, the curative effects and complications due to californium-252 ({sup 252}Cf) neutron intracavitary brachytherapy (ICBT) combined with external-beam radiotherapy (EBRT) in the treatment of cervical cancer. Methods and Materials: From February 1999 to December 2007, 696 patients with cervical cancer (Stages IB to IIIB) were treated with {sup 252}Cf-ICBT in combination of EBRT. Of all, 31 patients were at Stage IB, 104 at IIA, 363 at IIB, 64 at IIIA, and 134 at IIIB. Californium-252 ICBT was delivered at 7-12 Gy per insertion per week, with a total dose of 29-45 Gy to reference point A in three to five insertions. The whole pelvic cavity was treated with 8-MV X-ray external irradiation at 2 Gy per fraction, four times per week. After 16-38 Gy of external irradiation, the center of the whole pelvic field was blocked with a 4-cm-wide lead shield, with a total external irradiation dose of 44-56 Gy. The total treatment course was 5 to 6 weeks. Results: Overall survival rate at 3 and 5 years for all patients was 76.0% and 64.9%, respectively. Disease-free 3- and 5-year survival rates of patients were 71.2% and 58.4%, respectively. Late complications included vaginal contracture and adhesion, radiation proctitis, radiation cystitis, and inflammatory bowel, which accounted for 5.8%, 7.1%, 6.2%, and 4.9%, respectively. Univariate analysis results showed significant correlation of stage, age, histopathologic grade, and lymph node status with overall survival. Cox multiple regression analysis showed that the independent variables were stage, histopathologic grade, tumor size, and lymphatic metastasis in all patients. Conclusion: Results of this series suggest that the combined use of {sup 252}Cf-ICBT with EBRT is an effective method for treatment of cervical cancer.

  14. 27 CFR 46.237 - Controlled group member.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 2 2010-04-01 2010-04-01 false Controlled group member... Tubes Held for Sale on April 1, 2009 Filing Requirements § 46.237 Controlled group member. If the dealer is a member of a controlled group, but has its own employer identification number, the dealer must...

  15. 48 CFR 352.237-70 - Pro-Children Act.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Pro-Children Act. 352.237...-Children Act. As prescribed in 337.103-70(a), the Contracting Officer shall insert the following clause: Pro-Children Act (January 2006) (a) Public Law 103-227, Title X, Part C, also known as the Pro...

  16. 48 CFR 1852.237-71 - Pension portability.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Pension portability. 1852... 1852.237-71 Pension portability. As prescribed at 1837.110-70(b), insert the following clause: Pension Portability (JAN 1997) (a) In order for pension costs attributable to employees assigned to this contract to...

  17. 5 CFR 838.237 - Death of the former spouse.

    Science.gov (United States)

    2010-01-01

    ... annuity terminates on the last day of the month before the death of the former spouse, and the former... processing that directs OPM to pay, after the death of the former spouse, the former spouse's share of the... 5 Administrative Personnel 2 2010-01-01 2010-01-01 false Death of the former spouse. 838.237...

  18. Phenotype-gene: 237 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 237 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u3ria224u1235i decreased speed...(7048):282-4. http://metadb.riken.jp/db/SciNetS_ria224i/cria224u4ria224u16015335i decreased speed in organ n

  19. 48 CFR 237.172 - Service Contracts Surveillance.

    Science.gov (United States)

    2010-10-01

    ...-General 237.172 Service Contracts Surveillance. Ensure that quality assurance surveillance plans are prepared in conjunction with the preparation of the statement of work or statement of objectives for... Four—Requirements Definition, for examples of quality assurance surveillance plans. ...

  20. Measurements of the fission cross section of {sup 237}Np

    Energy Technology Data Exchange (ETDEWEB)

    Carlson, A.D. [National Institute of Standards and Technology, Gaithersburg, MD (United States); Parker, W.E. [Lawrence Livermore National Lab., CA (United States); Lisowski, P.W.; Morgan, G.L.; Seestrom, S. [Los Alamos National Lab., NM (United States); Hill, N.W. [Oak Ridge National Lab., TN (United States); Meggers, K. [Univ. of Kiel, Geesthacht (Germany)

    1994-12-31

    Measurements have been made of the fission cross section of {sup 237}Np below 2 MeV neutron energy in order to improve the data base of this important cross section. The data were obtained with a white neutron source at the Los Alamos Neutron Scattering Center at Los Alamos National Laboratory. The measurements were made with ionization chambers containing {sup 237}Np deposits located at the end of a 60-m flight path. The fission cross section data are relative to the {sup 235}U(n,f) standard at the higher energies. At the lower energies, the {sup 10}B(n,{alpha}) standard was used to determine the energy dependence of the neutron fluence and the normalization was based on the very accurate 7.8 to 11.0 eV resonance integral for {sup 235}U(n,f). The results of this work indicate that the ENDF/B-VI evaluation of the {sup 237}Np(n,f) cross section is about a factor of three low in the 5 eV to 5 keV energy region but only about 3% lower than this work near 1 MeV neutron energy.

  1. 48 CFR 552.237-72 - Prohibition Regarding “Quasi-Military Armed Forces.”

    Science.gov (United States)

    2010-10-01

    ...Quasi-Military Armed Forces.â 552.237-72 Section 552.237-72 Federal Acquisition Regulations System... Provisions and Clauses 552.237-72 Prohibition Regarding “Quasi-Military Armed Forces.” As prescribed in 537.110(b), insert the following clause: Prohibition Regarding “Quasi-Military Armed Forces” (SEP 1999...

  2. 48 CFR 1352.237-72 - Security processing requirements-national security contracts.

    Science.gov (United States)

    2010-10-01

    ... requirements-national security contracts. 1352.237-72 Section 1352.237-72 Federal Acquisition Regulations... Provisions and Clauses 1352.237-72 Security processing requirements—national security contracts. As prescribed in 48 CFR 1337.110-70(d), use the following clause: Security Processing Requirements—National...

  3. 48 CFR 352.237-71 - Crime Control Act-reporting of child abuse.

    Science.gov (United States)

    2010-10-01

    ...-reporting of child abuse. 352.237-71 Section 352.237-71 Federal Acquisition Regulations System HEALTH AND... Clauses 352.237-71 Crime Control Act—reporting of child abuse. As prescribed in 337.103-70(b), the Contracting Officer shall insert the following clause: Crime Control Act of 1990—Reporting of Child Abuse...

  4. Long-term effects of an intracavitary treatment with californium-252 on normal tissue. [Swine, /sup 226/Ra

    Energy Technology Data Exchange (ETDEWEB)

    Sullivan, M.F.; Beamer, J.L.; Mahony, T.D.; Cross, F.T.; Lund, J.E.; Endres, G.W.R.

    1976-01-01

    About one hundred fifty swine were exposed to either radium-226 or californium-252 sources in the uterine cervix to determine an RBE for both acute and long-term effects. That value for early changes in the tissues at risk in the treatment of cervical cancer was between 6.2 and 6.8. The incidence of complications increased with time after exposure, especially among animals treated with /sup 252/Cf. Analysis of rectal injury showed that ulceration occurred frequently within a year postexposure at doses between 1600 and 2400 rad calculated at 2 cm lateral to the source midline. Fat necrosis and smooth muscle atrophy, resulting in a local rectal stricture, were delayed changes observed in some animals. The lower ureter was the site for a greater frequency of complications than the GI tract. Ureteral stricture often occurred at doses of 1200 rad from /sup 252/Cf and 7000 rad from /sup 226/Ra. Observation of delayed effects in the uterine-cervix in animals held up to 4 years postexposure indicate that the RBE for /sup 252/Cf may be increased to a value as high as 18, while repair may have even decreased it to about 5.6 in the rectum. Fifty swine are still being observed for long-term effects after doses above 800 rad from /sup 252/Cf and 5000 rad from /sup 226/Ra.

  5. Ab initio full-potential study of mechanical properties and magnetic phase stability of californium monopnictides (CfN and CfP)

    Energy Technology Data Exchange (ETDEWEB)

    Amari, S., E-mail: siham_amari@yahoo.fr [Faculté des Sciences de la Nature et de la Vie, Université Hassiba Benbouali, Chlef, 02000 (Algeria); Bouhafs, B. [Laboratoire de Modélisation et Simulation en Sciences des Matériaux, Université Djillali Liabès de Sidi Bel-Abbés, Sidi Bel-Abbés, 22000 (Algeria)

    2016-09-15

    Based on the first-principles methods, the structural, elastic, electronic, properties and magnetic ordering of californium monopnictides CfX (X = P) have been studied using the full-potential augmented plane wave plus local orbitals (FP-L/APW + lo) method within the framework of density functional theory (DFT). The electronic exchange correlation energy is described by generalized gradient approximation GGA and GGA+U (U is the Hubbard correction). The GGA+U method is applied to the rare-earth 5f states. We have calculated the lattice parameters, bulk modulii and the first pressure derivatives of the bulk modulii. The elastic properties of the studied compounds are only investigated in the most stable calculated phase. In order to gain further information, we have calculated Young’s modulus, shear modulus, anisotropy factor and Kleinman parameter by the aid of the calculated elastic constants. The results mainly show that californium monopnictides CfX (X = P) have an antiferromagnetic spin ordering. Density of states (DOS) and charge densities for both compounds are also computed in the NaCl (B1) structure.

  6. Low-Dose-Rate Californium-252 Neutron Intracavitary Afterloading Radiotherapy Combined With Conformal Radiotherapy for Treatment of Cervical Cancer

    Energy Technology Data Exchange (ETDEWEB)

    Zhang Min [Department of Oncology, Armed Police Hospital of Hangzhou, Hangzhou, Zhejiang Province (China); Xu Hongde [Cancer Center, Armed Police Hospital of Hangzhou, Hangzhou, Zhejiang Province (China); Pan Songdan; Lin Shan; Yue Jianhua [Department of Oncology, Armed Police Hospital of Hangzhou, Hangzhou, Zhejiang Province (China); Liu Jianren, E-mail: liujianren0571@hotmail.com [Second Affiliated Hospital, School of Medicine, Zhejiang University, Hangzhou, Zhejiang Province (China)

    2012-07-01

    Purpose: To study the efficacy of low-dose-rate californium-252 ({sup 252}Cf) neutron intracavitary afterloading radiotherapy (RT) combined with external pelvic RT for treatment of cervical cancer. Methods and Materials: The records of 96 patients treated for cervical cancer from 2006 to 2010 were retrospectively reviewed. For patients with tumors {<=}4 cm in diameter, external beam radiation was performed (1.8 Gy/day, five times/week) until the dose reached 20 Gy, and then {sup 252}Cf neutron intracavitary afterloading RT (once/week) was begun, and the frequency of external beam radiation was changed to four times/week. For patients with tumors >4 cm, {sup 252}Cf RT was performed one to two times before whole-pelvis external beam radiation. The tumor-eliminating dose was determined by using the depth limit of 5 mm below the mucosa as the reference point. In all patients, the total dose of the external beam radiation ranged from 46.8 to 50 Gy. For {sup 252}Cf RT, the dose delivered to point A was 6 Gy/fraction, once per week, for a total of seven times, and the total dose was 42 Gy. Results: The mean {+-} SD patient age was 54.7 {+-} 13.7 years. Six patients had disease assessed at stage IB, 13 patients had stage IIA, 49 patients had stage IIB, 3 patients had stage IIIA, 24 patients had stage IIIB, and 1 patient had stage IVA. All patients obtained complete tumor regression (CR). The mean {+-} SD time to CR was 23.5 {+-} 3.4 days. Vaginal bleeding was fully controlled in 80 patients within 1 to 8 days. The mean {+-} SD follow-up period was 27.6 {+-} 12.7 months (range, 6-48 months). Five patients died due to recurrence or metastasis. The 3-year survival and disease-free recurrence rates were 89.6% and 87.5 %, respectively. Nine patients experienced mild radiation proctitis, and 4 patients developed radiocystitis. Conclusions: Low-dose-rate {sup 252}Cf neutron RT combined with external pelvic RT is effective for treating cervical cancer, with a low incidence of

  7. 50 CFR 23.7 - What office do I contact for CITES information?

    Science.gov (United States)

    2010-10-01

    ... IMPORTATION OF WILDLIFE AND PLANTS (CONTINUED) CONVENTION ON INTERNATIONAL TRADE IN ENDANGERED SPECIES OF WILD... 50 Wildlife and Fisheries 6 2010-10-01 2010-10-01 false What office do I contact for CITES information? 23.7 Section 23.7 Wildlife and Fisheries UNITED STATES FISH AND WILDLIFE SERVICE, DEPARTMENT OF...

  8. 48 CFR 252.237-7019 - Training for Contractor Personnel Interacting with Detainees.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Training for Contractor... PROVISIONS AND CONTRACT CLAUSES Text of Provisions And Clauses 252.237-7019 Training for Contractor Personnel Interacting with Detainees. As prescribed in 237.171-4, use the following clause: Training for Contractor...

  9. 27 CFR 24.237 - Spirits added to juice or concentrated fruit juice.

    Science.gov (United States)

    2010-04-01

    ... concentrated fruit juice. 24.237 Section 24.237 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX... concentrated fruit juice. Juice or concentrated fruit juice to which spirits have been added may not have an... fruit juice to which spirits have been added will be included in the appropriate tax class of any wine...

  10. 40 CFR 23.7 - Timing of Administrator's action under Safe Drinking Water Act.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 1 2010-07-01 2010-07-01 false Timing of Administrator's action under Safe Drinking Water Act. 23.7 Section 23.7 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY... Drinking Water Act. Unless the Administrator otherwise explicitly provides in a particular promulgation...

  11. Measurements of {sup 237}Np secondary neutron spectra

    Energy Technology Data Exchange (ETDEWEB)

    Kornilov, N.V.

    1997-03-01

    The activities carried out during the first year of the project are summarized. The main problems for Np spectra measurements arise from high intrinsic gamma-ray activity of the sample and admixture of the oxygen and iron nuclei. The inelastically scattered neutrons and the fission neutrons spectra for {sup 237}Np were measured by time-of-flight spectrometer of the IPPE at incident neutron energies {approx_equal}1.5 MeV, and {approx_equal}0.5 MeV. A solid tritium target and a Li-metallic target were used as neutron sources. The neutron scattering on C sample (C(n,n) standard reaction) was measured to normalize the Np data. The experimental data should be simulated by Monte Carlo method to correct the experimental data for oxygen and iron admixture as well as for multiple scattering of the neutrons in the sample. Therefore the response function of the spectrometer, and the neutron energy distribution from the source were investigated in detail. (author)

  12. Pigmented villonodular synovitis: a retrospective multicenter study of 237 cases.

    Directory of Open Access Journals (Sweden)

    Guo-ping Xie

    Full Text Available To review clinical characteristics of pigmented villonodular synovitis (PVNS in China.Electronic medical records (EMR of four Chinese institutes were queried for patients with histologically proven PVNS between January 2005 and February 2014. Their data were collected including gender, age at diagnosis, clinical presentation, affected site, symptom duration, comorbidities, treatment strategy, recurrence and routine laboratories.A total of 237 patients with biopsy-proven PVNS were investigated. The gender ratio was 1.35 for a female predominance (101 males and 136 females. The average age was 36 years (range, 2 to 83 years. The median delay from initial clinical symptom to diagnosis was 18 months. Main affected areas were the knee (73.84% and the hip (18.14%. Forty patients had a clear history of joint trauma. Six patients were concurrently diagnosed with PVNS and avascular necrosis (AVN. Five patients suffered from PVNS following implantation of orthopaedic devices including artificial prosthesis, plate and wire. One hundred and twenty-nine patients underwent arthroscopic synovectomy and 108 open synovectomy. Altogether 48 patients (26 males and 22 females had recurrence of disease. The relapse rate was 24% (knee and 6.98% (hip, 20.93% (open surgery and 19.44% (arthroscopy, respectively. Erythrocyte sedimentation rate (ESR and C-reactive protein (CRP rate were elevated in 45.83% and 38.41% of the patients respectively.To our knowledge, this study is the largest sample size of PVNS patients reported as well as the largest sample of PVNS with concurrent AVN reported to date. Our outcomes suggest that PVNS shows a female predominance, occurs mostly between 20-40 years and favors the knee and hip. Recurrence is frequent, particularly in the knee. Serum ESR and CRP may be elevated in some patients. Additionally, the present study supports the theory of an association between PVNS and orthopedic surgery, which is not limited to joint replacement.

  13. 49 CFR 237.73 - Protection of bridges from over-weight and over-dimension loads.

    Science.gov (United States)

    2010-10-01

    ...-dimension loads. 237.73 Section 237.73 Transportation Other Regulations Relating to Transportation... Bridges § 237.73 Protection of bridges from over-weight and over-dimension loads. (a) Each track owner... exceed the capacity or dimensions of its bridges. (b) The instructions regarding weight shall be...

  14. Standardisation and measurement of the decay scheme data of 237Np

    Science.gov (United States)

    Woods; Woods; de Lavison P; Jerome; Makepeace; Woods; Husband; Lineham

    2000-03-01

    Within the framework of a EUROMET project, a solution of 237Np/233Pa at equilibrium has been standardised by 4pi(PC)-gamma counting. An intrinsic Ge spectrometer was employed to measure relevant gamma-ray emission probabilities. Good agreement was obtained for those pertaining to the decay of 233Pa, but not for the gamma-ray emissions following the decay of 237Np. The cause of such discrepancies is discussed.

  15. 237 Np analytical method using 239 Np tracers and application to a contaminated nuclear disposal facility

    Energy Technology Data Exchange (ETDEWEB)

    Snow, Mathew S.; Morrison, Samuel S.; Clark, Sue B.; Olson, John E.; Watrous, Matthew G.

    2017-06-01

    Environmental 237Np analyses are challenged by low 237Np concentrations and lack of an available yield tracer; we report a rapid, inexpensive 237Np analytical approach employing the short lived 239Np (t1/2 = 2.3 days) as a chemical yield tracer followed by 237Np quantification using inductively coupled plasma-mass spectrometry. 239Np tracer is obtained via separation from a 243Am stock solution and standardized using gamma spectrometry immediately prior to sample processing. Rapid digestions using a commercial, 900 watt “Walmart” microwave and Parr microwave vessels result in 99.8 ± 0.1% digestion yields, while chromatographic separations enable Np/U separation factors on the order of 106 and total Np yields of 95 ± 4% (2σ). Application of this method to legacy soil samples surrounding a radioactive disposal facility (the Subsurface Disposal Area at Idaho National Laboratory) reveal the presence of low level 237Np contamination within 600 meters of this site, with maximum 237Np concentrations on the order of 103 times greater than nuclear weapons testing fallout levels.

  16. Standardisation and measurement of the decay scheme data of {sup 237}Np

    Energy Technology Data Exchange (ETDEWEB)

    Woods, S.A. E-mail: simon.woods@npl.co.uk; Woods, D.H.; Lavison, P. de; Jerome, S.M.; Makepeace, J.L.; Woods, M.J.; Husband, L.J.; Lineham, S

    2000-03-01

    Within the framework of a EUROMET project, a solution of {sup 237}Np/{sup 233}Pa at equilibrium has been standardised by 4{pi}(PC)-{gamma} counting. An intrinsic Ge spectrometer was employed to measure relevant {gamma}-ray emission probabilities. Good agreement was obtained for those pertaining to the decay of {sup 233}Pa, but not for the {gamma}-ray emissions following the decay of {sup 237}Np. The cause of such discrepancies is discussed. It has been shown that the CIEMAT/NIST method is appropriate for {sup 237}Np standardization, whereas the pulse shape discriminator (PSD) method is affected by much higher uncertainties due di difficulties to discriminate precisely {alpha} and {beta} pulses.

  17. 49 CFR 372.237 - Cameron, Hidalgo, Starr, and Willacy Counties, TX.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 5 2010-10-01 2010-10-01 false Cameron, Hidalgo, Starr, and Willacy Counties, TX... REGULATIONS EXEMPTIONS, COMMERCIAL ZONES, AND TERMINAL AREAS Commercial Zones § 372.237 Cameron, Hidalgo, Starr, and Willacy Counties, TX. (a) Transportation within a zone comprised of Cameron, Hidalgo, Starr...

  18. 15 CFR 23.7 - Notice to Department of Commerce organizational units of implementation and procedures.

    Science.gov (United States)

    2010-01-01

    ... representatives to discuss the program and identify additional opportunities to use the missing children data with... material provided by the Operating Unit in preparation of material for use with penalty mail, and (3... Secretary of Commerce USE OF PENALTY MAIL IN THE LOCATION AND RECOVERY OF MISSING CHILDREN § 23.7 Notice to...

  19. 48 CFR 352.237-72 - Crime Control Act-requirement for background checks.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Crime Control Act... and Clauses 352.237-72 Crime Control Act—requirement for background checks. As prescribed in 337.103-70(c), the Contracting Officer shall insert the following clause: Crime Control Act of 1990...

  20. Evaluation of {sup 237}Np transmutation characteristics with chemical analysis of Neptunium dosimeter irradiated in `Joyo`

    Energy Technology Data Exchange (ETDEWEB)

    Osaka, Masahiko; Koyama, Shin-ichi; Otsuka, Yuko; Mitsugashira, Toshiaki; Namekawa, Takushi; Konno, Koichi [Power Reactor and Nuclear Fuel Development Corp., Oarai, Ibaraki (Japan). Oarai Engineering Center

    1997-12-01

    The purpose of this study is to evaluate transmutation characteristics such as dependence of {sup 237}Np transmutation rate to neutron energy spectrum and neutron fluences. Analysis of the Neptunium dosimeter, in which was irradiated in the experimental fast reactor `Joyo`, was carried out by applying the technique for analysis of minor actinide nuclides in irradiated MOX fuel. It is necessary to remove Vanadium before analysis of Neptunium dosimeter because NpO{sub 2} powder was enclosed in Neptunium dosimeter that was made of Vanadium capsule. The result of analysis and evaluations are as follows. (1) In order to recover Neptunium sample completely, sample was dissolved with capsule before removing the Vanadium from sample solution. Sample treatment method of whole capsule dissolution for chemical analysis of Neptunium dosimeter was established. (2) {sup 237}Np, Plutonium isotopes, {sup 241}Am and {sup 137}Cs in the dosimeter were analyzed using the method of whole capsule dissolution, alpha spectrometry, gamma spectrometry and isotopic dilution mass spectrometry. Transmutation rate of {sup 237}Np was calculated using the analyzed value. Tendency of transmutation rate was certified, which is higher fission ratio at the center and higher capture ratio at both upper and lower end. (3) Transmutation rate with error was evaluated by neutron fluences considering the neutron energy spectrum, and calculated value by `MAGI` code was agreed well with analysis value. Dependence of transmutation rate of {sup 237}Np to neutron energy spectrum was certified. (author)

  1. Role of once-daily glycopyrronium bromide (NVA237 in the management of COPD

    Directory of Open Access Journals (Sweden)

    D’Urzo A

    2013-08-01

    Full Text Available Anthony D'UrzoDepartment of Family and Community Medicine, University of Toronto, Toronto, ON, CanadaAbstract: Progressive airflow limitation is a hallmark feature of chronic obstructive pulmonary disease (COPD that ultimately leads to breathlessness, impaired quality of life, and reduced exercise capacity. Pharmacotherapy is used in patients with COPD to prevent and control symptoms, reduce both the frequency and severity of exacerbations, improve health status, and increase exercise tolerance. These strategies are intended to address management issues which promote both current disease control and a reduction in the risk of disease deterioration in the future. At the present time, long-acting β2-agonists (LABAs and long-acting muscarinic antagonists (LAMAs are available for maintenance therapy in patients with persistent symptoms. Tiotropium was the first LAMA to be approved for management of COPD, and many studies have described its beneficial effects on multiple clinically relevant outcomes. Glycopyrronium bromide (NVA237, a new LAMA, has been developed and received regulatory approval for management of COPD in a number of countries around the world. Results from pivotal Phase III trials suggest that NVA237 is safe and well tolerated in patients with moderate to severe COPD, and provides rapid and sustained improvements in lung function. Further, these changes are associated with statistically and clinically meaningful improvements in dyspnea, health-related quality of life, and exercise tolerance. Treatment with NVA237 also results in a significant reduction in risk of exacerbations and the need for rescue medication, and has been comparable with tiotropium with respect to safety and efficacy outcomes. Finally, emerging data indicate that NVA237 is efficacious both as monotherapy and in combination with indacaterol.Keywords: glycopyrronium bromide, NVA237, chronic obstructive pulmonary disease, inhaled long-acting bronchodilators

  2. 29 CFR 779.237 - Enterprise engaged in commerce or in the production of goods for commerce.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 3 2010-07-01 2010-07-01 false Enterprise engaged in commerce or in the production of goods for commerce. 779.237 Section 779.237 Labor Regulations Relating to Labor (Continued) WAGE AND... commerce or in the production of goods for commerce. Under section 3(s) the “enterprise” to be covered must...

  3. Californium-252 neutron intracavity brachytherapy alone for T1N0 low-lying rectal adenocarcinoma: A definitive anal sphincter-preserving radiotherapy

    Science.gov (United States)

    Xiong, Yanli; Shan, Jinlu; Liu, Jia; Zhao, Kewei; Chen, Shu; Xu, Wenjing; Zhou, Qian; Yang, Mei; Lei, Xin

    2017-01-01

    This study evaluated the 4-year results of 32 patients with T1N0 low-lying rectal adenocarcinoma treated solely with californium-252 (Cf-252) neutron intracavity brachytherapy (ICBT). Patients were solicited into the study from January 2008 to June 2011. All the patients had refused surgery or surgery was contraindicated. The patients were treated with Cf-252 neutron ICBT using a novel 3.5-cm diameter off-axis 4-channel intrarectal applicator designed by the authors. The dose reference point was defined on the mucosa surface, with a total dose of 55–62 Gy-eq/4 f (13–16 Gy-eq/f/wk). All the patients completed the radiotherapy in accordance with our protocol. The rectal lesions regressed completely, and the acute rectal toxicity was mild (≤G2). The 4-year local control, overall survival, disease-free survival, and late complication (≥G2) rates were 96.9%, 90.6%, 87.5% and 15.6%, respectively. No severe late complication (≥G3) occurred. The mean follow-up was 56.1 ± 16.0 months. At the end of last follow-up, 29 patients remained alive. The mean survival time was 82.1 ± 2.7 months. Cf-252 neutron ICBT administered as the sole treatment (without surgery) for patients with T1N0 low-lying rectal adenocarcinoma is effective with acceptable late complications. Our study and method offers a definitive anal sphincter-preserving radiotherapy for T1N0 low-lying rectal adenocarcinoma patients. PMID:28094790

  4. (237)Np(n,f) Cross Section: New Data and Present Status

    CERN Document Server

    Paradela, C; Carrapico, C; Eleftheriadis, C; Leeb, H; Calvino, F; Herrera-Martinez, A; Savvidis, I; Vlachoudis, V; Haas, B; Vannini, G; Le Naour, C; Gramegna, F; Wiescher, M; Pigni, M T; Audouin, L; Mengoni, A; Quesada, J; Becvar, F; Plag, R; Cennini, P; Mosconi, M; Duran, I; Rauscher, T; Couture, A; Capote, R; Sarchiapone, L; Vlastou, R; Domingo-Pardo, C; Dillmann, I; Pavlopoulos, P; Karamanis, D; Krticka, M; Jericha, E; Ferrari, A; Martinez, T; Trubert, D; Oberhummer, H; Karadimos, D; Plompen, A; Isaev, S; Terlizzi, R; Kaeppeler, F; Cortes, G; Cox, J; Voss, F; Pretel, C; Colonna, N; Berthoumieux, E; Vaz, P; Heil, M; Lopes, I; Lampoudis, C; Walter, S; Calviani, M; Gonzalez-Romero, E; Embid-Segura, M; Stephan, C; Igashira, M; Papachristodoulou, C; Aerts, G; Tavora, L; Berthier, B; Rudolf, G; Andrzejewski, J; Villamarin, D; Ferreira-Marques, R; Tain, J L; O'Brien, S; Gunsing, F; Reifarth, R; Perrot, L; Lindote, A; Neves, F; Poch, A; Kerveno, M; Rubbia, C; Koehler, P; Dahlfors, M; Wisshak, K; Salgado, J; Dridi, W; Ventura, A; Andriamonje, S; Assimakopoulos, P; Santos, C; Ferrant, L; Lozano, M; Patronis, N; Chiaveri, E; Guerrero, C; Kadi, Y; Vicente, M C; Praena, J; Baumann, P; Oshima, M; Rullhusen, P; Furman, W; David, S; Marrone, S; Tassan-Got, L; Cano-Ott, D; Pavlix, A; Alvarez-Velarde, F; Massimi, C; Mastinu, P; Pancin, J; Papadopoulos, C; Tagliente, G; Haight, R; Chepel, V; Kossionides, E; Badurek, G; Marganiec, J; Lukic, S; Tarrio, D; Alvarez, H

    2011-01-01

    In this document, we present the final result obtained at the n_TOF experiment; for the neutron-induced fission cross section of the (237)Np, from the fission threshold up to 1 GeV. The method applied to get tins result is briefly discussed. n_TOF data are compared to the last experimental measurements using other TOF facilities or the surrogate method, reported experiments performed with monoenergetic sources and the FISCAL systematic, including a discussion about the existing discrepancies.

  5. Improving nuclear data accuracy of 241Am and 237Np capture cross sections

    Science.gov (United States)

    Žerovnik, Gašper; Schillebeeckx, Peter; Cano-Ott, Daniel; Jandel, Marian; Hori, Jun-ichi; Kimura, Atsushi; Rossbach, Matthias; Letourneau, Alain; Noguere, Gilles; Leconte, Pierre; Sano, Tadafumi; Kellett, Mark A.; Iwamoto, Osamu; Ignatyuk, Anatoly V.; Cabellos, Oscar; Genreith, Christoph; Harada, Hideo

    2017-09-01

    In the framework of the OECD/NEA WPEC subgroup 41, ways to improve neutron induced capture cross sections for 241Am and 237Np are being sought. Decay data, energy dependent cross section data and neutron spectrum averaged data are important for that purpose and were investigated. New time-of-flight measurements were performed and analyzed, and considerable effort was put into development of methods for analysis of spectrum averaged data and re-analysis of existing experimental data.

  6. 'n Nota oor die vertaling van Jeremia 2:37 ("Met jou hande op jou hoof"

    Directory of Open Access Journals (Sweden)

    H.F. Stander

    1998-08-01

    Full Text Available A note on the translation of Jeremiah 2:37 ("With your hands on your head" In Jeremiah 2:37 God says to Israel: "You will leave that place (= Egypt with your hands upon your head". In this article various Bible translations and commentaries are scrutinized to determine how modem exegetes interpret this phrase. Thereafter the author discusses Egyptian depictions of mourners in funeral processions with their hands on their heads. He shows how an exploration of Egyptian Art can contribute to a better understanding of Jeremiah 2:37. This study also shows that the two dynamic Afrikaans translations of the Bible ("Die Lewende Bybel" and "Die Nuwe Afrikaanse Vertaling" are wide off the mark in their interpretation of the phrase "with your hands on your head". The author also argues that exegetes should not only rely on written texts when they study the ancient world in which the Scriptures originated, but that they should also explore works of art.

  7. Evaluation of nuclear data of {sup 244}Pu and {sup 237}Pu

    Energy Technology Data Exchange (ETDEWEB)

    Nakagawa, Tsuneo; Konshin, V.A. [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment

    1995-10-01

    The evaluation of nuclear data for {sup 244}Pu and {sup 237}Pu was made in the neutron energy region from 10{sup -5} eV to 20 MeV. For the both nuclides, the total, elastic and inelastic scattering, fission, capture, (n,2n) and (n,3n) reaction cross sections were evaluated on the basis of theoretical calculation. The resonance parameters were given for {sup 244}Pu. The angular and energy distributions of secondary neutrons were also estimated for the both nuclides. The results were compiled in the ENDF-5 format and will be adopted in JENDL Actinoid File. (author).

  8. Measurements of the {sup 237}Np(n,f) cross section

    Energy Technology Data Exchange (ETDEWEB)

    Carlson, A.D. [National Inst. of Standards and Technology, Gaithersburg, MD (United States); Parker, W.E. [Lawrence Livermore National Lab., CA (United States); Lisowski, P.W.; Morgan, G.L.; Seestrom, S.J. [Los Alamos National Lab., NM (United States); Hill, N.W. [Oak Ridge National Lab., TN (United States); Meggers, K. [Univ. of Kiel, Geesthacht (Germany)

    1994-12-31

    Measurements have been made of the neutron induced fission cross section of {sup 237}Np(n,f) at the Los Alamos Neutron Scattering Center utilizing a white neutron source and a fast parallel multiplate ionization chamber. The {sup 10}B(n,{alpha}) standard cross section was used to establish the energy dependence of the neutron fluence and a very accurately known fission resonance integral for {sup 235}U was used for normalization. The measurements in the resonance region, from 5 eV to 5 keV, indicate that the ENDF/B-VI values are too low by about a factor of three.

  9. Deducing the 237U(n,f) cross-section using the Surrogate Ratio Method

    Energy Technology Data Exchange (ETDEWEB)

    Burke, J T; Bernstein, L A; Escher, J; Ahle, L; Church, J A; Dietrich, F; Moody, K J; Norman, E B; Phair, L W; Fallon, P; Clark, R; Delaplanque, M; Descovich, M; Cromaz, M; Lee, I Y; Macchiavelli, A O; McMahan, M A; Moretto, L G; Rodriguez-Vieitez, E; Stephens, F S

    2005-08-16

    The authors have deduced the {sup 237}U(n,f) cross-section over an equivalent neutron energy range of 0 to 20 MeV using the Surrogate Ratio method. A 55 MeV {sup 4}He{sup 2+} beam from the 88 Inch Cyclotron at Lawrence Berkeley National Laboratory was used to induce fission in the following reactions {sup 238}U({alpha},{alpha}'f) and {sup 236}U({alpha},{alpha}'f). The {sup 238}U reaction was a surrogate for {sup 237}U(n,f) and the {sup 236}U reaction was used as a surrogate for {sup 235}U(n,f). The energies of the scattered alpha particles were detected in a fully depleted segmented silicon telescope array (STARS) over an angle range of 35{sup o} to 60{sup o} with respect to the beam axis. The fission fragments were detected in a third independent silicon detector located at backward angles between 106{sup o} to 131{sup o}.

  10. Californium-252 Program Equipment Evaluation

    Energy Technology Data Exchange (ETDEWEB)

    Chattin, Fred Rhea [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Wilson, Kenton [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Ezold, Julie G. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States)

    2017-12-01

    To successfully continue the 252Cf production and meet the needs of the customers, a comprehensive evaluation of the Building 7920 processing equipment was requested to identify equipment critical to the operational continuity of the program.

  11. Sc237 hamster PrPSc and Sc237-derived mouse PrPSc generated by interspecies in vitro amplification exhibit distinct pathological and biochemical properties in tga20 transgenic mice.

    Science.gov (United States)

    Yoshioka, Miyako; Imamura, Morikazu; Okada, Hiroyuki; Shimozaki, Noriko; Murayama, Yuichi; Yokoyama, Takashi; Mohri, Shirou

    2011-05-01

    Prions are the infectious agents responsible for transmissible spongiform encephalopathy, and are primarily composed of the pathogenic form (PrP(Sc)) of the host-encoded prion protein (PrP(C)). Recent studies have revealed that protein misfolding cyclic amplification (PMCA), a highly sensitive method for PrP(Sc) detection, can overcome the species barrier in several xenogeneic combinations of PrP(Sc) seed and PrP(C) substrate. Although these findings provide valuable insight into the origin and diversity of prions, the differences between PrP(Sc) generated by interspecies PMCA and by in vivo cross-species transmission have not been described. This study investigated the histopathological and biochemical properties of PrP(Sc) in the brains of tga20 transgenic mice inoculated with Sc237 hamster scrapie prion and PrP(Sc) from mice inoculated with Sc237-derived mouse PrP(Sc), which had been generated by interspecies PMCA using Sc237 as seed and normal mouse brain homogenate as substrate. Tga20 mice overexpressing mouse PrP(C) were susceptible to Sc237 after primary transmission. PrP(Sc) in the brains of mice inoculated with Sc237-derived mouse PrP(Sc) and in the brains of mice inoculated with Sc237 differed in their lesion profiles and accumulation patterns, Western blot profiles, and denaturant resistance. In addition, these PrP(Sc) exhibited distinctive virulence profiles upon secondary passage. These results suggest that different in vivo and in vitro environments result in propagation of PrP(Sc) with different biological properties. © 2011 The Societies and Blackwell Publishing Asia Pty Ltd.

  12. Biochemical, biophysical, and thermal properties of alkaline phosphatase from thermophile Thermus sp. NTU-237

    Directory of Open Access Journals (Sweden)

    Nguyen, HC.

    2017-01-01

    Full Text Available Description of the subject. Alkaline phosphatases (APases are commonly used as nonradioactive markers for detecting specific proteins or DNA targets in clinical medicine and molecular biology. However, their applications in the biotechnology industry require thermostability and storage stability. Our preliminary study revealed that APase from Thermus sp. NTU-237 (TsAPase is thermostable and exhibits high activity. Therefore, it is desirable to establish the optimal conditions for its application. Objectives. To characterize APase from thermophile Thermus sp. NTU-237 and to evaluate its potential applications. Method. The APase gene of Thermus sp. NTU-237 was cloned and expressed in Escherichia coli. Subsequently, the effects of buffer, glycerol, sodium dodecyl sulfate (SDS, NaCl, and temperature on enzyme activity were studied to establish the optimal conditions for TsAPase assays. In addition, the potential for application of TsAPase was evaluated using the 5-bromo-4-chloro-3-indolyl phosphate/nitro blue tetrazolium (BCIP/NBT active staining method. Results. Recombinant TsAPase was identified as having a dimeric structure and a molecular mass of 109 kDa. Sequence alignment analysis of known thermophilic APases with TsAPase and E. coli APase revealed that catalytic and binding residues were highly conserved. This finding suggested that the catalytic mechanism of TsAPase is the same as that of other APases. TsAPase activity was inhibited by glycerol and SDS but enhanced by NaCl and Tris-HCl buffer. The kinetic parameters Km, kcat, and Vmax were determined to be 81 µM, 6.08 s-1, and 6.76 U·mg-1, respectively. The optimum temperature of TsAPase was 80 °C, and TsAPase was stable at room temperature for more than 10 days. Moreover, TsAPase could catalyze the dephosphorylation of BCIP and could elicit blue color development by the BCIP/NBT reaction kit at room temperature. Conclusions. These results illustrate that TsAPase has potential for

  13. Savannah River Plant 200 Area technical manual. Part SP. Processing of Np/sup 237/ and Pu/sup 238/

    Energy Technology Data Exchange (ETDEWEB)

    Hill, A.J. (comp.)

    1963-01-03

    This manual covers the technology involved in the 200 Area process for the recovery of Np/sup 237/ from certain aqueous waste streams in the separations plants, for the recovery of NP/sup 237/ and Pu/sup 238/ from irradiated NpO/sub 2/-Al slugs and for the fabrication of NpO/sub 2/-Al slugs. The manual contains sections on the fundamental chemistry, the primary recovery of Np by ion exchange, the decontamination of Np by ion exchange, the processing of NpO/sub 2/-Al targets, the separation and purification of Np/sup 237/ and Pu/sup 238/, the finishing of Np, the preparation of NpO/sub 2/, the disposal of spent resin, and the safety aspects of the handling of hydrazine. The section on the fabrication of NpO/sub 2/-Al slugs will be added later. 76 refs., 22 figs.

  14. Measurements of fast neutron-induced fission data of Np-237

    Energy Technology Data Exchange (ETDEWEB)

    Win, Than; Saito, Keiichiro; Baba, Mamoru; Iwasaki, Tomohiko; Ibaraki, Masanobu; Miura, Takako; Sanami, Toshiya; Nauchi, Yasushi; Hirakawa, Naohiro [Tohoku Univ., Sendai (Japan). Faculty of Engineering

    1998-03-01

    We have performed the following measurements for {sup 237}Np using the 4.5 MV Dynamitron accelerator of Tohoku University as the pulsed neutron source: (1) Prompt fission neutron spectrum for 0.62 MeV incident neutrons, and (2) Neutron-Induced fission cross-section between 10 and 100 keV. The prompt fission neutron spectrum was measured using TOF method with a heavily shielded NE213 scintillation detector. The Maxwellian temperature T{sub m} derived is 1.28 MeV, which is lower than that of 1.38 MeV in JENDL-3.2. The fission cross sections were measured between 10 - 100 keV. The results are between JENDL-3.2 and ENDF/B-VI. (author)

  15. Identification of Nilsson orbitals in the superdeformed minimum of {sup 237}Pu

    Energy Technology Data Exchange (ETDEWEB)

    Morgan, Thomas James

    2008-03-31

    In this thesis, a spectroscopy experiment in the second minimum of the double humped fission barrier of {sup 237}Pu is presented, in which, for the first time, single - particle states for a neutron - rich shape isomer with odd neutron number were identified and characterised by their Nilsson quantum numbers. While rotational ({sup 236f}U and {sup 240f}Pu) and vibrational excitations ({sup 240f}Pu) had already been identified earlier in the even-even neighbouring nuclei, now the fission isomers in {sup 237}Pu (t{sub 1/2}=115 ns/1.12 {mu}s) were investigated in a {gamma}-spectroscopy experiment at the Cologne Tandem accelerator. Using the {sup 235}U({alpha},2n) reaction with a pulsed R beam, states in the second minimum were populated. Following the prompt decay of excited states into the ground states of the two shape isomers, the nucleus decays with its halflife, the resulting fission fragments were detected in a specially built 4{pi} parallel plate detector. The extremely rare isomeric {gamma} decays were measured in coincidence with the fission fragments using the highly efficient MINIBALL spectrometer. The background-subtracted {gamma}-ray spectrum was disentangled into contributions from the two shape isomers and 9 excited rotational bands were identified built on the ground states of the two isomers. The ground state spins of the two shape isomers were determined to be I=5/2 (115 ns isomer) and I=9/2 (1120 ns isomer). From the 149 identified {gamma} transitions, independent level schemes were constructed for the two fission isomers in {sup 237}Pu. The consistency of these level schemes was supported by the connecting {gamma} transitions between rotational bands. Furthermore, both level schemes could be combined to a common level scheme, in which the ground state of the long-lived 9/2 isomer was placed 54.0(3) keV above the ground state of the short-lived 5/2 isomer. The resulting level scheme was compared to Hartree-Fock-Bogolyubov single

  16. Improvement of evaluated neutron nuclear data for {sup 237}Np and {sup 241}Am

    Energy Technology Data Exchange (ETDEWEB)

    Nakagawa, Tsuneo; Iwamoto, Osamu; Hasegawa, Akira [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment

    2002-01-01

    The nuclear data of {sup 237}Np and {sup 241}Am that are particularly important among the minor actinides were investigated by comparing JENDL-3.2 with the recent evaluated data and available experimental data. As a result of the study, several defects of JENDL-3.2 data were revealed. They were improved on the basis of experimental data or recent evaluated data. For the both nuclides, main quantities revised in the present work were the resonance parameters, cross sections, angular and energy distributions of secondary neutrons, number of neutrons per fission. The data were given in the neutron energy range from 10{sup -5} eV to 20 MeV, and compiled in the ENDF-6 format. (author)

  17. Measurements of delayed neutron parameters for U-235 and Np-237

    Energy Technology Data Exchange (ETDEWEB)

    Loaiza, David [Univ. of New Mexico, Albuquerque, NM (United States)

    1997-07-01

    Delayed neutrons are emitted by excited nuclei formed in beta decay of fission products called delayed neutron precursors. About 1% of the total neutrons released in fission are delayed neutrons; however, this small fraction plays an important role in nuclear reactor control. The delayed neutrons determine the time-dependent behavior of reactors, and knowledge of parameters used to predict neutron emission rate is essential for establishing reactivity worths. The delayed neutron yields, decay constants, and the absolute yield for the six-group delayed neutrons have been measured for U-235 and Np-237. This experiment has been called for in the forecast of experiments needed to support operations in the US. The bare U-235 metal assembly Godiva IV at the Los Alamos Critical Experiment Facility (LACEF) provided the source of neutrons. Godiva IV generated about 107 total fissions in the samples for the infinite and instantaneous irradiation needed to accentuate the shorter and longer-lived groups of delayed neutrons. The detection system used in the experiment consisted of 20 He-3 tubes embedded in a polyethylene cylinder. The delayed neutron activity resulting from the fast neutron-induced fission has been measured. The measured absolute yield for U-235 was determined to be 0.0163 ± 0.009 neutrons/fission. This value compares very well with the well-established Keepin absolute yield of 0.0165 ± 0.0005. The newly measured absolute yield value for Np-237 was 0.0126 ± 0.0007, which compares well to the recently reported value of 0.0129 ± 0.0004 by Saleh and Parish. The measured values for U-235 are corroborated with period (e-folding time) versus reactivity calculations.

