
Sample records for californium 236

  1. Metabolism and toxicity of californium

    International Nuclear Information System (INIS)

    Metabolism of californium can be compared with that of other transplutonium elements. The most important points are as follows: a fast blood clearance and fast bone uptake more important than liver uptake, a relatively high urinary excretion and kidney retention. Blood clearance of californium can be compared with that of americium. Distribution of californium 252 nitrate after intramuscular injection in rats was studied. There are very few experimental data on acute or long term toxicity of californium. (28 references)

  2. Magnetism in californium

    International Nuclear Information System (INIS)

    A SQUID-based magnetic susceptometer has been constructed for studying small radioactive samples at temperatures below 350 K and in magnetic fields up to 50 kilogauss. The device has been used to study californium (element 98) in a number of solid-state forms: the dhcp metal, several oxides (Cf2O3 in both the bcc and monoclinic structures, Cf7O12, CfO2 and BaCfO3), several monopnictides (CfN, CfAs and CfSb) and the trichloride (in both the hexagonal and orthorhombic structures). All of these materials were studied in polycrystalline form, and hexagonal CfCl3 was studied in single-crystal form as well. The susceptometer has the sensitivity to measure samples containing less than 10 micrograms of californium. The magnetic susceptibilities of all of the californium materials at temperatures above about 100 K are described well by the Curie-Weiss relationship. This behavior is consistent with the assumption that the magnetic 5f electrons are localized and that the paramagnetic behavior can be interpreted in terms of the properties of the free ion. The measured values of the effective paramagnetic moment, μ/sub eff/, for all the californium materials that were studied are reasonably consistent with theoretical values based on intermediate coupling models. All of the californium materials showed some indications of cooperative magnetic effects. The dhcp metal was observed to order ferromagnetically at 52 K, and all of the californium compounds studied showed signs of antiferromagnetic ordering, mostly at temperatures below 25 K. 91 refs., 50 figs., 19 tabs

  3. Californium Multiplier (CFX)

    International Nuclear Information System (INIS)

    The availability of 252Cf as an economical high-intensity neutron source has made it possible to construct compact neutron irradiation devices with widespread applications. The simplest such device consists of a single 252Cf source within a moderating and shielding medium. Higher neutron flux levels can be attained either through the use of more 252Cf or through source multiplication by means of a subcritical uranium assembly. Although the use of larger 252Cf sources to achieve higher neutron flux is technically straightforward, an economic penalty is paid as the source strength is increased. Larger californium sources imply larger initial investments to cover the cost of source material and larger operating costs resulting from the decay of the 252Cf source. A Californium Multiplier, the CFX, which produces a flux enhancement of 30 when compared to a conventional moderated 252Cf system has been designed, licensed, built, and tested by IRT Corporation. Such systems are now available on a commercial basis for both neutron radiography and neutron activation analysis. The first commercial CFX system was installed at the Research Laboratories of Eastman Kodak Company in Rochester, NY, in March 1975. This device, using 1 mg of 252Cf, is very stable and the neutron flux generated by the CFX is very reproducible. The performance characteristics of this system are summarized

  4. Californium--palladium metal neutron source material (United States)

    Dahlen, B.L.; Mosly, W.C. Jr.; Smith, P.K.; Albenesius, E.L.


    Californium, as metal or oxide, is uniformly dispersed throughout a noble metal matrix, provided in compact, rod or wire form. A solution of californium values is added to palladium metal powder, dried, blended and pressed into a compact having a uni-form distribution of californium. The californium values are decomposed to californium oxide or metal by heating in an inert or reducing atmosphere. Sintering the compact to a high density closes the matrix around the dispersed californium. The sintered compact is then mechanically shaped into an elongated rod or wire form. (4 claims, no drawings) (Official Gazette)

  5. Californium-252 Neutron Sources for Medical Applications

    International Nuclear Information System (INIS)

    Californium-252 neutron sources are being prepared to investigate the value of this radionuclide in diagnosing and treating diseases. A source resembling a cell-loaded radium needle was developed for neutron therapy. Since therapy needles are normally implanted in the body, very conservative design criteria were established to prevent leakage of radioactive. Methods are being developed to prepare very intense californium sources that could be used eventually for neutron radiography and for diagnosis by neutron activation analysis. This paper discusses these methods

  6. Californium Electrodepositions at Oak Ridge National Laboratory

    Energy Technology Data Exchange (ETDEWEB)