  18. Development of ionization technique for measurement of fast neutron induced fission products yields of {sup 237}Np

    Energy Technology Data Exchange (ETDEWEB)

    Goverdovski, A.A.; Khryachkov, V.A.; Ketlerov, V.V.; Mitrofanov, V.F.; Ostapenko, Yu.B.; Semenova, N.N.; Fomichev, A.N.; Rodina, L.F. [Institute of Physics and Power Engineering, Obninsk (Russian Federation)

    1997-03-01

    Twin gridded ionization chamber and corresponding software was designed for measurements of masses, kinetic energies and nuclear charges of fission fragments from fast neutron induced fission of {sup 237}Np. The ionization detector design, electronics, data acquisition and processing system and the test results are presented in this paper. (J.P.N.)

  19. The influence of conceptual model structure on model performance: a comparative study for 237 French catchments

    Directory of Open Access Journals (Sweden)

    W. R. van Esse

    2013-10-01

    Full Text Available Models with a fixed structure are widely used in hydrological studies and operational applications. For various reasons, these models do not always perform well. As an alternative, flexible modelling approaches allow the identification and refinement of the model structure as part of the modelling process. In this study, twelve different conceptual model structures from the SUPERFLEX framework are compared with the fixed model structure GR4H, using a large set of 237 French catchments and discharge-based performance metrics. The results show that, in general, the flexible approach performs better than the fixed approach. However, the flexible approach has a higher chance of inconsistent results when calibrated on two different periods. When analysing the subset of 116 catchments where the two approaches produce consistent performance over multiple time periods, their average performance relative to each other is almost equivalent. From the point of view of developing a well-performing fixed model structure, the findings favour models with parallel reservoirs and a power function to describe the reservoir outflow. In general, conceptual hydrological models perform better on larger and/or wetter catchments than on smaller and/or drier catchments. The model structures performed poorly when there were large climatic differences between the calibration and validation periods, in catchments with flashy flows, and in catchments with unexplained variations in low flow measurements.

  20. [External cephalic version: experience about 237 versions at Port-Royal maternity].

    Science.gov (United States)

    Le Bret, T; Grangé, G; Goffinet, F; Cabrol, D

    2004-06-01

    To evaluate the effectiveness of external cephalic version for reducing the rate of cesarean section by preserving fetal safety. A retrospective review of 237 external cephalic versions between January 1, 1998 and December 31, 2000 was conducted at Port Royal maternity. The success rate of external cephalic version was 50.6%. When version failed vaginal birth could be allowed after strict evaluation. The rate of cesarean section was 12.5% in the success group and 53% in the unsuccessful group, two thirds were planned. The overall rate of vaginal birth among breech presentations was 67%. After version there were 3.4% abnormal fetal heart rate tracings and 2.9% positive Kleihauer tests. No major complications occurred. Successful external cephalic version was associated with statistically significant higher multiparity, complete breech out of the pelvis and normal amniotic fluid Volume. External cephalic version reduces the cesarean section rate by about 20.5% among breech presentations and so, lowers maternal morbidity. External cephalic version could be proposed to the patients when safety criteria are respected and close fetal monitoring is maintained.

  1. Modeling 237 Lyman-α spectra of the MUSE-Wide survey

    Science.gov (United States)

    Gronke, Max

    2017-12-01

    We compare 237 Lyman-α (Lyα) spectra of the MUSE-Wide survey to a suite of radiative transfer simulations consisting of a central luminous source within a concentric, moving shell of neutral gas, and dust. This six parameter shell-model has been used numerously in previous studies, however, on significantly smaller data-sets. We find that the shell-model can reproduce the observed spectral shape very well - better than the also common "Gaussian-minus-Gaussian" model which we also fitted to the dataset. Specifically, we find that 94% of the fits possess a goodness-of-fit value of p(χ2) > 0.1. The large number of spectra allows us to robustly characterize the shell-model parameter range, and consequently, the spectral shapes typical for realistic spectra. We find that the vast majority of the Lyα spectral shapes require an outflow and only 5% are well-fitted through an inflowing shell. In addition, we find 46% of the spectra to be consistent with a neutral hydrogen column density http://cdsarc.u-strasbg.fr (http://130.79.128.5) or via http://cdsarc.u-strasbg.fr/viz-bin/qcat?J/A+A/608/A139

  2. Measurements of delayed neutron emission from Np-237, Am-241, and Am-243

    Energy Technology Data Exchange (ETDEWEB)

    Saleh, H.H.; Parish, T.A. [Texas A& M Univ., College Station, TX (United States); Raman, S. [Oak Ridge National Lab., TN (United States)

    1995-12-01

    Isotopes of transuranic elements are produced as a result of successive radiative capture reactions in the fuel of a nuclear reactor. Typically, these transuranic isotopes decay through long chains, have long half lives and dominate the long term toxicity of the spent reactor fuel. One of the options for waste management is to remove the transuranic from spent fuel by chemical processing, to load them into new special fuel elements, and to transmute them by neutron induced fission into shorter-lived fission fragments. Previous studies have shown the feasibility of actinide transmutation in either Light Water Reactors or Liquid Metal Fast Reactors. Due to the anticipated high transuranic loadings in the fuel of actinide burner reactors, the neutronic properties of the transuranic isotopes will have a significant effect on the operational and safety characteristics of such reactors. Experiments to determine delayed neutron group yields and decay constants for Np-237, Am-241, and Am-243 have been designed and carried out. The experiments were conducted at Texas A&M University TRIGA reactor using a very fast pneumatic transfer system.

  3. Manganese determination om minerals by activation analysis, using the californium-252 as a neutron source; Determinacao de manganes em minerios, por analise por ativacao, usando californio-252 como fonte de neutrons

    Energy Technology Data Exchange (ETDEWEB)

    Cardoso, Antonio

    1976-07-01

    Neutron Activation Analysis, using a Californium-252 neutron source, has been applied for the determination of manganese in ores such as pyrolusite, rodonite (manganese silicate)' and blending used in dry-batteries The favorable nuclear properties of manganese, such as high thermal neutron cross-section for the reaction {sup 55}Mn (n.gamma){sup 56} Mn, high concentration of manganese in the matrix and short half - life of {sup 56}Mn, are an ideal combination for non-destructive analysis of manganese in ores. Samples and standards of manganese dioxide were irradiated for about 20 minutes, followed by a 4 to 15 minutes decay and counted in a single channel pulse-height discrimination using a NaI(Tl) scintillation detector. Counting time was equal to 10 minutes. The interference of nuclear reactions {sup 56}Fe(n,p){sup 56}Mn and {sup 59} Co (n, {alpha}){sup 56} were studied, as well as problems in connection with neutron shadowing during irradiation, gamma-rays attenuation during counting and influence of granulometry of samples. One sample,was also analysed by wet-chemical method (sodium bismuthate) in order to compare results. As a whole, i t was shown that the analytical method of neutron activation for manganese in ores and blending, is a method simple, rapid and with good precision and accuracy. (author)

  4. Design of a homogeneous subcritical nuclear reactor based on thorium with a source of californium 252; Diseno de un reactor nuclear subcritico homogeneo a base de Torio con una fuente de Californio 252

    Energy Technology Data Exchange (ETDEWEB)

    Delgado H, C. E.; Vega C, H. R. [Universidad Autonoma de Zacatecas, Unidad Academica de Estudios Nucleares, Cipres No. 10, Fracc. La Penuela, 98068 Zacatecas, Zac. (Mexico); Sajo B, L., E-mail: ce_delgado89@hotmail.com [Universidad Simon Bolivar, Laboratorio de Fisica Nuclear, Apdo. 89000, 1080A Caracas (Venezuela, Bolivarian Republic of)

    2015-10-15

    Full text: One of the energy alternatives to fossil fuels which do not produce greenhouse gases is the nuclear energy. One of the drawbacks of this alternative is the generation of radioactive wastes of long half-life and its relation to the generation of nuclear materials to produce weapons of mass destruction. An option to these drawbacks of nuclear energy is to use Thorium as part of the nuclear fuel which it becomes in U{sup 233} when capturing neutrons, that is a fissile material. In this paper Monte Carlo methods were used to design a homogeneous subcritical reactor based on thorium. As neutron reflector graphite was used. The reactor core is homogeneous and is formed of 70% light water as moderator, 12% of enriched uranium UO{sub 2}(NO{sub 3}){sub 4} and 18% of thorium Th(NO{sub 3}){sub 4} as fuel. To start the nuclear fission chain reaction an isotopic source of californium 252 was used with an intensity of 4.6 x 10{sup 7} s{sup -1}. In the design the value of the effective multiplication factor, whose value turned out k{sub eff} <1 was calculated. Also, the neutron spectra at different distances from the source and the total fluence were calculated, as well as the values of the ambient dose equivalent in the periphery of the reactor. (Author)

  5. New experimental determination of the neutronic resonance parameters of {sup 237}Np below 500 eV; Nouvelle determination experimentale des parametres de resonances neutroniques de {sup 237}Np en dessous de 500 eV

    Energy Technology Data Exchange (ETDEWEB)

    Gressier, V

    1999-10-01

    For studies of future nuclear reactors dedicated to nuclear waste transmutation, an improvement of the accuracy of the neutron radiative capture cross section of {sup 237}Np appears necessary. In the framework of a collaboration between the Commissariat a l'Energie atomique (CEA) and Institute for Reference Materials and Measurement (IRMM, Geel, Bergium), a new determination of the resonance parameters of {sup 237}Np has been performed. Two types of experiments are carried out at GELINA, the IRMM pulsed neutron source, using the time of flight method: a transmission experiment which is related to the neutron total cross section and a capture experiment which gives the neutron radiative capture cross section. The resonance parameters presented in this work are extracted from the transmission data between 0 and 500 eV with the least square code REFIT, using the Reich-Moore formalism. In parallel, the Doppler effect is investigated. The commonly used free gas model appears inadequate below 20 eV for neptunium dioxide at room temperature. By the use of the program DOPUSH, which calculates the Doppler broadening with a harmonic crystal model according to Lamb's theory, we are able to produce abetter fit of the experimental data for the resonances of {sup 237}Np in NpO{sub 2} at low energy or temperatures. In addition to the resonance parameters, a study of their mean value and distribution is included in this work. (authors)

  6. NEXT Long-Duration Test After 11,570 h and 237 kg of Xenon Processed

    Science.gov (United States)

    Soulas, George C.; Patterson, Michael J.; Herman, Daniel A.

    2009-01-01

    The NASA s Evolutionary Xenon Thruster (NEXT) program is developing the next-generation ion propulsion system with significant enhancements beyond the state-of-the-art in ion propulsion to provide future NASA science missions with enhanced mission capabilities at a low total development cost. As part of a comprehensive thruster service life assessment utilizing both testing and analyses, a Long-Duration Test (LDT) was initiated to validate and qualify the NEXT propellant throughput capability to a qualification-level of 450 kg, 1.5 times the mission-derived throughput requirement of 300 kg. This wear test is being conducted with a modified, flight-representative NEXT engineering model ion thruster, designated EM3. As of September 1, 2007, the thruster has accumulated 11,570 h of operation primarily at the thruster full-input-power of 6.9 kW with 3.52 A beam current and 1800 V beam power supply voltage. The thruster has processed 237 kg of xenon surpassing the NSTAR propellant throughput demonstrated during the extended life testing of the Deep Space 1 (DS1) flight spare. The NEXT LDT has demonstrated a total impulse of 9.78 10(exp 6) N(dot)s; the highest total impulse ever demonstrated by an ion thruster. Thruster performance tests are conducted periodically over the entire NEXT throttle table with input power ranging 0.5 to 6.9 kW. Thruster performance parameters including thrust, input power, specific impulse, and thruster efficiency have been nominal with little variation to date. Lifetime-limiting component erosion rates have been consistent with the NEXT service life assessment, which predicts the earliest failure sometime after 750 kg of xenon propellant throughput; well beyond the mission-derived lifetime requirement. The NEXT wear test data confirm that the erosion of the discharge keeper orifice, enlarging of nominal-current-density accelerator grid aperture cusps at full-power, and the decrease in cold grid-gap observed during NSTAR wear testing have been

  7. Farmland biodiversity and agricultural management on 237 farms in 13 European and two African regions.

    Science.gov (United States)

    Lüscher, Gisela; Ammari, Youssef; Andriets, Aljona; Angelova, Siyka; Arndorfer, Michaela; Bailey, Debra; Balázs, Katalin; Bogers, Marion; Bunce, Robert G H; Choisis, Jean-Philippe; Dennis, Peter; Díaz, Mario; Dyman, Tetyana; Eiter, Sebastian; Fjellstad, Wendy; Fraser, Mariecia; Friedel, Jürgen K; Garchi, Salah; Geijzendorffer, Ilse R; Gomiero, Tiziano; González-Bornay, Guillermo; Guteva, Yana; Herzog, Felix; Jeanneret, Philippe; Jongman, Rob H G; Kainz, Max; Kwikiriza, Norman; López Díaz, María Lourdes; Moreno, Gerardo; Nicholas-Davies, Pip; Nkwiine, Charles; Opio, Julius; Paoletti, Maurizio G; Podmaniczky, László; Pointereau, Philippe; Pulido, Fernando; Sarthou, Jean-Pierre; Schneider, Manuel K; Sghaier, Tahar; Siebrecht, Norman; Stoyanova, Siyka; Wolfrum, Sebastian; Yashchenko, Sergiy; Albrecht, Harald; Báldi, András; Belényesi, Márta; Benhadi-Marin, Jacinto; Blick, Theo; Buholzer, Serge; Centeri, Csaba; Choisis, Norma; Cuendet, Gérard; De Lange, Hendrika J; Déjean, Sylvain; Deltshev, Christo; Díaz Cosín, Darío J; Dramstad, Wenche; Elek, Zoltán; Engan, Gunnar; Evtushenko, Konstantin; Falusi, Eszter; Finch, Oliver-D; Frank, Thomas; Gavinelli, Federico; Genoud, David; Gillingham, Phillipa K; Grónás, Viktor; Gutiérrez, Mónica; Häusler, Werner; Heer, Xaver; Hübner, Thomas; Isaia, Marco; Jerkovich, Gergely; Jesus, Juan B; Kakudidi, Esezah; Kelemen, Eszter; Koncz, Nóra; Kovacs, Eszter; Kovács-Hostyánszki, Anikó; Last, Luisa; Ljubomirov, Toshko; Mandery, Klaus; Mayr, Josef; Mjelde, Atle; Muster, Christoph; Nascimbene, Juri; Neumayer, Johann; Ødegaard, Frode; Ortiz Sánchez, Francisco Javier; Oschatz, Marie-Louise; Papaja-Hülsbergen, Susanne; Paschetta, Mauro; Pavett, Mark; Pelosi, Céline; Penksza, Károly; Pommeresche, Reidun; Popov, Victor; Radchenko, Volodymyr; Richner, Nina; Riedel, Susanne; Scullion, John; Sommaggio, Daniele; Szalkovszki, Ottó; Szerencsits, Erich; Trigo, Dolores; Vale, Jim; van Kats, Ruud; Vasilev, Angel; Whittington, Andrew E; Wilkes-Allemann, Jerylee; Zanetti, Tommaso

    2016-06-01

    Farmland is a major land cover type in Europe and Africa and provides habitat for numerous species. The severe decline in farmland biodiversity of the last decades has been attributed to changes in farming practices, and organic and low-input farming are assumed to mitigate detrimental effects of agricultural intensification on biodiversity. Since the farm enterprise is the primary unit of agricultural decision making, management-related effects at the field scale need to be assessed at the farm level. Therefore, in this study, data were collected on habitat characteristics, vascular plant, earthworm, spider, and bee communities and on the corresponding agricultural management in 237 farms in 13 European and two African regions. In 15 environmental and agricultural homogeneous regions, 6-20 farms with the same farm type (e.g., arable crops, grassland, or specific permanent crops) were selected. If available, an equal number of organic and non-organic farms were randomly selected. Alternatively, farms were sampled along a gradient of management intensity. For all selected farms, the entire farmed area was mapped, which resulted in total in the mapping of 11 338 units attributed to 194 standardized habitat types, provided together with additional descriptors. On each farm, one site per available habitat type was randomly selected for species diversity investigations. Species were sampled on 2115 sites and identified to the species level by expert taxonomists. Species lists and abundance estimates are provided for each site and sampling date (one date for plants and earthworms, three dates for spiders and bees). In addition, farmers provided information about their management practices in face-to-face interviews following a standardized questionnaire. Farm management indicators for each farm are available (e.g., nitrogen input, pesticide applications, or energy input). Analyses revealed a positive effect of unproductive areas and a negative effect of intensive

  8. Prospects for a measurement of the 237U(n,f) cross section at the LANSCE Lujan Center

    Energy Technology Data Exchange (ETDEWEB)

    Devlin, Matthew James [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Mocko, Michal [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Gavron, Victor [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Jandel, Marian [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Rusev, Gencho Yordanov [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Bredeweg, Todd Allen [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2015-06-24

    A new measurement of the 237U(n, f) cross section from thermal to ≈ 100 keV is discussed, using one of the flightpaths at the LANSCE Lujan Center. Previous energy-resolved resonance-region measurements have been conducted using weapon test time-of-flight[1] and the LANSCE Lead Slowing Down Spectrometer[2], the former of which is limited in its energy range, and the latter in its energy resolution and range. We present here a proposal, based on simulations of the Lujan Center neutron flux and a hypothetical experiment, that is expected to adequately address both of these issues.

  9. Depth profiling of residual activity of ^{237}U fragments as a range verification technique for ^{238}U primary ion beam

    Directory of Open Access Journals (Sweden)

    I. Strašík

    2012-07-01

    Full Text Available Experimental and simulation data concerning fragmentation of ^{238}U ion beam in aluminum, copper, and stainless-steel targets with the initial energy 500 and 950  MeV/u are collected in the paper. A range-verification technique based on depth profiling of residual activity is presented. The irradiated targets were constructed in the stacked-foil geometry and analyzed using gamma-ray spectroscopy. One of the purposes of these experiments was depth profiling of residual activity of induced nuclides and projectile fragments. Among the projectile fragments, special attention is paid to the ^{237}U isotope that has a range very close to the range of the primary ^{238}U ions. Therefore, the depth profiling of the ^{237}U isotope can be utilized for experimental verification of the ^{238}U primary-beam range, which is demonstrated and discussed in the paper. The experimental data are compared with computer simulations by FLUKA, SRIM, and ATIMA, as well as with complementary experiments.

  10. Depth profiling of residual activity of U237 fragments as a range verification technique for U238 primary ion beam

    Science.gov (United States)

    Strašík, I.; Chetvertkova, V.; Mustafin, E.; Pavlovič, M.; Belousov, A.

    2012-07-01

    Experimental and simulation data concerning fragmentation of U238 ion beam in aluminum, copper, and stainless-steel targets with the initial energy 500 and 950MeV/u are collected in the paper. A range-verification technique based on depth profiling of residual activity is presented. The irradiated targets were constructed in the stacked-foil geometry and analyzed using gamma-ray spectroscopy. One of the purposes of these experiments was depth profiling of residual activity of induced nuclides and projectile fragments. Among the projectile fragments, special attention is paid to the U237 isotope that has a range very close to the range of the primary U238 ions. Therefore, the depth profiling of the U237 isotope can be utilized for experimental verification of the U238 primary-beam range, which is demonstrated and discussed in the paper. The experimental data are compared with computer simulations by FLUKA, SRIM, and ATIMA, as well as with complementary experiments.

  11. Efficacy and safety of once-daily NVA237 in patients with moderate-to-severe COPD: the GLOW1 trial

    Directory of Open Access Journals (Sweden)

    D'Urzo Anthony

    2011-12-01

    Full Text Available Abstract Background NVA237 is a once-daily dry-powder formulation of the long-acting muscarinic antagonist glycopyrronium bromide in development for the treatment of chronic obstructive pulmonary disease (COPD. The glycopyrronium bromide in COPD airways clinical study 1 (GLOW1 evaluated the efficacy, safety and tolerability of NVA237 in patients with moderate-to-severe COPD. Methods Patients with COPD with a smoking history of ≥ 10 pack-years, post-bronchodilator forced expiratory volume in 1 second (FEV1 1/forced vital capacity 1 antagonists permitted in patients stabilized on them prior to study entry. The primary outcome measure was trough FEV1 at Week 12. Results A total of 822 patients were randomized to NVA237 (n = 552 or placebo (n = 270. Least squares mean (± standard error trough FEV1 at Week 12 was significantly higher in patients receiving NVA237 (1.408 ± 0.0105 L, versus placebo (1.301 ± 0.0137 L; treatment difference 108 ± 14.8 mL, p 1 were apparent at the end of Day 1 and sustained through Week 26. FEV1 was significantly improved in the NVA237 group versus placebo throughout the 24-hour periods on Day 1 and at Weeks 12 and 26, and at all other visits and timepoints. Transition dyspnoea index focal scores and St. George's Respiratory Questionnaire scores were significantly improved with NVA237 versus placebo at Week 26, with treatment differences of 1.04 (p Conclusions Once-daily NVA237 was safe and well tolerated and provided rapid, sustained improvements in lung function, improvements in dyspnoea, and health-related quality of life, and reduced the risk of exacerbations and the use of rescue medication. Trial registration ClinicalTrials.gov: NCT01005901

  12. Exercise-induced TBC1D1 Ser237 phosphorylation and 14-3-3 protein binding capacity in human skeletal muscle

    DEFF Research Database (Denmark)

    Frøsig, Christian; Pehmøller, Christian; Birk, Jesper Bratz

    2010-01-01

    increasing 60 - 250% (Pprotein kinase (AMPK) induced both Ser237 phosphorylation and 14-3-3 binding properties on human TBC1D1 when evaluated in vitro. To further characterize the role of AMPK as an upstream kinase regulating TBC1D1, extensor digitorum longus......TBC1D1 is a Rab-GTPase activating protein involved in regulation of GLUT4 translocation in skeletal muscle. We here evaluated exercise-induced regulation of TBC1D1 Ser237 phosphorylation and 14-3-3 protein binding capacity in human skeletal muscle. In separate experiments healthy men performed all......-out cycle exercise lasting either 30 sec, 2 min or 20 min. After all exercise protocols, TBC1D1 Ser237 phosphorylation increased (~70 - 230%, Pprotein showed a similar pattern of regulation...

  13. Ultra-trace determination of neptunium-237 and plutonium isotopes in urine samples by compact accelerator mass spectrometry

    Energy Technology Data Exchange (ETDEWEB)

    Dai, X.; Christl, M.; Kramer-Tremblay, S., E-mail: sheila.kramer-tremblay@cnl.ca [Canadian Nuclear Laboratories, Chalk River, Ontario (Canada); Synal, H-A. [ETH Zurich, Lab. of Ion Beam Physics, Zurich (Switzerland)

    2015-12-15

    Ultra-trace analysis of actinides, such as Pu isotopes and {sup 237}Np, in bioassay samples is often needed for radiation protection programs at nuclear facilities. Accelerator mass spectrometry (AMS), particularly the compact ETH Zurich system “Tandy”, has evolved over the years as one of the most sensitive, selective, and robust techniques for actinide analysis. Employment of the AMS technique can reduce the demands on sample preparation chemistry and increase sample analysis throughput, due to very low instrumental detection limit, high rejection of interferences, and low susceptibility to adverse sample matrices. Initial research and development tests were performed to explore and demonstrate the analytical capability of AMS for Pu and Np urine bioassay. In this study, urine samples spiked with femtogram levels of Np and Pu isotopes were prepared and measured using compact ETH AMS system and the results showed excellent analytical capability for measuring Np and Pu isotopes at femtogram/litre levels in urine. (author)

  14. Comparison of neutron induced fission and capture in Np-237 and Pu-239 irradiated in QUINTA assembly with 660 MeV proton beam

    Science.gov (United States)

    Kilim, Stanislaw; Strugalska-Gola, Elzbieta; Szuta, Marcin; Bielewicz, Marcin; Tyutyunnikov, Sergey; Stegailov, Vladimir

    2017-03-01

    Two Np-237 samples and one Pu-239 were irradiated in spallation neutrons produced in ADS setup QUINTA. The accelerated beam consisted of protons of energy 660 MeV. The method was based on gamma-ray spectrometry measurement. During analysis of the spectra several fission products and one actinide were identified. Fission product activities gave the number of fissions. The actinide (Np-238), a result of neutron capture by Np-237 gave the number of captures. In a similar manner the number of fissions in Pu-239 was determined. The Pu-240, a product of neutron capture by Pu-239, activity was impossible to measure.

  15. Comparison of neutron induced fission and capture in Np-237 and Pu-239 irradiated in QUINTA assembly with 660 MeV proton beam

    Directory of Open Access Journals (Sweden)

    Kilim Stanislaw

    2017-01-01

    Full Text Available Two Np-237 samples and one Pu-239 were irradiated in spallation neutrons produced in ADS setup QUINTA. The accelerated beam consisted of protons of energy 660 MeV. The method was based on gamma-ray spectrometry measurement. During analysis of the spectra several fission products and one actinide were identified. Fission product activities gave the number of fissions. The actinide (Np-238, a result of neutron capture by Np-237 gave the number of captures. In a similar manner the number of fissions in Pu-239 was determined. The Pu-240, a product of neutron capture by Pu-239, activity was impossible to measure.

  16. N-(3,4-Dimethoxyphenyl-4-oxo-2,3,7-triazaspiro[4.5]dec-1-ene-1-carboxamide Hydrochloride

    Directory of Open Access Journals (Sweden)

    Seranthimata Samshuddin

    2012-08-01

    Full Text Available A simple and novel route for synthesis of new spirocyclic amide derivative is developed. The present work involves the oxidative cleavage of tert-butyl 1-(furan-2-yl-4-oxo-2,3,7-triazaspiro[4.5]dec-1-ene-7-carboxylate 1 followed by the amine coupling and deprotection of Boc.

  17. Comment: 237 [Taxonomy Icon

    Lifescience Database Archive (English)

    Full Text Available for Life Science licensed under CC Attribution2.1 Japan 絵や写真の投稿もできます。右は、没になったティラノザウルス(目がかわいい)です。 ttamura 2008/11/11 12:11:40 2011/09/14 21:10:36 ...

  18. Screening of the FcεRI-β-Gene in a Swiss Population of Asthmatic Children: No Association with E237G and Identification of New Sequence Variations

    Directory of Open Access Journals (Sweden)

    M. Rohrbach

    1998-01-01

    Full Text Available Background: The gene of the beta subunit of the high affinity receptor for IgE (FcεRI-β encoded on chromosome 11q13 has recently been identified as a candidate gene for asthma and atopy. Two coding variations, E237G and I181L have been described as being associated with asthma and atopy. Our aim was to investigate a Swiss population of atopic and asthmatic children for variations in this gene.

  19. Unexpected combined effects of NADH dehydrogenase subunit-2 237 Leu/Met polymorphism and green tea consumption on renal function in male Japanese health check-up examinees: a cross-sectional study.

    Science.gov (United States)

    Kokaze, Akatsuki; Ishikawa, Mamoru; Matsunaga, Naomi; Karita, Kanae; Yoshida, Masao; Ohtsu, Tadahiro; Ochiai, Hirotaka; Shirasawa, Takako; Nanri, Hinako; Hoshino, Hiromi; Takashima, Yutaka

    2013-11-20

    NADH dehydrogenase subunit-2 237 leucine/methionine (ND2-237 Leu/Met) polymorphism is associated with longevity in Japanese. A previous study has shown that ND2-237 Leu/Met polymorphism modulates the effects of green tea consumption on risk of hypertension. For men with ND2-237Leu, habitual green tea consumption may reduce the risk of hypertension. Moreover, there is a combined effect of ND2-237 Leu/Met polymorphism and alcohol consumption on risk of mildly decreased estimated glomerular filtration rate (eGFR) (consumption on risk of mildly decreased eGFR in male Japanese health check-up examinees. For ND2-237Leu genotypic men, after adjustment for confounding factors, green tea consumption may increase the risk of mildly decreased eGFR (P for trend = 0.016). The adjusted odds ratio (OR) for mildly decreased eGFR was significantly higher in subjects with ND2-237Leu who consume ≥6 cups of green tea per day than those who consume ≤1 cup of green tea per day (adjusted OR = 5.647, 95% confidence interval: 1.528-20.88, P = 0.009). On the other hand, for ND2-237Met genotypic men, green tea consumption does not appear to determine the risk of mildly decreased eGFR. The present results suggest that ND2-237 Leu/Met polymorphism unexpectedly modifies the effects of green tea consumption on eGFR and the risk of mildly decreased eGFR in male Japanese subjects.

  20. Probing the dynamic interface between trimethylamine dehydrogenase (TMADH) and electron transferring flavoprotein (ETF) in the TMADH-2ETF complex: role of the Arg-alpha237 (ETF) and Tyr-442 (TMADH) residue pair.

    Science.gov (United States)

    Burgess, Selena G; Messiha, Hanan Latif; Katona, Gergely; Rigby, Stephen E J; Leys, David; Scrutton, Nigel S

    2008-05-06

    We have used multiple solution state techniques and crystallographic analysis to investigate the importance of a putative transient interaction formed between Arg-alpha237 in electron transferring flavoprotein (ETF) and Tyr-442 in trimethylamine dehydrogenase (TMADH) in complex assembly, electron transfer, and structural imprinting of ETF by TMADH. We have isolated four mutant forms of ETF altered in the identity of the residue at position 237 (alphaR237A, alphaR237K, alphaR237C, and alphaR237E) and with each form studied electron transfer from TMADH to ETF, investigated the reduction potentials of the bound ETF cofactor, and analyzed complex formation. We show that mutation of Arg-alpha237 substantially destabilizes the semiquinone couple of the bound FAD and impedes electron transfer from TMADH to ETF. Crystallographic structures of the mutant ETF proteins indicate that mutation does not perturb the overall structure of ETF, but leads to disruption of an electrostatic network at an ETF domain boundary that likely affects the dynamic properties of ETF in the crystal and in solution. We show that Arg-alpha237 is required for TMADH to structurally imprint the as-purified semiquinone form of wild-type ETF and that the ability of TMADH to facilitate this structural reorganization is lost following (i) redox cycling of ETF, or simple conversion to the oxidized form, and (ii) mutagenesis of Arg-alpha237. We discuss this result in light of recent apparent conflict in the literature relating to the structural imprinting of wild-type ETF. Our studies support a mechanism of electron transfer by conformational sampling as advanced from our previous analysis of the crystal structure of the TMADH-2ETF complex [Leys, D. , Basran, J. , Sutcliffe, M. J., and Scrutton, N. S. (2003) Nature Struct. Biol. 10, 219-225] and point to a key role for the Tyr-442 (TMADH) and Arg-alpha237 (ETF) residue pair in transiently stabilizing productive electron transfer configurations. Our work

  1. On the sequential separation and quantification of (237)Np, (241)Am, thorium, plutonium, and uranium isotopes in environmental and urine samples.

    Science.gov (United States)

    Vasile, M; Jacobs, K; Bruggeman, M; Van Hoecke, K; Dobney, A; Verrezen, F

    2017-07-13

    The implementation of the one-pass-through separation technique using two stacked chromatography columns of TEVA - TRU resins for the separation of (237)Np, (241)Am, thorium, plutonium and uranium from environmental and urine samples was investigated. The sequential separation technique proved to be successful and gave similar results to those obtained when using individual separations. The analysis time was considerably improved. The amount of chemical waste was also reduced by 50% and the use of HClO4 was avoided. The technique of ICP-MS was also investigated as a complementary technique to alpha-spectrometry. Copyright © 2017 Elsevier Ltd. All rights reserved.

  2. 4-[5-(3,5-Difluorophenylfuran-2-yl]-2,3,7-triazaspiro[4.5]dec-3-en-1-one Hydrochloride

    Directory of Open Access Journals (Sweden)

    Balladka Kunhanna Sarojini

    2012-08-01

    Full Text Available A novel route for the synthesis of new spirocyclic derivative is developed. The present work involves the synthesis of title compound 3 by Suzuki coupling of 3,5-difluorophenyl boronic acid with tert-butyl 1-(5-bromofuran-2-yl-4-oxo-2,3,7-triazaspiro[4.5]dec-1-ene-7-carboxylate (2, which in turn prepared from the ethyl nipecotate (1. Newly prepared spirocyclic derivative (3 is characterized by IR, NMR and mass spectral data.

  3. Decay Data Evaluation Project (DDEP): evaluation of the {sup 237}U,{sup 236}Np, {sup 236m}Np and {sup 241}Pu decay characteristics

    Energy Technology Data Exchange (ETDEWEB)

    Checheva, V.P.; Kuzmenko, N.K. [V.G. Khlopin Radium Institute, Saint Petersburg (Russian Federation)

    2008-07-01

    The results of decay data evaluations are presented for {sup 237}U, {sup 236}Np, {sup 236m}Np and {sup 241}Pu. These evaluated data have been obtained within the Decay Data Evaluation Project and the IAEA CRP 'Updated Decay Data Library for Actinides' using information published up to 2007. The following decay characteristics have been evaluated: half-life, decay energy, energies and probabilities of alpha, beta and electron-capture transitions, energies and transition probabilities of gamma transitions, internal conversion coefficients, and energies and absolute emission probabilities of gamma rays, X-rays and electron emissions.

  4. Data Evaluation of Actinide Cross Sections: 238Pu, 237Pu, and 236Pu

    Energy Technology Data Exchange (ETDEWEB)

    Guaglioni, S. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Jurgenson, E. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Descalle, M. A. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Thompson, I. J. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Ormand, E. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Escher, J. E. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Younes, W. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Mattoon, C. M. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Beck, B. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Burke, J. T. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Bailey, T. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

    2017-10-04

    This report documents the recent evaluation of the 236Pu, 237Pu, and 238Pu cross section sets. Nuclear data evaluation is the fundamental interface that takes measured nuclear cross section data and turns them into a continuous curve that 1) is consistent with other measurements and nuclear reaction theory/models, and 2) is required by down-stream users. All experiments that generate nuclear data need to include an evaluation step for their data to be broadly useful to the end users.

  5. The neutron capture cross sections of {sup 237}Np(n,{gamma}) and {sup 240}Pu(n,{gamma}) and its relevance in the transmutation of nuclear waste

    Energy Technology Data Exchange (ETDEWEB)

    Guerrero, C.; Abbondanno, U.; Aerts, G.; Alvarez, H.; Alvarez-Velarde, F.; Andriamonje, S.; Andrzejewski, J.; Assimakopoulos, P.; Audouin, L.; Badurek, G.; Baumann, P.; Becvar, F.; Berthoumieux, E.; Calvino, F.; Calviani, M.; Cano-Ott, D.; Capote, R.; Carrapico, C.; Cennini, P.; Chepel, V.; Chiaveri, E.; Colonna, N.; Cortes, G.; Couture, A.; Cox, J.; Dahlfors, M.; David, S.; Dillmann, I.; Domingo-Pardo, C.; Dridi, W.; Duran, I.; Eleftheriadis, C.; Embid-Segura, M.; Ferrant, L.; Ferrari, A.; Ferreira-Marques, R.; Fujii, K.; Furman, W.; Goncalves, I.; Gonzalez-Romero, E.; Gramegna, F.; Gunsing, F.; Haas, B.; Haight, R.; Heil, M.; Herrera-Martinez, A.; Igashira, M.; Jericha, E.; Kappeler, F.; Kadi, Y.; Karadimos, D.; Karamanis, D.; Kerveno, M.; Koehler, P.; Kossionides, E.; Krticka, M.; Lampoudis, C.; Leeb, H.; Lindote, A.; Lopes, I.; Lozano, M.; Lukic, S.; Marganiec, J.; Marrone, S.; Martinez, T.; Massimi, C.; Mastinu, P.; Mengoni, A.; Milazzo, P.M.; Moreau, C.; Mosconi, M.; Neves, F.; Oberhummer, H.; O' Brien, S.; Pancin, J.; Papachristodoulou, C.; Papadopoulos, C.; Paradela, C.; Patronis, N.; Pavlik, A.; Pavlopoulos, P.; Perrot, L.; Pigni, M.T.; Plag, R.; Plompen, A.; Plukis, A.; Poch, A.; Praena, J.; Pretel, C.; Quesada, J.; Rauscher, T.; Reifarth, R.; Rubbia, C.; Rudolf, G.; Rullhusen, P.; Salgado, J.; Santos, C.; Sarchiapone, L.; Savvidis, I.; Stephan, C.; Tagliente, G.; Tain, J.L.; Tassan-Got, L.; Tavora, L.; Terlizzi, R.; Vannini, G.; Vaz, P.; Ventura, A.; Villamarin, D.; Vincente, M.C.; Vlachoudis, V.; Vlastou, R.; Voss, F.; Walter, S.; Wiescher, M.; Wisshak, K

    2008-07-01

    Neutron capture cross sections of actinides are of great relevance for the Transmutation of Nuclear Waste in Accelerator Driven Systems (ADS) and Generation-IV reactors. The neutron capture cross sections of {sup 237}Np and {sup 240}Pu in the range of 1 eV to 2 keV were measured at the n-TOF facility with a Total Absorption Calorimeter. The data have been analyzed with the SAMMY code. The corresponding covariance matrices have been generated. The final cross sections are presented and compared to the previously existing ones.The n-TOF {sup 237}Np {sigma}(n,{gamma}) is in agreement with the evaluated data files below 300 eV and its is lower by 10 to 15% up to 2 keV. This discrepancy with the evaluated data files is also observed in the capture cross section derived from the transmission measurements of Gressier et al. In the case of the {sup 240}Pu {sigma}(n,{gamma}), the n-TOF {sigma}(n,{gamma}) agrees within uncertainties with JENDL-3.3 and JEFF-3.1, except for a group of resonances around 800 eV. Endf/B-VII data are lower than n-TOF and the mentioned evaluations, with differences that increase with neutron energy up to 15-20 per cent.

  6. Standard practice for the determination of 237Np, 232Th, 235U and 238U in urine by inductively coupled plasma-Mass spectrometry (ICP-MS) and gamma ray spectrometry.

    CERN Document Server

    American Society for Testing and Materials. Philadelphia

    2005-01-01

    1.1 This practice covers the separation and preconcentration of neptunium-237 (237Np), thorium-232 (232Th), uranium-235 (235U) and uranium-238 (238U) from urine followed by quantitation using ICP-MS. 1.2 This practice can be used to support routine bioassay programs. The minimum detectable concentrations (MDC) for this method, taking the preconcentration factor into account, are approximately 1E-2Bq for 237Np (0.38ng), 2E-6Bq for 232Th (0.50ng), 4E-5Bq for 235U (0.50ng) and 6E-6Bq for 238U (0.48ng). 1.3 This standard does not purport to address all of the safety problems, if any, associated with its use. It is the responsibility of the user of this standard to establish appropriate safety and health practices and determine the applicability of regulatory limitations prior to use.

  7. Sequential Injection Method for Rapid and Simultaneous Determination of 236U, 237Np, and Pu Isotopes in Seawater

    DEFF Research Database (Denmark)

    Qiao, Jixin; Hou, Xiaolin; Steier, Peter

    2013-01-01

    target analytes, whereupon plutonium and neptunium were simultaneously isolated and purified on TEVA, while uranium was collected on UTEVA. The separation behavior of U, Np, and Pu on TEVA–UTEVA columns was investigated in detail in order to achieve high chemical yields and complete purification...... for the radionuclides of interest. 242Pu was used as a chemical yield tracer for both plutonium and neptunium. 238U was quantified in the sample before the separation for deducing the 236U concentration from the measured 236U/238U atomic ratio in the separated uranium target using accelerator mass spectrometry....... Plutonium isotopes and 237Np were measured using inductively coupled plasma mass spectrometry after separation. The analytical results indicate that the developed method is robust and efficient, providing satisfactory chemical yields (70–100%) of target analytes and relatively short analytical time (8 h/sample)....

  8. VALIDACIÓN DE UN PROGRAMA EDUCATIVO PARA MEJORAR EL CONOCIMIENTO DE LAS MADRES DE FAMILIA SOBRE LA SALUD BUCAL EN LA INSTITUCIÓN EDUCATIVA INICIAL N° 237 LA RINCONADA, AYAVIRI-PUNO 2015.

    OpenAIRE

    TAPIA TAPIA, RAXONA MARY

    2016-01-01

    El presente trabajo de investigación intitulado “Validación de un programa educativo para mejorar el conocimiento de las madres de familia sobre salud bucal en la Institución Educativa Inicial N° 237 la Rinconada, Ayaviri Puno 2015”. Tuvo como objetivo identificar el conocimiento de las madres de familia de la Institución Educativa Inicial N° 237 la Rinconada sobre Salud Bucal antes del programa educativo, identificar el conocimiento de las madres de familia de la Institución E...

  9. Modelling Neutron-induced Reactions on 232-237U from 10 keV up to 30 MeV

    Science.gov (United States)

    Sin, M.; Capote, R.; Herman, M. W.; Trkov, A.

    2017-01-01

    Comprehensive calculations of cross sections for neutron-induced reactions on 232-237U targets are performed in the 10 keV-30 MeV incident energy range with the code EMPIRE-3.2 Malta. The advanced modelling and consistent calculation scheme are aimed at improving our knowledge of the neutron scattering and emission cross sections, and to assess the consistency of available evaluated libraries for light uranium isotopes. The reaction model considers a dispersive optical potential (RIPL 2408) that couples from five (even targets) to nine (odd targets) levels of the ground-state rotational band, and a triple-humped fission barrier with absorption in the wells described within the optical model for fission. A modified Lorentzian model (MLO) of the radiative strength function and Enhanced Generalized Superfluid Model nuclear level densities are used in Hauser-Feschbach calculations of the compound-nuclear decay that include width fluctuation corrections. The starting values for the model parameters are retrieved from RIPL. Excellent agreement with available experimental data for neutron emission and fission is achieved, giving confidence that the quantities for which there is no experimental information are also accurately predicted. Deficiencies in existing evaluated libraries are highlighted.

  10. Capture and Fission rate of 232-Th, 238-U, 237-Np and 239-Pu from spallation neutrons in a huge block of lead.

    CERN Document Server

    Vlachoudis, Vasilis

    2000-01-01

    The study is centered on the research of the incineration possibility of nuclear waste, by the association of a particle accelerator with a multiplying medium of neutrons, in the project "Energy Amplifier" of C. Rubbia. It consists of the experimental determination of the rates of capture and fission of certain elements (232-Th, 238-U, 237-Np and 239-Pu) subjected to a fluence of fast spallation neutrons. These neutrons are produced by the interaction of high kinetic energy protons (several GeV) provided by the CERN-PS accelerator, on a large lead solid volume. The measurement techniques used in this work, are based on the activation of elements in the lead volume and the subsequent gamma spectroscopy of the activated elements, and also by the detection of fission fragment traces. The development, of a Monte Carlo code makes it possible, on one hand, to better understand the relevant processes, and on the other hand, to validate the code, by comparison with measurements, for the design and the construction of...

  11. South Equatorial Current (SEC) driven changes at DSDP Site 237, Central Indian Ocean, during the Plio-Pleistocene: Evidence from Benthic Foraminifera and Stable Isotopes

    Science.gov (United States)

    Gupta, Anil K.; Das, Moumita; Bhaskar, K.

    2006-12-01

    This study attempts to analyse paleoceanographic changes in the Central Indian Ocean (Deep Sea Drilling Project Site 237), linked to monsoon variability as well as deep-sea circulation during the Plio-Pleistocene. We used factor and cluster analyses of census data of the 34 most dominant species of benthic foraminifera that enabled us to identify five biofacies: Astrononion umbilicatulum- Uvigerina proboscidea (Au-Up), Pullenia bulloides- Bulimina striata (Pb-Bs), Globocassidulina tumida- Nuttallides umbonifera (Gt-Nu), Gyroidinoides nitidula- Cibicides wuellerstorfi (Gn-Cw) and Cassidulina carinata- Cassidulina laevigata (Cc-Cl) biofacies. Knowledge of the environmental preferences of modern deep-sea benthic foraminifera helped to interpret the results of factor and cluster analyses in combination with oxygen and carbon isotope values. The biofacies indicative of high surface productivity, resulting from a stronger South Equatorial Current (Au-Up and Pb-Bs biofacies), dominate the early Pliocene interval (5.6-4.5 Ma) of global warmth. An intense Indo-Pacific 'biogenic bloom' and strong Oxygen Minimum Zone extended to intermediate depths (˜1000-2000 m) over large parts of the Indian Ocean in the early Pliocene. Since 4.5 Ma, the food supply in the Central Indian Ocean dropped and fluctuated while deep waters were corrosive (biofacies Gt-Nu, Gn-Cw). The Pleistocene interval is characterized by an intermediate flux of organic matter (Cc-Cl biofacies).

  12. Accurate 238U(n , 2 n )237U reaction cross-section measurements from 6.5 to 14.8 MeV

    Science.gov (United States)

    Krishichayan, Bhike, M.; Tornow, W.; Tonchev, A. P.; Kawano, T.

    2017-10-01

    The cross section for the 238U(n ,2 n )237U reaction has been measured in the incident neutron energy range from 6.5 to 14.8 MeV in small energy steps using an activation technique. Monoenergetic neutron beams were produced via the 2H(d ,n )3He and 3H(d ,n )4He reactions. 238U targets were activated along with Au and Al monitor foils to determine the incident neutron flux. The activity of the reaction products was measured in TUNL's low-background counting facility using high-resolution γ -ray spectroscopy. The results are compared with previous measurements and latest data evaluations. Statistical-model calculations, based on the Hauser-Feshbach formalism, have been carried out using the CoH3 code and are compared with the experimental results. The present self-consistent and high-quality data are important for stockpile stewardship and nuclear forensic purposes as well as for the design and operation of fast reactors.

  13. Study of the excited levels of 233{sup P}a by the 237{sup N}p alpha decay; Estudio de los niveles excitados en el 233{sup P}a por la desintegracion alfa del 237{sup N}p

    Energy Technology Data Exchange (ETDEWEB)

    Gonzalez, J.; Gaeta, R.; Vano, E.; Los Arcos, J. M.

    1978-07-01

    The excited levels in 233{sup P}a following the 237{sup N}p alpha decay have been studied, by performing different experiences to complete available data and supply new information. Thus, two direct alpha spectrum measurement, one alpha-gamma bidimensional coincidence experiment, three gamma-gamma and gamma-X ray coincidences and some other measurements of the gamma spectrum, direct and coincident with alpha-particles have been made. These last experiences have allowed to obviate usual radiochemical separation methods, the 233{sup P}a radioactive descendent interferences being eliminated by means of the coincidence technic. As a result, a primary decay scheme has been elaborated, including 15 new gamma transitions and two new levels, not observed in the most recent works. (Author) 60 refs.

  14. Determination of neutron resonance parameters of Neptunium 237 between 0 and 500 eV. The covariance matrices of statistical and of systematic origin, relating the resonance parameters, are also given; Determination des parametres des resonances neutroniques du neptunium 237, en dessous de 500eV, et obtention des matrices de covariances statistiques et systematiques entre les parametres de ces resonances

    Energy Technology Data Exchange (ETDEWEB)

    Lepretre, A.; Herault, N. [CEA Saclay, Dept. d' Astrophysique de Physique des Particules, de Physique Nucleaire et de l' Instrumentation Associee, 91- Gif sur Yvette (France); Brusegan, A.; Noguere, G.; Siegler, P. [Institut des Materiaux et des Metrologies - IRMM, Joint Research Centre, Gell (Belgium)

    2002-12-01

    This report is a follow up of the report CEA DAPNIA/SPHN-99-04T of Vincent Gressier. In the frame of a collaboration between the 'Commissariat a l'Energie Atomique (CEA)' and the Institute for Reference Materials and Measurement (IRMM, Geel, Belgique), the resonance parameters of neptunium 237 have been determined in the energy interval between 0 and 500 eV. These parameters have been obtained by using the Refit code in analysing simultaneously three transmission experiments. The covariance matrix of statistical origin is provided. A new method, based on various sensitivity studies is proposed for determining also the covariance matrix of systematic origin, relating the resonance parameters. From an experimental viewpoint, the study indicated that, with a large probability, the background spectrum has structure. A two dimensional profiler for the neutron density has been proved feasible. Such a profiler could, among others, demonstrate the existence of the structured background. (authors)

  15. Prevalence, distribution and functional significance of the -237C to T polymorphism in the IL-12Rβ2 promoter in Indian tuberculosis patients.

    Directory of Open Access Journals (Sweden)

    Vikas Kumar Verma

    Full Text Available Cytokine/cytokine receptor gene polymorphisms related to structure/expression could impact immune response. Hence, the -237 polymorphic site in the 5' promoter region of the IL-12Rβ2 (SNP ID: rs11810249 gene associated with the AP-4 transcription motif GAGCTG, was examined. Amplicons encompassing the polymorphism were generated from 46 pulmonary tuberculosis patients, 35 family contacts and 28 miscellaneous volunteers and sequenced. The C allele predominated among patients, (93.4%, 43/46, and in all volunteers and contacts screened, but the T allele was exclusively limited to patients, (6.5%, 3/46. The functional impact of this polymorphism on transcriptional activity was assessed by Luciferase-reporter and electrophoretic mobility shift assays (EMSA. Luciferase-reporter assays showed a significant reduction in transcriptional efficiency with T compared to C allele. The reduction in transcriptional efficiency with the T allele construct (pGIL-12Rb2-T, in U-87MG, THP-1 and Jurkat cell lines, were 53, 37.6, and 49.8% respectively, compared to the C allele construct (pGIL-12Rb2-C. Similarly, densitometric analysis of the EMSA assay showed reduced binding of the AP-4 transcription factor, to T compared to the C nucleotide probe. Reduced mRNA expression in all patients (3/3 harboring the T allele was seen, whereas individuals with the C allele exhibited high mRNA expression (17/25; 68%, p = 0.05. These observations were in agreement with the in vitro assessment of the promoter activity by Luciferase-reporter and EMSA assays. The reduced expression of IL-12Rβ2 transcripts in 8 patients despite having the C allele was attributed to the predominant over expression of the suppressors (IL-4 and GATA-3 and reduced expression of enhancers (IFN-α of IL-12Rβ2 transcripts. The 17 high IL-12Rβ2 mRNA expressers had significantly elevated IFN-α mRNA levels compared to low expressers and volunteers. Notwithstanding the presence of high levels of IL-12R

  16. Automated absolute activation analysis with californium-252 sources

    Energy Technology Data Exchange (ETDEWEB)

    MacMurdo, K.W.; Bowman, W.W.

    1978-09-01

    A 100-mg /sup 252/Cf neutron activation analysis facility is used routinely at the Savannah River Laboratory for multielement analysis of many solid and liquid samples. An absolute analysis technique converts counting data directly to elemental concentration without the use of classical comparative standards and flux monitors. With the totally automated pneumatic sample transfer system, cyclic irradiation-decay-count regimes can be pre-selected for up to 40 samples, and samples can be analyzed with the facility unattended. An automatic data control system starts and stops a high-resolution gamma-ray spectrometer and/or a delayed-neutron detector; the system also stores data and controls output modes. Gamma ray data are reduced by three main programs in the IBM 360/195 computer: the 4096-channel spectrum and pertinent experimental timing, counting, and sample data are stored on magnetic tape; the spectrum is then reduced to a list of significant photopeak energies, integrated areas, and their associated statistical errors; and the third program assigns gamma ray photopeaks to the appropriate neutron activation product(s) by comparing photopeak energies to tabulated gamma ray energies. Photopeak areas are then converted to elemental concentration by using experimental timing and sample data, calculated elemental neutron capture rates, absolute detector efficiencies, and absolute spectroscopic decay data. Calculational procedures have been developed so that fissile material can be analyzed by cyclic neutron activation and delayed-neutron counting procedures. These calculations are based on a 6 half-life group model of delayed neutron emission; calculations include corrections for delayed neutron interference from /sup 17/O. Detection sensitivities of < or = 400 ppB for natural uranium and 8 ppB (< or = 0.5 (nCi/g)) for /sup 239/Pu were demonstrated with 15-g samples at a throughput of up to 140 per day. Over 40 elements can be detected at the sub-ppM level.

  17. Metastable charge-transfer state of californium(iii) compounds.

    Science.gov (United States)

    Liu, Guokui; Cary, Samantha K; Albrecht-Schmitt, Thomas E

    2015-06-28

    Among a series of anomalous physical and chemical properties of Cf(iii) compounds revealed by recent investigations, the present work addresses the characteristics of the optical spectra of An(HDPA)3·H2O (An = Am, Cm, and Cf), especially the broadband photoluminescence from Cf(HDPA)3·H2O induced by ligand-to-metal charge transfer (CT). As a result of strong ion-ligand interactions and the relative ease of reducing Cf(iii) to Cf(ii), a CT transition occurs at low energy (transfer state undergoes radiative and non-radiative relaxations. Broadening of the CT transition arises from strong vibronic coupling and hole-charge interactions in the valence band. The non-radiative relaxation of the metastable CT state results from a competition between phonon-relaxation and thermal tunneling that populates the excited states of Cf(iii).

  18. Measurement of neutron-induced fission cross-sections of Th232, U238, U233 and Np237 relative to U235 from 1 MeV to 200 MeV

    Energy Technology Data Exchange (ETDEWEB)

    Shcherbakov, O.A.; Laptev, A.B.; Petrov, G.A. [Petersburg Nuclear Physics Inst., Gatchina, Leningrad district (Russian Federation); Fomichev, A.V.; Donets, A.Y.; Osetrov, O.I.

    1998-11-01

    The measurements of neutron-induced cross-section ratios for Th232, U238, U233 and Np237 relative to U235 have been carried out in the energy range from 1 MeV up to 200 MeV using the neutron time-of-flight spectrometer GNEIS based on 1 GeV proton synchrocyclotron. Below 20 MeV, the results of present measurements are roughly in agreement with evaluated data though there are some discrepances to be resolved. (author)

  19. Measurement of the Neutron Capture Cross Sections of $^{233}$U, $^{237}$Np, $^{240,242}$Pu, $^{241,243}$Am and $^{245}$Cm with a Total Absorption Calorimeter at n_TOF

    CERN Multimedia

    Beer, H; Wiescher, M; Cox, J; Rapp, W; Embid, M; Dababneh, S

    2002-01-01

    Accurate and reliable neutron capture cross section data for actinides are necessary for the poper design, safety regulation and precise performance assessment of transmutation devices such as Fast Critical Reactors or Accelerator Driven Systems (ADS). The goal of this proposal is the measurement of the neutron capture cross sections of $^{233}$U, $^{237}$Np, $^{240,242}$Pu, $^{241,243}$Am and $^{245}$Cm at n_TOF with an accuracy of 5~\\%. $^{233}$U plays an essential role in the Th fuel cycle, which has been proposed as a safer and cleaner alternative to the U fuel cycle. The capture cross sections of $^{237}$Np,$^{240,242}$Pu, $^{241,243}$Am and $^{245}$Cm play a key role in the design and optimization of a strategy for the Nuclear Waste Transmutation. A high accuracy can be achieved at n_TOF in such measurements due to a combination of features unique in the world: high instantaneous neutron fluence and excellent energy resolution of the facility, innovative Data Acquisition System based on flash ADCs and t...

  20. Investigation of Neutron Spectra and Transmutation of ^{129}I, ^{237}Np and Other Nuclides with 1.5 GeV Protons from the Dubna Nuclotron Using the Electronuclear Setup "Energy plus Transmutation"

    CERN Document Server

    Krivopustov, M I; Balabekyan, A R; Batusov, Yu A; Bielewicz, M; Brandt, R; Chaloun, P; Chultem, D; Dwivedi, K K; Elishev, A F; Fragopoulou, M; Henzl, V; Henzlová, D; Kalinnikov, V G; Kievets, M K; Krása, A; Krizek, F; Kugler, A; Manolopoulou, Metaxia; Mariin, I I; Nourreddine, A; Odoj, R; Pavliouk, A V; Pronskikh, V S; Robotham, H; Siemon, K; Szuta, M; Stegailov, V I; Solnyshkin, A A; Sosnin, A N; Stoulos, S; Tsoupko-Sitnikov, V M; Tumendelger, T; Wojecehowski, A; Wagner, V; Wan, J S; Westmeier, W; Zamani-Valasiadou, M; Kumawat, H; Kumar, V; Zaverioukha, O S; Zhuk, I V

    2004-01-01

    Experiments which are part of the scientific program "Investigations of physical aspects of electronuclear method of energy production and transmutation for radioactive waste of atomic energetics using relativistic beams from the JINR Synchrophasotron/Nuclotron" (project "Energy plus Transmutation") are described. A large lead target surrounded by a four-section uranium blanket with total weight of 206.4 kg natural uranium was irradiated with 1.5 GeV protons from the new cryogenic accelerator Nuclotron. Radiochemical sensors were exposed to the secondary particle fluences inside and on top of the target assembly. Two long-lived radioactive waste of atomic energetics sensors ^{129}I and ^{237}Np (approximately 1 g weight each) and stable nuclides ^{27}Al, ^{59}Co, ^{127}I, ^{139}La, ^{197}Au and ^{209}Bi as well as natural and enriched uranium were used. In addition, various solid state nuclear track detectors and nuclear emulsions were exposed simultaneously. The experimental results confirm the theoretical e...

  1. Measurement of the average energy and multiplicity of prompt-fission neutrons from {sup 238}U(n,f) and {sup 237}Np(n,f) from 1 to 200 MeV

    Energy Technology Data Exchange (ETDEWEB)

    Taieb, J.; Granier, T.; Ethvignot, T. [CEA Bruyeres-le-Chatel (DPTA/SPN), 91 (France). Dept. de Physique Theorique et Appliquee; Devlin, M.; Haight, R.C.; Nelson, R.O.; O' Donnell, J.M. [Los Alamos National Laboratory, LANSCE, MS H855, Los Alamos, New Mexico (United States); Rochman, D. [Brookhaven National Laboratory (NNDC), Upton, NY (United States)

    2008-07-01

    Taking advantage of the neutron source of the LANCSE, it has been possible to obtain a measure of the velocity distribution and the number of prompt-neutrons emitted in the neutron-induced fission of {sup 238}U and {sup 237}Np over a broad incident neutron energy range from 1 to 200 MeV. The mean kinetic energy was extracted and is shown as a function of the incident-neutron energy. We confirm here the observation, for both reactions, of a dip around the second-chance fission which is explained by the lower kinetic energy of the pre-fission neutrons. Such a observation is reproduced by Los Alamos model and by the Maslov model. As far as the neutron multiplicity is concerned, a similar dip is observed. (authors)

  2. Wind-tunnel investigation of aerodynamic loading on a 0.237-scale model of a remotely piloted research vehicle with a thick, high-aspect-ratio supercritical wing

    Science.gov (United States)

    Byrdsong, T. A.; Brooks, C. W., Jr.

    1983-01-01

    Wind-tunnel measurements were made of the wing-surface static-pressure distributions on a 0.237 scale model of a remotely piloted research vehicle equipped with a thick, high-aspect-ratio supercritical wing. Data are presented for two model configurations (with and without a ventral pod) at Mach numbers from 0.70 to 0.92 at angles of attack from -4 deg to 8 deg. Large variations of wing-surface local pressure distributions were developed; however, the characteristic supercritical-wing pressure distribution occurred near the design condition of 0.80 Mach number and 2 deg angle of attack. The significant variations of the local pressure distributions indicated pronounced shock-wave movements that were highly sensitive to angle of attack and Mach number. The effect of the vertical pod varied with test conditions; however at the higher Mach numbers, the effects on wing flow characteristics were significant at semispan stations as far outboard as 0.815. There were large variations of the wing loading in the range of test conditions, both model configurations exhibited a well-defined peak value of normal-force coefficient at the cruise angle of attack (2 deg) and Mach number (0.80).

  3. 237-IJBCS-Article-Dr Traore

    African Journals Online (AJOL)

    Dr Gatsing

    Sahel. However, the long term effects of substrates are to be assessed. ... Keywords: Water, Sahel, aquatic invading plants, raw and composted substrate, yield benefit. INTRODUCTION. Cotton is .... MF*: Mineral Fertilization corresponds to 0.133 g/pot of complex fertilizer NPKSB and 0.133 g/pot of urea with maize and 0.13 ...

  4. 237-IJBCS-Article-Dr Traore

    African Journals Online (AJOL)

    Dr Gatsing

    Original Paper http://indexmedicus.afro.who.int. Characterization of three invading aquatic plants in Burkina Faso and their possible use for crop production. Ouola TRAORE 1 *, Karim TRAORE 1 and Adiza YAYE 2. 1 Institut de l'Environnement et de Recherches Agricoles (INERA), Station de Farako-Bâ 01 BP 910 Bobo-.

  5. 48 CFR 237.7601 - Definitions.

    Science.gov (United States)

    2010-10-01

    ... provided by a firm or individual under contract to DoD to support mission-essential functions, such as support of vital systems, including ships owned, leased, or operated in support of military missions or... commander or equivalent. Mission-essential functions means those organizational activities that must be...

  6. Publications | Page 237 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Cigarette taxation in Tanzania : final technical report (open access). Taxation has proved to be the single most effective tool in reducing tobacco consumption and smoking prevalence. The research aims to reduce tobacco use while increasing government revenue in Tanzania through an appropriate taxation policy; to use ...

  7. 48 CFR 237.7602 - Policy.

    Science.gov (United States)

    2010-10-01

    ... terms and conditions of their contracts, during periods of crisis. As a general rule, the designation of services as essential contractor services will not apply to an entire contract but will apply only to those... DEFENSE SPECIAL CATEGORIES OF CONTRACTING SERVICE CONTRACTING CONTINUATION OF ESSENTIAL CONTRACTOR...

  8. 33 CFR 117.237 - Christina River.

    Science.gov (United States)

    2010-07-01

    ... five short blasts, and an audio voice warning stating, “Attention, Attention. Norfolk Southern Railroad... infrared detectors, until green lights are displayed on the swing span. (c) The draw of the Third Street...

  9. TMFunction data: 237 [TMFunction[Archive

    Lifescience Database Archive (English)

    Full Text Available HC. J Biol Chem. 2000 Jul 14;275(28):21017-24 mutagenesis ... affinity chromatography 1AJJ ... LDLR_HUMAN (P01130) Helix ... ligand binding site; surface exposed; acidic residue; conserved

  10. Publications | Page 237 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    restricted access). The Ministry of ... This paper considers the relationship between the social and the academic in students'' communication networks with reference to specific technologies: the computer and the cell phone. Previous research ...

  11. 32 CFR 237a.4 - Procedures.

    Science.gov (United States)

    2010-07-01

    ... Government's interest. (3) Jointly sponsored events. Joint DoD-industry sponsorship may be desirable in...., projected at least forty-five (45) days, for the “Calendar of Events.” (2) Each DoD component will designate... events—(1) Industry-sponsored events. (i) DoD components are encouraged to cooperate with and assist...

  12. Publications | Page 237 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Mainstreaming climate change impact in the design of urban drainage infrastructures : a case study of Addis Ababa (Arat kilo-Kebena road) (restricted access). To build sustainable drainage systems, designers need to incorporate future climatic conditions into their computation of design. The most urgent problem for many ...

  13. Neutron Protection Factor Determination and Validation for a Vehicle Surrogate Using a Californium Fission Source

    Science.gov (United States)

    2017-06-01

    a 4 mm x 4 mm (0.157" x 0.157") LiI(Eu) crystal with 96% enrichment of lithium -6. The crystal is connected to a photomultiplier tube (PMT) which...32 Figure 17. Lithium -6 Iodide, Europium Doped Scintillation Detector. Source: [27...Alamos National Laboratory LiI(Eu) Lithium Iodide Europium Doped LLD Low Level Discriminator LLNL Lawrence Livermore National Laboratory MASH Monte

  14. 237 Interrogating Nollywood and its Sources of Funding: The Case ...

    African Journals Online (AJOL)

    other established film hubs around the globe, corporate interests and government incentives supersedes individual efforts upon which Nollywood prides its enterprise. ...... LANCELOT: if I understand you very well because we spoke yesterday, set and props for INVASION 1897 was about three million six hundred thousand ...

  15. Dicty_cDB: SFI237 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available sae68c10.y1 Gm-c1064 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1064-3212 5' similar to TR:O65744...saf75f12.y1 Gm-c1078 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1078-2184 5' similar to TR:O65744...sa37e09.y1 Gm-c1004 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1004-1505 5' similar to TR:O24653...sq98c12.y1 Gm-c1049 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1049-1199 5' similar to TR:O65744...sg79d05.y1 Gm-c1007 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1007-2626 5' similar to TR:O65744

  16. 48 CFR 252.237-7017 - Individual laundry.

    Science.gov (United States)

    2010-10-01

    ... contract on both a unit bundle and on a piece-rate bundle basis for individual personnel. (b) The total... services. (c) Charges for individual laundry will be on a per unit bundle or a piece-rate basis. The... whether the laundry is a unit bundle or a piece-rate bundle. An individual laundry bundle will be...

  17. Dicty_cDB: VHH237 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SDGKPTFLSTTIKNETDSIIVVLNLPHCTKECLIDPDFSLLVDPQFKPECESKSRKWVVP VAVVVSVVGFSGLAVAGFILYKKQSIAIKVQIHKLKRFNQD*m*yy...SDGKPTFLSTTIKNETDSIIVVLNLPHCTKECLIDPDFSLLVDPQFKPECESKSRKWVVP VAVVVSVVGFSGLAVAGFILYKKQSIAIKVQIHKLKRFNQD*m*yy

  18. Dicty_cDB: AFL237 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Translated Amino Acid sequence ff*th*HINNIYLSIHTPKVFILMAEITISIENENFIQVNLQPDQTVEDLKRRVEFETTI LVNNQVLTLDG...LKEILNKEQNDLEEDTKKAXANSL Frame B: ff*th*HINNIYLSIHTPKVFILMAEITISIENENFIQVNLQPDQTVEDLKRRVEFETTI LVNNQVLTLDG

  19. 7 CFR 58.237 - Condensed surge supply.

    Science.gov (United States)

    2010-01-01

    ... Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Standards, Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE (CONTINUED) REGULATIONS AND STANDARDS UNDER THE AGRICULTURAL MARKETING ACT OF 1946 AND THE EGG PRODUCTS INSPECTION ACT (CONTINUED) GRADING AND INSPECTION...

  20. Dicty_cDB: VSF237 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available mRNA sequence. 40 0.009 2 BU574126 |BU574126.1 PA__Ea0006F03f Almond developing seed Prunus dulcis cDNA clo...ne PA__Ea0006F03f, mRNA sequence. 52 0.010 1 BU044788 |BU044788.1 PP_LEa0020I02f Peach developing... |BU042820.1 PP_LEa0014B11f Peach developing fruit mesocarp Prunus persica cDNA clone PP_LEa0014B11f, mRNA s

  1. 48 CFR 1852.237-72 - Access to Sensitive Information.

    Science.gov (United States)

    2010-10-01

    ... currently in the public domain, and which may embody trade secrets or commercial or financial information... and administrative functions, the Contractor shall provide the services specified elsewhere in this... relation to the mandates and restrictions found in these laws and regulations. Unauthorized uses or...

  2. 7 CFR 2.37 - Chief Information Officer.

    Science.gov (United States)

    2010-01-01

    ... architecture. (5) Promoting the effective and efficient design and operation of all major information resources... system acquisition under OMB Circular A-109. (9) On an annual basis: (i) Assessing Departmentwide... assessing the burden to the public and costs to the Department of information requirements contained in...

  3. Dicty_cDB: VFF237 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Translated Amino Acid sequence NNIKMISLEDLSPTLWKSPDKEGELKKQGHVVKNWKKRKFIIQNDMLFYFKDKEERPVGA VPLRMSRCYENK...pif*nilswiwhviplnlnh*fkpqemfnlcrl Frame B: NNIKMISLEDLSPTLWKSPDKEGELKKQGHVVKNWKKRKFIIQNDMLFYFKDKEERPVGA VPLRMSRCYENK

  4. Dicty_cDB: VHC237 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available YNLSKLQDPRIEKLPYSIRILLES AVRNCDNFEVHEKDVENILNWENTANKVEIPFKPARVLLQDFTGVPAVVDLAAMRDAMKR LGGDPAKINPLVPV...YNLSKLQDPRIEKLPYSIRILLES AVRNCDNFEVHEKDVENILNWENTANKVEIPFKPARVLLQDFTGVPAVVDLAAMRDAMKR LGGDPAKINPLVPV

  5. Dicty_cDB: AFM237 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available pmfrc*iwqtys cvtn**yhrrsqwqsl*slpqtilfrslpssp*g*lifstwwyesrri*scrnrpr*ily rctrdiytl*r*gsqerg*rpsr*gwlr*--- ---mcfvl**vg*xctxxrf...itr*cwwcw**syqsnfn*ngwyerqexrfhhwcyq*try hrssyppsrsfrsthlhsitr...ftiscchxqglxq*ixsrqgcrfxifgskxsrfxwxrfn *nlstcl*isys*ih*kgy*ixqspsxiw*xqxgx*lcrsxtrnys*slpxsheicssfx ir**y*k

  6. 48 CFR 552.237-71 - Qualifications of Employees.

    Science.gov (United States)

    2010-10-01

    ... fingerprinted. (c) Each employee of the Contractor shall be a citizen of the United States of America, or an... Card Form I-151, or, who presents other evidence from the Immigration and Naturalization Service that employment will not affect his immigration status. (End of clause) ...

  7. 48 CFR 1252.237-70 - Qualifications of contractor employees.

    Science.gov (United States)

    2010-10-01

    ... ensure that contractor employees are: (1) Citizens of the United States of America or an alien who has been lawfully admitted for permanent residence or employment (indicated by immigration status) as evidenced Bureau of Citizenship and Immigration Services documentation; and (2) Have background...

  8. 237 Missionary Historiography: A Factor for the Emergence of ...

    African Journals Online (AJOL)

    User

    2012-01-24

    Jan 24, 2012 ... clarifications of these factors may in some way facilitate the understanding of origin of nationalism in Africa, which is ... For the missionaries, the social change the people's pattern of response to the missionary propaganda, the rate and ... enterprise and thus offered resistance. Ayandele demonstrated also ...

  9. 48 CFR 1552.237-71 - Technical direction.

    Science.gov (United States)

    2010-10-01

    ... Technical direction. As prescribed in 1537.110, insert a clause substantially the same as the following..., delivery order, or any other document issued by the contracting officer to order work under a service.... (d) Technical direction will be issued in writing or confirmed in writing within five (5) days after...

  10. Dicty_cDB: SSL237 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 00384_3475( CP000384 |pid:none) Mycobacterium sp. MCS, complete... 38 0.13 DQ418879_1( DQ418879 |pid:none) Glycine max cultivar Resni...ck senes... 37 0.28 AP007164_779( AP007164 |pid:none) Aspergillus oryzae RIB40 geno

  11. 237 Interrogating Nollywood and its Sources of Funding: The Case ...

    African Journals Online (AJOL)

    introduction of SAP and Capital Market. Deregulation, it now swings between N1m and. N2.5m. as a result of its inability to recover outstanding loans, the NFDC/NFC has found it impossible to advance loans to local film makers since mid-80s. The NFC has now shifted its attention to in-house productions and support for.

  12. 48 CFR 1252.237-72 - Prohibition on advertising.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Prohibition on advertising... Prohibition on advertising. As prescribed in (TAR) 48 CFR 1213.7101 and 1237.7003, insert the following clause: Prohibition on Advertising (JAN 1996) The contractor or its representatives (including training instructors...

  13. Dicty_cDB: AHA237 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 9e-29 AF016833_1( AF016833 |pid:none) Homo sapiens maltase-glucoamylase ... 130 1e-28 EU955937_1( EU955937...Os06g0675700; ... 129 3e-28 ( O43451 ) RecName: Full=Maltase-glucoamylase, intestinal; Include... 128 4e-28

  14. Measurements of the neutron capture cross sections and incineration potentials of minor-actinides in high thermal neutron fluxes: Impact on the transmutation of nuclear wastes; Mesures des sections efficaces de capture et potentiels d'incineration des actinides mineurs dans les hauts flux de neutrons: Impact sur la transmutation des dechets

    Energy Technology Data Exchange (ETDEWEB)

    Bringer, O

    2007-10-15

    This thesis comes within the framework of minor-actinide nuclear transmutation studies. First of all, we have evaluated the impact of minor actinide nuclear data uncertainties within the cases of {sup 241}Am and {sup 237}Np incineration in three different reactor spectra: EFR (fast), GT-MHR (epithermal) and HI-HWR (thermal). The nuclear parameters which give the highest uncertainties were thus highlighted. As a result of fact, we have tried to reduce data uncertainties, in the thermal energy region, for one part of them through experimental campaigns in the moderated high intensity neutron fluxes of ILL reactor (Grenoble). These measurements were focused onto the incineration and transmutation of the americium-241, the curium-244 and the californium-249 isotopes. Finally, the values of 12 different cross sections and the {sup 241}Am isomeric branching ratio were precisely measured at thermal energy point. (author)

  15. Pu236(n,f) , Pu237(n,f) , and Pu238(n,f) cross sections deduced from (p,t) , (p,d) , and (p,p') surrogate reactions

    Energy Technology Data Exchange (ETDEWEB)

    Hughes, R. O. [Univ. of Richmond, VA (United States); Beausang, C. W. [Univ. of Richmond, VA (United States); Ross, T. J. [Univ. of Richmond, VA (United States); Burke, J. T. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Casperson, R. J. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Cooper, N. [Yale Univ., New Haven, CT (United States); Escher, J. E. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Gell, K. [Univ. of Richmond, VA (United States); Good, E. [Univ. of Richmond, VA (United States); Humby, P. [Yale Univ., New Haven, CT (United States); McCleskey, M. [Texas A & M Univ., College Station, TX (United States); Saastimoinen, A. [Texas A & M Univ., College Station, TX (United States); Tarlow, T. D. [Univ. of Richmond, VA (United States); Thompson, I. J. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

    2014-07-01

    The Pu236(n,f), Pu237(n,f) and Pu238(n,f) cross sections have been inferred by utilizing the surrogate ratio method. Targets of Pu239 and U235 were bombarded with 28.5-MeV protons, and the light ion recoils, as well as fission fragments, were detected using the STARS detector array at the K150 Cyclotron at the Texas A&M cyclotron facility. The (p, tf) reaction on Pu239 and U235 targets was used to deduce the σ (Pu236(n,f))/σ(U232(n,f)) ratio, and the Pu236(n,f) cross section was subsequently determined for En=0.5–7.5 MeV. Similarly, the (p,df) reaction on the same two targets was used to deduce the σ(Pu237(n,f))/σ(U233(n,f)) ratio, and the Pu237(n,f) cross section was extracted in the energy range En=0.5–7 MeV. The Pu238(n,f) cross section was also deduced by utilizing the (p,p') reaction channel on the same targets. There is good agreement with the recent ENDF/B-VII.1 evaluated cross section data for Pu238(n,f) in the range En=0.5–10.5 MeV and for Pu237(n,f) in the range En=0.5–7 MeV; however, the Pu236(n,f) cross section deduced in the present work is higher than the evaluation between 2 and 7 MeV.

  16. A retrospective study of californium-252 neutron brachytherapy combined with EBRT versus 3D-CRT in the treatment of esophageal squamous cell cancer.

    Science.gov (United States)

    Wang, Qifeng; Li, Tao; Lang, Jinyi; Wang, Jie; Wang, Jian; Liu, Huiming; Jia, Xitang; Liu, Bo; Wang, C-K Chris

    2015-10-24

    We conducted a retrospective analysis on 884 patients who were diagnosed with esophageal squamous cell carcinoma (ESCC) and treated with either the neutron brachytherapy in combination with external beam radiotherapy (NBT + EBRT) or 3-dimensional conformal radiation therapy (3D-CRT) to determine the differences in efficacy and morbidity between the two treatment groups. The 884 ESCC patients treated with either NBT + EBRT or 3D-CRT between 2002 and 2012 were retrospectively reviewed and analyzed. Multivariable Cox regression was used to compare oncologic outcomes of the two groups of patients in the context of other clinically relevant variables. The acute and chronic toxicities associated with the two groups were compared using Fisher exact and log-rank tests, respectively. Among the 884 patients, 545 received NBT + EBRT and 339 received 3D-CRT (i.e. EBRT-only). The age range is 39-95 years (median 66). The follow-up time range is 3-145 months (median 32). The analysis shows that the NBT + EBRT group has higher overall survival rate and local control rate than that of the 3D-CRT group. The acute toxicity effects were acceptable for both groups of patients with the NBT + EBRT group showing higher rates of leukopenia and thrombocytopenia and the 3D-CRT group showing higher rates on fistula and massive bleeding. The patients treated with NBT + EBRT showed better oncologic outcomes than those treated with 3D-CRT. The toxicity effects were acceptable for both groups with the NBT + EBRT group showing higher rates on the acute effects and the 3D-CRT group showing higher rates on the late effects.

  17. Accurate determination of Curium and Californium isotopic ratios by inductively coupled plasma quadrupole mass spectrometry (ICP-QMS) in 248Cm samples for transmutation studies

    Energy Technology Data Exchange (ETDEWEB)

    Gourgiotis, A.; Isnard, H.; Aubert, M.; Dupont, E.; AlMahamid, I.; Cassette, P.; Panebianco, S.; Letourneau, A.; Chartier, F.; Tian, G.; Rao, L.; Lukens, W.

    2011-02-01

    The French Atomic Energy Commission has carried out several experiments including the mini-INCA (INcineration of Actinides) project for the study of minor-actinide transmutation processes in high intensity thermal neutron fluxes, in view of proposing solutions to reduce the radiotoxicity of long-lived nuclear wastes. In this context, a Cm sample enriched in {sup 248}Cm ({approx}97 %) was irradiated in thermal neutron flux at the High Flux Reactor (HFR) of the Laue-Langevin Institute (ILL). This work describes a quadrupole ICP-MS (ICP-QMS) analytical procedure for precise and accurate isotopic composition determination of Cm before sample irradiation and of Cm and Cf after sample irradiation. The factors that affect the accuracy and reproducibility of isotopic ratio measurements by ICP-QMS, such as peak centre correction, detector dead time, mass bias, abundance sensitivity and hydrides formation, instrumental background, and memory blank were carefully evaluated and corrected. Uncertainties of the isotopic ratios, taking into account internal precision of isotope ratio measurements, peak tailing, and hydrides formations ranged from 0.3% to 1.3%. This uncertainties range is quite acceptable for the nuclear data to be used in transmutation studies.

  18. Radiological Characterization Technical Report on Californium-252 Sealed Source Transuranic Debris Waste for the Off-Site Source Recovery Project at Los Alamos National Laboratory

    Energy Technology Data Exchange (ETDEWEB)

    Feldman, Alexander [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2014-04-24

    This document describes the development and approach for the radiological characterization of Cf-252 sealed sources for shipment to the Waste Isolation Pilot Plant. The report combines information on the nuclear material content of each individual source (mass or activity and date of manufacture) with information and data on the radionuclide distributions within the originating nuclear material. This approach allows for complete and accurate characterization of the waste container without the need to take additional measurements. The radionuclide uncertainties, developed from acceptable knowledge (AK) information regarding the source material, are applied to the summed activities in the drum. The AK information used in the characterization of Cf-252 sealed sources has been qualified by the peer review process, which has been reviewed and accepted by the Environmental Protection Agency.

  19. Robert et Maya Kandel, La Catastrophe climatique, Hachette, 2009, 237 p.

    Directory of Open Access Journals (Sweden)

    Luc Semal

    2012-05-01

    Full Text Available Robert Kandel, astrophysicien et directeur de recherche émérite au CNRS, n’en est pas à son premier ouvrage sur le réchauffement climatique. Dans ce nouvel essai (co-rédigé avec sa fille Maya Kandel, il est intéressant de constater un changement de ton assez représentatif de l’inquiétude croissante des scientifiques à l’égard du bouleversement climatique en cours. Tout en rappelant qu’il a longtemps fait preuve de méfiance à l’égard des discours catastrophistes, Robert Kandel annonce dès l’i...

  20. Transmutation of 129 I, 237 Np, 238 Pu, 239 Pu, and 241 Am using ...

    Indian Academy of Sciences (India)

    Target-blanket facility `Energy + Transmutation' was irradiated by proton beam extracted from the Nuclotron Accelerator in Laboratory of High Energies of Joint Institute for Nuclear Research in Dubna, Russia. Neutrons generated by the spallation reactions of 0.7, 1.0, 1.5 and 2 GeV protons and lead target interact with ...

  1. 237 Impacts socio-sanitaires et environnementaux de la gestion des ...

    African Journals Online (AJOL)

    SWEET

    L'étude relève les particularités hydrométéorologiques de la ville, analyse le système de gestion des eaux pluviales, et les ... d'inondation, mais aussi contribuer à limiter la pollution et partant, améliorer le cadre de vie des populations. ..... Sciences de la Terre, Yaoundé : Université Yaoundé I (2009) 65. [4] - T. BALDET ...

  2. 77 FR 237 - Protection of Stratospheric Ozone: Adjustments to the Allowance System for Controlling HCFC...

    Science.gov (United States)

    2012-01-04

    .... More detail is provided on the case and EPA's interpretation of the Court's decision in section II.D... 1992, through the Copenhagen Amendment to the Montreal Protocol, the Parties created a detailed... substances listed in appendix B to 40 CFR part 82 subpart A. The 1992 Copenhagen Amendment created a schedule...

  3. Transmutation of 129I, 237Np, 238Pu, 239Pu, and 241Am using ...

    Indian Academy of Sciences (India)

    1Joint Institute for Nuclear Research, Dubna near Moscow, 141 980 Russian Federation. 2Czech Academy of ... tween each two sections are slits into which experimental instruments and detectors are inserted. The side from where ... Simplified design of the 'Energy + Transmutation' assembly inside its shielding as used in ...

  4. Analysis of shape isomer yields of 237 Pu in the framework of ...

    Indian Academy of Sciences (India)

    Data on shape isomer yield for + 235U reaction at E lab = 20–29 MeV are analysed in the framework of a combined dynamical–statistical model. From this analysis, information on the double humped fission barrier parameters for some Pu isotopes has been obtained and it is shown that the depth of the second potential ...

  5. 28 CFR 2.37 - Disclosure of information concerning parolees; Statement of policy.

    Science.gov (United States)

    2010-07-01

    ...) pursuant to a request under 18 U.S.C. 4203(e). (c) Information deemed to be “public sector” information may be disclosed to third parties without the consent of the file subject. Public sector information...

  6. SU-E-J-237: Real-Time 3D Anatomy Estimation From Undersampled MR Acquisitions

    Energy Technology Data Exchange (ETDEWEB)

    Glitzner, M; Lagendijk, J; Raaymakers, B; Crijns, S [University Medical Center Utrecht, Utrecht (Netherlands); Senneville, B Denis de [University Medical Center Utrecht, Utrecht (Netherlands); Mathematical Institute of Bordeaux, University of Bordeaux, Talence Cedex (France)

    2015-06-15

    Recent developments made MRI guided radiotherapy feasible. Performing simultaneous imaging during fractions can provide information about changing anatomy by means of deformable image registration for either immediate plan adaptations or accurate dose accumulation on the changing anatomy. In 3D MRI, however, acquisition time is considerable and scales with resolution. Furthermore, intra-scan motion degrades image quality.In this work, we investigate the sensitivity of registration quality on imageresolution: potentially, by employing spatial undersampling, the acquisition timeof MR images for the purpose of deformable image registration can be reducedsignificantly.On a volunteer, 3D-MR imaging data was sampled in a navigator-gated manner, acquiring one axial volume (360×260×100mm{sup 3}) per 3s during exhale phase. A T1-weighted FFE sequence was used with an acquired voxel size of (2.5mm{sup 3}) for a duration of 17min. Deformation vector fields were evaluated for 100 imaging cycles with respect to the initial anatomy using deformable image registration based on optical flow. Subsequently, the imaging data was downsampled by a factor of 2, simulating a fourfold acquisition speed. Displacements of the downsampled volumes were then calculated by the same process.In kidneyliver boundaries and the region around stomach/duodenum, prominent organ drifts could be observed in both the original and the downsampled imaging data. An increasing displacement of approximately 2mm was observed for the kidney, while an area around the stomach showed sudden displacements of 4mm. Comparison of the motile points over time showed high reproducibility between the displacements of high-resolution and downsampled volumes: over a 17min acquisition, the componentwise RMS error was not more than 0.38mm.Based on the synthetic experiments, 3D nonrigid image registration shows little sensitivity to image resolution and the displacement information is preserved even when halving the resolution. This can be employed to greatly reduce image acquisition times for interventional applications in real-time. This work was funded by the SoRTS consortium, which includes the industry partners Elekta, Philips and Technolution.

  7. Yeast Interacting Proteins Database: YGL237C, YOR047C [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available ene expression; interacts with protein kinase Snf1p, glucose sensors Snf3p and Rgt2p, and TATA-binding prote... expression; interacts with protein kinase Snf1p, glucose sensors Snf3p and Rgt2p, and TATA-binding protein

  8. Yeast Interacting Proteins Database: YGL237C, YGR146C [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available transcription factor Aft2p; multicopy suppressor of a temperature sensitive hsf1 mutant; induced by treatment with...transcription factor Aft2p; multicopy suppressor of a temperature sensitive hsf1 mutant; induced by treatment with

  9. 48 CFR 52.237-8 - Restriction on Severance Payments to Foreign Nationals.

    Science.gov (United States)

    2010-10-01

    ... forces stationed or deployed outside the United States, or (ii) employees of an executive agency posted outside the United States; (2) The Contractor has taken (or has established plans to take) appropriate... necessary in order to comply with a law that is generally applicable to a significant number of businesses...

  10. Page 1 Studies in terpenoids—Part 43 - - - - 237 ammonia (100 ml ...

    Indian Academy of Sciences (India)

    A solution of the dienone (6d) (1.3 g) in dry ether (20ml) was added to a solution of methylmagnesium iodide in ether (20 ml) ſprepared from magnesium (0.12 g) and methyl iodide (1.42 g)]. The reaction mixture was stirred for 5 hr and left overnight. It was poured into saturated aqueous ammonium chloride (200 ml) and the ...

  11. Aerospace Medicine and Biology: A continuing bibliography with indexes, supplement 237

    Science.gov (United States)

    1982-01-01

    A bibliography is given on the biological, physiological, psychological, and environmental effects to which man is subjected during and following simulated or actual flight in the Earth's atmosphere or in interplanetary space. References describing similar effects of biological organisms of lower order are also included. Such related topics as sanitary problems, pharmacology, toxicology, safety and survival, life support systems, exobiology, and personnel factors receive appropriate attention. In general, emphasis is placed on applied research, but references to fundamental studies and theoretical principles related to experimental development also qualify for inclusion.

  12. 48 CFR 237.7204 - Format and clauses for educational service agreements.

    Science.gov (United States)

    2010-10-01

    ...-2, Audit and Records—Negotiation. 6. FAR 52.215-8, Order of Precedence—Uniform Contract Format. 7. Conflicts Between Agreement and Catalog. Insert the following clause: Conflicts Between Agreement and...

  13. 48 CFR 252.237-7023 - Continuation of Essential Contractor Services.

    Science.gov (United States)

    2010-10-01

    ... paragraph (a) of this section during a crisis situation, the Contractor shall notify the Contracting Officer... ACQUISITION REGULATIONS SYSTEM, DEPARTMENT OF DEFENSE CLAUSES AND FORMS SOLICITATION PROVISIONS AND CONTRACT... Government has identified all or a portion of the services performed under this contract as essential...

  14. s Afr J Anim Sci 1999 29(3) 237 A breeding goal for South African ...

    African Journals Online (AJOL)

    1999-06-10

    Jun 10, 1999 ... tose yield and the functional traits included survival rate, feed efficiency, live weight and calving interval. The study ... enterprises milk yield is potentially the most important trait to improve in selection, with the second trait being ..... production theory: An alternative to rescaling. Aním Prod. 54, 341. BANOS, G.

  15. Yeast Interacting Proteins Database: YGL237C, YLR423C [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available protein responsible for phagophore assembly site organization; regulatory subunit of an autophagy-specific...protein responsible for phagophore assembly site organization; regulatory subunit of an autophagy-specific

  16. Reliable determination of 237Np in environmental solid samples using 242Pu as a potential tracer

    DEFF Research Database (Denmark)

    Qiao, Jixin; Hou, Xiaolin; Roos, Per

    2011-01-01

    experimental conditions. Disulfite-8M HNO3 was selected as a redox pair for valence adjustment to Np(IV) and the tetravalent Np in the sample solution was demonstrated to be stabilized for up to 5 days under 3°C. The analytical results for reference materials showed a good agreement with the expected values...

  17. Correction: Cocaine cardiomyopathy: A case report (2014, vol. 9, no. 3, pp. 233-237

    Directory of Open Access Journals (Sweden)

    Georgijev Antonio

    2016-12-01

    Full Text Available In Sanamed Medical Journal, vol. 9, issue 3, in the text titled 'COCAINE CARDIOMYOPATHY-A CASE REPORT' authors made a mistake by inadequately citing parts of scientific paper, in sections Introduction and Discussion. The mistake was discovered by Center for Evaluation in Education and Science (CEON. Authors were informed from the Editorial Board of Medical Journal 'Sanamed' and the stated parts of paper were timely corrected.

  18. Yeast Interacting Proteins Database: YPR148C, YDL237W [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available this prey as bait (0) Literature on bait (YPD) 3 Literature on prey (YPD) 3 Literature shared by bait and...and prey 3 Literature sharing score 4 CuraGen (0 or 1) 0 S. Fields (0 or 1) 0 Association (0 or 1,YPD)

  19. 48 CFR 1352.237-70 - Security processing requirements-high or moderate risk contracts.

    Science.gov (United States)

    2010-10-01

    ... includes an Immigration and Customs Enforcement agency check. (c) Additional Requirements for Foreign... an Immigration and Customs Enforcement agency check. It is the option of the Office of Security to...

  20. 48 CFR 1352.237-71 - Security processing requirements-low risk contracts.

    Science.gov (United States)

    2010-10-01

    ... includes an Immigration and Customs Enforcement agency check. (e) Additional Requirements for Foreign...) must undergo a NACI that includes an agency check conducted by the Immigration and Customs Enforcement... Customs Enforcement SAC on Form OFI-86C, by checking Block #7, Item I. In Block 13, the Sponsor should...

  1. Page 1 T. enhancement in Tl, BaCuO 237 400 OO 70 85 100 5 i30 ...

    Indian Academy of Sciences (India)

    one Ca plane. XRD studies of samples of 2202 nominal composition showed various peaks (figure 4) which can be indexed with a n 3.86 A and cru 23,2A. The whole pattern suggests the formation of 2201 with unreacted Tl2O, CuO and BaCuO phases. The low angle peak at 26 M 7.7 degrees supports the same contention.

  2. Cusculium (Plin. XVI 22, coscus (Chiron 237 and coccolubis (Colum. III 2.19: Mediterranean substrate and Latin form

    Directory of Open Access Journals (Sweden)

    Benjamín García-Hernández

    2014-12-01

    Full Text Available Cusculium, a hapax used by Pliny in its accusative form, has a Pre-Roman base (cuscu- that is found throughout western Mediterranean countries; the same root appears in coscus, referring to certain types of worm. Given its Latin ending, the word could be used to designate both the tree (cusculius «kermes oak» and its acorns (cusculium. Coccolubis is a compound adjective, the first element of which is the diminutive of coccum («grain of kermes», which carries the same Mediterranean root as the previous word. Given its use as an epithet for a type of vine, its second element may be seen to contain the base of the noun uua. Its original form may have therefore been coccoluuis («of red grape». The Navarran term cuzculubita («oak apple», however, suggests that a Pre-Roman compound may have existed.

  3. Measurement of Hadronically Produced $^3P$ State Charmonium at $\\sqrt{s}$ = 23.7-GeV

    Energy Technology Data Exchange (ETDEWEB)

    Tesarek, Richard James [Duke Univ., Durham, NC (United States)

    1993-01-01

    Fermilab experiment E705 measured the inclusive production ratio for the two higher mass $1^3 P_1$ charmonium states, $\\sigma_{x1} / \\sigma_{ x2}$, for 300 GeV /c proton and ,$\\pi^{\\pm}$ beams interacting with a lithium target. Our measured ratios of $0.08^{+0.25}_{-0.15}$ and $0.52^{+0.52}_{-0.28}$ for proton a.nd pion induced reactions, respectively, show good agreement with previous experiments. The production ratio for proton data is consistant with a gluon fusion model for p-wave charmonium, while the pion ratio could be represented by a strict color evaporation model or an admixture of different mechanisms.

  4. 48 CFR 652.237-73 - Statement of Qualifications for Preference as a U.S. Person.

    Science.gov (United States)

    2010-10-01

    ... in his or her entrepreneurial capacity will be deemed to be a “person legally organized” within the... described in Section B and Exhibit A of this solicitation; combined with the required quality of the effort...

  5. Corrigendum to ;Applications of biotite inclusion composition to zircon provenance determination; [Earth Planet. Sci. Lett. 473 (2017) 237-246

    Science.gov (United States)

    Bell, Elizabeth A.; Boehnke, Patrick; Harrison, T. Mark

    2017-10-01

    We are grateful for support from the Collaborative for Research in Origins (CRiO) at the University of Colorado Boulder, which is funded by the John Templeton Foundation-FfAME Origins program. The opinions expressed in this publication are those of the authors, and do not necessarily reflect the views of the John Templeton Foundation.

  6. Measurements of periods, relative abundances and absolute yields of delayed neutrons from fast neutron induced fission of {sup 237}Np

    Energy Technology Data Exchange (ETDEWEB)

    Piksaikine, V. [Institute of Physics and Power Engineering, Obninsk (Russian Federation)

    1997-03-01

    The experimental method for measurements of the delayed neutron yields and period is presented. The preliminary results of the total yield, relative abundances and periods are shown comparing with the previously reported values. (J.P.N.)

  7. 49 CFR Appendix A to Part 237 - Supplemental Statement of Agency Policy on the Safety of Railroad Bridges

    Science.gov (United States)

    2010-10-01

    ... traffic levels. 7. Underwater inspections of railroad bridges. (a) Inspections of bridges should include... communication between an inspector and an engineer who performs an analysis of a bridge. (c) An inspection... bridge evaluation depends on the quality of the communication between them. Review of inspection reports...

  8. Efficacy of a haemostatic matrix for the management of bleeding in patients undergoing liver resection: results from 237 cases.

    Science.gov (United States)

    Izzo, Francesco; Di Giacomo, Raimondo; Falco, Paolo; Piccirillo, Mauro; Iodice, Rossana; Orlando, Antonio Pio; Aprea, Pasquale; Cremona, Francesco; Di Marzo, Massimiliano; Idà, Domenico Nicola; Mastro, Angelo A; Curley, Steven A

    2008-04-01

    The haemostatic matrix (FloSeal) is a topical agent that provides effective haemostasis in a range of surgical applications. We evaluated this sealant for intraoperative haemostatic effectiveness in an observational series of patients undergoing surgery for the resection of primary and metastatic liver tumours. A haemostatic matrix was applied directly to areas of bleeding. The severity of bleeding before and after application was graded on a 5-point scale (0 = no bleeding, 1 = oozing, 2 = moderate blood flow, 3 = heavy blood flow, 4 = spurting blood). The time to complete haemostasis was also recorded. 105 women (age 61 +/- 9 years) and 132 men (age 61 +/- 12 years) were included in this study. One hundred and seventeen patients (49.36%) had pre-operative coagulopathy resulting from co-existent cirrhosis (67 Child-Pugh Class A; 50 Child-Pugh Class B). Prior to administration of a haemostatic matrix, 93 bleeding sites (24.8%) had a bleeding severity score of 2, 269 bleeding sites (71.7%) had a score of 3 and 13 bleeding sites (3.5%) had a score of 4. Following administration of the haemostatic matrix, bleeding stopped completely (score of 0) at 367 (97.9%) of the 375 sites and was reduced to a score of 1 at the remaining 8 sites (2.1%), of which only 2 were in patients with coagulopathy. The mean time to achieve haemostasis in the overall population was 2.9 +/- 1 min; this was significantly increased in patients with coagulopathy versus noncoagulopathic patients (4 +/- 1 vs. 2 +/- 1 min, p matrix provided rapid and effective intraoperative control of mild to severe bleeding from the liver edge, even in patients with prolonged bleeding times resulting from cirrhosis. This preliminary evidence warrants a randomised, controlled clinical trial with a larger sample size.

  9. Quality of life of women submitted to myocardial revascularization surgery in a public hospital - doi:10.5020/18061230.2010.p237

    Directory of Open Access Journals (Sweden)

    Rafaela Melo de Oliveira

    2012-01-01

    Full Text Available Objective: To analyze the sociodemografic profile, risck factors and the quality of life of women submitted to myocardial revascularization surgery. Methods: We conducted a qualitative study by applying a questionnaire on lifestyle and risk factors and an interview with four guiding questions to 15 revascularized inpatients of cardiology units of a referral public hospital and who had no manifestations of depression prior to surgery. Results: The patients profile showed that 9 (60% were Caucasian, 8 (54% had incomplete primary education, 4(27% were housewives, 9 (60% lived in urban area, 10 (67% were married, all had a family income lower than three minimum wages and 4(27% had only two kids. From the content analysis of the interviews, the following categories aroused: religiosity, disruption with everyday life, family and quality of life. Conclusion: We found out that the knowledge about the psychosocial structure of each patient helps in the treatment of the individual submitted to myocardial revascularization. By identifying the lifestyle and risk factors, women promote self-knowledge, which can avoid habits that lead to cardiovascular diseases. We suggest the development of strategies for prevention and health promotion involving the patients and their families so that there is an extension of hospital care at home and a better adaptation to the new condition.

  10. tert-Butyl 1-(Furan-2-yl-4-oxo-2,3,7-triazaspiro[4.5]dec-1-ene-7-carboxylate

    Directory of Open Access Journals (Sweden)

    Balladka Kunhanna Sarojini

    2012-05-01

    Full Text Available A simple and novel route for synthesis of new spirocyclic compound is developed. The present work involves condensation of ethyl nipecotate with 2-furaldehyde followed by the MnO2 oxidation to give the β-keto ester which upon reaction with hydrazine hydrate gives the spiro pyrazolone.

  11. Curcumin, myrecen and cineol modulate the percentage of lymphocyte subsets altered by 2,3,7, 8-tetracholorodibenzo-p-dioxins (TCDD) in rats.

    Science.gov (United States)

    Ciftci, Osman; Tanyildizi, Sadettin; Godekmerdan, Ahmet

    2011-12-01

    The aim of this study was to investigate the toxic effects of 2,3,7,8-tetrachlorodibenzo-p-dioxin (TCDD), a persistent environmental pollutant, on the percentage of T-cell subsets and B-lymphocyte and effectiveness of curcumin, β-myrcene (myrcene) and 1,8-cineole (cineol) on this toxicity in rats. Rats (n = 112) were divided randomly into 8 equal groups. One group was kept as control and given corn oil as carrier. TCDD was orally administered at the dose of 2 µg/kg/week. Curcumin, myrcene and cineol were orally administered by gavages at the doses of 100, 200 and 100 mg/kg/day, respectively, dissolved in corn oil with and without TCDD. The blood samples were taken from half of the rats on day 30 and from the rest on day 60 for the determination of lymphocyte subsets (CD3(+), CD4(+), CD8(+), CD161(+), CD45RA, CD4(+)CD25(+) and total lymphocyte). The results indicated that although TCDD significantly (p cineol significantly decreased CD8(+) cells levels but increased CD3(+), CD4(+), CD161(+), CD45RA, CD4(+)CD25(+) and total lymphocyte cells populations. The beneficial effects of curcumin, myrcene and cineol and the toxic effects of TCDD were increased at day 60 compared to day 30. In conclusion, curcumin, myrcene and cineol showed immunomodulatory effects and eliminated TCDD-induced immune suppressive effects in rats.

  12. SU-F-T-237: The Imaging and Radiation Oncology Core (IROC) Cooperatives Activities Supporting the NCI’s National Clinical Trial Network

    Energy Technology Data Exchange (ETDEWEB)

    Followill, D [UT MD Anderson Cancer Center, Houston, TX (United States); Galvin, J [Thomas Jefferson University Hospital, Newtown, PA (United States); Michalski, J [Washington University in St. Louis, St. Louis, MO (United States); Rosen, M [University of Pennsylvania Medical Center, Philadelphia, PA (United States); FitzGerald, T [University of Massachusetts Medical School, Lincoln, RI (United States); Knopp, M [The Ohio State University, Columbus, OH (United States)

    2016-06-15

    Purpose: The Imaging and Radiation Oncology Core (IROC) Cooperative has been active for the past two years supporting the National Clinical Trial Network and the details of that support are reported. Methods: There are six QA centers (Houston, Ohio, Philadelphia-RT, Philadelphia-DI, Rhode Island, St. Louis) providing an integrated RT and DI quality control program in support of the NCI’s clinical trials. The QA Center’s efforts are focused on assuring high quality data for clinical trials designed to improve the clinical outcomes for cancer patients worldwide. This program is administered through five core services: site qualification, trial design support, credentialing, data management, and case review. Results: IROC currently provides core support for 172 NCTN trials with RT, DI and RT/DI components. Many of these trials were legacy trial from the previous cooperative group program. IROC monitors nearly 1800 RT photon and 20 proton institutions. Over 28,000 beams outputs were monitored with 8% of the sites requiring repeat audits due to beam out of criteria. As part of credentialing, 950 QA phantoms have been irradiated, 515 imaging modalities evaluated and almost 4000 credentialing letters have been issued. In just year 2, 5290 RT and 4934 DI patient datasets were received (many using TRIAD) by IROC QA Centers to be prepared for review. During the past 2 years, a total of 6300 RT cases and 19,000 DI image sets were reviewed by IROC technical staff. To date, IROC has published 36 manuscripts. Conclusion: The QA services provided by IROC are numerous and are continually being evaluated for effectiveness, harmonized across all NCTN Groups and administered in an efficient and timely manner to enhance accurate and per protocol trial data submission. These efforts increase each NCTN Group’s ability to derive meaningful outcomes from their clinical trials. This work was supported by DHHS NIH grant 5U24CA180803.

  13. UTILIZATION OF AN ACTIVE SERINE 101 -] CYSTEINE MUTANT TO DEMONSTRATE THE PROXIMITY OF THE CATALYTIC SERINE 101 AND HISTIDINE 237 RESIDUES IN THIOESTERASE-II

    NARCIS (Netherlands)

    WITKOWSKI, A; NAGGERT, J; WITKOWSKA, HE; RANDHAWA, ZI; SMITH, S

    1992-01-01

    Thioesterase II is a 29-kDa monomer which, in certain specialized tissues, acts as a chain terminator in fatty acid synthesis by hydrolyzing medium-chain fatty acids from the fatty acid synthase. As with serine proteases, hydrolysis appears to involve acylation of the active site serine residue

  14. Protocolo Nacional para la Evaluacion de Disturbios en Suelos Forestales; Volumen II: Metodos complementarios, estad&#237stica y recoleccion de datos

    Science.gov (United States)

    Deborah S. Page-Dumroese; Ann M. Abbott; Thomas M. Rice

    2013-01-01

    Este documento-El Volumen II: Métodos complementarios, estadística y recolección de datos- define las bases, los métodos estadísticos y de almacenamiento de datos de un Protocolo Nacional para la Evaluación de Disturbios en Suelos Forestales. Esta guía técnica proporciona las bases de un método consistente, con definiciones comunes, para generar datos de alta calidad,...

  15. Stereoselective synthesis of 2,3,7-trimethylcyclooctanone and related compounds and determination of their relative and absolute configurations by the M alpha NP acid method

    NARCIS (Netherlands)

    Naito, Junpei; Kuwahara, Shunsuke; Watanabe, Masataka; Decatur, John; Bos, Pieter H.; Van Summeren, Ruben P.; Ter Horst, Bjorn; Feringa, Ben L.; Minnaard, Adriaan J.; Harada, Nobuyuki

    2008-01-01

    The copper/chiral phosphoramidite (L-1)-catalyzed conjugate addition of dimethylzinc to cycloocta-2,7-dienone 4, followed by the methylation of the intermediate enolate, yielded a single isomer of 7,8-dimethylcyclooct-2-enone (+)-5. Compound (+)-5 was subjected to the second conjugate addition with

  16. 237. Malformación hamartomatosa de la aurícula izquierda como causa infrecuente de ataque isquémico transitorio de repetición

    Directory of Open Access Journals (Sweden)

    O. Leal

    2012-04-01

    Conclusiones: Ante la presencia de AIT, en primer lugar debemos considerar el origen cardioembólico, excluidos éstos, la patología tumoral aunque infrecuente debe tenerse en cuenta, y su tratamiento generalmente es quirúrgico.

  17. Graduation Outcomes of Students Who Entered New York City Public Schools in Grade 5 or 6 as English Learner Students. REL 2017-237

    Science.gov (United States)

    Kieffer, Michael J.; Parker, Caroline E.

    2017-01-01

    This longitudinal study analyzes high school graduation outcomes of students who entered New York City public schools in grade 5 or 6 as English learner students. It extends the work of Kieffer and Parker (2016) by investigating the high school graduation rates and the types of diploma earned by the 1,734 students who entered New York City public…

  18. PS2-37: Oral Cancer Information on the Web: Assessing the Quality and Content of English and Spanish Oral Cancer Websites

    Science.gov (United States)

    Irwin, Jeannie Y; Thyvalikakath, Thankam; Schleyer, Titus; Wali, Teena; Kerr, Ross

    2010-01-01

    Background/Aims: In the United States, about 8,000 people a year die from oral cancer and more than 30,000 new cases are diagnosed annually. A recent study showed that 80% of American adult Internet users have searched the Web for health information and 15% of those specifically searched for dental health information. Having high quality oral cancer information available via the Web is important given the significance of this health problem. The goal of this study was to evaluate the quality and content of multiple English and Spanish oral cancer websites. Methods: We developed a search strategy using the keywords: oral cancer, mouth cancer, and tongue cancer to find oral cancer sites via Medline Plus, Google, and Yahoo. We then used the translations cancer oral, cancer de la boca, and cancer de la lengua to search Medline Plus en Español, Google Español, and Yahoo Telemundo. We added sites to the datasets based on inclusion/exclusion criteria. Two native speaking raters evaluated each site within their set for quality using the modified Information Quality Tool (IQT). We then developed a survey tool to asses the content of the sites. Two native speaking oral cancer experts evaluated each site within their set using this new tool. Results: Our search strategy produced 24 English language sites and 24 Spanish language sites for evaluation. English language websites had an average IQT score of 74.7 (out of 100) and average content score of 51.5 (out of 100). Spanish-language sites had an average IQT score of 48.8 and an average content score of 25.9. Conclusions: Despite higher scores for the English language websites, our analysis showed that there was a great variation in overall quality and content with room for improvement for both language types. English sites could make the biggest improvements by providing more information about their sponsors and who controls site content as well as updated and fixing links and author credentials. The Spanish sites should focus on improving information about their agenda and overall site design. For content, both types of sites need to provide more images and information on etiology and risk factors. Both English and Spanish sites scored highest in coverage of clinical presentation, treatment and follow-up care after treatment. Overall, this study identifies several information gaps and areas for improvements for oral cancer websites. We hope our results will be used to improve online oral cancer information.

  19. CTD data of the Hawaii Ocean Time-series (HOT) program in the North Pacific 100 miles north of Oahu, Hawaii for cruises HOT228-237 during 2011 (NODC Accession 0101727)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The HOT program makes repeated observations of the physics, biology and chemistry at a site approximately 100 km north of Oahu, Hawaii. Two stations are visited...

  20. 3-(4-Fluorophenyl-N-[4-(4-furan-2-yl-1-oxo-2,3,7-triazaspiro[4.5]dec-3-en-2-ylphenyl]propionamide Hydrochloride

    Directory of Open Access Journals (Sweden)

    Badiadka Narayana

    2012-08-01

    Full Text Available A simple and novel route for the synthesis of new spirocyclic propionamide derivative is developed. The present work involves N-arylation of pyrazolone (1 using copper(I iodide catalyst followed by reduction to give amine (2. The coupling of 2 with 3-(4-fluorophenylpropionic acid and deprotection of Boc group yields the title compound (3.

  1. Health Technology Integration for Clinical, Patient Records and Financial Management Related to the Military

    Science.gov (United States)

    2012-09-01

    computer literacy ) related to the amount of training/technical support needed to achieve proficiency with the EHR system? Do these characteristics affect...tailed) .025 .000 .025 .014 .015 .312 .000 .000 .001 N 231 231 231 237 237 237 237 237 236 237 Self-rated computer skil ls (1-5) Pearson Correlation...daily computer use and self-rated computer skills – are significant and negative, indicating that initial levels of general computer literacy (as opposed

  2. Discovery of isotopes of the transuranium elements with 93≤Z≤98

    Energy Technology Data Exchange (ETDEWEB)

    Fry, C.; Thoennessen, M., E-mail: thoennessen@nscl.msu.edu

    2013-01-15

    One hundred and five isotopes of the transuranium elements neptunium, plutonium, americium, curium, berkelium, and californium have been observed so far; the discovery of these isotopes is described. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  3. Separation of Transplutonium Elements from Neutron Irradiated Americium-241

    National Research Council Canada - National Science Library

    UENO, Kaoru; WATANABE, Kenju; SAGAWA, Chiaki; ISHIMORI, Tomitaro

    1974-01-01

    .... The ratios of the amounts present of these isotopes were determined by mass spectrometry. It was not possible to identify 249Bk in the berkelium fraction owing to the interference from other β-ray emitting nuclides. In the californium fraction, both spontaneous fission and a-activities due to 250, 252 were observed.

  4. Neutron-Activated Gamma-Emission: Technology Review

    Science.gov (United States)

    2012-01-01

    flux sources developed for boron neutron capture therapy ( BNCT ), found to be an experimental success in cancer treatment (26). 30 Improved flux on...achievable Am americium API associated particle imaging B boron Be beryllium BNCT boron neutron capture therapy C carbon Cf californium Cl

  5. Solid-State Neutron Multiplicity Counting System Using Commercial Off-the-Shelf Semiconductor Detectors

    Energy Technology Data Exchange (ETDEWEB)

    Rozhdestvenskyy, S. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

    2017-08-09

    This work iterates on the first demonstration of a solid-state neutron multiplicity counting system developed at Lawrence Livermore National Laboratory by using commercial off-the-shelf detectors. The system was demonstrated to determine the mass of a californium-252 neutron source within 20% error requiring only one-hour measurement time with 20 cm2 of active detector area.

  6. Cold valleys in the radioactive decay of 248−254Cf isotopes

    Indian Academy of Sciences (India)

    Geiger–Nuttal plots of log10(T1/2) vs. Q−1/2 for 48−52Ca emitting from various californium isotopes. Acknowledgement. One of the authors (KPS) would like to thank University Grants Commis- sion, Govt. of India for the financial support under project No. MRP(S)-. 352/2005(X Plan)/KLKA 002/UGC-SWRO. References.

  7. Directed evolution of the periodic table: probing the electronic structure of late actinides.

    Science.gov (United States)

    Marsh, M L; Albrecht-Schmitt, T E

    2017-07-25

    Recent investigations of the coordination chemistry and physical properties of berkelium (Z = 97) and californium (Z = 98) have revealed fundamental differences between post-curium elements and lighter members of the actinide series. This review highlights these developments and chronicles key findings and concepts from the last half-century that have helped usher in a new understanding of the evolution of electronic structure in the periodic table.

  8. Open Source: Potential in Latin America for Radiological Weapons

    Science.gov (United States)

    2010-03-01

    terrorist group would need to acquire a radioactive isotope with a relatively short half-life. 36,37 As an aside, the IAEA verified that depleted...cns.miis.edu/npr/pdfs/123salama.pdf (accessed March 3, 2010), Useful RDD isotopes include cobalt-60, strontium-90, yttrium-90, iridium-192, cesium-137...plutonium-238, radium -226, americium-241, and californium-252. 37 Hansell and Salama, “Does intent equal capability?,” 640-641. 38 Internation Atomic

  9. Diseño del sistema de alimentación de corriente y voltaje en los visores nocturnos para ser utilizados en el avión scheweizer SA2-37B de la Fuerza Aérea Colombiana

    Directory of Open Access Journals (Sweden)

    José Antonio Beltrán Bernate

    2009-01-01

    Con las baterias tradicionales el tiempo de vuelo de la aeronave, en operación con (Lentes de Visión Nocturna L.V.N. es de 10 horas, pero con la utilización del sistema de alimentación de corriente, resultado de este trabajo, se puede prolongar más allá este límite, beneficiando el desarrollo de las operaciones aéreas.

  10. Three novel HBB mutations, c.-140C>G (-90 C>G), c.237_256delGGACAACCTCAAGGGCACCT (FS Cd 78/85 -20 bp), and c.315+2T>G (IVS2:2 T>G). Update of the mutational spectrum of β-Thalassemia in Mexican mestizo patients.

    Science.gov (United States)

    Rizo-de-la-Torre, L C; Ibarra, B; Sánchez-López, J Y; Magaña-Torres, M T; Rentería-López, V M; Perea-Díaz, F J

    2017-10-01

    Beta-thalassemia (β-thal) is frequent in Mexican patients with microcytosis and hypochromia. We report three novel mutations and analyze the actual mutational spectrum in Mexican population. One hundred and forty-nine β-thal Mexican mestizo patients were studied (154 alleles). ARMS-PCR was performed to identify Cd39C>T, IVS1:1G>A, IVS1:110G>A, -28A>C, initiation codonA>G and IVS1:5G>A mutations, and gap-PCR for δβ-thal Spanish type. DNA sequencing of HBB gene was carried out in negative samples for the initial screening. Fifteen different HBB gene mutations were observed in 148 alleles; three of them are novel: -90C>G, 20 bp deletion (at codons 78/85), and IVS2:2T>G; the mutation IVS1:6T>C that was observed for first time in our population; and eleven previously described mutations. Six alleles showed normal HBB sequence. To date, a total of 21 different mutations have been observed in Mexican patients; the four most frequent mutations are of Mediterranean origin: Cd39C>T (37.2%), IVS1:1G>A (17.3%), IVS1:110G>A (13.9%), and δβ-thal Spanish type (9.0%), which represent 77.4% of the total studied alleles. Considering the novel mutations -90C>G, -20 bp Cd78/85, IVS2:2T>G and the first observation of IVS1:6T>C, the molecular spectrum of β-thal in Mexicans comprises 21 different mutations, confirming the high allelic heterogeneity in Mexicans. © 2017 John Wiley & Sons Ltd.

  11. Comment on Spracklandus Hoser, 2009 (Reptilia, Serpentes, ELAPIDAE): request for confirmation of availability of the generic name and for the nomenclatural validation of the journal in which it was published (Case 3601; BZN 70:234–237; 71:30–38; 133-135,181-182 ,252-253)

    Science.gov (United States)

    Rhodin, Anders G.J.; Kaiser, Hinrich; van Dijk, Peter Paul; Wüster, Wolfgang; O’Shea, Mark; Archer, Michael; Auliya, Mark; Boitani, Luigi; Bour, Roger; Clausnitzer, Viola; Contreras-MacBeath, Topiltzin; Crother, Brian I.; Daza, Juan M.; Driscoll, Carlos A.; Flores-Villela, Oscar; Frazier, Jack; Fritz, Uwe; Gardner, Alfred L.; Gascon, Claude; Georges, Arthur; Glaw, Frank; Grazziotin, Felipe G.; Groves, Colin P.; Haszprunar, Gerhard; Havaš, Peter; Hero, Jean-Marc; Hoffmann, Michael; Hoogmoed, Marinus S.; Horne, Brian D.; Iverson, John B.; Jäch, Manfred; Jenkins, Christopher L.; Jenkins, Richard K.B.; Kiester, A. Ross; Keogh, J. Scott; Lacher, Thomas E.; Lovich, Jeffrey E.; Luiselli, Luca; Mahler, D. Luke; Mallon, David P.; Mast, Roderic; McDiarmid, Roy W.; Measey, John; Mittermeier, Russell A.; Molur, Sanjay; Mosbrugger, Volker; Murphy, Robert W.; Naish, Darren; Niekisch, Manfred; Ota, Hidetoshi; Parham, James F.; Parr, Michael J.; Pilcher, Nicolas J.; Pine, Ronald H.; Rylands, Anthony B.; Sanderson, James G.; Savage, Jay M.; Schleip, Wulf; Scrocchi, Gustavo J.; Shaffer, H. Bradley; Smith, Eric N.; Sprackland, Robert; Stuart, Simon N.; Vetter, Holger; Vitt, Laurie J.; Waller, Tomás; Webb, Grahame; Wilson, Edward O.; Zaher, Hussam; Thomson, Scott

    2015-01-01

    In Case 3601 Raymond Hoser has asked the Commission to validate for the purposes of nomenclature the name Spracklandus Hoser, 2009, and ‘the journal in which it was published,’ issue 7 of the Australasian Journal of Herpetology (AJH). We note that the entire run of AJH has been written, edited, and published solely by Hoser. Although his requests to the Commission were presented as narrow and, in his words, ‘routine matters,’ we are convinced that they represent an important tipping-point with broad implications of major concern for zoological taxonomy and nomenclature as a whole and, by extension, the greater scientific community. Since Hoser’s actions and works have failed to follow scientific best practices (e.g. Turtle Taxonomy Working Group, 2007, 2014; Kaiser et al., 2013; Kaiser, 2014) and both the Commission’s general Recommendations and Code of Ethics in Appendix A, the global herpetological community has widely rejected his taxonomic decisions and resultant nomenclature. This has unfortunately caused a confusing dual nomenclature to develop in the herpetological community, with most boycotting or ignoring Hoser’s 700+ new names coined in the AJH, while he and a few personal followers actively promote their usage. We believe that suppression of the name Spracklandus, and all issues of AJH, is the only effective way to bring this contentious and confusing issue to resolution. The plenary power available under Article 81.1 of the Code exist specifically to allow the Commission to make rulings in individual cases that disturb stability and cause confusion, whether the works are Code-compliant or not. We maintain that it is in the interest of nomenclatural stability, not only for herpetology, but for all of zoological taxonomy, that the plenary power be invoked to declare the works in AJH unavailable, regardless of any narrow interpretation of their technical Code-compliance. We present our arguments for rejection of the validity of AJH in the following commentary. In view of the wide-reaching implications of this case for all of zoology, and reflecting the deep and broad-based community concern over these issues, our contributing authors include 70 global scientific leaders and accomplished amateurs from a wide variety of zoological disciplines.

  12. A emergência de metáforas multimodais: análise da metaforização e da compressão no debate político-eleitoral DOI - 10.5752/P.2358-3428.2014v18n34p237

    Directory of Open Access Journals (Sweden)

    Maíra Avelar Miranda

    2014-07-01

    Full Text Available Neste artigo, pretendemos analisar a emergência das metáforas multimodais em interações face a face no debate político-eleitoral, levando em consideração duas variáveis: a verbal – que pertence à modalidade auditiva – e a gestual – que pertence à modalidade visual. Partimos da hipótese de que, quanto mais entrincheirada a expressão metafórica está em nosso sistema conceitual, mais difícil é reconhecer essa expressão como sendo metafórica. Por outro lado, quanto menos entrincheirada a expressão está em nosso sistema conceitual, mais fácil é reconhecê-la como uma expressão metafórica. Além disso, hipotetizamos que a veiculação de metáforas menos entrincheiradas funciona como um mecanismo de compressão da argumentação desenvolvida no turno de fala. A fim de demonstrar a emergência das metáforas nas modalidades acima citadas, bem como a relação entre essas modalidades, selecionamos cenas provenientes de uma réplica da candidata Dilma Rousseff, de um debate presidencial de segundo turno exibido pela Rede Record. Os resultados de análise corroboram as nossas hipóteses de trabalho e, além disso, tornam possível demonstrar como as variáveis verbais e gestuais podem interagir, a fim de gerar metáforas multimodais.Palavras-chave: Metáforas multimodais. Metaforicidade. Compressão. Debate político-eleitoral.

  13. Safety assessment of poloxamers 101, 105, 108, 122, 123, 124, 181, 182, 183, 184, 185, 188, 212, 215, 217, 231, 234, 235, 237, 238, 282, 284, 288, 331, 333, 334, 335, 338, 401, 402, 403, and 407, poloxamer 105 benzoate, and poloxamer 182 dibenzoate as used in cosmetics.

    Science.gov (United States)

    Singh-Joy, Subhashni D; McLain, Valerie C

    2008-01-01

    Poloxamers are polyoxyethlyene, polyoxypropylene block polymers. The impurities of commercial grade Poloxamer 188, as an example, include low-molecular-weight substances (aldehydes and both formic and acetic acids), as well as 1,4-dioxane and residual ethylene oxide and propylene oxide. Most Poloxamers function in cosmetics as surfactants, emulsifying agents, cleansing agents, and/or solubilizing agents, and are used in 141 cosmetic products at concentrations from 0.005% to 20%. Poloxamers injected intravenously in animals are rapidly excreted in the urine, with some accumulation in lung, liver, brain, and kidney tissue. In humans, the plasma concentration of Poloxamer 188 (given intravenously) reached a maximum at 1 h, then reached a steady state. Poloxamers generally were ineffective in wound healing, but were effective in reducing postsurgical adhesions in several test systems. Poloxamers can cause hypercholesterolemia and hypertriglyceridemia in animals, but overall, they are relatively nontoxic to animals, with LD(50) values reported from 5 to 34.6 g/kg. Short-term intravenous doses up to 4 g/kg of Poloxamer 108 produced no change in body weights, but did result in diffuse hepatocellular vacuolization, renal tubular dilation in kidneys, and dose-dependent vacuolization of epithelial cells in the proximal convoluted tubules. A short-term inhalation toxicity study of Poloxamer 101 at 97 mg/m(3) identified slight alveolitis after 2 weeks of exposure, which subsided in the 2-week postexposure observation period. A short-term dermal toxicity study of Poloxamer 184 in rabbits at doses up to 1000 mg/kg produced slight erythema and slight intradermal inflammatory response on histological examination, but no dose-dependent body weight, hematology, blood chemistry, or organ weight changes. A 6-month feeding study in rats and dogs of Poloxamer 188 at exposures up to 5% in the diet produced no adverse effects. Likewise, Poloxamer 331 (tested up to 0.5 g/kg day(-1)), Poloxamer 235 (tested up to 1.0 g/kg day(-1)), and Poloxamer 338 (at 0.2 or 1.0 g/kg day(-1)) produced no adverse effects in dogs. Poloxamer 338 (at 5.0 g/kg day(-1)) produced slight transient diarrhea in dogs. Poloxamer 188 at levels up to 7.5% in diet given to rats in a 2-year feeding study produced diarrhea at 5% and 7.5% levels, a small decrease in growth at the 7.5% level, but no change in survival. Doses up to 0.5 mg/kg day(-1) for 2 years using rats produced yellow discoloration of the serum, high serum alkaline phosphatase activity, and elevated serum glutamicpyruvic transaminase and glutamic-oxalacetic transaminase activities. Poloxamers are minimal ocular irritants, but are not dermal irritants or sensitizers in animals. Data on reproductive and developmental toxicity of Poloxamers were not found. An Ames test did not identify any mutagenic activity of Poloxamer 407, with or without metabolic activation. Several studies have suggested anticarcinogenic effects of Poloxamers. Poloxamers appear to increase the sensitivity to anticancer drugs of multidrug-resistant cancer cells. In clinical testing, Poloxamer 188 increased the hydration of feces when used in combination with a bulk laxative treatment. Compared to controls, one study of angioplasty patients receiving Poloxamer 188 found a reduced myocardial infarct size and a reduced incidence of reinfarction, with no evidence of toxicity, but two other studies found no effect. Poloxamer 188 given to patients suffering from sickle cell disease had decreased pain and decreased hospitilization, compared to controls. Clinical tests of dermal irritation and sensitization were uniformly negative. The Cosmetic Ingredient Review (CIR) Expert Panel stressed that the cosmetic industry should continue to use the necessary purification procedures to keep the levels below established limits for ethylene oxide, propylene oxide, and 1,4-dioxane. The Panel did note the absence of reproductive and developmental toxicity data, but, based on molecular weight and solubility, there should be little skin penetration and any penetration of the skin should be slow. Also, the available data demonstrate that Poloxamers that are introduced into the body via routes other than dermal exposure have a rapid clearance from the body, suggesting that there would be no risk of reproductive and/or developmental toxicity. Overall, the available data do not suggest any concern about carcinogenesis. Although there are gaps in knowledge about product use, the overall information available on the types of products in which these ingredients are used, and at what concentration, indicates a pattern of use. Based on these safety test data and the information that the manufacturing process can be controlled to limit unwanted impurities, the Panel concluded that these Poloxamers are safe as used.

  14. 10 CFR Appendix L to Part 110 - Illustrative List of Byproduct Materials Under NRC Export/Import Licensing Authority a

    Science.gov (United States)

    2010-01-01

    ... 149 (Nd 149) Neptunium 235 (Np 235) Neptunium 237 (Np 237) Nickel 59 (Ni 59) Nickel 63 (Ni 63) Nickel...) Palladium 109 (Pd 109) Phosphorus 32 (P 32) Phosphorus 33 (P 33) Platinum 191 (Pt 191) Platinum 193m (Pt...

  15. Gclust Server: 121899 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available Sequences Related Sequences(14) 237 NP_006168.1 neural retina leucine zipper ; no annotation 1 1.00e-45...length 237 Representative annotation NP_006168.1 neural retina leucine zipper ; no annotation Number of

  16. Comments on ;Geochronology and geochemistry of rhyolites from Hormuz Island, southern Iran: A new Cadomian arc magmatism in the Hormuz Formationˮ by N. S. Faramarzi, S. Amini, A. K. Schmitt, J. Hassanzadeh, G. Borg, K. McKeegan, S. M. H. Razavi, S. M. Mortazavi, Lithos, Sep. 2015, V.236-237, P.203-211: A missing link of Ediacaran A-type rhyolitic volcanism associated with glaciogenic banded iron salt formation (BISF)

    Science.gov (United States)

    Atapour, Habibeh; Aftabi, Alijan

    2017-07-01

    A critical overview on the petrogeochemistry of Hormuz Island highlights that the Ediacaran Hormuz Complex includes synchronous felsic submarine volcanism associated with diamictite and dropstone-bearing banded iron salt (anhydrite, halite, sylvite) formation (BISF) that formed 558-541 Ma in the Late Neoproterozoic. Our field observations disagree with Faramarzi et al. (2015) on the geological map of the Hormuz Island, in particular on the occurrence of the ferruginous agglomerates in the Hormuz Island, thus the geological data do not provide a robust geological mapping. The agglomerates are commonly related to the strombolian peralkaline basaltic eruptions rather than the submarine felsic volcanism. Based on the tectonogeochemical diagrams extracted from the geochemical data of the authors, the Hormuz rhyolites show an affinity to the A-type or A2-type submarine riftogenic and or intra-plate rhyolites of Eby (1992). However, the authors admitted two sides of the debate and proposed an extensional back arc or rift-related magmatic activity as well as continental arc margin setting. The rhyolites are also similar to the Ediacaran Arabian-Nubian A-type alkaline rhyolites that formed by intra-plate rifting during the Pan-African orogen in the proto-Tethys shallow grabens of the Gondwana supercontinent. The most exceptional feature of the Hormuz rhyolites is related to their co-occurrence with the Ediacaran salt rocks, glaciogenic diamictites and jaspillitic banded iron formations, which have never ever been reported previously.

  17. PROCEEDINGS OF THE SYMPOSIUM COMMEMORATING THE 25th ANNIVERSARY OF ELEMENTS 97 and 98 HELD ON JAN. 20, 1975

    Energy Technology Data Exchange (ETDEWEB)

    Seaborg, Glenn T.; Street Jr., Kenneth; Thompson, Stanley G.; Ghiorso, Albert

    1976-07-01

    This volume includes the talks given on January 20, 1975, at a symposium in Berkeley on the occasion of the celebration of the 25th anniversary of the discovery of berkelium and californium. Talks were given at this symposium by the four people involved in the discovery of these elements and by a number of people who have made significant contributions in the intervening years to the investigation of their nuclear and chemical properties. The papers are being published here, without editing, in the form in which they were submitted by the authors in the months following the anniversary symposium, and they reflect rather faithfully the remarks made on that occasion.

  18. Composition containing transuranic elements for use in the homeopathic treatment of aids

    Energy Technology Data Exchange (ETDEWEB)

    Lustig, D.

    1996-04-18

    A homeopathic remedy consisting of a composition containing one or more transuranic elements, particularly plutonium, for preventing and treating acquired immunodeficiency syndrome (AIDS) in humans, as well as seropositivity for human immunodeficiency virus (HIV). Said composition is characterized in that it uses any chemical or isotopic form of one or more transuranic elements (neptunium, plutonium, americium, curium, berkelium, californium or einsteinium), particularly plutonium, said form being diluted and dynamized according to conventional homeopathic methods, particularly the so-called Hahnemann and Korsakov methods, and provided preferably but not exclusively in the form of lactose and/or saccharose globules or granules impregnated with the active principle of said composition. (author).

  19. Advanced development of the spectrum sciences Model 5005-TF, single-event test fixture

    Energy Technology Data Exchange (ETDEWEB)

    Ackermann, M.R.; Browning, J.S. (Sandia National Labs., Albuquerque, NM (USA)); Hughlock, B.W. (Boeing Aerospace and Electronics Co., Seattle, WA (USA)); Lum, G.K. (Lockheed Missiles and Space Co., Sunnyvale, CA (USA)); Tsacoyeanes, W.C. (Draper (Charles Stark) Lab., Inc., Cambridge, MA (USA)); Weeks, M.D. (Spectrum Sciences, Inc., Santa Clara, CA (USA))

    1990-09-01

    This report summarizes the advanced development of the Spectrum Sciences Model 5005-TF, Single-Event Test Fixture. The Model 5005-TF uses a Californium-252 (Cf-252) fission-fragment source to test integrated circuits and other devices for the effects of single-event phenomena. Particle identification methods commonly used in high-energy physics research and nuclear engineering have been incorporated into the Model 5005-TF for estimating the particle charge, mass, and energy parameters. All single-event phenomena observed in a device under test (DUT) are correlated with an identified fission fragment, and its linear energy transfer (LET) and range in the semiconductor material of the DUT.

  20. TOWARD AN IMPROVED UNDERSTANDING OF STRUCTURE AND MAGNETISM IN NEPTUNIUM AND PLUTONIUM PHOSPHONATES AND SULFONATES

    Energy Technology Data Exchange (ETDEWEB)

    Albrecht-Schmitt, Thomas

    2012-03-01

    This grant supported the exploratory synthesis of new actinide materials with all of the actinides from thorium to californium with the exceptions of protactinium and berkelium. We developed detailed structure-property relationships that allowed for the identification of novel materials with selective ion-exchange, selective oxidation, and long-range magnetic ordering. We found novel bonding motifs and identified periodic trends across the actinide series. We identified structural building units that would lead to desired structural features and novel topologies. We also characterized many different spectroscopic trends across the actinide series. The grant support the preparation of approximately 1200 new compounds all of which were structurally characterized.

  1. Detection of rare earth elements in Powder River Basin sub-bituminous coal ash using laser-induced breakdown spectroscopy (LIBS)

    Energy Technology Data Exchange (ETDEWEB)

    Tran, Phuoc [National Energy Technology Lab. (NETL), Pittsburgh, PA, (United State; Mcintyre, Dustin [National Energy Technology Lab. (NETL), Pittsburgh, PA, (United State

    2015-10-01

    We reported our preliminary results on the use of laser-induced breakdown spectroscopy to analyze the rare earth elements contained in ash samples from Powder River Basin sub-bituminous coal (PRB-coal). We have identified many elements in the lanthanide series (cerium, europium, holmium, lanthanum, lutetium, praseodymium, promethium, samarium, terbium, ytterbium) and some elements in the actinide series (actinium, thorium, uranium, plutonium, berkelium, californium) in the ash samples. In addition, various metals were also seen to present in the ash samples

  2. Dicty_cDB: Contig-U12507-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 129S1/SvImJ Mus musculus STS genomi... 58 0.001 1 ( BV434071 ) S237P6227RB12.T0 PortugueseWaterDog Canis fam...ilia... 58 0.001 1 ( BV424860 ) S237P6196FC6.T0 PortugueseWaterDog Canis familiar

  3. Dicty_cDB: Contig-U03903-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available A sequence from clone DKEYP-86F8 in l... 52 0.023 1 ( BV433213 ) S237P6285FG10.T0 Portuguese...6 1 ( BV438906 ) S237P6374FA9.T0 PortugueseWaterDog Canis familiar... 44 5.6 1 ( AM456273 ) Vitis vinifera c

  4. Magnetostratigraphy and biostratigraphy od Jurassic-Cretaceous boundary sections in the Vocontian Basin, France

    Czech Academy of Sciences Publication Activity Database

    Schnabl, Petr; Kdýr, Šimon; Svobodová, Andrea; Reháková, D.; Čížková, Kristýna; Elbra, Tiiu; Pruner, Petr; Frau, C.; Wimbledon, W. A. P.

    2017-01-01

    Roč. 120 (2017), s. 237-237 ISSN 1017-8880. [International Symposium on the Cretaceous /10./. 21.08.2017-26.08.2017, Vienna] R&D Projects: GA ČR(CZ) GA16-09979S Institutional support: RVO:67985831 Keywords : magnetostratigraphy * biostratigraphy * Jurassic/Cretaceous * Vocontian Basin, France Subject RIV: DE - Earth Magnetism, Geodesy, Geography

  5. 78 FR 73109 - Radio Broadcasting Services; Benjamin and Cisco, TX; De Beque, CO; Port Lions, AK; Rule and...

    Science.gov (United States)

    2013-12-05

    ... COMMISSION 47 CFR Part 73 Radio Broadcasting Services; Benjamin and Cisco, TX; De Beque, CO; Port Lions, AK... at De Beque, Colorado; Channel 237C3 at Benjamin, Texas; Channel 261C3 at Cisco, Texas; Channel 288C2..., Channel 237C3; by removing Cisco, Channel 261C3; by removing Channel 288C2 at Rule; and by removing...

  6. Evaluation of carcass performance of Matebele goats managed ...

    African Journals Online (AJOL)

    users

    Matebele goats were slaughtered at different state of permanent incisors eruption 1st pair (I1 )(237records), 2nd pair (I2 )(312 records), 3rd pair (I3 )(237records), 4th pair (I4)(232 ), Broken Mouth (BM)(214) and Smooth Mouth. (SM)(218) over a period of 15 years (1989- 2004) and analysed for carcass performance.

  7. 78 FR 20883 - Notice of Solicitation of Applications for the Intermediary Relending Program

    Science.gov (United States)

    2013-04-08

    ... State Offices addresses and telephone numbers are listed below. Rural Development State Offices Note... Union Place, Suite 330 Harrisburg, PA 17110-2996 (717) 237-2299/FAX (717) 237-2191 Puerto Rico USDA.... Statutory Authority. This program is authorized by the Secretary of Agriculture via a note to 7 U.S.C. 1932...

  8. 47 CFR 73.202 - Table of Allotments.

    Science.gov (United States)

    2010-10-01

    ... Marceline 256A Marquand 295A Moberly 223A MONTANA Bozeman *240C3 Charlo 251C3 Cut Bank 265C1 Lewistown 300C1... Sonora 237C3, 272A Spur 254A, 260C3 Stamford 233A Sweetwater 221C3 Teague 237C3 Turkey 244C2, 269A Van...

  9. Drug: D08673 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D08673 Drug Viloxazine (INN) C13H19NO3 237.1365 237.2949 D08673.gif Antidepressant ...:6530] [KO:K05035]; serotonin transporter inhibitor [HSA:6532] [KO:K05037] hsa04726(6532) Serotonergic synapse map07027 Antidepressan

  10. EST Table: AV398368 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available AV398368 NV021731 10/09/28 95 %/237 aa ref|NP_001136443.1| clathrin heavy chain [Bo...2 %/237 aa T20G5.1#CE00480#WBGene00011867#locus:chc-1#Clathrin heavy chain#status:Partially_confirmed#UniPro

  11. Dicty_cDB: Contig-U04716-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ( BV429027 ) S237P6215FG6.T0 PortugueseWaterDog Canis familiar... 38 6e-04 2 ( CE020668 ) tigr-gss-dog-1700...AFT ... 48 0.034 2 ( CE733596 ) tigr-gss-dog-17000315432205 Dog Library Canis lup... 38 0.034 2 ( BV431612 ) S237P656RA1.T0 Portugues...library Mus ... 38 0.13 2 ( BV431707 ) S237P6458FA8.T0 PortugueseWaterDog Canis familiar... 38 0.13 2 ( BV25... ( BV437326 ) S237P6229FG2.T0 PortugueseWaterDog Canis familiar... 38 0.13 2 ( CE358139 ) tigr-gss-dog-17000... Canis lup... 38 0.14 2 ( BV432826 ) S237P6430RB9.T0 PortugueseWaterDog Canis familiar... 36 0.14 2 ( CE4742

  12. A gas secondary electron detector

    CERN Document Server

    Drouart, A; Alamanos, N; Auger, F; Besson, P; Bougamont, E; Bourgeois, P; Lobo, G; Pollacco, E C; Riallot, M

    2002-01-01

    A new Secondary Electron gas Detector (SED) is under development to be used in conjunction with an emissive foil to detect low energy heavy ions as an alternative to micro-channel plates. It could measure position and time of flight. Secondary electrons are accelerated to 10 keV so that they can cross through the 0.9 mu m Mylar entrance window. The electrons then are multiplied in the isobutane gas of the detector at 4-10 Torr. A time resolution of 150 ps and a spatial resolution of 3 mm have been obtained by using californium fission fragments on a prototype detector of 7x7 cm sup 2. The advantage of the SED against MCP is that its size is not limited. Our final goal is to build a large size detector (15x40 cm sup 2) that will operate at the focal plane of the VAMOS magnetic spectrometer at GANIL.

  13. Environmental assessment of the thermal neutron activation explosive detection system for concourse use at US airports

    Energy Technology Data Exchange (ETDEWEB)

    Jones, C.G.

    1990-08-01

    This document is an environmental assessment of a system designed to detect the presence of explosives in checked airline baggage or cargo. The system is meant to be installed at the concourse or lobby ticketing areas of US commercial airports and uses a sealed radioactive source of californium-252 to irradiate baggage items. The major impact of the use of this system arises from direct exposure of the public to scattered or leakage radiation from the source and to induced radioactivity in baggage items. Under normal operation and the most likely accident scenarios, the environmental impacts that would be created by the proposed licensing action would not be significant. 44 refs., 19 figs., 18 tabs.

  14. Chelation and stabilization of berkelium in oxidation state +IV

    Science.gov (United States)

    Deblonde, Gauthier J.-P.; Sturzbecher-Hoehne, Manuel; Rupert, Peter B.; An, Dahlia D.; Illy, Marie-Claire; Ralston, Corie Y.; Brabec, Jiri; de Jong, Wibe A.; Strong, Roland K.; Abergel, Rebecca J.

    2017-09-01

    Berkelium (Bk) has been predicted to be the only transplutonium element able to exhibit both +III and +IV oxidation states in solution, but evidence of a stable oxidized Bk chelate has so far remained elusive. Here we describe the stabilization of the heaviest 4+ ion of the periodic table, under mild aqueous conditions, using a siderophore derivative. The resulting Bk(IV) complex exhibits luminescence via sensitization through an intramolecular antenna effect. This neutral Bk(IV) coordination compound is not sequestered by the protein siderocalin—a mammalian metal transporter—in contrast to the negatively charged species obtained with neighbouring trivalent actinides americium, curium and californium (Cf). The corresponding Cf(III)-ligand-protein ternary adduct was characterized by X-ray diffraction analysis. Combined with theoretical predictions, these data add significant insight to the field of transplutonium chemistry, and may lead to innovative Bk separation and purification processes.

  15. The CARIBU EBIS control and synchronization system

    Science.gov (United States)

    Dickerson, Clayton; Peters, Christopher

    2015-01-01

    The Californium Rare Isotope Breeder Upgrade (CARIBU) Electron Beam Ion Source (EBIS) charge breeder has been built and tested. The bases of the CARIBU EBIS electrical system are four voltage platforms on which both DC and pulsed high voltage outputs are controlled. The high voltage output pulses are created with either a combination of a function generator and a high voltage amplifier, or two high voltage DC power supplies and a high voltage solid state switch. Proper synchronization of the pulsed voltages, fundamental to optimizing the charge breeding performance, is achieved with triggering from a digital delay pulse generator. The control system is based on National Instruments realtime controllers and LabVIEW software implementing Functional Global Variables (FGV) to store and access instrument parameters. Fiber optic converters enable network communication and triggering across the platforms.

  16. Off-line commissioning of EBIS and plans for its integration into ATLAS and CARIBU

    Energy Technology Data Exchange (ETDEWEB)

    Ostroumov, P. N., E-mail: ostroumov@anl.gov; Barcikowski, A.; Dickerson, C. A.; Mustapha, B.; Perry, A.; Sharamentov, S. I.; Vondrasek, R. C.; Zinkann, G. [Argonne National Laboratory, Argonne, Illinois 60439 (United States)

    2016-02-15

    An Electron Beam Ion Source Charge Breeder (EBIS-CB) has been developed at Argonne to breed radioactive beams from the CAlifornium Rare Isotope Breeder Upgrade (CARIBU) facility at Argonne Tandem Linac Accelerator System (ATLAS). The EBIS-CB will replace the existing ECR charge breeder to increase the intensity and significantly improve the purity of reaccelerated radioactive ion beams. The CARIBU EBIS-CB has been successfully commissioned offline with an external singly charged cesium ion source. The performance of the EBIS fully meets the specifications to breed rare isotope beams delivered from CARIBU. The EBIS is being relocated and integrated into ATLAS and CARIBU. A long electrostatic beam transport system including two 180° bends in the vertical plane has been designed. The commissioning of the EBIS and the beam transport system in their permanent location will start at the end of this year.

  17. Populations of selected microbial and fungal species growing on the surface of rape seeds following treatment with desiccants or plant growth regulators.

    Science.gov (United States)

    Frac, Magdalena; Jezierska-Tys, Stefania; Tys, Jerzy

    2010-01-01

    The aim of this study was to determine the effects of desiccants and plant growth regulators on selected microbial species affecting rape seeds, with special emphasis on the growth of fungi and identification of the genus and species composition. The experimental material in the study was seeds of winter rape cv. Californium that were collected from the field during combine harvest. The chemical agents applied, both desiccants and growth regulators, generally decreased the populations of bacteria occurring on the surface of rape seeds. The responses of fungi depended upon the type of agent applied and were manifested as either stimulation or inhibition of the growth of the fungal species. The fungi isolated from the surface of rape seeds were characteristic of those found in the field environment (Cladosporium and Penicillium) and typical for those present on the surface of rape seeds (Alternaria).

  18. Reliability of semiconductor and gas-filled diodes for over-voltage protection exposed to ionizing radiation

    Directory of Open Access Journals (Sweden)

    Stanković Koviljka

    2009-01-01

    Full Text Available The wide-spread use of semiconductor and gas-filled diodes for non-linear over-voltage protection results in a variety of possible working conditions. It is therefore essential to have a thorough insight into their reliability in exploitation environments which imply exposure to ionizing radiation. The aim of this paper is to investigate the influence of irradiation on over-voltage diode characteristics by exposing the diodes to californium-252 combined neutron/gamma radiation field. The irradiation of semiconductor over-voltage diodes causes severe degradation of their protection characteristics. On the other hand, gas-filled over-voltage diodes exhibit a temporal improvement of performance. The results are presented with the accompanying theoretical interpretations of the observed changes in over-voltage diode behaviour, based on the interaction of radiation with materials constituting the diodes.

  19. Triton and alpha-particle contribution from LiF converter for neutron dosimeter

    CERN Document Server

    Camacho, M E; Balcazar, M

    1999-01-01

    A personnel neutron dosimeter prototype based on chemical and electrochemical etched CR-39 detector, combined with LiF converter, has been calibrated using an ICRP-like phantom, under a heavy-water moderated Californium source neutron spectra; A conversion factor of 1.052+-126 spots cm sup - sup 2 mSv sup - sup 1 was obtained. The sealing properties of the detector holder showed a ten-fold reduction in radon background when it was tested in a high radon atmosphere. A convenient mechanical shock resistance was achieved in LiF converters by sintering to 11 tons pressure LiF powder at 650 deg. C, during one hour.

  20. Holdup Measures on an SRNL Mossbauer Spectroscopy Instrument

    Energy Technology Data Exchange (ETDEWEB)

    Dewberry, R.; Brown, T.; Salaymeh, S.

    2010-05-05

    Gamma-ray holdup measurements of a Mossbauer spectroscopy instrument are described and modeled. In the qualitative acquisitions obtained in a low background area of Savannah River National Laboratory, only Am-241 and Np-237 activity were observed. The Am-241 was known to be the instrumental activation source, while the Np-237 is clearly observed as a source of contamination internal to the instrument. The two sources of activity are modeled separately in two acquisition configurations using two separate modeling tools. The results agree well, demonstrating a content of (1980 {+-} 150) {mu}Ci Am-241 and (110 {+-} 50) {mu}Ci of Np-237.

  1. Comparison of fission and capture cross sections of minor actinides

    CERN Document Server

    Nakagawa, T

    2003-01-01

    The fission and capture cross sections of minor actinides given in JENDL-3.3 are compared with other evaluated data and experimental data. The comparison was made for 32 nuclides of Th-227, 228, 229, 230, 233, 234, Pa-231, 232, 233, U-232, 234, 236, 237, Np-236, 237, 238, Pu-236, 237, 238, 242, 244, Am-241, 242, 242m, 243, Cm-242, 243, 244, 245, 246, 247 and 248. Given in the present report are figures of these cross sections and tables of cross sections at 0.0253 eV and resonance integrals.

  2. Capability to Recover Plutonium-238 in H-Canyon/HB-Line - 13248

    Energy Technology Data Exchange (ETDEWEB)

    Fuller, Kenneth S. Jr.; Smith, Robert H. Jr.; Goergen, Charles R. [Savannah River Nuclear Solutions, LLC, Savannah River Site, Aiken, SC 29802 (United States)

    2013-07-01

    Plutonium-238 is used in Radioisotope Thermoelectric Generators (RTGs) to generate electrical power and in Radioisotope Heater Units (RHUs) to produce heat for electronics and environmental control for deep space missions. The domestic supply of Pu-238 consists of scrap material from previous mission production or material purchased from Russia. Currently, the United States has no significant production scale operational capability to produce and separate new Pu-238 from irradiated neptunium-237 targets. The Department of Energy - Nuclear Energy is currently evaluating and developing plans to reconstitute the United States capability to produce Pu-238 from irradiated Np-237 targets. The Savannah River Site had previously produced and/or processed all the Pu-238 utilized in Radioisotope Thermoelectric Generators (RTGs) for deep space missions up to and including the majority of the plutonium for the Cassini Mission. The previous full production cycle capabilities included: Np- 237 target fabrication, target irradiation, target dissolution and Np-237 and Pu-238 separation and purification, conversion of Np-237 and Pu-238 to oxide, scrap recovery, and Pu-238 encapsulation. The capability and equipment still exist and could be revitalized or put back into service to recover and purify Pu-238/Np-237 or broken General Purpose Heat Source (GPHS) pellets utilizing existing process equipment in HB-Line Scrap Recovery, and H-Canyon Frame Waste Recovery processes. The conversion of Np-237 and Pu-238 to oxide can be performed in the existing HB-Line Phase-2 and Phase- 3 Processes. Dissolution of irradiated Np-237 target material, and separation and purification of Np-237 and Pu-238 product streams would be possible at production rates of ∼2 kg/month of Pu-238 if the existing H-Canyon Frames Process spare equipment were re-installed. Previously, the primary H-Canyon Frames equipment was removed to be replaced: however, the replacement project was stopped. The spare equipment

  3. Attenuation of Foot-and-Mouth Disease Virus by Engineered Viral Polymerase Fidelity.

    Science.gov (United States)

    Rai, Devendra K; Diaz-San Segundo, Fayna; Campagnola, Grace; Keith, Anna; Schafer, Elizabeth A; Kloc, Anna; de Los Santos, Teresa; Peersen, Olve; Rieder, Elizabeth

    2017-08-01

    Foot-and-mouth disease virus (FMDV) RNA-dependent RNA polymerase (RdRp) (3Dpol) catalyzes viral RNA synthesis. Its characteristic low fidelity and absence of proofreading activity allow FMDV to rapidly mutate and adapt to dynamic environments. In this study, we used the structure of FMDV 3Dpol in combination with previously reported results from similar picornaviral polymerases to design point mutations that would alter replication fidelity. In particular, we targeted Trp237 within conserved polymerase motif A because of the low reversion potential inherent in the single UGG codon. Using biochemical and genetic tools, we show that the replacement of tryptophan 237 with phenylalanine imparts higher fidelity, but replacements with isoleucine and leucine resulted in lower-fidelity phenotypes. Viruses containing these W237 substitutions show in vitro growth kinetics and plaque morphologies similar to those of the wild-type (WT) A24 Cruzeiro strain in BHK cells, and both high- and low-fidelity variants retained fitness during coinfection with the wild-type virus. The higher-fidelity W237F (W237FHF) mutant virus was more resistant to the mutagenic nucleoside analogs ribavirin and 5-fluorouracil than the WT virus, whereas the lower-fidelity W237I (W237ILF) and W237LLF mutant viruses exhibited lower ribavirin resistance. Interestingly, the variant viruses showed heterogeneous and slightly delayed growth kinetics in primary porcine kidney cells, and they were significantly attenuated in mouse infection experiments. These data demonstrate, for a single virus, that either increased or decreased RdRp fidelity attenuates virus growth in animals, which is a desirable feature for the development of safer and genetically more stable vaccine candidates.IMPORTANCE Foot-and-mouth disease (FMD) is the most devastating disease affecting livestock worldwide. Here, using structural and biochemical analyses, we have identified FMDV 3Dpol mutations that affect polymerase fidelity

  4. Study of reproducibility of measurements with the spectrometer of Bonner multispheres

    Energy Technology Data Exchange (ETDEWEB)

    Azevedo, G.A.; Pereira, W.W.; Patrao, K.C.S.; Fonseca, E.S., E-mail: geisadeazevedo@gmail.com, E-mail: walsan@ird.gov.br, E-mail: karla@ird.gov.br, E-mail: evaldo@ird.gov.br [Instituto de Radionprotecao e Dosimetria (IRD/CNEN-RJ), Rio de Janeiro, RJ (Brazil)

    2013-07-01

    This work aims to study the metrological behavior of the Bonner Multisphere Spectrometer (BMS) of the LN / LNMRI / IRD - Laboratorio Metrologia de Neutrons / Laboratorio Nacional de Metrologia e Radiacao Ionizante / Instituto de Radioprotecao e Dosimetria, for measurements in repeatability and reproducibility conditions. Initially, a simulation was done by applying the Monte Carlo method, using the MCNP code and respecting the ISO 8529-1 (2001), using the sources of Californium ({sup 252} Cf), Americium-Beryllium ({sup 241} AmBe) and californium in heavy water (Cf + D{sub 2}O), all located at a distance of 100 cm from the neutron detector ({sup 6}Li (Eu) - crystal scintillator). In this program, the counting of neutrons that are captured by the detector was made. The source is located in the center of a sphere of radius 300 cm. Analyzes the impact of these neutrons in a point of the sphere wall, which in this case acted as a neutron detector and from there, it is estimated the number of neutrons that collide in the whole sphere. The purpose is to obtain the neutron count for different energy bands in a solid field of neutrons, since they have a spectrum ranging from a low to a high energy that can also vary within a particular environment. Wishes to obtain new fields with different sources and moderators materials to be used as new reference fields. Measurements are being conducted for these fields, with the aim of analyzing the variability conditions of the measurement (repeatability and reproducibility) in LEN - Laboratorio de Espectrometria de Neutrons of the LN/LMNRI/IRD. Thus, the spectrometer will be used to improve both the knowledge of the spectrum as the standard of neutrons of the lab, proving that a spectrometry is essential for correct measurement.

  5. Oral Contraception: A Survey of College Women's Concerns and Experience.

    Science.gov (United States)

    Sawyer, Robin G.; Beck, Kenneth H.

    1989-01-01

    Results are reported from a study which examined attitudes, experiences, and concerns of college women (N=237) regarding oral contraception. Implications of the findings for health educators are discussed. (IAH)

  6. S¯adhan¯a Vol. 29, 2004 Author Index

    Indian Academy of Sciences (India)

    R. Narasimhan (Krishtel eMaging) 1461 1996 Oct 15 13:05:22

    CO2 laser. 297. Bhattacharya S. Performance evaluation of multi-sensor data fusion technique for test range application. 237. Bora S N. Hydrodynamic coefficients for water wave diffraction by spherical structures. 617. Brncic M see Herceg Z.

  7. Animal Production Research Advances - Vol 5, No 4 (2009)

    African Journals Online (AJOL)

    Genetic and Relationship Estimations of Body Weight and Morphometric Traits in the Red Sokoto Goat · EMAIL FULL TEXT EMAIL FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. GN Akpa, Y Abubakar, BI Nwagu, C Alphonsus, 232-237 ...

  8. Grenzen der nachmetaphysischen Moralkonzeptionen

    Directory of Open Access Journals (Sweden)

    Susanne Moser

    2016-09-01

    Full Text Available A review on Herta Nagl-Docekal's book Innere Freiheit. Grenzen der nachmetaphysischen Moralkonzeptionen. (Sonderband der Deutschen Zeitschrift für Philosophie 36. Berlin, Boston: De Gruyter, 2014, 237 pp.

  9. ORF Alignment: NC_006086 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006086 gi|50914876 >1edt0 6 248 223 459 1e-24 ... emb|CAE84954.1| chitin binding protein [Debaryomyces robe...rtsiae] ... Length = 237 ... Query: 138 WHDKTSDPTEKDKVNSMGELPKEVDLAFIFHDWTKDYSL

  10. 85 STUDIES ON DOG POPULATION IN MAKURDI, NIGERIA (I ...

    African Journals Online (AJOL)

    2001). The role of veterinary epidemiology in the study of free - roaming dogs and cats. Prev. Veterinary medicine, 48:237 286. JOURNAL OF RESEARCH IN FORESTRY, WILDLIFE AND ENVIRONMENT. VOLUME 2 NO.1 MARCH, 2010.

  11. 78 FR 27246 - Center for Scientific Review; Notice of Closed Meetings

    Science.gov (United States)

    2013-05-09

    ... HUMAN SERVICES National Institutes of Health Center for Scientific Review; Notice of Closed Meetings... Committee: Bioengineering Sciences & Technologies Integrated Review Group; Modeling and Analysis of...-237- 2693, [email protected] . Name of Committee: Cell Biology Integrated Review Group; Cellular...

  12. Combined effects of reduced irrigation and water quality on the soil microbial community of a citrus orchard under semi-arid conditions

    Czech Academy of Sciences Publication Activity Database

    Bastida, F.; Torres, I.F.; Romero-Trigueros, C.; Baldrian, Petr; Větrovský, Tomáš; Bayona, J.M.; Alarcón, J.J.; Hernandéz, T.; García, C.; Nikolás, E.

    2017-01-01

    Roč. 104, JAN 2017 (2017), s. 226-237 ISSN 0038-0717 Institutional support: RVO:61388971 Keywords : Microbial biomass * Bacterial diversity * Enzyme activities Subject RIV: EE - Microbiology, Virology Impact factor: 4.857, year: 2016

  13. Living within limits: ecology, economics and population taboos

    National Research Council Canada - National Science Library

    Hardin, Garrett

    1993-01-01

    ... Positions of Human Biology 20. Carrying Capacity 204 21. The Global Pillage: Consequences of Unmanaged Commons 22. Discriminating Altruisms 225 23. The Double C-Double P Game 237 24. Birth Contr...

  14. Actinide transmutation in nuclear reactors

    Energy Technology Data Exchange (ETDEWEB)

    Ganev, I.K.; Lopatkin, A.V.; Naumov, V.V.; Tocheny, L.V.

    1993-12-31

    Of some interest is the comparison between the actinide nuclide burning up (fission) rates such as americium 241, americium 242, curium 244, and neptunium 237, in the reactors with fast or thermal neutron spectra.

  15. 48 CFR 2137.102 - Policy.

    Science.gov (United States)

    2010-10-01

    ... termination during which services are continued, not to exceed a pro rata portion of the risk or service... exceed the pro rata risk or service charge for the continuity of services period (LIFAR 2152.237-70...

  16. MRSA Information for Patients

    Science.gov (United States)

    ... aureus resistente a la meticilina” [PDF – 237 KB] “Staph” is a very common germ that about 1 ... infections, pneumonia, or infections of the blood. When staph infections go untreated, they can lead to serious ...

  17. Towards a methodology for educational modelling: a case in educational assessment

    NARCIS (Netherlands)

    Giesbers, Bas; Van Bruggen, Jan; Hermans, Henry; Joosten-ten Brinke, Desirée; Burgers, Jan; Koper, Rob; Latour, Ignace

    2005-01-01

    Giesbers, B., van Bruggen, J., Hermans, H., Joosten-ten Brinke, D., Burgers, J., Koper, R., & Latour, I. (2007). Towards a methodology for educational modelling: a case in educational assessment. Educational Technology & Society, 10 (1), 237-247.

  18. Transformation of arsenic-rich copper smelter flue dust in contrasting soils: A 2-year field experiment

    Czech Academy of Sciences Publication Activity Database

    Jarošíková, A.; Ettler, V.; Mihaljevič, M.; Penížek, V.; Matoušek, Tomáš; Culka, A.; Drahota, P.

    2018-01-01

    Roč. 237, JUN (2018), s. 83-92 ISSN 0269-7491 Institutional support: RVO:68081715 Keywords : arsenic * smelter dust * soil Subject RIV: CB - Analytical Chemistry, Separation OBOR OECD: Analytical chemistry Impact factor: 5.099, year: 2016

  19. Trematodes of fishes of the Indo-west Pacific: told and untold richness

    Czech Academy of Sciences Publication Activity Database

    Cribb, T.H.; Bray, R. A.; Diaz, P.E.; Huston, D.C.; Kudlai, Olena; Martin, S.B.; Yong, R.Q.-Y.; Cutmore, S.C.

    2016-01-01

    Roč. 93, č. 3 (2016), s. 237-247 ISSN 0165-5752 Institutional support: RVO:60077344 Keywords : Great Barrier reef * French Polynesia * Cardicola forsteri Subject RIV: EH - Ecology, Behaviour Impact factor: 1.181, year: 2016

  20. Disease: H01361 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available sence of environmental and food allergens. Recently, an association between a single nuclear polymorphism (S...osinophilic esophagitis: which role for food and inhalant allergens? ... JOURNAL ... Asia Pac Allergy 2:237-41 (

  1. Sooaspekt ja selle keeleline ülekanne : Emil Tode Piiririik / Riita-Ilona Märka

    Index Scriptorium Estoniae

    Märka, Riita-Ilona

    2003-01-01

    "Piiririigi" tõlge inglise keelde: Õnnepalu, Tõnu. Border state : [novel] / translated from the Estonian by Madli Puhvel. Evanston [USA] : Northwestern University Press, 2000. Autorist lk. 234 (inglise k.) ja lk. 237 (vene k.)

  2. Early pregnancy vitamin D status and risk for adverse maternal and infant outcomes in a bi-ethnic cohort: the Behaviors Affecting Baby and You (B.A.B.Y.) Study

    National Research Council Canada - National Science Library

    Nobles, Carrie J; Markenson, Glenn; Chasan-Taber, Lisa

    2015-01-01

    .... Few studies have included Hispanic women. Therefore, we investigated this association among 237 participants in the Behaviors Affecting Baby and You Study, a randomised trial of an exercise intervention among ethnically diverse prenatal care...

  3. 76 FR 9249 - Radio Broadcasting Services; Enfield, NH; Hartford, VT; Keeseville and Morrisonville, NY; White...

    Science.gov (United States)

    2011-02-17

    ... Morrisonville, NY; White River Junction, VT AGENCY: Federal Communications Commission. ACTION: Final rule... WWOD(FM) accordingly; and (3) reallotted Channel 237A, Station WXLF(FM), from White River Junction...

  4. Může arbuskulární mykorhiza pomoci v zemědělské produkci?

    Czech Academy of Sciences Publication Activity Database

    Janoušková, Martina

    2017-01-01

    Roč. 65, č. 5 (2017), s. 237-240 ISSN 0044-4812 R&D Projects: GA MŠk(CZ) LH14285 Institutional support: RVO:67985939 Keywords : arbuscular mycorrhiza * agriculture * inoculation Subject RIV: EH - Ecology, Behaviour

  5. Dicty_cDB: Contig-U01557-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ling_GS-29-01-01-1... 30 5.1 3 ( BV439796 ) S237P619FE6.T0 PortugueseWaterDog Canis familiari... 36 5.1 2 ( ...enom... 42 8.1 1 ( BV424741 ) S237P6453FF6.T0 PortugueseWaterDog Canis familiar... 42 8.1 1 ( BV402984 ) S22

  6. Modeling of lung cancer risk due to radon exhalation of granite stone in dwelling houses

    Directory of Open Access Journals (Sweden)

    Akbar Abbasi

    2017-01-01

    Conclusions: The estimated numbers of lung cancer deaths attributable to indoor radon due to granite stones in 2013 were 145 (3.33% and 103 (2.37% for poor and normal ventilation systems, respectively. According to our estimations, the values of 3.33% and 2.37% of lung cancer deaths in 2013 are attributed to radon exhalation of granite stones with poor and normal ventilation systems, respectively.

  7. 242Pu as tracer for simultaneous determination of 237Np and 239,240Pu in environmental samples

    DEFF Research Database (Denmark)

    Chen, Q.J.; Dahlgaard, H.; Nielsen, S.P.

    2002-01-01

    describes a suitable chemical procedure for Np and Pu including a quantitative pre-concentration of neptunium and plutonium, preparation of Np4+ and Pu4+, NP(NO3)(6)(2-) and Pu(NO3)(6)(2-), The ratio of Np-237/Pu-242 (or Np-237/Pu-239) before and after the procedure has been determined using 10 g soil (free...

  8. Comparative Analysis of Path Loss Prediction Models for Urban ...

    African Journals Online (AJOL)

    ... Egli were 16.24dB, 2.37dB and 8.40dB respectively. The results showed that Hata's model is the most accurate and reliable path loss prediction model for macrocellular urban propagation environments, since its MSE value of 2.37dB is smaller than the acceptable minimum MSE value of 6dB for good signal propagation.

  9. 40 CFR 60.4202 - What emission standards must I meet for emergency engines if I am a stationary CI internal...

    Science.gov (United States)

    2010-07-01

    ... CI ICE with a maximum engine power less than or equal to 2,237 KW (3,000 HP) and a displacement of... CI ICE with a maximum engine power greater than 2,237 KW (3,000 HP) and a displacement of less than... CI engines in 40 CFR 94.8, as applicable, for all pollutants, for the same displacement and maximum...

  10. Heavy metal contaminants in Malapterurus electricus (Gmeli, 1789 ...

    African Journals Online (AJOL)

    Zinc (Zn), Copper (Cu), Cadmium (Cd) and Lead (Pb) were determined in Malpterurus electricus, Tilapia zillii and water by Atomic Absorption Spectrometric Technique. A total of 8 M. electricus sp. (mean wet weight 59.75±2.37g; mean total length 17.50±1.94 cm) and 10 T. zillii sp. (mean wet weight 39.45±2.37g; mean total ...

  11. Regeneration of plantlets under NaCl stress from NaN3 treated ...

    African Journals Online (AJOL)

    Maximum of 8.41 ± 0.36 plantlets callus-1 were regenerated in MS4 (control) culture of Thatta-10, and 4.94 ± 0.05 plantlets of CPF-237 in 25 mol m-3 NaCl stressed plant regeneration (MS4a) medium. Plant regeneration on MS4b (2.21 ± 0.17 plantlets callus-1) was observed in CPF-237 only. Regenerated plantlets were ...

  12. Neptunium Transport Behavior in the Vicinity of Underground Nuclear Tests at the Nevada Test Site

    Energy Technology Data Exchange (ETDEWEB)

    Zhao, P; Tinnacher, R M; Zavarin, M; Williams, R W; Kersting, A B

    2010-12-03

    We used short lived {sup 239}Np as a yield tracer and state of the art magnetic sector ICP-MS to measure ultra low levels of {sup 237}Np in a number of 'hot wells' at the Nevada National Security Site (NNSS), formerly known as the Nevada Test Site (NTS). The results indicate that {sup 237}Np concentrations at the Almendro, Cambric, Dalhart, Cheshire and Chancellor sites, are in the range of 3 x 10{sup -5} to 7 x 10{sup -2} pCi/L and well below the MCL for alpha emitting radionuclides (15 pCi/L) (EPA, 2009). Thus, while Np transport is believed to occur at the NNSS, activities are expected to be well below the regulatory limits for alpha-emitting radionuclides. We also compared {sup 237}Np concentration data to other radionuclides, including tritium, {sup 14}C, {sup 36}Cl, {sup 99}Tc, {sup 129}I, and plutonium, to evaluate the relative {sup 237}Np transport behavior. Based on isotope ratios relative to published unclassified Radiologic Source Terms (Bowen et al., 1999) and taking into consideration radionuclide distribution between melt glass, rubble and groundwater (IAEA, 1998), {sup 237}Np appears to be substantially less mobile than tritium and other non-sorbing radionuclides, as expected. However, this analysis also suggests that {sup 237}Np mobility is surprisingly similar to that of plutonium. The similar transport behavior of Np and Pu can be explained by one of two possibilities: (1) Np(IV) and Pu(IV) oxidation states dominate under mildly reducing NNSS groundwater conditions resulting in similar transport behavior or (2) apparent Np transport is the result of transport of its parent {sup 241}Pu and {sup 241}Am isotopes and subsequent decay to {sup 237}Np. Finally, measured {sup 237}Np concentrations were compared to recent Hydrologic Source Term (HST) models. The 237Np data collected from three wells in Frenchman Flat (RNM-1, RNM-2S, and UE-5n) are in good agreement with recent HST transport model predictions (Carle et al., 2005). The agreement

  13. Method for Determination of Neptunium in Large-Sized Urine Samples Using Manganese Dioxide Coprecipitation and 242Pu as Yield Tracer

    DEFF Research Database (Denmark)

    Qiao, Jixin; Hou, Xiaolin; Roos, Per

    2013-01-01

    A novel method for bioassay of large volumes of human urine samples using manganese dioxide coprecipitation for preconcentration was developed for rapid determination of 237Np. 242Pu was utilized as a nonisotopic tracer to monitor the chemical yield of 237Np. A sequential injection extraction...... to 100% and high separation capacity of processing up to 5 L of human urine samples. The MnO2 coprecipitation process is simple and straightforward in which a batch (8–12) of samples can be pretreated within 4 h (i.e., sample). In connection with the automated column separation and ICPMS...... quantification, which takes less than 1.5 h in total, the overall analytical time was on average less than 2 h for each sample. The high effectiveness and sample throughput make the developed method well suited for urine bioassay of 237Np in routine monitoring of occupationally internal radiation exposure...

  14. Excited levels of Pa-233; Niveles excitados del Pa-233

    Energy Technology Data Exchange (ETDEWEB)

    Vara Cuadrado, J. M.

    1969-07-01

    A study of Pa-233 excited levels from the alpha decay of Np-237 and from beta decay of Th-233 has been performed. The alpha decay spectrum was measured with a semiconductor spectrometer of 18 keV effective resolution (FWHM). Over 13 new lines were identified. The gamma ray spectra of Np-237 and Th-233 were obtained with a Ge-Li detector low and medium range energy lines, and with Si-Li detector for the low energy region. A continuous purification method of Np-237 from its comparatively short-lived daughter Pa-233 was applied. A high number of new lines were identified in both spectra. The gamma-gamma coincidence spectra were obtained with INa(T{sub 1}) detectors. (Author) 54 refs.

  15. Seroprevalence of Neospora caninum Infection in Rural and Industrial Cattle in Northern Iran

    Directory of Open Access Journals (Sweden)

    MR Youssefi

    2009-02-01

    Full Text Available Background: Neospora caninum is an intracellular parasite which causes abortion in cattle worldwide.  The aim of this study was to determine the seroprevalence of N. caninum in cattle in Babol City, North of Iran."nMethods: Blood samples were collected from 237 cattle for determining the seroprevalence of N.  caninum.  A total of 237 serum samples were tested for anti-Neospora antibodies.  Serum samples were analyzed for antibodies against N. caninum antigen using a commercial N. caninum ELISA kit."nResults: Antibodies to N. caninum were found in 76 of 237 total cattle (32%, 40 of 155 industrial cat­tle (25. 8% and 36 of 82 rural cattle sera (43. 9% based on ELISA test results."nConclusion: This study is the first report of Neospora infection in this area.  Significant difference was observed regarding infection in industrial and rural cattle (P<0. 01.

  16. Prevalence of eye diseases and causes of visual impairment in school-aged children in Western China.

    Science.gov (United States)

    Pi, Lian-Hong; Chen, Lin; Liu, Qin; Ke, Ning; Fang, Jing; Zhang, Shu; Xiao, Jun; Ye, Wei-Jiang; Xiong, Yan; Shi, Hui; Zhou, Xi-Yuan; Yin, Zheng-Qin

    2012-01-01

    The present study investigated the prevalence of refractive error, visual impairment, and eye diseases in school-aged children in western China. The survey was done in a representative county (Yongchuan District, Chongqing Municipality) of western China. Cluster random sampling was used to select children aged 6 to 15 years. We conducted door-to-door surveys and eye examinations including optometry, stereoscopic vision test, eye position and eye movement, slit lamp examination of the anterior segment, retinoscopy, and fundus examination after cycloplegia with 1% cyclopentolate. Among 3469 children, data were available for 3079 (88.76%). The prevalences of eye diseases were, in descending order, refractive error (20.69%; 637/3079), conjunctivitis (11.76%; 362/3079), amblyopia (1.88%; 58/3079), color vision defect (0.52%; 16/3079), keratitis (0.36%; 11/3079), strabismus (0.29%; 9/3079), cataract (0.23%; 7/3079), pathologic myopia (0.19%; 6/3079), and ocular trauma (0.13%; 4/3079). The prevalence of corneal leucoma, corneal staphyloma, optic neuropathy, macular degeneration, and myelinated nerve fibers was 0.03% (1/3079) for each. The prevalence of visual impairment was 7.70% (237/3079), and the major causes of visual impairment were uncorrected refractive error (86.08%; 204/237), amblyopia (9.70%; 23/237), pathologic myopia (1.27%; 3/237), congenital cataract (0.42%; 1/237), and others (2.11%; 5/237). Among school-aged children in a less developed area of western China, refractive error was the most prevalent eye disorder, and uncorrected refractive error was the main cause of visual impairment.

  17. Criticality experiments and benchmarks for cross section evaluation: the neptunium case

    Directory of Open Access Journals (Sweden)

    Duran I.

    2013-03-01

    Full Text Available The 237Np neutron-induced fission cross section has been recently measured in a large energy range (from eV to GeV at the n_TOF facility at CERN. When compared to previous measurement the n_TOF fission cross section appears to be higher by 5-7% beyond the fission threshold. To check the relevance of n_TOF data, we apply a criticality experiment performed at Los Alamos with a 6 kg sphere of 237Np, surrounded by enriched uranium 235U so as to approach criticality with fast neutrons. The multiplication factor ke f f of the calculation is in better agreement with the experiment (the deviation of 750 pcm is reduced to 250 pcm when we replace the ENDF/B-VII.0 evaluation of the 237Np fission cross section by the n_TOF data. We also explore the hypothesis of deficiencies of the inelastic cross section in 235U which has been invoked by some authors to explain the deviation of 750 pcm. With compare to inelastic large distortion calculation, it is incompatible with existing measurements. Also we show that the v of 237Np can hardly be incriminated because of the high accuracy of the existing data. Fission rate ratios or averaged fission cross sections measured in several fast neutron fields seem to give contradictory results on the validation of the 237Np cross section but at least one of the benchmark experiments, where the active deposits have been well calibrated for the number of atoms, favors the n_TOF data set. These outcomes support the hypothesis of a higher fission cross section of 237Np.

  18. Drug: D07283 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D07283 Drug Esketamine (INN) C13H16ClNO 237.092 237.7252 D07283.gif Anesthetic ATC ...amine D07283 Esketamine (INN) Target-based classificatio...-aspartate receptor [HSA:2902 2903 2904 2905 2906] [KO:K05208 K05209 K05210 K05211 K05212] Esketamine [ATC:N01AX14] D07283 Esketamin... classification [BR:br08303] N NERVOUS SYSTEM N01 ANESTHETICS N01A ANESTHETICS, GENERAL N01AX Other general anesthetics N01AX14 Esket

  19. Construction of a Recyclable Genetic Marker and Serial Gene Deletions in the Human Pathogenic Mucorales Mucor circinelloides

    Directory of Open Access Journals (Sweden)

    Alexis Garcia

    2017-07-01

    Full Text Available Mucor circinelloides is a human pathogen, biofuel producer, and model system that belongs to a basal fungal lineage; however, the genetics of this fungus are limited. In contrast to ascomycetes and basidiomycetes, basal fungal lineages have been understudied. This may be caused by a lack of attention given to these fungi, as well as limited tools for genetic analysis. Nonetheless, the importance of these fungi as pathogens and model systems has increased. M. circinelloides is one of a few genetically tractable organisms in the basal fungi, but it is far from a robust genetic system when compared to model fungi in the subkingdom Dikarya. One problem is the organism is resistant to drugs utilized to select for dominant markers in other fungal transformation systems. Thus, we developed a blaster recyclable marker system by using the pyrG gene (encoding an orotidine-5′-phosphate decarboxylase, ortholog of URA3 in Saccharomyces cerevisiae. A 237-bp fragment downstream of the pyrG gene was tandemly incorporated into the upstream region of the gene, resulting in construction of a pyrG-dpl237 marker. To test the functionality of the pyrG-dpl237 marker, we disrupted the carRP gene that is involved in carotenoid synthesis in pyrG− mutant background. The resulting carRP::pyrG-dpl237 mutants exhibit a white colony phenotype due to lack of carotene, whereas wild type displays yellowish colonies. The pyrG marker was then successfully excised, generating carRP-dpl237 on 5-FOA medium. The mutants became auxotrophic and required uridine for growth. We then disrupted the calcineurin B regulatory subunit cnbR gene in the carRP::dpl237 strain, generating mutants with the alleles carRP::dpl237 and cnbR::pyrG. These results demonstrate that the recyclable marker system is fully functional, and therefore the pyrG-dpl237 marker can be used for sequential gene deletions in M. circinelloides.

  20. EST Table: FY745710 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available PREDICTED: similar to Intron-binding protein aquarius (Intron-binding protein of 160 kDa) (IBP160) [Tribolium castaneum] FY745710 famL ... ...arius [Nasonia vitripennis] 11/11/04 73 %/237 aa FBpp0269217|DyakGE24207-PA 11/11/0...FY745710 E_FL_famL_27M11_F_0 11/12/09 n.h 11/11/04 79 %/237 aa ref|XP_001600886.1| PREDICTED: similar to aqu

  1. Light Sensitivity of Lactococcus lactis Thioredoxin Reductase

    DEFF Research Database (Denmark)

    Skjoldager, Nicklas

    . Reaction mechanisms accounting for the observed oxidations on FAD and Tyr237 were proposed with the photo-excited isoalloxazine ring generating a superoxide radical (O2•-) at the si-face oxygen pocket. The one-electron deficient isoalloxazine cation can then oxidize Tyr237, which upon deprotonation forms...... a Tyr phenoxyl radical, a target of superoxide at the C3 position, accounting for the DOPA formation. The superoxide radicals can in addition react with the deprotonated form of carbon-7α of the isoalloxazine, which via a Russel mechanism accounts for the observed aldehyde formation. Another distinct...

  2. Compensated bismuth-loaded plastic scintillators for neutron detection using low-energy pseudo-spectroscopy

    Energy Technology Data Exchange (ETDEWEB)

    Dumazert, Jonathan, E-mail: jonathan.dumazert@cea.fr [CEA, LIST, Laboratoire Capteurs Architectures Electroniques, 91191 Gif-sur-Yvette (France); Coulon, Romain; Bertrand, Guillaume H.V.; Normand, Stéphane [CEA, LIST, Laboratoire Capteurs Architectures Electroniques, 91191 Gif-sur-Yvette (France); Méchin, Laurence [CNRS, UCBN, Groupe de Recherche en Informatique, Image, Automatique et Instrumentation de Caen, 14050 Caen (France); Hamel, Matthieu [CEA, LIST, Laboratoire Capteurs Architectures Electroniques, 91191 Gif-sur-Yvette (France)

    2016-05-21

    Gadolinium-covered modified plastic scintillators show a high potential for the deployment of cost-effective neutron detectors. Taking advantage of the low-energy photon and electron signature of thermal neutron captures in gadolinium-155 and gadolinium-157 however requires a background correction. In order to display a trustable rate, dual compensation schemes appear as an alternative to Pulse Shape Discrimination. This paper presents the application of such a compensation scheme to a two-bismuth loaded plastic scintillator system. A detection scintillator interacts with incident photon and fast neutron radiations and is covered with a gadolinium converter to become thermal neutron-sensitive as well. In the meantime, an identical compensation scintillator, covered with terbium, solely interacts with the photon and fast neutron part of incident radiations. After the acquisition and the treatment of the counting signals from both sensors, a hypothesis test determines whether the resulting count rate after subtraction falls into statistical fluctuations or provides a robust image of neutron activity. A laboratory prototype is tested under both photon and neutron radiations, allowing us to investigate the performance of the overall compensation system. The study reveals satisfactory results in terms of robustness to a cesium-137 background and in terms of sensitivity in presence of a californium-252 source.

  3. Systematic studies of the fundamental chemistry of pyrochlore oxides. An{sub 2}Zr{sub 2}O{sub 7} [An=Pu, Am, Cm, Bk and Cf

    Energy Technology Data Exchange (ETDEWEB)

    Haire, R.G.; Assefa, Z. [Oak Ridge National Laboratory, Oak Ridge, TN (United States); Raison, P.E. [Commissariat a l' Energie Atomique, CEA-Cadarache DRN/DEC/SPUA/LACA (France)

    2002-11-01

    Our efforts to pursue the fundamental science of actinide pyrochlore oxides, An{sub 2}Zr{sub 2}O{sub 7}, (An=plutonium through californium), are presented. We have addressed their structural and chemical behavior via X-ray diffraction, Raman spectroscopy and by considering the pseudo-oxidation potentials of the actinides. The structure, fundamental chemistry, ionic radii and the electronic configuration of the specific actinide involved in these oxide systems all have a significant impact on their science. We are also exploring a calculational approach based on valence-bond relationships to assess the position of the oxygen atoms located at the general crystallographic position. The oxygen position is important regarding the chemical behavior and thermal stability of these materials. Also considered is the structural stability of the materials regarding self-irradiation, and with some compounds, their resistance towards oxidation. These aspects will be discussed using a systematic evaluation of the five-actinide systems together with comparable lanthanide systems studied. (author)

  4. 1982 US-CEC neutron personnel dosimetry intercomparison study

    Energy Technology Data Exchange (ETDEWEB)

    Swaja, R.E.; Sims, C.S.; Greene, R.T.; Schraube, H.; Burger, G.

    1983-11-01

    A neutron personnel dosimetry intercomparison study was conducted during April 19-23, 1982, as a joint effort between the United States and the Commission of European Communities. Dosimeters from 48 participating agencies were mounted on cylindrical phantoms and exposed to a range of low-level dose equivalents (0.48-13.91 mSv neutron and 0.02-1.32 mSv gamma) in nine different radiation fields. Exposure conditions considered in this study included four mixed-field spectra produced using the Health Physics Research Reactor, four monoenergetic neutron fields generated by accelerators, and one 15-cm D/sub 2/O-moderated californium source spectrum. In general, neutron results reported by the participating agencies were consistent with expected dosimeter performance based on energy response characteristics of the detection systems. Albedo dosimeters, which were the most popular neutron monitoring systems used in this study, provided the best overall accuracy for all exposure conditions. Film, Cr-39 recoil track, and Th-232 fission track systems generally underestimated dose equivalents relative to reference values. Associated gamma measurements showed that TLD monitors produced more accurate results than film dosimeters although both systems overestimated gamma dose equivalents in mixed radiation fields. 24 references, 10 figures, 19 tables.

  5. Application of the backward extrapolation method to pulsed neutron sources

    Energy Technology Data Exchange (ETDEWEB)

    Talamo, Alberto; Gohar, Yousry

    2018-01-01

    Particle detectors operated in pulse mode are subjected to the dead-time effect. When the average of the detector counts is constant over time, correcting for the dead-time effect is simple and can be accomplished by analytical formulas. However, when the average of the detector counts changes over time it is more difficult to take into account the dead-time effect. When a subcritical nuclear assembly is driven by a pulsed neutron source, simple analytical formulas cannot be applied to the measured detector counts to correct for the dead-time effect because of the sharp change of the detector counts over time. This work addresses this issue by using the backward extrapolation method. The latter can be applied not only to a continuous (e.g. californium) external neutron source but also to a pulsed external neutron source (e.g. by a particle accelerator) driving a subcritical nuclear assembly. The backward extrapolation method allows to obtain from the measured detector counts both the dead-time value and the real detector counts.

  6. The cross sections of fusion-evaporation reactions: the most promising route to superheavy elements beyond Z=118

    Science.gov (United States)

    Jadambaa, Khuyagbaatar

    2017-11-01

    The synthesis of superheavy elements beyond oganesson (Og), which has atomic number Z = 118, is currently one of the main topics in nuclear physics. An absence of sufficient amounts of target material with atomic numbers heavier than californium (Z = 98) forces the use of projectiles heavier than 48Ca (Z = 20), which has been successfully used for the discoveries of elements with Z = 114 - 118 in complete fusion reactions. Experimental cross sections of 48Ca with actinide targets behave very differently to "cold" and "hot" fusion-evaporation reactions, where doubly-magic lead and deformed actinides are used as targets, respectively. The known cross sections of these reactions have been analysed compared to calculated fission barriers. It has been suggested that observed discrepancies between the cross sections of 48Ca-induced and other fusionevaporation reactions originate from the shell structure of the compound nucleus, which lies in the island of the stability. Besides scarcely known data on other reactions involving heavier projectiles, the most promising projectile for the synthesis of the elements beyond Og seems to be 50Ti. However, detailed studies of 50Ti, 54Cr, 58Fe and 64Ni-induced reactions are necessary to be performed in order to fully understand the complexities of superheavy element formation.

  7. Report to the DOE nuclear data committee. [EV RANGE 10-100; CROSS SECTIONS; PHOTONEUTRONS; NEUTRONS; GAMMA RADIATION; COUPLED CHANNEL THEORY; DIFFERENTIAL CROSS SECTIONS; MEV RANGE 01-10; ; CAPTURE; GAMMA SPECTRA; THERMAL NEUTRONS; COMPUTER CALCULATIONS; DECAY; FISSION PRODUCTS; FISSION YIELD; SHELL MODELS; NUCLEAR DATA COLLECTIONS

    Energy Technology Data Exchange (ETDEWEB)

    Struble, G.L.; Haight, R.C.

    1981-03-01

    Topics covered include: studies of (n, charged particle) reactions with 14 to 15 MeV neutrons; photoneutron cross sections for /sup 15/N; neutron radiative capture; Lane-model analysis of (p,p) and (n,n) scattering on the even tin isotopes; neutron scattering cross sections for /sup 181/Ta, /sup 197/Au, /sup 209/Bi, /sup 232/Th, and /sup 238/U inferred from proton scattering and charge exchange cross sections; neutron-induced fission cross sections of /sup 245/Cm and /sup 242/Am; fission neutron multiplicities for /sup 245/Cm and /sup 242/Am; the transport of 14 MeV neutrons through heavy materials 150 < A < 208; /sup 249/Cm energy levels from measurement of thermal neutron capture gamma rays; /sup 231/Th energy levels from neutron capture gamma ray and conversion electron spectroscopy; new measurements of conversion electron binding energies in berkelium and californium; nuclear level densities; relative importance of statistical vs. valence neutron capture in the mass-90 region; determination of properties of short-lived fission products; fission yield of /sup 87/Br and /sup 137/I from 15 nuclei ranging from /sup 232/Th to /sup 249/Cf; evaluation of charged particle data for the ECPL library; evaluation of secondary charged-particle energy and angular distributions for ENDL; and evaluated nuclear structure libraries derived from the table of isotopes. (GHT)

  8. Activation analysis of ITER blanket first wall

    Energy Technology Data Exchange (ETDEWEB)

    Lopatkin, A.; Muratov, V. [RDIPE (NIKIET), Moscow (Russian Federation)

    1998-09-01

    To analyze the activation of ITER blanket structural components, the authors have prepared the AUCDAS code that calculates changes in nuclide concentrations and radioactivity characteristics during neutron irradiation and during cooling. UCDAS takes into account all neutron reactions and decay types, the prepared library of constants contains nuclear data of nuclides from hydrogen to californium. A comparative analysis of the results as obtained using UCDAS code and the widely known FISPACT code is given. The analysis of decay heat, gas generation and activity of ITER blanket first wall`s structural components was carried out. The beryllium coating, copper alloy and stainless steel were analysed. Calculations were performed for the first plasma burning pulse, 6 months and 1 year of operation in accordance with the ITER scenario. The materials recommended by ITER central team and their Russian analogs were considered: TGR and B1 (beryllium coating), GlidCop AL-25 Ds and Br-MKX (copper alloy), 316LN-IG and 12Cr18Ni10Ti (stainless steel). It has been demonstrated that there is a difference in all of the considered characteristics between the above materials. It is caused by impurities which are present in the materials. The report also considers the accumulation of gases (H, D, T, He{sup 3}, He{sup 4}) in the above materials. Besides, the change in the activity of irradiated materials during the cooling of up to 10{sup 7} years was calculated. (orig.) 7 refs.

  9. Toward achieving flexible and high sensitivity hexagonal boron nitride neutron detectors

    Science.gov (United States)

    Maity, A.; Grenadier, S. J.; Li, J.; Lin, J. Y.; Jiang, H. X.

    2017-07-01

    Hexagonal boron nitride (h-BN) detectors have demonstrated the highest thermal neutron detection efficiency to date among solid-state neutron detectors at about 51%. We report here the realization of h-BN neutron detectors possessing one order of magnitude enhancement in the detection area but maintaining an equal level of detection efficiency of previous achievement. These 3 mm × 3 mm detectors were fabricated from 50 μm thick freestanding and flexible 10B enriched h-BN (h-10BN) films, grown by metal organic chemical vapor deposition followed by mechanical separation from sapphire substrates. Mobility-lifetime results suggested that holes are the majority carriers in unintentionally doped h-BN. The detectors were tested under thermal neutron irradiation from californium-252 (252Cf) moderated by a high density polyethylene moderator. A thermal neutron detection efficiency of ˜53% was achieved at a bias voltage of 200 V. Conforming to traditional solid-state detectors, the realization of h-BN epilayers with enhanced electrical transport properties is the key to enable scaling up the device sizes. More specifically, the present results revealed that achieving an electrical resistivity of greater than 1014 Ωṡcm and a leakage current density of below 3 × 10-10 A/cm2 is needed to fabricate large area h-BN detectors and provided guidance for achieving high sensitivity solid state neutron detectors based on h-BN.

  10. Design of the low energy beam transport line between CARIBU and the EBIS charge breeder

    Energy Technology Data Exchange (ETDEWEB)

    Perry, A., E-mail: aperry4@hawk.iit.edu [Argonne National Laboratory, Argonne, IL 60439, USA and Illinois Institute of Technology, Chicago, IL 60616 (United States); Ostroumov, P. N.; Barcikowski, A.; Dickerson, C.; Kondrashev, S. A.; Mustapha, B.; Savard, G. [Argonne National Laboratory, Argonne, IL 60439 (United States)

    2015-01-09

    An Electron Beam Ion Source Charge Breeder (EBIS-CB) has been developed to breed radioactive beams from the CAlifornium Rare Isotope Breeder Upgrade (CARIBU) facility at ATLAS. The EBIS-CB will replace the existing ECR charge breeder to increase the intensity and improve the purity of reaccelerated radioactive ion beams. The EBIS-CB is in the final stage of off-line commissioning. Currently, we are developing a low energy beam transport (LEBT) system to transfer CARIBU beams to the EBIS-CB. As was originally planned, an RFQ cooler-buncher will precede the EBIS-CB. Recently, it was decided to include a multi-reflection time-of-flight (MR-TOF) mass-spectrometer following the RFQ. MR-TOF is a relatively new technology used to purify beams with a mass-resolving power up to 3×10{sup 5} as was demonstrated in experiments at CERN/ISOLDE. Very high purity singly-charged radioactive ion beams will be injected into the EBIS for charge breeding and due to its inherent properties, the EBIS-CB will maintain the purity of the charge bred beams. Possible contamination of residual gas ions will be greatly suppressed by achieving ultra-high vacuum in the EBIS trap. This paper will present and discuss the design of the LEBT and the overall integration of the EBIS-CB into ATLAS.

  11. Analysis of patents on mining technology

    Energy Technology Data Exchange (ETDEWEB)

    Menyailo, N.I.; Grishchenko, A.N.; Ratner, M.V.; Kobylyanskii, A.Ya.; Tyshlek, E.G.

    1987-09-01

    Analyses the current work being carried out with the aim of developing and perfecting coal mining technology with regard to improving safety and working conditions (equipment is currently responsible for 6.3% of all hazards in coal mines) by examining patents of class ES 21 S produced in the USSR, USA, UK, FRG, Japan and France between 1970-1984. By far the majority of patents is concerned with improving technology and productivity and a disappointing number deals with safety matters (only 7.2% of the patents for new cutter loader designs deal with dust suppression systems and most of these come from the FRG; no patents for powered mining complexes deal with the problem of noise and vibration reduction). The patents with the most direct relevance to health and safety concern remote control devices for mining equipment, in particular, devices based on radioactive isotopes (e.g. cesium-137, americum-241, selenium-75, californium-252) but measures for monitoring them and protecting against them are not found.

  12. MinT: Middleware for Cooperative Interaction of Things

    Directory of Open Access Journals (Sweden)

    Soobin Jeon

    2017-06-01

    Full Text Available This paper proposes an Internet of Things (IoT middleware called Middleware for Cooperative Interaction of Things (MinT. MinT supports a fully distributed IoT environment in which IoT devices directly connect to peripheral devices easily construct a local or global network, and share their data in an energy efficient manner. MinT provides a sensor abstract layer, a system layer and an interaction layer. These enable integrated sensing device operations, efficient resource management, and active interconnection between peripheral IoT devices. In addition, MinT provides a high-level API to develop IoT devices easily for IoT device developers. We aim to enhance the energy efficiency and performance of IoT devices through the performance improvements offered by MinT resource management and request processing. The experimental results show that the average request rate increased by 25% compared to Californium, which is a middleware for efficient interaction in IoT environments with powerful performance, an average response time decrease of 90% when resource management was used, and power consumption decreased by up to 68%. Finally, the proposed platform can reduce the latency and power consumption of IoT devices.

  13. MinT: Middleware for Cooperative Interaction of Things

    Science.gov (United States)

    Jeon, Soobin; Jung, Inbum

    2017-01-01

    This paper proposes an Internet of Things (IoT) middleware called Middleware for Cooperative Interaction of Things (MinT). MinT supports a fully distributed IoT environment in which IoT devices directly connect to peripheral devices easily construct a local or global network, and share their data in an energy efficient manner. MinT provides a sensor abstract layer, a system layer and an interaction layer. These enable integrated sensing device operations, efficient resource management, and active interconnection between peripheral IoT devices. In addition, MinT provides a high-level API to develop IoT devices easily for IoT device developers. We aim to enhance the energy efficiency and performance of IoT devices through the performance improvements offered by MinT resource management and request processing. The experimental results show that the average request rate increased by 25% compared to Californium, which is a middleware for efficient interaction in IoT environments with powerful performance, an average response time decrease of 90% when resource management was used, and power consumption decreased by up to 68%. Finally, the proposed platform can reduce the latency and power consumption of IoT devices. PMID:28632182

  14. An Account of Oak Ridge National Laboratory's Thirteen Research Reactors

    Energy Technology Data Exchange (ETDEWEB)

    Rosenthal, Murray Wilford [ORNL

    2009-08-01

    The Oak Ridge National Laboratory has built and operated 13 nuclear reactors in its 66-year history. The first was the graphite reactor, the world's first operational nuclear reactor, which served as a plutonium production pilot plant during World War II. It was followed by two aqueous-homogeneous reactors and two red-hot molten-salt reactors that were parts of power-reactor development programs and by eight others designed for research and radioisotope production. One of the eight was an all-metal fast burst reactor used for health physics studies. All of the others were light-water cooled and moderated, including the famous swimming-pool reactor that was copied dozens of times around the world. Two of the reactors were hoisted 200 feet into the air to study the shielding needs of proposed nuclear-powered aircraft. The final reactor, and the only one still operating today, is the High Flux Isotope Reactor (HFIR) that was built particularly for the production of californium and other heavy elements. With the world's highest flux and recent upgrades that include the addition of a cold neutron source, the 44-year-old HFIR continues to be a valuable tool for research and isotope production, attracting some 500 scientific visitors and guests to Oak Ridge each year. This report describes all of the reactors and their histories.

  15. Neutron Detector Signal Processing to Calculate the Effective Neutron Multiplication Factor of Subcritical Assemblies

    Energy Technology Data Exchange (ETDEWEB)

    Talamo, Alberto [Argonne National Lab. (ANL), Argonne, IL (United States). Nuclear Engineering Division; Gohar, Yousry [Argonne National Lab. (ANL), Argonne, IL (United States). Nuclear Engineering Division

    2016-06-01

    This report describes different methodologies to calculate the effective neutron multiplication factor of subcritical assemblies by processing the neutron detector signals using MATLAB scripts. The subcritical assembly can be driven either by a spontaneous fission neutron source (e.g. californium) or by a neutron source generated from the interactions of accelerated particles with target materials. In the latter case, when the particle accelerator operates in a pulsed mode, the signals are typically stored into two files. One file contains the time when neutron reactions occur and the other contains the times when the neutron pulses start. In both files, the time is given by an integer representing the number of time bins since the start of the counting. These signal files are used to construct the neutron count distribution from a single neutron pulse. The built-in functions of MATLAB are used to calculate the effective neutron multiplication factor through the application of the prompt decay fitting or the area method to the neutron count distribution. If the subcritical assembly is driven by a spontaneous fission neutron source, then the effective multiplication factor can be evaluated either using the prompt neutron decay constant obtained from Rossi or Feynman distributions or the Modified Source Multiplication (MSM) method.

  16. Fast neutron tomography with real-time pulse-shape discrimination in organic scintillation detectors

    Energy Technology Data Exchange (ETDEWEB)

    Joyce, Malcolm J., E-mail: m.joyce@lancaster.ac.uk [Department of Engineering, Lancaster University, Lancaster, Lancashire LA1 4YW (United Kingdom); Agar, Stewart [Department of Engineering, Lancaster University, Lancaster, Lancashire LA1 4YW (United Kingdom); Aspinall, Michael D. [Hybrid Instruments Ltd., Gordon Manley Building, Lancaster Environment Centre, Lancaster University, Lancaster LA1 4YW (United Kingdom); Beaumont, Jonathan S.; Colley, Edmund; Colling, Miriam; Dykes, Joseph; Kardasopoulos, Phoevos; Mitton, Katie [Department of Engineering, Lancaster University, Lancaster, Lancashire LA1 4YW (United Kingdom)

    2016-10-21

    A fast neutron tomography system based on the use of real-time pulse-shape discrimination in 7 organic liquid scintillation detectors is described. The system has been tested with a californium-252 source of dose rate 163 μSv/h at 1 m and neutron emission rate of 1.5×10{sup 7} per second into 4π and a maximum acquisition time of 2 h, to characterize two 100×100×100 mm{sup 3} concrete samples. The first of these was a solid sample and the second has a vertical, cylindrical void. The experimental data, supported by simulations with both Monte Carlo methods and MATLAB®, indicate that the presence of the internal cylindrical void, corners and inhomogeneities in the samples can be discerned. The potential for fast neutron assay of this type with the capability to probe hydrogenous features in large low-Z samples is discussed. Neutron tomography of bulk porous samples is achieved that combines effective penetration not possible with thermal neutrons in the absence of beam hardening.

  17. Report on the workshop "Decay spectroscopy at CARIBU: advanced fuel cycle applications, nuclear structure and astrophysics". 14-16 April 2011, Argonne National Laboratory, USA.

    Energy Technology Data Exchange (ETDEWEB)

    Kondev, F.; Carpenter, M.P.; Chowdhury, P.; Clark, J.A.; Lister, C.J.; Nichols, A.L.; Swewryniak, D. (Nuclear Engineering Division); (Univ. of Massachusetts); (Univ. of Surrey)

    2011-10-06

    A workshop on 'Decay Spectroscopy at CARIBU: Advanced Fuel Cycle Applications, Nuclear Structure and Astrophysics' will be held at Argonne National Laboratory on April 14-16, 2011. The aim of the workshop is to discuss opportunities for decay studies at the Californium Rare Isotope Breeder Upgrade (CARIBU) of the ATLAS facility with emphasis on advanced fuel cycle (AFC) applications, nuclear structure and astrophysics research. The workshop will consist of review and contributed talks. Presentations by members of the local groups, outlining the status of relevant in-house projects and availabile equipment, will also be organized. time will also be set aside to discuss and develop working collaborations for future decay studies at CARIBU. Topics of interest include: (1) Decay data of relevance to AFC applications with emphasis on reactor decay heat; (2) Discrete high-resolution gamma-ray spectroscopy following radioactive decya and related topics; (3) Calorimetric studies of neutron-rich fission framgents using Total ABsorption Gamma-Ray Spectrometry (TAGS) technique; (4) Beta-delayed neutron emissions and related topics; and (5) Decay data needs for nuclear astrophysics.

  18. The cross sections of fusion-evaporation reactions: the most promising route to superheavy elements beyond Z=118

    Directory of Open Access Journals (Sweden)

    Jadambaa Khuyagbaatar

    2017-01-01

    Full Text Available The synthesis of superheavy elements beyond oganesson (Og, which has atomic number Z = 118, is currently one of the main topics in nuclear physics. An absence of sufficient amounts of target material with atomic numbers heavier than californium (Z = 98 forces the use of projectiles heavier than 48Ca (Z = 20, which has been successfully used for the discoveries of elements with Z = 114 - 118 in complete fusion reactions. Experimental cross sections of 48Ca with actinide targets behave very differently to “cold” and “hot” fusion-evaporation reactions, where doubly-magic lead and deformed actinides are used as targets, respectively. The known cross sections of these reactions have been analysed compared to calculated fission barriers. It has been suggested that observed discrepancies between the cross sections of 48Ca-induced and other fusionevaporation reactions originate from the shell structure of the compound nucleus, which lies in the island of the stability. Besides scarcely known data on other reactions involving heavier projectiles, the most promising projectile for the synthesis of the elements beyond Og seems to be 50Ti. However, detailed studies of 50Ti, 54Cr, 58Fe and 64Ni-induced reactions are necessary to be performed in order to fully understand the complexities of superheavy element formation.

  19. Intracavitary moderator balloon combined with (252)Cf brachytherapy and boron neutron capture therapy, improving dosimetry in brain tumour and infiltrations.

    Science.gov (United States)

    Brandão, S F; Campos, T P R

    2015-07-01

    This article proposes a combination of californium-252 ((252)Cf) brachytherapy, boron neutron capture therapy (BNCT) and an intracavitary moderator balloon catheter applied to brain tumour and infiltrations. Dosimetric evaluations were performed on three protocol set-ups: (252)Cf brachytherapy combined with BNCT (Cf-BNCT); Cf-BNCT with a balloon catheter filled with light water (LWB) and the same set-up with heavy water (HWB). Cf-BNCT-HWB has presented dosimetric advantages to Cf-BNCT-LWB and Cf-BNCT in infiltrations at 2.0-5.0 cm from the balloon surface. However, Cf-BNCT-LWB has shown superior dosimetry up to 2.0 cm from the balloon surface. Cf-BNCT-HWB and Cf-BNCT-LWB protocols provide a selective dose distribution for brain tumour and infiltrations, mainly further from the (252)Cf source, sparing the normal brain tissue. Malignant brain tumours grow rapidly and often spread to adjacent brain tissues, leading to death. Improvements in brain radiation protocols have been continuously achieved; however, brain tumour recurrence is observed in most cases. Cf-BNCT-LWB and Cf-BNCT-HWB represent new modalities for selectively combating brain tumour infiltrations and metastasis.

  20. Intracavitary moderator balloon combined with 252Cf brachytherapy and boron neutron capture therapy, improving dosimetry in brain tumour and infiltrations

    Science.gov (United States)

    Brandão, S F

    2015-01-01

    Objective: This article proposes a combination of californium-252 (252Cf) brachytherapy, boron neutron capture therapy (BNCT) and an intracavitary moderator balloon catheter applied to brain tumour and infiltrations. Methods: Dosimetric evaluations were performed on three protocol set-ups: 252Cf brachytherapy combined with BNCT (Cf-BNCT); Cf-BNCT with a balloon catheter filled with light water (LWB) and the same set-up with heavy water (HWB). Results: Cf-BNCT-HWB has presented dosimetric advantages to Cf-BNCT-LWB and Cf-BNCT in infiltrations at 2.0–5.0 cm from the balloon surface. However, Cf-BNCT-LWB has shown superior dosimetry up to 2.0 cm from the balloon surface. Conclusion: Cf-BNCT-HWB and Cf-BNCT-LWB protocols provide a selective dose distribution for brain tumour and infiltrations, mainly further from the 252Cf source, sparing the normal brain tissue. Advances in knowledge: Malignant brain tumours grow rapidly and often spread to adjacent brain tissues, leading to death. Improvements in brain radiation protocols have been continuously achieved; however, brain tumour recurrence is observed in most cases. Cf-BNCT-LWB and Cf-BNCT-HWB represent new modalities for selectively combating brain tumour infiltrations and metastasis. PMID:25927876

  1. Investigation of Workplace-like Calibration Fields via a Deuterium-Tritium (D-T) Neutron Generator.

    Science.gov (United States)

    Mozhayev, Andrey V; Piper, Roman K; Rathbone, Bruce A; McDonald, Joseph C

    2017-04-01

    Radiation survey meters and personal dosimeters are typically calibrated in reference neutron fields based on conventional radionuclide sources, such as americium-beryllium (Am-Be) or californium-252 (Cf), either unmodified or heavy-water moderated. However, these calibration neutron fields differ significantly from the workplace fields in which most of these survey meters and dosimeters are being used. Although some detectors are designed to yield an approximately dose-equivalent response over a particular neutron energy range, the response of other detectors is highly dependent upon neutron energy. This, in turn, can result in significant over- or underestimation of the intensity of neutron radiation and/or personal dose equivalent determined in the work environment. The use of simulated workplace neutron calibration fields that more closely match those present at the workplace could improve the accuracy of worker, and workplace, neutron dose assessment. This work provides an overview of the neutron fields found around nuclear power reactors and interim spent fuel storage installations based on available data. The feasibility of producing workplace-like calibration fields in an existing calibration facility has been investigated via Monte Carlo simulations. Several moderating assembly configurations, paired with a neutron generator using the deuterium tritium (D-T) fusion reaction, were explored.

  2. Production of medical radioisotopes in the ORNL High Flux Isotope Reactor (HFIR) for cancer treatment and arterial restenosis therapy after PTCA

    Energy Technology Data Exchange (ETDEWEB)

    Knapp, F.F. Jr.; Beets, A.L.; Mirzadeh, S.; Alexander, C.W.; Hobbs, R.L.

    1998-06-01

    The High Flux Isotope Reactor (HFIR) at the Oak Ridge National Laboratory (ORNL) represents an important resource for the production of a wide variety of medical radioisotopes. In addition to serving as a key production site for californium-252 and other transuranic elements, important examples of therapeutic radioisotopes which are currently routinely produced in the HFIR for distribution include dysprosium-166 (parent of holmium-166), rhenium-186, tin-117m and tungsten-188 (parent of rhenium-188). The nine hydraulic tube (HT) positions in the central high flux region permit the insertion and removal of targets at any time during the operating cycle and have traditionally represented a major site for production of medical radioisotopes. To increase the irradiation capabilities of the HFIR, special target holders have recently been designed and fabricated which will be installed in the six Peripheral Target Positions (PTP), which are also located in the high flux region. These positions are only accessible during reactor refueling and will be used for long-term irradiations, such as required for the production of tin-117m and tungsten-188. Each of the PTP tubes will be capable of housing a maximum of eight HT targets, thus increasing the total maximum number of HT targets from the current nine, to a total of 57. In this paper the therapeutic use of reactor-produced radioisotopes for bone pain palliation and vascular brachytherapy and the therapeutic medical radioisotope production capabilities of the ORNL HFIR are briefly discussed.

  3. 'n Begronde bedieningsmodel vir die diakonia van die gemeente

    African Journals Online (AJOL)

    15 Feb 2012 ... 'n model (Pastoral Family Model) (2008:235–237). Hy gee ook belangrike aspekte van die toepassing van die model weer (2008:244–247), maar .... geleenthede is gereël waar lidmate die sinodebesluite kon bespreek, asook die rigting waarin die kerkraad dink met die oog op 'n nuwe bedieningsmodel.

  4. Stereotypes on Nodding syndrome: responses of health workers in ...

    African Journals Online (AJOL)

    EB

    patients with intellectual disability, substance abuse, and acute mental illness: a cross-sectional study. BMC Med Educ 2010; 10:71. 2. Hilton JL, von Hippel W: Stereotypes. Annu Rev. Psychol 1996; 47:237-271. 3. Rusch N, Angermeyer MC, Corrigan PW. Mental illness stigma: concepts, consequences, and initiatives to ...

  5. Biological Art of Producing Useful Chemicals

    Indian Academy of Sciences (India)

    Home; Journals; Resonance – Journal of Science Education; Volume 21; Issue 3. Metabolic Engineering: Biological Art of Producing Useful Chemicals. Ram Kulkarni. General Article Volume 21 Issue 3 March 2016 pp 233-237. Fulltext. Click here to view fulltext PDF. Permanent link:

  6. Indications, output and types of eyelid surgeries in a tertiary eye care ...

    African Journals Online (AJOL)

    Eyelid surgeries were performed on 237 eyes of 221 persons, 121(54.8%) were males. Mean age was 30.3 ± 17.8 years. Eyelid lacerations, chalazia, and eyelid tumours accounted for 30%, 25.8%, 21% of all morbidities respectively. 249 eyelid surgeries were performed, 246 (98.8%) as minor procedures and 3(1.2%) as ...

  7. Enzootic plague foci, Algeria

    Directory of Open Access Journals (Sweden)

    M.A. Malek

    2015-03-01

    Full Text Available In Algeria, PCR sequencing of pla, glpD and rpoB genes found Yersinia pestis in 18/237 (8% rodents of five species, including Apodemus sylvaticus, previously undescribed as pestiferous; and disclosed three new plague foci. Multiple spacer typing confirmed a new Orientalis variant. Rodent survey should be reinforced in this country hosting reemerging plague.

  8. Delineation of the recharge areas and distinguishing the sources of ...

    Indian Academy of Sciences (India)

    8

    sinkholes also support the Bringi stream as an ideal source of recharge. Based on the .... hazards in karst. Environmental Geology 58:235-237. Payne BR., Yurtsever Y. 1974. Environmental isotopes as hydrogeological tool in Nicaragua, In. Proceedings of a ... Aquifer System, Everglades National Park, Florida, USA.

  9. Improved Refolding Efficacy of Recombinant Human Interferon α-2b ...

    African Journals Online (AJOL)

    helix from 23.7 % at ... synthesis overwhelm the folding machinery or the cell's capacity .... Table 3: Secondary structure of refolded rhIFN α-2b determined by CD spectropolarimetry at different pH values. pH. Helix (%). Beta Sheet (%). Turn (%).

  10. Unemployment Impairs Mental Health: Meta-Analyses

    Science.gov (United States)

    Paul, Karsten I.; Moser, Klaus

    2009-01-01

    The effect of unemployment on mental health was examined with meta-analytic methods across 237 cross-sectional and 87 longitudinal studies. The average overall effect size was d = 0.51 with unemployed persons showing more distress than employed persons. A significant difference was found for several indicator variables of mental health (mixed…

  11. Znovuuvedení kritické analýzy diskurzu do českého prostředí

    Czech Academy of Sciences Publication Activity Database

    Homoláč, Jiří; Mrázková, Kamila

    2017-01-01

    Roč. 78, č. 3 (2017), s. 237-253 ISSN 0037-7031 Institutional support: RVO:68378092 Keywords : critical discourse analysis * discourse-historical approach * discursive strategies * topos Subject RIV: AI - Linguistics OBOR OECD: Linguistics Impact factor: 0.625, year: 2016

  12. Semi-automatic motion compensation of contrast-enhanced ultrasound images from abdominal organs for perfusion analysis

    Czech Academy of Sciences Publication Activity Database

    Schafer, S.; Nylund, K.; Saevik, F.; Engjom, T.; Mézl, M.; Jiřík, Radovan; Dimcevski, G.; Gilja, O.H.; Tönnies, K.

    2015-01-01

    Roč. 63, AUG 1 (2015), s. 229-237 ISSN 0010-4825 R&D Projects: GA ČR GAP102/12/2380 Institutional support: RVO:68081731 Keywords : ultrasonography * motion analysis * motion compensation * registration * CEUS * contrast-enhanced ultrasound * perfusion * perfusion modeling Subject RIV: FS - Medical Facilities ; Equipment Impact factor: 1.521, year: 2015

  13. The Role of Academic Factors, Self-Efficacy, Mentoring Relationships and Learning Communities in Persistence and Academic Success of Freshman College Students

    Science.gov (United States)

    Baier, Stefanie Theresia

    2014-01-01

    Many U.S. universities are concerned with student retention. The current study surveyed 237 first time college students at a Midwestern university to determine the extent to which social-cognitive factors, such as high school GPA, ACT scores, first semester college GPA, college self-efficacy and perceptions of mentorship support influence…

  14. Dealing with Uncertainty about Item Parameters: Expected Response Functions

    Science.gov (United States)

    1994-04-01

    Psychometric Society, Nashville TN, June, 1985. Lindley, D.V. (1980). Approximate Bayesian methods. Trabajos Estadistica , 31,223-237. Lord, F.M. (1980...isn’t actually a maximum likelihood estimate of the mean, the likelihood may not increase uniformly. To prevent premature stopping of the estimation

  15. Journal of Agricultural Extension http://dx.doi.org/10.4314/jae.v18i2 ...

    African Journals Online (AJOL)

    PROF. MADUKWE

    Data analysis. Data were ... technologies of sesame production except diseases and pest control (2.79) and harrowing(M=2.2). .... linking farmers and other stake holders to commercial banks (M = 2.37) and buying all sesame produced ...

  16. Analysis of shape isomer yields of Pu in the framework of dynamical ...

    Indian Academy of Sciences (India)

    of induced fission [1] to analyse experimental fission probabilities of some Pu isotopes and shape isomer yields ... It should be stressed that so far experimental data on shape isomer yields for 237Pu have only been analysed on ... (2) population of the second potential well and cooling via particle or γ emission (this event is ...

  17. NMCI to NGEN: Managing the Transition of Navy Information Technology Infrastructure

    Science.gov (United States)

    2013-03-01

    management survey / KPMG Information Risk Management group. (2005). Sydney, Australia : KPMG. Goss,T., Pascale, R. & Athos, A. (1998). The reinvention roller...The case of homeless management information systems. International Journal of Project Management, 23(7), 513 – 523. http://dx.doi.org/10.1016

  18. Trade policy in markets with collusion: the case of North–South R&D spillovers

    Czech Academy of Sciences Publication Activity Database

    Boone, J.; Žigić, Krešimir

    2015-01-01

    Roč. 69, č. 2 (2015), s. 224-237 ISSN 1090-9443 R&D Projects: GA ČR(CZ) GAP402/12/0961 Institutional support: PRVOUK-P23 Keywords : R&D spillovers * tariff protection * supergames Subject RIV: AH - Economics

  19. Potential emigration of Siberian cattle germplasm on Chirikof Island ...

    Indian Academy of Sciences (India)

    4Department of Environmental and Biological Sciences, University of Eastern Finland, PO Box 1627,. FI-70211 Kuopio, Finland ..... update. Bioinformatics 28, 2537–2539. Reed D. H. and Frankham R. 2003 Correlation between fitness and genetic diversity. Conserv. Biol. 17, 230–237. Ruzina M. N., Shtyfurko T. A., ...

  20. Social Justice Perceptions of Teacher Candidates

    Science.gov (United States)

    Turhan, Muhammed

    2010-01-01

    This study aims to determine the social justice perceptions of teacher candidates being trained in an education faculty. For this purpose, national and international literature was reviewed by the researcher and a 32-item questionnaire was developed and implemented on 237 senior year education faculty students. Data from the questionnaires were…

  1. Correlates of functional disability in early rheumatoid arthritis : A cross-sectional study of 706 patients in four European countries

    NARCIS (Netherlands)

    Smedstad, LM; Moum, T; Guillemin, F; Kvien, TK; Finch, MB; Suurmeijer, TPBM; vandenHeuvel, WJA

    In this cross-sectional study of 706 European patients with rheumatoid arthritis (RA) of less than or equal to 4 yr duration, we examined possible correlates of functional disability assessed by the Health Assessment Questionnaire. First, we examined a subsample of 237 Norwegian patients. The

  2. CLIC Drive Beam Accelerating Structures

    CERN Document Server

    Wegner, Rolf

    2012-01-01

    Travelling structures for accelerating the high-current (4.2 A) CLIC Drive Beam to an energy of 2.37 GeV are presented. The structures are optimised for efficiency (full beam loading operation) and a desired filling time. Higher order modes are studied and are reduced by detuning along the structure and by damping with silicon carbide loads.

  3. Journal of Genetics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Genetics; Volume 95; Issue 2. Issue front cover thumbnail. Volume 95, Issue 2. June 2016, pages 229-480. pp 229-230 CORRESPONDENCE. Comments on 'A note on the variance of the estimate of the fixation index F' · Ranajit Chakraborty · More Details Abstract Fulltext PDF. pp 231-237 ...

  4. 77 FR 18766 - Proposed Flood Elevation Determinations

    Science.gov (United States)

    2012-03-28

    ... Incorporated Areas * Elevation in feet (NGVD) + Elevation in feet (NAVD) Depth in feet above Flooding source(s... Cass upstream of U.S. Route County. 59. Hurricane Creek Approximately 250 feet None +237 Unincorporated... Datum. + North American Vertical Datum. Depth in feet above ground. Mean Sea Level, rounded to the...

  5. North Jetty Performance and Entrance Navigation Channel Maintenance, Grays Harbor, Washington. Volume 2. Appendices

    Science.gov (United States)

    2004-06-01

    Figure E471 . East-west velocity component at node 13251 (neap tide, west-northwest waves...Circulation Simulation Results E237 Figure E470. North-south velocity component at node 13251 (neap tide, west- northwest waves) Figure E471

  6. Theoretical Analyses of the Functional Regions of the Heavy Chain of Botulinum Neurotoxin

    Science.gov (United States)

    1994-01-01

    hemifacial spasm . Mov Disord 1987:4:237-254. 5. Brin MF. Blitzer A, Fahn S, Gould W. Lovelace RE. Adductor laryngeal dystonia (spastic dysphonia): treatment... reviews (6-9). The primary toxic effect of all the BTX serotypes (excluding the C2 and C3 serotypes I10)) is flaccid paralysis. The toxin prevents

  7. A Longitudinal Investigation of the Development of Weight and Muscle Concerns among Preadolescent Boys

    Science.gov (United States)

    Ricciardelli, Lina A.; McCabe, Marita P.; Lillis, Jessica; Thomas, Kristina

    2006-01-01

    The study examined the impact of body mass index (BMI), negative affect, self-esteem, and sociocultural influences in the development of weight and muscle concerns among preadolescent boys. Body dissatisfaction, importance placed on weight and muscles, weight loss strategies, and strategies to increase muscles were evaluated. Participants were 237

  8. Dicty_cDB: Contig-U15153-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 42 ) Dictyostelium discoideum gamete cDNA, clone FC-AU21. 400 e-170 4 ( BV426376 ) S237P6125FG3.T0 Portugu...eseWaterDog Canis familiar... 52 0.020 1 ( AC068970 ) Homo sapiens BAC clone RP11-8

  9. Dicty_cDB: Contig-U15405-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available tugueseWaterDog Canis familiar... 44 0.80 1 ( BV312740 )...s troglodyt... 44 0.80 1 ( BV495481 ) S217P61918FE2.T0 Noemie Pan troglodytes troglodyt... 44 0.80 1 ( BV436248 ) S237P6495RF5.T0 Por

  10. Dicty_cDB: Contig-U14247-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 22555 ) Zebrafish DNA sequence from clone DKEY-19D21 in l... 44 7.5 1 ( BV440136 ) S237P6107RD7.T0 Portugu...eseWaterDog Canis familiar... 44 7.5 1 ( AC158364 ) Mus musculus BAC clone RP23-187

  11. Dicty_cDB: CHK317 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available nments: (bits) Value N AL844507 |AL844507.1 Plasmodium falciparum chromosome 8. 66 2e-13 2 BV429546 |BV429546.1 S237P6409FA7.T0 Portu...gueseWaterDog Canis familiaris STS genomic, sequence tag

  12. Dicty_cDB: Contig-U09376-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 1540 ) S237P6228RD7.T0 PortugueseWaterDog Canis familiar... 44 8.9 1 ( BV422520 )...H211-264C24 in... 44 8.9 1 ( BX294128 ) Zebrafish DNA sequence from clone DKEYP-35F12 in ... 44 8.9 1 ( BV44

  13. Dicty_cDB: Contig-U04524-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 06281 ) Plasmodium falciparum chromosome 12 clone PFYACB8... 36 6.5 7 ( BV433064 ) S237P691RD10.T0 Portugu...eseWaterDog Canis familiar... 36 6.5 2 ( BX119923 ) Zebrafish DNA sequence from clo

  14. Thermohaline features of the subsurface cyclonic eddy in the south ...

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Earth System Science; Volume 112; Issue 2. Thermohaline features of the subsurface cyclonic eddy in the south central Bay of Bengal during August 1999. P Madhusoodanan V V James. Volume 112 Issue 2 June 2003 pp 233-237 ...

  15. Reference: 523 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available affan et al. 2007 Jan. Plant Cell 19(1):237-55. The secondary cell wall in higher plants consists mainly of ...nd homogalacturonan in higher plants and that IRX8 provides an important link bet...ellulose deficiency. Taken together, the data presented show that IRX8 affects the level of glucuronoxylan a

  16. Psalm 98: Sing 'n nuwe lied tot lof van die Koning, Jahwe

    African Journals Online (AJOL)

    10. Die Psalm word in twee strofes, naamlik vers 1-3 en 4-9 ingedeel deur byvoor beeld Jeremias (1987:132-133); Anderson (1981:691-693); Deissler (1975:385);. Criisemann (1969:71); Eaton (1967:237); Kraus (1966:676); Ridderbos (1958: 452-453); Buttenwieser (1938:318-319); Schmidt (1934:180). Tate (1990:524-.

  17. e' QRIGINAL ARTICLES

    African Journals Online (AJOL)

    modelling techniques were used to quantify uncertainty in the estimates. ... uncertainty interval 6.6 - 7.4%) of total DALYs in 2000. Injuries .... particularly sensitive nature of the question. Data from three underprivileged areas in the Western Cape“ suggest little awareness of the health risks of alcohol as 23.7% of the sample.

  18. Overtopping Measurements on the Wave Dragon Nissum Bredning Prototype

    DEFF Research Database (Denmark)

    Frigaard, Peter; Kofoed, Jens Peter; Rasmussen, Michael R.

    2004-01-01

    The paper describes the methods used to estimate (calculated from some indirect measurements) the overtopping of the wave energy converter Wave Dragon placed in a real sea environment. The wave energy converter in quistion is the 237-tonne heavy Wave Dragon Nissum Bredning Prototype. Comparisons ...

  19. Does intensity of physical activity moderate interrelationships among ...

    African Journals Online (AJOL)

    The aim of this study was to determine whether perceived intensity of training moderates the physical activity-health, physical activity-fitness, and fitness-health relationships. The participants (N=237) from eight different companies were assessed for participation in physical activity, cardiovascular fitness and health. Fasting ...

  20. 40 CFR 799.9630 - TSCA developmental neurotoxicity.

    Science.gov (United States)

    2010-07-01

    ... Teratology 10:237-244 (1988). (4) Campbell, B.A. and Haroutunian, V. Effects of age on long-term memory... separation as an external sign of pubertal development in the male rat. Biology of Reproduction 17:298-303... fetal period. Neurobehavioral Toxicology 1:129-135 (1979). (20) Spear, N.E. and Campbell, B.A. (eds...

  1. Viron kirjallisuuden kieli 1990-luvulla modernismin, postmodernismin ja postkolonialismin taustaa vasten / Tiit Hennoste ; tõlk. Niko Remes

    Index Scriptorium Estoniae

    Hennoste, Tiit, 1953-

    2003-01-01

    Andmed autori kohta lk. 237. Orig.: Eesti kirjanduse keelest modernismi, postmodernismi ja postkolonialismi taustal. Ilmunud ka kogumikus: Hennoste, Tiit. Eurooplaseks saamine : kõrvaltkäija altkulmupilk. Tartu : Tartu Ülikooli Kirjastus, 2003, lk. 202-231. Bibliograafia lk. 229-231

  2. Browse Title Index

    African Journals Online (AJOL)

    Items 1 - 50 of 237 ... Vol 55 (2014), 20 Years of democracy: Transforming the public service, Abstract. A Ruiters ... Vol 58 (2015), Anything but charity: Fixing the ills of bee share purchase schemes, Abstract. L Nobaza ... Vol 56 (2014), BEE share-purchase deals: South Africa's biggest corporate fraud, Abstract. L Nobaza.

  3. Bacterial utilization of size-fractionated dissolved organic matter

    Digital Repository Service at National Institute of Oceanography (India)

    Khodse, V.B.; Bhosle, N.B.

    ), dissolved uronic acid (DURA), delta13C, bacterial abundance (BA), and bacterial production (BP). The LMW fraction was isotopically heavier (delta13C = −23.7 to −21.7ppt) than the HMW fraction (delta13C = −27.0 to −26.2ppt), and the initial TDCHO content...

  4. Attachment-based intervention for enhancing sensitive discipline in mothers of 1- to 3-year-old children at risk for externalizing behavior problems: A randomized controlled trial

    NARCIS (Netherlands)

    van Zeijl, J.; Mesman, J.; van IJzendoorn, M.H.; Bakermans-Kranenburg, M.J.; Juffer, F.; Stolk, M.N.; Koot, H.M.; Alink, L.R.A.

    2006-01-01

    The home-based intervention program Video-feedback Intervention to promote Positive Parenting and Sensitive Discipline (VIPP-SD) was tested in a randomized controlled trial with 237 families screened for their 1- to 3-year-old children's relatively high scores on externalizing behavior. VIPP-SD,

  5. Simulation of logical traffic isolation using differentiated services

    CSIR Research Space (South Africa)

    Dlamini, I

    2009-06-01

    Full Text Available ://www.forensicmag.com/articles.asp? pid=130, as on April, 12, 2008. [3] Strauss, T., Olivier, M.S. & Kourie, D.G. 2006, Differentiated Services for Logical Traffic Isolation, in M.S. Olivier and S. Shenoi (Eds), Advances in Digital Forensics II, pp 229-237, Springer. [4] Vidas, T...

  6. Large-scale study on effects of metritis on reproduction in Danish Holstein cows

    DEFF Research Database (Denmark)

    Elkjær, Karina; Labouriau, Rodrigo; Ancker, Marie-Louise

    2013-01-01

    A total of 398,237 lactations of Danish Holstein dairy cows were studied with the main objective to investigate the effects of metritis on 2 fertility variables: interval from calving to first insemination (CFI) and nonreturn rate at 56d after first insemination (NR56), adjusting for milk product...

  7. Sustainable tourism development and the world heritage status of ...

    African Journals Online (AJOL)

    Our study investigates to what extent the World Heritage status of the Wadden Sea matters to tourists visiting the Wadden island of Terschelling, in the off season. Results showed that for most respondents (93.5%) the World Heritage Status was not a reason to visit Terschelling, while almost a quarter (23.7%) did not know ...

  8. Symptoms of Post-Traumatic Stress Disorder among Surviving Parents of Child Homicide Victims.

    Science.gov (United States)

    Rinear, Eileen E.

    This paper recognizes murder as a major cause of mortality among adolescents and young adults and addresses the need for research examining the effects of murder on the victim's surviving family members. The information contained in this report was obtained from surveys completed by 237 members of the Parents of Murdered Children support group.…

  9. Experiencing More Mathematics Anxiety than Expected? Contrasting Trait and State Anxiety in High Achieving Students

    Science.gov (United States)

    Roos, A.-L.; Bieg, M.; Goetz, T.; Frenzel, A. C.; Taxer, J.; Zeidner, M.

    2015-01-01

    This study examined mathematics anxiety among high and low achieving students (N = 237, grades 9 and 10) by contrasting trait (habitual) and state (momentary) assessments of anxiety. Previous studies have found that trait anxiety measures are typically rated higher than state measures. Furthermore, the academic self-concept has been identified to…

  10. Early career burnout among Dutch nurses: A process captured in a Rasch model

    NARCIS (Netherlands)

    Vos, J.A. de; Brouwers, A.; Schoot, T.; Pat-El, R.; Verboon, P.; Näring, G.W.B.

    2016-01-01

    This study investigates burnout among Dutch nursing graduates as a process by testing a sequential-developmental model. A sample of 237 respondents was recruited from a population of Dutch early career nurses. Burnout was measured with the Dutch version of the Maslach Burnout Inventory Human

  11. HIV testing among youths in a Nigerian local population

    African Journals Online (AJOL)

    'avaient pas subi au test du dépistage du SIDA, 237 soit 68,2% voudraient le faire dans le cas ou le test est gratuit, 278 soit 79,9% des sondés voulaient le faire. Des jeunes célibataires, ceux avec enseignement secondaire du moins et des ...

  12. Neovison vison

    Indian Academy of Sciences (India)

    2014-07-24

    Jul 24, 2014 ... Breathnach A. S. 1988 Extra-cutaneous melanin. Pigm. Cell Res. 1(4), 234–237. Conlee J. W., Parks Y. N., Schwartz I. R. and Creel D. J. 1989 Com- parative anatomy of melanin pigment in the stria vascularis. Evi- dence for distinction between melanocytes and intermediate cells in the cat. Acta Otolaryngol ...

  13. Browse Title Index

    African Journals Online (AJOL)

    Items 51 - 100 of 237 ... Issue, Title. Vol 64 (2017), Book Review: What Fanon Said: Philosophical Introduction to His Life and Thought, Abstract. S'busisiwe Mnguni. Vol 57 (2015), Book Review: Winelands, wealth and work: Transformations in the Dwars River Valley, Stellenbosch, Abstract. H Smith. Vol 36 (2009), Book ...

  14. Vortices in dam reservoir: A case study of Karun III dam

    Indian Academy of Sciences (India)

    Velocity measurements are performed in the hydraulic model of Karun III ... Formation of vortices at power intakes is a challenging problem for hydraulic engineers. The ..... Eng., 137(6): 701–705. Yildirim N, Eyüpo˘glu A and Tastan K 2012 Critical Submergence for Dual Rectangular Intakes. J. Energy. Eng., 138: 237–245.

  15. Early career burnout among Dutch nurses : A process captured in a Rasch model

    NARCIS (Netherlands)

    de Vos, Jan Alexander; Brouwers, Andre; Schoot, Tineke; Pat-El, Ron; Verboon, Peter; Näring, Gerard

    2016-01-01

    This study investigates burnout among Dutch nursing graduates as a process by testing a sequential-developmental model. A sample of 237 respondents was recruited from a population of Dutch early career nurses. Burnout was measured with the Dutch version of the Maslach Burnout Inventory Human

  16. Dicty_cDB: Contig-U08768-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available hondrialis mRNA for phyllosepti... 48 0.68 1 ( AM229013 ) Phyllomedusa hypochondrialis mRNA for phyllosepti...... 48 0.68 1 ( AM229012 ) Phyllomedusa hypochondrialis mRNA for phyllosepti... 48 0.68 1 ( BV424989 ) S237P6...hypochondrialis azurea partial mRNA ... 48 0.68 1 ( AM229014 ) Phyllomedusa hypoc

  17. Resonance – Journal of Science Education | Indian Academy of ...

    Indian Academy of Sciences (India)

    More Details Fulltext PDF. pp 204-218 General Article. Sir Alfred Bray Kempe-An Amateur Kinematician · A K Mallik · More Details Fulltext PDF. pp 218-218 General Article. Errata · More Details Fulltext PDF. pp 219-219 Science Smiles. Science Smiles · Ayan Guha · More Details Fulltext PDF. pp 220-237 General Article.

  18. 24 CFR Appendix A to Part 200 - Standards Incorporated by Reference in the Minimum Property Standards for Housing (HUD Handbook...

    Science.gov (United States)

    2010-04-01

    ... Gas Code (ANSI Z223.1-1988) NFPA 70-93 National Electrical Code National Institute of Building....O. Box 6808, Falls Church, VA 22046, Telephone (703) 237-8100. National Standard Plumbing Code—1993... National Archives and Records Administration (NARA). For information on the availability of this material...

  19. Visual Problems in Night Operations (Problemes de Vision dans les Operations de Nuit)

    Science.gov (United States)

    1992-05-01

    Imagery and verbal processes, Holt, Rinehart, Winston eds, NY PIAGETJ. INHELDER B. (1966) Les images mentales, in Fraisse et Piaget, eds, Tralte de...environment. ENG Publication en serbe BERNARD E. VOL 24; pp. 237-242; 2 Fig.; 6 Phot. ;OP. 1991/03 C-91-007480 Cot article est entidrement consacr6 aux

  20. International Musicological Conference Young Musicology Prague: Czech and European Avant-garde Music of the Early 20th Century, Kabinet hudební historie Etnologického ústavu AV ČR, Praha 5.–8. září 2016

    Czech Academy of Sciences Publication Activity Database

    Pirner, Jan

    2017-01-01

    Roč. 54, č. 2 (2017), s. 236-237 ISSN 0018-7003. [International Musicological Conference Young Musicology Prague: Czech and European Avant-garde Music of the Early 20th Century. Prague, 05.10.2016-08.10.2016] Institutional support: RVO:68378076 Keywords : 20th Century * Young Musicology * Conference Subject RIV: AL - Art, Architecture, Cultural Heritage

  1. Complications of peripherally inserted central venous catheters in ...

    African Journals Online (AJOL)

    Background: The objective of this study was to assess the complications of peripherally inserted central venous catheters (PICC) in neonates admitted to neonatal surgical intensive care unit (NSICU). Patients and Methods: Retrospective analysis of 237 neonates admitted to NSICU from January 2010 to December 2011 ...

  2. Pramana – Journal of Physics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Pramana – Journal of Physics. S D Katore. Articles written in Pramana – Journal of Physics. Volume 67 Issue 2 August 2006 pp 227-237 Research Articles. Magnetized cosmological models in bimetric theory of gravitation · S D Katore R S Rane · More Details Abstract Fulltext PDF. Bianchi type-III ...

  3. Quadrupole moments of low-lying baryons with spin

    Indian Academy of Sciences (India)

    ... spin − 3 2 + → 1 2 + transitions. Neetika Sharma Harleen Dahiya. Research Articles Volume 80 Issue 2 February 2013 pp 237-249 ... GP parameters pertaining to the two- and three-quark contributions. It is found that the CQM is successful in giving a quantitative and qualitative description of the quadrupole moments.

  4. EST Table: FY038949 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available 237 aa gi|91078946|ref|XP_974065.1| PREDICTED: similar to Outer dense fiber protein 2 (Out...er dense fiber of sperm tails protein 2) (84 kDa outer dense fiber protein) (Cenexin) [Tribolium castaneum] FS892927 bmte ...

  5. Download this PDF file

    African Journals Online (AJOL)

    against a background of more general spending on health in the region of 2-3.7 % for Congo-Kinshasha and Mauritius respectively, with Madagascar and Angola slightly more than. Mauritius and Sierre Leone and Cote d'Ivoire just less than. Mauritius. When comparing the population per doctor, Cuba and Estonia with 170 ...

  6. Teachers' Emotions and Emotion Management: Integrating Emotion Regulation Theory with Emotional Labor Research

    Science.gov (United States)

    Lee, Mikyoung; Pekrun, Reinhard; Taxer, Jamie L.; Schutz, Paul A.; Vogl, Elisabeth; Xie, Xiyao

    2016-01-01

    While the similarities between emotion regulation (Gross in "J Personal Soc Psychol" 74:224-237, 1998a) and emotional labor (Hochschild in The managed heart: commercialization of human feeling. University of California Press, Berkeley, 1983) have been theoretically discussed, empirical research on their relation is lacking. We examined…

  7. Comparative evaluation of organic and conventional farming on ...

    African Journals Online (AJOL)

    SAM

    2014-04-30

    Apr 30, 2014 ... Afr. J. Biotechnol. Miliauskas G, Venskutonis PR, Van Beek TA (2004). Screening of radical scavenging activity of some medicinal and aromatic plant extracts. Food Chem. 85(2): 231-237. Morillas Ruiz JM (2005). Capacidad antioxidante, vitamina c y polifenoles de cítricos ecológicos vs convencionales In:.

  8. Why Are Drugs So Hard to Quit?

    Medline Plus

    Full Text Available ... 711 views 4:16 Overcoming Addiction ► How To Prevent Relapse - Duration: 3:51. Truth Of Addiction 109, ... Meet Jake: A Story of Drug Addiction and Recovery - Duration: 5:33. TheNewsRecordOnline 62,237 views 5: ...

  9. Gclust Server: 22014 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available 22014 Rle_RL3138 Cluster Sequences Related Sequences(3) 237 putative DNA-B helicase... protein 5 1.00e-45 0.0 0.0 0.0 6.67 12.9 0.0 Show 22014 Cluster ID 22014 Sequence ID Rle_RL3138 Link to clu

  10. Efficient plant regeneration through somatic embryogenesis in ...

    African Journals Online (AJOL)

    enoh

    2012-02-21

    Feb 21, 2012 ... [Murashige and Skoog, (1962) basal salts; B5 vitamins complex. (Gamborg et al., 1968); 2% sucrose and 0.8% ... were reduced in the developing plantlets (Webb et al.,. 1983; Eudes et al., 2003). Callus in CPF-237 ... in size after 4-weeks of culture; d, developing somatic embryos in 4-weeks old somatic ...

  11. An Investigation of College Students' Learning Styles in the US and China

    Science.gov (United States)

    Zhan, Ginny Q.; Moodie, Douglas R.; Sun, Yanmin; Wang, Bailing

    2013-01-01

    This research project explores learning styles of college students in the US and China. The Grasha-Reichmann Student Learning Style Scale, designed to measure how college students view their learning, was used as the main instrument for the current study. A total of 511 college students, 274 from the US and 237 from China, participated in this…

  12. Pramana – Journal of Physics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Pramana – Journal of Physics. Harleen Dahiya. Articles written in Pramana – Journal of Physics. Volume 80 Issue 2 February 2013 pp 237-249 Research Articles. Quadrupole moments of low-lying baryons with spin − 1 2 + spin − 3 2 + and spin − 3 2 + → 1 2 + transitions · Neetika Sharma Harleen Dahiya.

  13. Pramana – Journal of Physics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Pramana – Journal of Physics. Neetika Sharma. Articles written in Pramana – Journal of Physics. Volume 80 Issue 2 February 2013 pp 237-249 Research Articles. Quadrupole moments of low-lying baryons with spin − 1 2 + spin − 3 2 + and spin − 3 2 + → 1 2 + transitions · Neetika Sharma Harleen Dahiya.

  14. Um olhar econômico sobre a fotografia

    Directory of Open Access Journals (Sweden)

    Bruna Mayara Komarchesqui

    2010-08-01

    Full Text Available Resenha do livro Economia da arte e da cultura, organizado por César Bolaño, Cida Golin e Valério Brittos. São Paulo: Itaú Cultural; São Leopoldo: Cepos/Unisinos; Porto Alegre: PPGCOM/UFRGS; São Cristóvão: Obscom/UFS, 2010, 237 p.

  15. Solar Filaments as Tracers of Subsurface Processes

    Indian Academy of Sciences (India)

    tribpo

    M., 1976, in Basic Mechanisms of Solar Activity, IAU Colloq. 71, (eds.) V. Bumba,. J. Kleczek, (Reidel) 367. Tang, F. 1987, Solar Phys., 107, 233 237. Taylor, J. B. 1986, Rev. Mod. Phys., 58, 741. Vainshtein, S. I., Rosner, R. 1991, Astrophys. J., 376, 199. Van Ballegooijen, Α. Α., Cartledge, Ν. P., Priest, Ε. R. 1998, Astrophys.

  16. Inverse Correlation Between Cardiac Injury and Cardiac Anxiety A Potential Role for Communication

    NARCIS (Netherlands)

    van Beek, Maria H. C. T.; Oude Voshaar, Richard; van Deelen, Femke M.; van Balkom, Anton J. L. M.; Pop, Gheorghe; Speckens, Anne E. M.

    2014-01-01

    Objective: General anxiety in cardiac patients is associated with worsened cardiac course. An acute coronary syndrome (ACS) might evoke specific cardiac anxiety. We explored the characteristics associated with cardiac anxiety in ACS patients. Methods: We assessed cardiac anxiety in 237 patients

  17. Inverse correlation between cardiac injury and cardiac anxiety: a potential role for communication

    NARCIS (Netherlands)

    Beek, M.H.C.T. van; Oude Voshaar, R.C.; Deelen, F.M. van; Balkom, A.J.L.M. van; Pop, G.A.; Speckens, A.E.M.

    2014-01-01

    OBJECTIVE: General anxiety in cardiac patients is associated with worsened cardiac course. An acute coronary syndrome (ACS) might evoke specific cardiac anxiety. We explored the characteristics associated with cardiac anxiety in ACS patients. METHODS: We assessed cardiac anxiety in 237 patients

  18. Inverse correlation between cardiac injury and cardiac anxiety: A potential role for communication

    NARCIS (Netherlands)

    van Beek, M.H.C.T.; Voshaar, R.C.O.; van Deelen, F.M.; van Balkom, A.J.L.M.; Pop, G.; Speckens, A.E.M.

    2014-01-01

    Objective: General anxiety in cardiac patients is associated with worsened cardiac course. An acute coronary syndrome (ACS) might evoke specific cardiac anxiety. We explored the characteristics associated with cardiac anxiety in ACS patients. Methods: We assessed cardiac anxiety in 237 patients

  19. Identification of bacterial uropathogens by preparative isoelectricfocusing and matrix-assisted laser desorption/ionizationtime-of-flight mass spectrometry

    Czech Academy of Sciences Publication Activity Database

    Šalplachta, Jiří; Horká, Marie; Růžička, F.; Šlais, Karel

    2018-01-01

    Roč. 1532, JAN (2018), s. 232-237 ISSN 0021-9673 R&D Projects: GA MV VI20172020069; GA MZd(CZ) NV16-29916A Institutional support: RVO:68081715 Keywords : isoelectric focusing * mass spectrometry * urine * bacteria Subject RIV: CB - Analytical Chemistry, Separation OBOR OECD: Analytical chemistry Impact factor: 3.981, year: 2016

  20. Editorial: Special thematic issue on the ecology of soil microorganisms

    Czech Academy of Sciences Publication Activity Database

    Baldrian, Petr

    2017-01-01

    Roč. 93, č. 2 (2017), s. 1-3, č. článku 237. ISSN 0168-6496 Institutional support: RVO:61388971 Keywords : soil * bacteria * fungi Subject RIV: EE - Microbiology, Virology Impact factor: 3.720, year: 2016

  1. Minor actinide separation by liquid-liquid extraction. World study system system overview; Separation des actinides mineurs par extraction liquide-liquide. Panorama des systemes etudies dans le monde

    Energy Technology Data Exchange (ETDEWEB)

    Madic, C.

    1994-12-31

    Long term management of nuclear wastes, coming from fuel reprocessing may be improved on one condition, to separate the long half-time radioisotopes. The mainest are {sup 237N}p,{sup 241A}m-{sup 243A}m, {sup 243C}m-{sup 245C}m. 1 fig.

  2. Pension reform in the Czech Republic: present situation and future prospects (a comparison with Austria)

    Czech Academy of Sciences Publication Activity Database

    Vavrejnová, Marie; Belabed, E.; Wörister, K.

    2004-01-01

    Roč. 13, č. 3 (2004), s. 237-259 ISSN 1210-0455 R&D Projects: GA AV ČR KSK9058117 Institutional research plan: CEZ:AV0Z7085904 Keywords : pension reforms * aging * multi-pillar system Subject RIV: AH - Economics

  3. Egyptian Journal of Medical Human Genetics - Vol 9, No 2 (2008)

    African Journals Online (AJOL)

    Frequency of fragile-x in x‑linked mental retardation · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. ES El Sobky, SA El‑Ella, MA Tawfik, WF Mohamed, 237-248 ...

  4. Alexandria Bulletin

    African Journals Online (AJOL)

    AmL

    2010-02-15

    Feb 15, 2010 ... 2003 Severe Acute Respiratory Syndrome (SARS) outbreak some .... Table I: Description of the surveyed students. Male Students Female Students. Total. (P- value). N (33). %. N (36). %. N. %. Mean age in years. X ±SD. 23.7±7.7. 23.2±0.7 ..... The fragile web of responsibility: AIDS and the duty to treat.

  5. Impact-pressure controlled orientation of shatter cone magnetizations in Sierra Madera, Texas, USA

    Czech Academy of Sciences Publication Activity Database

    Adachi, T.; Kletetschka, Günther

    2008-01-01

    Roč. 52, č. 2 (2008), s. 237-254 ISSN 0039-3169 Institutional research plan: CEZ:AV0Z30130516 Keywords : shatter cones * impact crater * shock fractures * magnetism * Mars Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.770, year: 2008

  6. Low-temperature photoluminescence in chalcogenide glasses doped with rare-earth ions

    Czech Academy of Sciences Publication Activity Database

    Kostka, Petr; Zavadil, Jiří; Iovu, M.S.; Ivanova, Z. G.; Furniss, D.; Seddon, A.B.

    2015-01-01

    Roč. 648, NOV 5 (2015), s. 237-243 ISSN 0925-8388 R&D Projects: GA ČR GAP106/12/2384 Institutional support: RVO:67985891 ; RVO:67985882 Keywords : chalcogenide glasses * rare earth ions * low-temperature photoluminescence * optical transmission Subject RIV: JH - Ceramics, Fire-Resistant Materials and Glass Impact factor: 3.014, year: 2015

  7. Statistical behaviour of optical vortex fields

    CSIR Research Space (South Africa)

    Roux, FS

    2009-09-01

    Full Text Available vortex fields F. Stef Roux CSIR National Laser Centre, South Africa Colloquium presented at School of Physics National University of Ireland Galway, Ireland 21 September 2009 . – p.1/37 What are optical vortices? . – p.2/37 Topological charge V− = x− iy...

  8. Studies of Compound States of Atomic Negative Ions Using Laser Beams

    Science.gov (United States)

    1984-07-01

    of experimental state. The results agree closely with the experimental and theoretical studies of the He- ion. value of 0.076 eV obtained by Oparin ...420 10 V. A. Oparin , R. N. Ilin, i. T. Serenkov and N. V. Fedorenko, (1968). Zh. Eksp. Teor. Fiz. Pis’ma Red. 12, 237 (1970) [JETP Lett. 25G. N. Estberg

  9. Nigerian Journal of Clinical Practice - Vol 19, No 2 (2016)

    African Journals Online (AJOL)

    Frequency and clinical impact of ETV6/RUNX1, AF4‑MLL, and BCR/ABL fusion genes on features of acute lymphoblastic leukemia at presentation · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. IC Ajuba, AJ Madu, C Okocha, OG Ibegbulam, I Okpala, OE Nna, 237- ...

  10. Risk of malignancy in myasthenia gravis patients exposed to

    African Journals Online (AJOL)

    Barthelmes L, Thomas K], Seale JRC. Prostatic involvement of a testicular lymphoma in a patient with myasthenia gravis on long-term azathioprinei Leak Lymphoma 2002; 43: 2425. 2426. 8. Levin N, Abramsky O, Lossos A, ct al. Extrathymic malignancies in patients with myasthenia gravis. ] Neural Sci 2005; 237(1-2): 39-43 ...

  11. Effect of gonadotropin-releasing hormone (GnRH) treatment on ...

    African Journals Online (AJOL)

    Administrator

    2011-09-28

    Sep 28, 2011 ... 1169-1171. Eppleston J, Roberts EM (1991). Effect of time of PMSG and GnRH on the time of ovulation, LH secretion and reproductive performance after intrauterine insemination with frozen ram semen. Anim. Reprod. Sci. 26: 227-237. Evans NP, Dahl GE, Caraty A, Padmanabhan V, Thrun LA, Karsch FJ.

  12. Color Recovery Effect of Different Bleaching Systems on a ...

    African Journals Online (AJOL)

    2018-02-07

    [Downloaded free from http://www.njcponline.com on Wednesday, February 7, 2018, IP: 197.89.67.237] ... build-up. In general, these mouthwashes contain a low concentration of hydrogen peroxide (1.5%) and sodium hexametaphosphate, which protect the teeth surface ... was regularly monitored with the light intensity.

  13. Stigma, treatment beliefs, and substance abuse treatment use in ...

    African Journals Online (AJOL)

    Journal of Substance Abuse Treatment. 2004; 26: 237–242. 13. Cunningham JA, Sobell LC, Sobell MC, Agrawal S, Toneatto T. Barriers to treatment: Why alcohol and drug abusers delay or never seek treatment. Addictive Behaviours 1993; 18: 347-353. 14. Moos RH. Addictive behaviors in context: Principles and puzzles of.

  14. Impact of silica environment on hyperfine interactions in ε-Fe.sub.2./sub.O.sub.3./sub. nanoparticles

    Czech Academy of Sciences Publication Activity Database

    Kubíčková, L.; Kohout, J.; Brázda, Petr; Veverka, Miroslav; Kmječ, T.; Kubániová, D.; Bezdička, Petr; Klementová, Mariana; Šantavá, Eva; Závěta, K.

    2016-01-01

    Roč. 237, č. 1 (2016), s. 1-10, č. článku 159. ISSN 0304-3843 Institutional support: RVO:68378271 ; RVO:61388980 Keywords : iron oxide * polymorph of ferric oxide * 57Fe Mössbauer spectrometry * ferrimagnetic nanoparticles * giant coercive field * spin-reorientation transition Subject RIV: BM - Solid Matter Physics ; Magnetism

  15. Journal of Humanities - Vol 3, No 1 (1989)

    African Journals Online (AJOL)

    A semio - statistical analysis of comics in the Bruxelles' school · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. B. Peleau, 56-108 ... Book review: James Gibbs, (ed.) The Literary Half Yearly: Wole Soyinka Number (Volume XXVIII, No2 July, 1987), 237 pages · EMAIL ...

  16. 75 FR 16153 - Proposed Substances To Be Evaluated for Set 24 Toxicological Profiles

    Science.gov (United States)

    2010-03-31

    ....... 000786-19-6 35 2,4-D ACID......... 000094-75-7 36 DIURON 000330-54-1 37 BUTYLATE 002008-41-5 38 DIMETHYL...-7 236 COPPER 065357-62-2 237 CHLORINE DIOXIDE... 010049-04-4 238 PBBs 059536-65-1 239 PBDEs 001163...

  17. Rafael R S Soares

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Biosciences. Rafael R S Soares. Articles written in Journal of Biosciences. Volume 33 Issue 2 June 2008 pp 231-237 Articles. Photodynamic effect of light-emitting diode light on cell growth inhibition induced by methylene blue · Lílian S Peloi Rafael R S Soares Carlos E G Biondo Vagner R ...

  18. Socio-demographic characteristics and sexual health related ...

    African Journals Online (AJOL)

    86.6%) were in the age group. 17-32 years. The majority, 73 (75.3%) of MSM had never married, 26 (32.5%) reported not always using condoms during sexual intercourse, and 23 (23.7%) had ever received money or gifts in exchange of sex.

  19. New contribution on the LRRK2 G2019S mutation associated to ...

    African Journals Online (AJOL)

    chromosome DNA haplotypes. Hum. Biol. 78: 307-16. Guedes LC, Ferreira JJ, Rosa MM, Coelho M, Bonifati V and Sampais C. 2010: Worlwide frequency of G2019S LRRK2 mutation in Parkinson's disease: a systematic review. Park. Rel. Disord. 16: 237-242. Infante J, Rodriguez E, Combarros O, Mateo I, Fontalba A et al.

  20. Soviet Military Thought. The Command and Staff of the Soviet Army Air Force in the Great Patriotic War 1941-1945 - A Soviet View,

    Science.gov (United States)

    1977-01-01

    ary was the most typical. The strike was made by seven 1l-2s commanded by I. P. Bakhtin , escorted by one squadron of Yak-I fighters commanded by...Babak, N. P. 214. 237 Buyanskiy. N. N 108 Babenko. A. D.. 168 Bagramyan. 1. Kh., 153 Chalik, Ye S. 23 Bakhirev. B. S.. 158 Chanpaov. V. P., 150 Bakhtin

  1. Bulletin of Materials Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science. K S Rajam. Articles written in Bulletin of Materials Science. Volume 26 Issue 2 February 2003 pp 233-237 Thin Films. Deposition of TiN/CrN hard superlattices by reactive d.c. magnetron sputtering · Harish C Barshilia K S Rajam · More Details Abstract Fulltext PDF. Multilayer ...

  2. AcEST: DK954411 [AcEST

    Lifescience Database Archive (English)

    Full Text Available receptor OS=Me... 32 1.8 sp|O43087|KMS2_SCHPO Karyogamy meiotic segregation protein 2 OS=... 32 2.4 sp|Q8RFJ...jct: 237 LHVLLMTFCPNNPYCVCYMSLFQINGML 264 >sp|O43087|KMS2_SCHPO Karyogamy meiotic segregation protein 2 OS=S

  3. Corrigendum to ;Late Devonian carbonate magnetostratigraphy from the Oscar and Horse Spring Ranges, Lennard Shelf, Canning Basin, Western Australia; [Earth Planet. Sci. Lett. 409 (2015) 232-242

    Science.gov (United States)

    Hansma, Jeroen; Tohver, Eric; Yan, Maodu; Trinajstic, Kate; Roelofs, Brett; Peek, Sarah; Slotznick, Sarah P.; Kirschvink, Joseph; Playton, Ted; Haines, Peter; Hocking, Roger

    2017-11-01

    We thank Sergei Pisarevsky for bringing to our attention an error in the stated geomagnetic pole position within our article (pp. 232, 237, and 242). The correct pole position should be 30.3°E/54.3°S, A95 = 2.6, n = 501.

  4. Milk quality in high production systems during dry and rainy seasons ...

    African Journals Online (AJOL)

    usuario

    2015-10-28

    19-24. Dohoo IR Leslie KE (1991). Evaluation of changes in somatic-cells counts as indicators of new intramammary infections. Prev. Vet. Med. 10(3):225-237. Dürr JW (2002). Atualização em pastagem e produção animal –.

  5. University Students' Early Maladaptive Schemas' Prediction of Their Mindfulness Levels

    Science.gov (United States)

    Yalcin, S.Barbaros; Kavakli, Mehmet; Kesici, Sahin; Ak, Mehmet

    2017-01-01

    Purpose: The aim of this study is to determine whether university students' early maladaptive schemas predict their mindfulness levels or not. Methods: The study was carried out in the relational screening model. The study group consisted of 293 university students; 237 (80,9%) females and 56 (19,1%) males. "Mindful Attention Awareness Scale…

  6. Factors Associated With Poor Medication Adherence In ...

    African Journals Online (AJOL)

    Methods: 237 adult patients aged 18 and above with previous diagnosis of essential hypertension receiving out patient care in the University Teaching Hospital ... Multivariable analysis showed that; participants were more likely to be non-adherent by self-report if they had attained a primary level of education, had missed ...

  7. Download this PDF file

    African Journals Online (AJOL)

    September 2007 Vol 10(3):234 -237. MISOPROSTOL USE FOR CERVICAL RIPENING AND. INDUCTION OF LABOUR IN A NIGERIAN TEACHING HOSPITAL. B.A Ekele, D.C Nnadi, M.A Gana, C.E Shehu, Y Ahmed , E.I Nwobodo. Department of Obstetrics and Gynaecology, Usmanu Danfodiyo University Teaching ...

  8. Relative Prevalence and Correlates of Depressive Characteristics among Seriously Emotionally Disturbed and Nonhandicapped Students.

    Science.gov (United States)

    Cullinan, Douglas; And Others

    1987-01-01

    The study assessed 237 seriously emotionally disturbed (SED) students and 577 nondisabled students (ages 6-18) on measures of depression, hyperactivity, social status, intelligence, school placement, and aspects of educational achievement. SED students showed greater depression than the nondisabled sample. Patterns of intercorrelations were…

  9. An analysis of the electrical conductivity in BaSO4-added AgZSO4

    Indian Academy of Sciences (India)

    Bull. Mater. Sci, Vol. 18, No. 3, June 1995, pp. 237*246. (6) Printed in India. An analysis of the electrical conductivity in BaSO4-added AgZSO4 solid electrolyte system. K SINGH, S M PANDE* and S S BHOGA+. Department of Physics, Nagpur University, Nagpur 440010, India. *Department of Applied Physics, Ramdeobaba ...

  10. The impact of energy efficiency interventions on industry – the Industrial Energy Efficiency Project in South Africa

    CSIR Research Space (South Africa)

    Hartzenburg, A

    2015-10-01

    Full Text Available 098 200 857 000 889 608 000 ESO 440 524 800 394 000 237 538 000 Total 1 341 622 000 1 251 000 1 127 146 000 The world’s leading sustainability consultancy Body text What’s this layout for? This slide forms the base of the majority of slides – a...

  11. Assessment of the Training Needs of Poultry Farmers in Ovia ...

    African Journals Online (AJOL)

    Assessment of the Training Needs of Poultry Farmers in Ovia & Oredo Local Government Areas of Edo State, Nigeria. ... 0.714); vaccination ( x̅ = 2.37 ± 0.726); health management practices like debeaking ( x̅ = 2.01 ± 0.712) and other management variables like poultry house construction techniques and floor spacing.

  12. Dicty_cDB: SSG635 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 6e-61 (Q9NZK5) RecName: Full=Cat eye syndrome critical region protein ... 237 6e-61 AF190746_1( AF190746...syndrome critical region protein ... 233 1e-59 ( P58780 ) RecName: Full=Cat eye syndrome critical region

  13. DNA barcoding of the leaf-mining moth subgenus Ectoedemia s. str. (Lepidoptera: Nepticulidae) with COI and EF1-α: two are better than one in recognising cryptic species

    NARCIS (Netherlands)

    Nieukerken, E.J.; Doorenweerd, C.; Stokvis, F.R.; Groenenberg, D.S.J.

    2012-01-01

    We sequenced 665bp of the Cytochrome C Oxidase I (COI) barcoding marker for 257 specimens and 482bp of Elongation Factor 1-α (EF1-α) for 237 specimens belonging to the leafmining subgenus Ectoedemia (Ectoedemia) in the basal Lepidopteran family Nepticulidae. The dataset includes 45 out of 48 West

  14. Ghana Mining Journal: Contact

    African Journals Online (AJOL)

    Principal Contact. Professor Daniel Mireku-Gyimah Editor-in-Chief University of Mines & Technology Ghana Mining Journal University of Mines & Technology P. O. BOX 237 Tarkwa Ghana Phone: +233 362 20280/20324. Fax: +233 362 20306. Email: dm.gyimah@umat.edu.gh ...

  15. Remarks abort certain species of the Anthribid genus Xylinades, Latr

    NARCIS (Netherlands)

    Ritsema Cz., C.

    1883-01-01

    1. Xylinades affinis Chevrol. in litt., judging from a typical specimen received from Mr. Chevrolat, is not a variety of Xylinades Westermanni Schönh., but identical with Dejean’s Xylinades marmoratus. described by Mr. Roelofs in the Notes from the Leyden Museum. Vol. II (1880), p. 237. 2. Xylinades

  16. The Free Provision of ARV Therapy: Is it a Golden Opportunity on a ...

    African Journals Online (AJOL)

    Overall there were 23.7 percent of organisations with referral mechanisms for antiretroviral therapy within the workplace, of which the majority of them had educational programmes of some kind. There is a significant positive relationship between the availability of ARV referral mechanism as the dependent variable and the ...

  17. Remote Observations of the Spatial Variability of Surface Waves Interacting With an Estuarine Outflow

    Science.gov (United States)

    2006-10-01

    EXPERIMENT ancy current along the Outer Banks of North Carolina [14], and the tidal circulation patterns associated with the Chesapeake The OSCR system...assessment, and regulation current meters," J. Phys. Oceanogr., vol. 15, pp. 237-256, 1998. of offshore platforms and pipelines in Bay of Campeche in

  18. March 2010 Final for Publicat...

    African Journals Online (AJOL)

    User

    The subjects included patients and volunteers. Seminal fluid collection and analysis were done using the WHO standards. Serum testosterone was also measured in all subjects. Correlation was tested with the student “t” test and the level significance was p<0.05. 317 subjects were studied, 20 were azoospermic, 237 were ...

  19. Q-Step methods for Newton-Jacobi operator equation | Uwasmusi ...

    African Journals Online (AJOL)

    The paper considers the Newton-Jacobi operator equation for the solution of nonlinear systems of equations. Special attention is paid to the computational part of this method with particular reference to the q-step methods. Journal of the Nigerian Association of Mathematical Physics Vol. 8 2004: pp. 237-241 ...

  20. Detection of Campylobacter jejuni by culture and real-time PCR in a French cohort of patients with Guillain-Barre syndrome.

    Science.gov (United States)

    Sivadon-Tardy, Valérie; Orlikowski, David; Porcher, Raphael; Ronco, Esthel; Caudie, Christiane; Roussi, Jacqueline; Fauchère, Jean-Louis; Mégraud, Francis; Tabor, Helen; Sharshar, Tarek; Annane, Djillali; Raphaël, Jean-Claude; Gaillard, Jean-Louis

    2010-06-01

    Bacteriological culture and real-time PCR (RT-PCR) were used to detect Campylobacter jejuni in fecal samples from a French cohort of 237 patients with Guillain-Barré syndrome (GBS). We provide evidence that diverse serotypes and genotypes of C. jejuni are a major trigger of GBS in France.

  1. Detection of Campylobacter jejuni by Culture and Real-Time PCR in a French Cohort of Patients with Guillain-Barré Syndrome▿

    OpenAIRE

    Sivadon-Tardy, Valérie; Orlikowski, David; Porcher, Raphael; Ronco, Esthel; Caudie, Christiane; Roussi, Jacqueline; Fauchère, Jean-Louis; Mégraud, Francis; Tabor, Helen; Sharshar, Tarek; Annane, Djillali; Raphaël, Jean-Claude; Gaillard, Jean-Louis

    2010-01-01

    Bacteriological culture and real-time PCR (RT-PCR) were used to detect Campylobacter jejuni in fecal samples from a French cohort of 237 patients with Guillain-Barré syndrome (GBS). We provide evidence that diverse serotypes and genotypes of C. jejuni are a major trigger of GBS in France.

  2. Do prion protein gene polymorphisms induce apoptosis in non ...

    Indian Academy of Sciences (India)

    Genetic variations such as single nucleotide polymorphisms (SNPs) in prion protein coding gene, Prnp, greatly affect susceptibility to prion diseases in mammals. Here, the coding region of Prnp was screened for polymorphisms in redeared turtle, Trachemys scripta. Four polymorphisms, L203V, N205I, V225A and M237V, ...

  3. 75 FR 34415 - Proposed Flood Elevation Determinations

    Science.gov (United States)

    2010-06-17

    ... Flood Insurance Study and FIRM, other than the proposed BFEs, will be considered. A letter acknowledging... 177 North Center Street, Versailles, OH 45380. Cass County, Texas, and Incorporated Areas Black Bayou Just upstream of FM 251 None +227 Unincorporated Areas of Cass County. Approximately 1 mile None +237...

  4. On the Links between Attachment Style, Parental Rearing Behaviors, and Internalizing and Externalizing Problems in Non-Clinical Children

    Science.gov (United States)

    Roelofs, Jeffrey; Meesters, Cor; ter Huurne, Mijke; Bamelis, Lotte; Muris, Peter

    2006-01-01

    We sought to investigate the relationships between negative family factors such as insecure attachment and adverse parental rearing, and internalizing and externalizing symptoms in a large sample of non-clinical children (N = 237) aged 9 to 12 years. All children completed a set of self-report questionnaires including a single-item measure of…

  5. Genetics Home Reference: glucose-galactose malabsorption

    Science.gov (United States)

    ... GALACTOSE MALABSORPTION Sources for This Page Brown GK. Glucose transporters: structure, function and consequences of deficiency. J Inherit Metab Dis. 2000 May;23(3):237-46. Review. Citation on ... in glucose-galactose malabsorption, association with renal tubular acidosis. Pediatr ...

  6. La ciudad y el ambiente como un solo sistema : el suelo de conservación y su carácter estratégico para la dinámica urbana del Distrito Federal /

    OpenAIRE

    Martínez Rivera, Sergio Efrén sustentante.

    2009-01-01

     tesis que para obtener el grado de Doctor en Economía, presenta Sergio Efrén Martínez Rivera ; asesor Delfín Yolanda Trápaga. 237 páginas : ilustraciones. Doctorado en Economía UNAM, Facultad de Economía, 2009

  7. Effects of maternal lines and mating systems on lamb carcass merit

    Science.gov (United States)

    Objectives: The objective of this study was to analyze the carcass composition of lambs produced from different mating systems. Materials and Methods: Lambs (n = 1,237) were produced by a multi- sire mating of three maternal lines (Katahdin (KN), Polypay (PP), and Easycare (EZ)) in two mating system...

  8. AcEST: DK951194 [AcEST

    Lifescience Database Archive (English)

    Full Text Available USE DnaJ homolog subfamily A member 2 OS=Mus musculus GN=Dnaja2 PE=2 SV=1 Length = 412 Score = 237 bits (604...LLPSRP 359 >sp|O35824|DNJA2_RAT DnaJ homolog subfamily A member 2 OS=Rattus norvegicus GN=Dnaja2 PE=2 SV=1 L

  9. CASE STUDy

    African Journals Online (AJOL)

    2011-06-02

    Jun 2, 2011 ... Harris SH, Khan MA, Khan R, Haque F, Syed A, Ansari MM. Mammary tuberculosis: analysis of thirty-eight patients. Aust N Z J Surg 2006;76:234-237. 18. Gupta R, Gupta AS, Duggal N. Tubercular mastitis. Int Surg 1982;67:422-424. 19. Cabie A, Abel S, Brebion A, Desbois N, Sobesky G. Mycobacterium ...

  10. Utilisation of maternity services by black women in rural and urban ...

    African Journals Online (AJOL)

    utilisation of maternal services for black women in the. Orange Free State. Two hundred and forty clusters ... of the world, including South Africa, adequate services of this nature are in operation. One example in .... Review Board of the Faculty of Medicine, University of the. Orange Free State. Of the 237 women who gave ...

  11. Download this PDF file

    African Journals Online (AJOL)

    2011

    tropics. Feeds and Feeding, Pasture. Management, Monogastric and. Ruminant nutrition. Davcon computers and Business Bereau,. Kaduna, Nigeria. Anderson, S. J., T. J. Klopfenstein, and V. A. Wilkerson. (1988). Escape protein supplementation of yearling steers grazing smooth brome pastures. J. Anim. Sci. 66:237-242.

  12. Laparoscopic Strassman's metroplasty for bicornuate uterus – is it ...

    African Journals Online (AJOL)

    Hum Reprod Update 2001;7:161-174. 7. Rackow BW, Arici A. Reproductive performance of women with müllerian anomalies. Curr Opin. Obstet Gynecol 2007;19:229-237. 8. Papp Z, Mezei G, Gávai M, Hupuczi P, Urbancsek J. Reproductive performance after transabdominal metroplasty: a review of 157 consecutive cases.

  13. ISSN 2073 ISSN 2073 9990 East Cent. Afr. J. 9990 East Cent. Afr. J ...

    African Journals Online (AJOL)

    Hp 630 Dual Core

    It is therefore important that more researches be performed on the pediatric age groups to ensure more specific management guidelines unique to this group. .... of the data found in our region2,3,7. This high preponderance of males is most likely due to the high involvement of males in risky and adventurous ventures which.

  14. 78 FR 42036 - Radio Broadcasting Services; Port Lions, AK, De Beque, CO, Benjamin, Cisco, Rule, and Shamrock, TX

    Science.gov (United States)

    2013-07-15

    ... From the Federal Register Online via the Government Publishing Office FEDERAL COMMUNICATIONS COMMISSION 47 CFR Part 73 Radio Broadcasting Services; Port Lions, AK, De Beque, CO, Benjamin, Cisco, Rule... 237C3; Cisco, Channel 261C3; Rule, Channel 288C2; and Shamrock, Channel 225C2. BILLING CODE 6712-01-P ...

  15. An evaluation of algorithms designed to classify the results from frequency doubling perimetry

    NARCIS (Netherlands)

    Muskens, RPHM; Heeg, GP; Jansonius, NM

    2004-01-01

    All previously published algorithms for the interpretation of frequency doubling perimetry test results were compared in full-threshold mode in a large group of glaucoma patients (n = 452) and normal subjects (n = 237). Areas under the receiver-operating characteristic (ROC) curve ranged from 0.86

  16. Biology Education Delivery for Attaining Health-specific Millennium ...

    African Journals Online (AJOL)

    This study investigated the strategies for ensuring effective delivery of Biology Education at the secondary school level for the attainment of health specific Millennium Development Goals (MDGs) in Akwa Ibom State - Nigeria. A survey design was used for the study. The population of the study covers the entire 237 public ...

  17. Journal of Biosciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Biosciences. Sameha Merzoug. Articles written in Journal of Biosciences. Volume 41 Issue 2 June 2016 pp 237-249 Article. Effects of quercetin on predator stress-related hematological and behavioral alterations in pregnant rats and their offspring · Mohamed L Toumi Sameha Merzoug Abdelkrim ...

  18. EST Table: EU141552 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available EU141552 IDH 10/09/29 100 %/236 aa gb|ABX57376.1| isocitrate dehydrogenase [Bombyx ...mori] 10/09/03 82 %/235 aa FBpp0266322|DyakGE21312-PA 10/08/28 74 %/237 aa F59B8.2#CE03436#WBGene00010317#locus:idh

  19. PREVIOUS SECOND TRIMESTER ABORTION

    African Journals Online (AJOL)

    PNLC

    -mail: njotangnanaphilip@yahoo.co Tel.(237). 77.74.37.31. I- INTRODUCTION .... outcome after pregnancy complicated by materno- foetal surgery. Am J Obstet Gynecol. 2004; 191, 4: 1430-6. 4. Abbassi H, El Karroumi M, Aboulfalah A, ...

  20. Florida's timber industry--an assessment of timber product output and use, 2007

    Science.gov (United States)

    Tony Johnson; Jarek Nowak; Rhonda Mathison

    2009-01-01

    In 2007, volume of industrial roundwood output from Florida’s forests totaled 491 million cubic feet, 10 percent more than in 2005. Mill byproducts generated from primary manufacturers increased to 167 million cubic feet. Almost all plant residues were used primarily for fuel and fiber products. Pulpwood was the leading roundwood product at 237 million cubic feet; saw...

  1. J. Genet. classic 235

    Indian Academy of Sciences (India)

    Unknown

    Journal of Genetics, Vol. 83, No. 3, December 2004. 235. Page 2. J. Genet. classic. Journal of Genetics, Vol. 83, No. 3, December 2004. 236. Page 3. J. Genet. classic. Journal of Genetics, Vol. 83, No. 3, December 2004. 237. Page 4. J. Genet. classic. Journal of Genetics, Vol. 83, No. 3, December 2004. 238. Page 5 ...

  2. Seasonality of cardiovascular risk factors

    DEFF Research Database (Denmark)

    Marti-Soler, Helena; Gubelmann, Cédric; Aeschbacher, Stefanie

    2014-01-01

    OBJECTIVE: To assess the seasonality of cardiovascular risk factors (CVRF) in a large set of population-based studies. METHODS: Cross-sectional data from 24 population-based studies from 15 countries, with a total sample size of 237 979 subjects. CVRFs included Body Mass Index (BMI) and waist...

  3. Improving Land Tenure Security through Customary Boundary ...

    African Journals Online (AJOL)

    Michael

    2017-06-01

    Jun 1, 2017 ... 1CSIR- Building and Road Research Institute, Kumasi. 2University of Mines and Technology, P.O. Box 237, .... linked by an all-weather tarred and untarred roads. 2.3 Methods Used. The main method adopted was a ..... in survey and mapping for land use and land administration and engineering survey.

  4. Early parenting intervention: Family risk and first-time parenting related to intervention effectiveness

    NARCIS (Netherlands)

    Stolk, M.N.; Mesman, J.; van Zeijl, J.; Alink, L.R.A.; Bakermans-Kranenburg, M.J.; van IJzendoorn, M.H.; Juffer, F.; Koot, H.M.

    2008-01-01

    The effects of cumulative risk and parity on the effectiveness of a home based parenting intervention were tested in a randomized controlled trial with 237 families with 1- to 3-year-old children screened for high levels of externalizing behavior. The intervention was aimed at enhancing positive

  5. American Military History: A Selected Bibliography

    Science.gov (United States)

    2013-04-01

    2009. 11 CDs. (UA23.7 .M942 2009) 21 Palmer, Dave R. George Washington’s Military Genius. Ashland, OR: Blackstone Audio, 2012. 7 CDs. (E230 .P32...1917-2008. http://permanent.access.gpo.gov/gpo13826/CMH_Pub_30-22.pdf Sutherland , Jonathan. African Americans at War: An Encyclopedia. Santa Barbara

  6. Ketogenic Diet: Effects on Growth

    Directory of Open Access Journals (Sweden)

    J Gordon Millichap

    2002-12-01

    Full Text Available The effects of the ketogenic diet on growth of 237 children (130 males, 107 females treated for intractable epilepsy has been evaluated in a prospective cohort study (average follow-up 308 days at the Johns Hopkins Hospital, Baltimore, MD.

  7. 77 FR 9694 - Notice of Availability of the Draft Environmental Impact Statement for the Restoration Design...

    Science.gov (United States)

    2012-02-17

    ... utility-scale solar development. In this regard, the BLM is also proposing to identify the Agua Caliente... for the proposed Agua Caliente SEZ: 2,760 acres, 6,770 acres, and 20,600 acres. Alternative 6 with 237... would be amended to identify the Agua Caliente SEZ and to change the Visual Resource Management class...

  8. Evaluación de impacto ambiental y concentración parcelaria

    OpenAIRE

    Alenza García, José Francisco

    1999-01-01

    El autor analiza los siguientes puntos: la concentración parcelaria y su impacto ambiental; el Decreto Foral 237/1999, de 21 de junio, por el que se regula la evaluación de impacto ambiental en los procesos de concentración parcelaria; la necesidad de una ley foral de protección ambiental.

  9. 77 FR 59882 - Radio Broadcasting Services; Tignall, GA

    Science.gov (United States)

    2012-10-01

    ... Proposed Rule Making, MB Docket No. 12-237, adopted August 29, 2012, and released August 31, 2012. The full text of this Commission decision is available for inspection and copying during normal business hours... ``hybrid'' application and rule making petition. Channel 287A can be allotted at Tignall, Georgia, in...

  10. phytoremediation of sewage sludge in soils contaminated with ...

    African Journals Online (AJOL)

    PROF EKWUEME

    chlorella vulgaris, to some heavy metals. Am. J. Environs. Sci. 6, 230 – 237. Agamuthu, P., Abioye, O. P and Aziz, A. A.,. 2010. Phytoremediation of soil contaminated with used lubricating oil using Jatropha curcas. Journ Hazard Mater., 179, 891 –. 894. Awalla, C. O. C., 2013. Global Environmental. Sustainability. Goodseed ...

  11. Norma kasumlikkus kahanes / Annika Matson

    Index Scriptorium Estoniae

    Matson, Annika, 1976-

    2005-01-01

    Autodele turvavöösid tootva Norma ärikasum oli kolmandas kvartalis 23,7 miljonit krooni, mis on ligi viiendiku võrra vähem kui eelmisel aastal samal ajal. Diagramm. Vt. samas: Rootsi analüütik ennustas suvel Norma ülevõtmist

  12. Malignant mandibular tumors: two case reports of rare mandibular ...

    African Journals Online (AJOL)

    Arun Kumar Agnihotri

    2014-02-26

    Feb 26, 2014 ... also experience paresthesia, loosening of teeth, nasal obstruction, epistaxis, proptosis, or diplopia.2. The osteogenic .... Mild displacement of right 2nd premolar and 2nd molar teeth were noticed. The non-‐ ..... Diagnostic Oncology Group. Radiology. 1997;202(1):237-‐46. 16. Clark JL, Unni KK, Dahlin DC, ...

  13. Short communication

    African Journals Online (AJOL)

    A NOTE ON SOLUTION OF ORDINARY DIFFERENTIAL. EQUATION OF THE SECOND-ORDER. Teshome Abay. Department of Physics, Faculty of Science, Addis Ababa University .... and 233-237. 2. Arflten, G. (1966). Mathematical Methods for Physics. Academic Press Inc., New. York, pp. 298—329. 3. Heading, J. (1962).

  14. Bodies, Bombs and Belief Systems: Sport, Lifestyle Construction and Education in Dangerous Times

    Science.gov (United States)

    Fitzclarence, Lindsay

    2004-01-01

    Dominant academic narratives about "the body" occur within two major camps. The first is derived from "classical social theory", and takes a macroscopic focus. The contrasting perspective is what Sharp ("Extended forms of the social", "Arena Journal", 1, pp. 221-237, 1993) refers to as "post-classical…

  15. Air Force Physician and Dentist Multiyear Special Pay: Current Status and Potential Reforms

    Science.gov (United States)

    2009-01-01

    ortho- dontics, oral surgery, and pediatric dentistry ) each made up less than 1.5 percent of all entering cohorts during this period. While the vast...Specialty Orthodontist Other Pediatric Dentistry Peridontist Prosthodontist Dental Officer 2.37 1.11 0.74 3.76 2.83 General Clinical Dentist 3.04

  16. Dicty_cDB: Contig-U01759-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available *** SEQUENCING CANCELLED *** f... 44 1.7 1 ( AC233010 ) Choloepus hoffmanni clone CH281-269K18, WORKING D......7 1 ( AC232652 ) Mustela putorius furo clone CH237-3K19, WORKING D... 44 1.7 1 ( AC231899 ) Choloepus hoffman

  17. Journal of Chemical Sciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Chemical Sciences. Archita Patnaik. Articles written in Journal of Chemical Sciences. Volume 125 Issue 2 March 2013 pp 237-246. Thermodynamic, kinetic and electronic structure aspects of a charge-transfer active bichromophoric organofullerene · K Senthil Kumar Archita Patnaik · More Details ...

  18. Bulletin of Materials Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Bulletin of Materials Science. Harish C Barshilia. Articles written in Bulletin of Materials Science. Volume 26 Issue 2 February 2003 pp 233-237 Thin Films. Deposition of TiN/CrN hard superlattices by reactive d.c. magnetron sputtering · Harish C Barshilia K S Rajam · More Details Abstract Fulltext PDF.

  19. Todos salimos ganando

    Directory of Open Access Journals (Sweden)

    Julián Estrada

    2002-09-01

    Full Text Available Aportes alimenticios del Viejo al Nuevo Mundo. Lucía Rojas de Perdomo. Editorial Voluntad, Bogotá, 1993, 197 págs., il. Cocina prehispánica. Lucía Rojas de Perdomo. Editorial Voluntad, Bogotá, 1994, 237 págs., il.

  20. Assessing the Relationship between Family Mealtime Communication and Adolescent Emotional Well-Being Using the Experience Sampling Method

    Science.gov (United States)

    Offer, Shira

    2013-01-01

    While most prior research has focused on the frequency of family meals the issue of which elements of family mealtime are most salient for adolescents' well-being has remained overlooked. The current study used the experience sampling method, a unique form of time diary, and survey data drawn from the 500 Family Study (N = 237 adolescents with…

  1. Family Time Activities and Adolescents' Emotional Well-Being

    Science.gov (United States)

    Offer, Shira

    2013-01-01

    The literature is divided on the issue of what matters for adolescents' well-being, with one approach focusing on quality and the other on routine family time. Using the experience sampling method, a unique form of time diary, and survey data drawn from the 500 Family Study ("N" = 237 adolescents with 8,122 observations), this study examined the…

  2. Minor Delinquency and Immigration: A Longitudinal Study among Male Adolescents

    Science.gov (United States)

    Titzmann, Peter F.; Silbereisen, Rainer K.; Mesch, Gustavo

    2014-01-01

    On the basis of general theories of delinquency and the specific situation of immigrants, this longitudinal study investigated predictors of initial levels and rates of change in delinquency among 188 male ethnic German Diaspora immigrants from the former Soviet Union (FSU) in Germany, 237 male native German adolescents, and 182 male Jewish…

  3. A review of opioid prescription in a teaching hospital in Colombia [Corrigendum

    OpenAIRE

    Moyano J; Figueras A

    2015-01-01

    Moyano J, Figueras A. J Pain Res. 2012;5:237–242.Jairo Moyano is also affiliated with Deparment de Farmacologia, Terapeutica i Toxicologia, Universitat Autonoma de Barcelona, Barcelona, Spain, which was not included in the original publication.Read the original article

  4. The frequency of hepatitis A and B viruses as the offending viral type ...

    African Journals Online (AJOL)

    Three hundred and thirty blood samples from patients suspected of having hepatitis on clinical grounds but in whom the aetiology of the hepatitis was unknown (93 Whites and 237 Blacks) were tested for the presence of hepatitis B surface antigen (HBsAg), anti-HBs, total anti-hepatitis A virus (HAV) activity and anti-HAY of ...

  5. Cryptic species of sharp-nosed reed frogs in the Hyperolius nasutus ...

    African Journals Online (AJOL)

    The sharp-nosed reed frog is widespread in Africa. Although currently recognized as one species, suggestions have been made that more than one species might exist. We analysed 237 calls of 69 males from 19 localities in the western to southern parts of Africa. Calls fall into three groups, which we recognize as cryptic ...

  6. Characterization of an immunodominant cancer-specific O-glycopeptide epitope in murine podoplanin (OTS8)

    DEFF Research Database (Denmark)

    Steentoft, Catharina; Schjoldager, Katrine T; Cló, Emiliano

    2010-01-01

    antibody 237, developed to a spontaneous murine fibrosarcoma, was shown to be directed to murine podoplanin (OTS8) with truncated Tn O-glycans. Our understanding of such cancer-specific auto-antibodies to truncated glycoforms of glycoproteins is limited. Here we have investigated immunogenicity...

  7. Applying Syundz's Philosophical Concepts to Teaching Leadership in Higher Education and Lifelong Learning

    Science.gov (United States)

    Ko, Hsin Chi

    2016-01-01

    Syundz (c. 314-237 BC), born in China during the Warring States Period, was a realist philosopher who contributed to the Hundred Schools of Thought, a period of cultural and philosophical development that flourished from the 6th century to 221 BC. Syundz commented on many ideas, particularly those of Confucius and Mencius, and a collection of…

  8. Efficacy of the Young Women's CoOp: An HIV Risk-Reduction Intervention for Substance-Using African-American Female Adolescents in the South

    Science.gov (United States)

    Wechsberg, Wendee M.; Browne, Felicia A.; Zule, William A.; Novak, Scott P.; Doherty, Irene A.; Kline, Tracy L.; Carry, Monique G.; Raiford, Jerris L.; Herbst, Jeffrey H.

    2017-01-01

    HIV/sexually transmitted infection (STI) risk-reduction interventions are needed to address the complex risk behaviors among African-American female adolescents in disadvantaged communities in North Carolina. In a two-group randomized trial, we reached 237 sexually active, substance-using African-American female adolescents, to test a…

  9. Effect of Fermentation Time and Leavening Agent on the Quality of ...

    African Journals Online (AJOL)

    Functional properties of rice were foam capacity (23.7%), foam stability (88.5%), water absorption capacity (0.02%), gelation capacity (20%), gelatinization temperature (82oC) and gelation time (20 minutes) Significant differences were observed between the masa samples for ash, moisture, protein, lipid and total bacterial ...

  10. Domain Modeling: NP_065838.1 [SAHG[Archive

    Lifescience Database Archive (English)

    Full Text Available NP_065838.1 chr17 Aart, a six finger zinc finger designed to recognize ANN triplets... c2i13b_ chr17/NP_065838.1/NP_065838.1_holo_83-237.pdb psi-blast 90L,91V,92S,93L,95L,97V,98S,99K,101D,102M,1

  11. Nieuws uit de literatuur III

    NARCIS (Netherlands)

    NN,

    1986-01-01

    C.G. Hanson & J.L. Mason, 1985. Bird seed aliens in Britain, Watsonia 15:237-252. Een goed gedocumenteerde en geannoteerde lijst van in totaal 438 soorten die als vogelvoer of als verontreiniging daarvan in Engeland worden ingevoerd. Het is aannemelijk dat de resultaten van hun bevindingen ook van

  12. Gclust Server: 120167 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available 120167 ATH_AT4G33520_18418230 Cluster Sequences Related Sequences(22) 237 PAA1 (met...sm 1 1.00e-19 14.29 0.0 0.0 0.0 0.0 0.0 Show 120167 Cluster ID 120167 Sequence ID ATH_AT4G33520_18418230 Lin

  13. Registration of the barley transposon-tagged population I:seventy lines each with a single, unique site of Ds insertion

    Science.gov (United States)

    The Agricultural Research Service, U.S. Dept. of Agriculture (USDA-ARS), has developed and released a new genetic stock resource, a transposon-tagging barley (Hordeum vulgare L.) population comprised of 70 lines, TNP 200-TNP 207, TNP 210—TNP 229, TNP 232, TNP 233, TNP 235, TNP 237—TNP 262, TNP 264—T...

  14. Journal of Earth System Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    2016-08-26

    Aug 26, 2016 ... Home; Journals; Journal of Earth System Science. Projit Kumar Das. Articles written in Journal of Earth System Science. Volume 121 Issue 1 February 2012 pp 237-240. Estimation of radon concentration in dwellings in and around Guwahati · Gautam Kumar Dey Projit Kumar Das · More Details Abstract ...

  15. Ethics politics of translating.

    Directory of Open Access Journals (Sweden)

    Hannah Lovejoy

    2013-04-01

    Full Text Available http://dx.doi.org/10.5007/2175-7968.2013v1n31p237 Ethics and Politics of Translating, written by Henri Meschonnic and translated from the French by Pier-Pascale Boulanger provides an in-depth look at the theory of language in regard to translational studies.

  16. Parenting Stress and Child Behavior Problems: A Transactional Relationship across Time

    Science.gov (United States)

    Neece, Cameron L.; Green, Shulamite A.; Baker, Bruce L.

    2012-01-01

    Parenting stress and child behavior problems have been posited to have a transactional effect on each other across development. However, few studies have tested this model empirically. The authors investigated the relationship between parenting stress and child behavior problems from ages 3 to 9 years old among 237 children, 144 of whom were…

  17. Biochar mitigation of allelopathy induced yield loss in continuous maize

    Science.gov (United States)

    Continuous maize yields are limited by the release of phytotoxic compounds as the previous year’s maize residue decomposes. We tested the hypothesis that soil biochar applications could help mitigate maize autotoxicity and the associated yield depression. Eighteen small field plots (23.7 m2) were es...

  18. Dicty_cDB: Contig-U13541-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 4e-73 AY466445_1( AY466445 |pid:none) Macrobrachium rosenbergii heat sho... 237 5e-73 AB206478_1( AB206478 ...1( AY836799 |pid:none) Saussurea medusa heat shock protei... 231 8e-73 DQ660140_1( DQ660140 |pid:none) Macrobrachium

  19. Bibliography of Children's Play and Toys.

    Science.gov (United States)

    Quilitch, H. Robert

    This bibliography of 237 titles on children's toys and play includes materials published from 1893 to 1970. Citations were gleaned from library catalogs, "Psychological Abstracts,""Child Development Abstracts,""Education Index" and "Reader's Guide to Periodical Literature." The bibliography is arranged alphabetically by author; where no author is…

  20. 77 FR 29681 - Announcement of Funding Awards, Capital Fund Education and Training Community Facilities (CFCF...

    Science.gov (United States)

    2012-05-18

    ... Jersey $998,640 Construction of a New Development of a facility at City, 400 U.S. Highway One, Jersey Facility. which the PHA will provide City, NJ 07102-3112. adult education and job training. Housing Authority of the City of 1,237,900 Construction of a New Development of a facility at Milwaukee, P.O. Box...

  1. 40 CFR Table 1 to Subpart IIIi of... - Emission Standards for Stationary Pre-2007 Model Year Engines With a Displacement of

    Science.gov (United States)

    2010-07-01

    ...-2007 Model Year Engines With a Displacement of 1 Table 1 to Subpart IIII of Part 60 Protection of... Combustion Engines Part 60, Subpt. IIII, Table 1 Table 1 to Subpart IIII of Part 60—Emission Standards for Stationary Pre-2007 Model Year Engines With a Displacement of 2,237 KW (3,000 HP) and With a Displacement of...

  2. 40 CFR 60.4201 - What emission standards must I meet for non-emergency engines if I am a stationary CI internal...

    Science.gov (United States)

    2010-07-01

    ... ICE with a maximum engine power greater than 2,237 KW (3,000 HP) and a displacement of less than 10... marine CI engines in 40 CFR 94.8, as applicable, for all pollutants, for the same displacement and... non-emergency engines if I am a stationary CI internal combustion engine manufacturer? 60.4201 Section...

  3. Past and prospective carbon stocks in forests of northern Wisconsin: a report from the Chequamegon-Nicolet National Forest Climate Change Response Framework

    Science.gov (United States)

    Richard Birdsey; Yude Pan; Maria Janowiak; Susan Stewart; Sarah Hines; Linda Parker; Stith Gower; Jeremy Lichstein; Kevin McCullough; Fangmin Zhang; Jing Chen; David Mladenoff; Craig Wayson; Chris. Swanston

    2014-01-01

    This report assesses past and prospective carbon stocks for 4.5 million ha of forest land in northern Wisconsin, including a baseline assessment and analysis of the impacts of disturbance and management on carbon stocks. Carbon density (amount of carbon stock per unit area) averages 237 megagrams (Mg) per ha, with the National Forest lands having slightly higher carbon...

  4. Nuclear Data Sheets for A=213

    Energy Technology Data Exchange (ETDEWEB)

    Basunia, M. S.

    2007-03-01

    Evaluated spectroscopic data and level schemes from radioactive decay and nuclear reaction studies are presented for all nuclei with mass number A=213. This evaluation for A=213 supersedes the earlier one by Y. A. Akovali (1992Ak01), published in Nuclear Data Sheets 66, 237 (1992).

  5. Endogenous and exogenous components in the circadian variation of core body temperature in humans

    NARCIS (Netherlands)

    Hiddinga, AE; Beersma, DGM; VandenHoofdakker, RH

    Core body temperature is predominantly modulated by endogenous and exogenous components. In the present study we tested whether these two components can be reliably assessed in a protocol which lasts for only 120 h. In this so-called forced desynchrony protocol, 12 healthy male subjects (age 23.7

  6. Coordinating a Team of Robots for Urban Reconnaisance

    Science.gov (United States)

    2010-11-01

    skid on the ground in order to allow the robot to turn. Our wheels are driven along a gearway built into the inner rim of the tyre , with the...Wagner, Alan and et al. s.l. : Springer, 2006, Distributed Autonomous Robotic Systems, Vol. 7, pp. 237-248. 13. OrcBoard. OrcBoard. [Online

  7. Internationalisation of Vocational Education and Training: An Adapting Curve for Teachers and Learners

    Science.gov (United States)

    Tran, Ly Thi

    2013-01-01

    Competency-based training and training packages are mandatory for Australian vocational education and training (VET). VET qualifications are designed to provide learners with skills, knowledge, and attributes required for Australian workplaces. Yet, toward the end of December 2011, there were 171,237 international student enrolments in the…

  8. Response of a natural Phytoplankton community from the Qingdao coast (Yellow Sea, China) to variable CO2 levels over a short-term incubation experiment

    Digital Repository Service at National Institute of Oceanography (India)

    Biswas, H.; Jie, J.; Li, Y.; Zhang, G.; Zhu, Z.-Y.; Wu, Y.; Zhang, G.-L.; Li, Y.-W.; Liu, S.M.; Zhang, J.

    directions. Mar. Ecol. Prog. Ser., 2008, 373, 227–237. 13. Lewis, E. and Wallace, D. W. R., CO2SYS_calc_DOS_Original, program developed for CO2 system calculations ORNL/CDIAC- 105 carbon Dioxide Information Analysis Center Oak Ridge National Laboratory...

  9. شیوع مصرف تنباکوی غیرتدخینی در دانشجویان پسر دانشگاه‏های شهر زاهدان و آگاهی از مضرات آن در سال 1391

    Directory of Open Access Journals (Sweden)

    ماریه هنرمند

    2013-12-01

    Results: 102 male students (23.7% had used smokeless tobacco during their life time and 11.4% were current users. Smokeless tobacco consumption showed significant relationship with university type, living place, yearly average grade and education level of mother (P

  10. El expresionismo de Gutiérrez Girardot

    Directory of Open Access Journals (Sweden)

    Guillermo Linero Montes

    2006-05-01

    Full Text Available Entre la ilustración y el expresionismo. Figuras de la literatura alemana. Rafael Gutiérrez Girardot. Fondo de Cultura Económica. Colombia, colección Tierra Firme, Bogotá, 2004, 237 págs.

  11. Handbook for Nuclear Weapons Effects under Arctic Conditions. Sanitized.

    Science.gov (United States)

    1980-04-30

    substantiated by experimental measurements being performed presently in solar furnaces ( Knasel , 1980). * 2.3.7 M nfluence of Snow and Water on Dynamic Pressures...AD-659774. Knasel , M., private communication, results expected in mid 1980. Lorenz, R. A., private communication, February 1980. Napadensky, H

  12. A Longitudinal Study of Computer Voice Recognition Performance and Vocabulary Size.

    Science.gov (United States)

    1981-06-01

    Bilingual Mode, by D. E. Neil and T. Andreason, February 1981. Taggart, J. L. and Wolfe , C. D., Speech Recognition As An Input Medium For Preflight In The P3C...KENNEDY 236 PLOT ALL SUBMARINES 237 UNITED AIR LINES 238 IBERIAN CARRIER 239 WEST GERMAN TORPEDO Now RETURN this data sheet to GARY POOCK. 31

  13. Heavy metals found at Umzimvubu River Estuary in the Eastern ...

    African Journals Online (AJOL)

    songca

    2013-05-10

    May 10, 2013 ... It is well known that fertilizers may contain up to 400 ppm lead which may constitute a major source ... fertilizers in South Africa over t he fifty year period from. Songca et al. 237. 1955 to 2005 has increased ..... houses, roofed with zinc coated corrugated iron sheets. These may have contributed to the higher ...

  14. American Public Support for US Military Operations from Mogadishu to Baghdad

    Science.gov (United States)

    2005-01-01

    Bibliography 237 Lasswell , Harold , A Pre-View of the Policy Sciences, New York: American Elsevier, 1971. Leeds, Brett Ashley, and David R. Davis...objectives. 31 Lasswell (1971, pp. 15-26) posited the "social process model" as describing the context in which and with which the policymaker

  15. EST Table: BP178400 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available nositol oxygenase [Tribolium castaneum] FS806574 maV3 ... ...gene:AGAP003636 10/09/10 68 %/237 aa gnl|Amel|GB14956-PA 10/09/10 68 %/243 aa gi|91084833|ref|XP_966469.1| PREDICTED: similar to myoi

  16. Journal of Genetics | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Special issue - Evolutionary genetics: the Drosophila model. Guest Editor: Amitabh Joshi. pp 1-55 Volume 78 Issue 1 April 1999. Stationary-phase mutations in microorganisms. pp 237-4656 Volume 75 Issue 3 December 1996 INR 150 USD 30. Special issue on Genetics of filamentous fungi - in honour of David D. Perkins.

  17. GETDB: 104642 [GETDB

    Lifescience Database Archive (English)

    Full Text Available quest - pns subset, hg, sg no larva weak no gfp signal - - comment1:A, comment2:3... X-gal weak Adult GFP no gfp signal Lethality - Also known as - Original Comments comment1:A, comment2:37F1

  18. Decay data evaluation project (DDEP): updated evaluations of the 233Th and 241Am decay characteristics.

    Science.gov (United States)

    Chechev, Valery P; Kuzmenko, Nikolay K

    2010-01-01

    The results of new decay data evaluations are presented for (233)Th (beta(-)) decay to nuclear levels in (233)Pa and (241)Am (alpha) decay to nuclear levels in (237)Np. These evaluated data have been obtained within the Decay Data Evaluation Project using information published up to 2009. Copyright 2009 Elsevier Ltd. All rights reserved.

  19. Decay data evaluation project (DDEP): Updated evaluations of the {sup 233}Th and {sup 241}Am decay characteristics

    Energy Technology Data Exchange (ETDEWEB)

    Chechev, Valery P., E-mail: chechev@khlopin.r [V.G. Khlopin Radium Institute, 28 Second Murinsky Ave., St. Petersburg 194021 (Russian Federation); Kuzmenko, Nikolay K. [V.G. Khlopin Radium Institute, 28 Second Murinsky Ave., St. Petersburg 194021 (Russian Federation)

    2010-07-15

    The results of new decay data evaluations are presented for {sup 233}Th ({beta}{sup -}) decay to nuclear levels in {sup 233}Pa and {sup 241}Am ({alpha}) decay to nuclear levels in {sup 237}Np. These evaluated data have been obtained within the Decay Data Evaluation Project using information published up to 2009.

  20. Self-Monitoring Processes and Holland Vocational Preferences among College Students.

    Science.gov (United States)

    Brown, Michael T.; And Others

    1989-01-01

    Used Holland's Vocational Preference Inventory (VPI) and a self-monitoring scale to examine 237 undergraduates' association between self-monitoring and occupational preferences. Regression analyses revealed correlations between gender, self-monitoring propensity, and preferred occupational types (i.e., social, enterprising, or artistic). (TE)