    Boll, Rose Ann [ORNL


    Electrodepositions of californium isotopes were successfully performed at Oak Ridge National Laboratory (ORNL) during the past year involving two different types of deposition solutions, ammonium acetate (NH4C2H3O2) and isobutanol ((CH3)2CHCH2OH). A californium product that was decay enriched in 251Cf was recovered for use in super-heavy element (SHE) research. This neutron-rich isotope, 251Cf, provides target material for SHE research for the potential discovery of heavier isotopes of Z=118. The californium material was recovered from aged 252Cf neutron sources in storage at ORNL. These sources have decayed for over 30 years, thus providing material with a very high 251Cf-to-252Cf ratio. After the source capsules were opened, the californium was purified and then electrodeposited using the isobutanol method onto thin titanium foils for use in an accelerator at the Joint Institute for Nuclear Research in Dubna, Russia. Another deposition method, ammonium acetate, was used to produce a deposition containing 1.7 0.1 Ci of 252Cf onto a stainless steel substrate. This was the largest single electrodeposition of 252Cf ever prepared. The 252Cf material was initially purified using traditional ion exchange media, such as AG50-AHIB and AG50-HCl, and further purified using a TEVA-NH4SCN system to remove any lanthanides, resulting in the recovery of 3.6 0.1 mg of purified 252Cf. The ammonium acetate deposition was run with a current of 1.0 amp, resulting in a 91.5% deposition yield. Purification and handling of the highly radioactive californium material created additional challenges in the production of these sources.

  7. Historical review of californium-252 discovery and development

    International Nuclear Information System (INIS)

    This paper discusses the discovery and history of californium 252. This isotope may be synthesized by irradiating plutonium 239, plutonium 242, americium 243, or curium 244 with neutrons in a nuclear reactor. Various experiments and inventions involving 252Cf conducted at the Savannah River Plant are discussed. The evolution of radiotherapy using californium 252 is reviewed

  8. Californium-252: a remarkable versatile radioisotope

    Energy Technology Data Exchange (ETDEWEB)

    Osborne-Lee, I.W.; Alexander, C.W.


    A product of the nuclear age, Californium-252 ({sup 252}Cf) has found many applications in medicine, scientific research, industry, and nuclear science education. Californium-252 is unique as a neutron source in that it provides a highly concentrated flux and extremely reliable neutron spectrum from a very small assembly. During the past 40 years, {sup 252}Cf has been applied with great success to cancer therapy, neutron radiography of objects ranging from flowers to entire aircraft, startup sources for nuclear reactors, fission activation for quality analysis of all commercial nuclear fuel, and many other beneficial uses, some of which are now ready for further growth. Californium-252 is produced in the High Flux Isotope Reactor (HFIR) and processed in the Radiochemical Engineering Development Center (REDC), both of which are located at the Oak Ridge National Laboratory (ORNL) in Oak Ridge, Tennessee. The REDC/HFIR facility is virtually the sole supplier of {sup 252}Cf in the western world and is the major supplier worldwide. Extensive exploitation of this product was made possible through the {sup 252}Cf Market Evaluation Program, sponsored by the United States Department of Energy (DOE) [then the Atomic Energy Commission (AEC) and later the Energy Research and Development Administration (ERDA)]. This program included training series, demonstration centers, seminars, and a liberal loan policy for fabricated sources. The Market Evaluation Program was instituted, in part, to determine if large-quantity production capability was required at the Savannah River Laboratory (SRL). Because of the nature of the product and the means by which it is produced, {sup 252}Cf can be produced only in government-owned facilities. It is evident at this time that the Oak Ridge research facility can meet present and projected near-term requirements. The production, shipment, and sales history of {sup 252}Cf from ORNL is summarized herein.

  9. Californium-252: a remarkable versatile radioisotope

    International Nuclear Information System (INIS)

    A product of the nuclear age, Californium-252 (252Cf) has found many applications in medicine, scientific research, industry, and nuclear science education. Californium-252 is unique as a neutron source in that it provides a highly concentrated flux and extremely reliable neutron spectrum from a very small assembly. During the past 40 years, 252Cf has been applied with great success to cancer therapy, neutron radiography of objects ranging from flowers to entire aircraft, startup sources for nuclear reactors, fission activation for quality analysis of all commercial nuclear fuel, and many other beneficial uses, some of which are now ready for further growth. Californium-252 is produced in the High Flux Isotope Reactor (HFIR) and processed in the Radiochemical Engineering Development Center (REDC), both of which are located at the Oak Ridge National Laboratory (ORNL) in Oak Ridge, Tennessee. The REDC/HFIR facility is virtually the sole supplier of 252Cf in the western world and is the major supplier worldwide. Extensive exploitation of this product was made possible through the 252Cf Market Evaluation Program, sponsored by the United States Department of Energy (DOE) [then the Atomic Energy Commission (AEC) and later the Energy Research and Development Administration (ERDA)]. This program included training series, demonstration centers, seminars, and a liberal loan policy for fabricated sources. The Market Evaluation Program was instituted, in part, to determine if large-quantity production capability was required at the Savannah River Laboratory (SRL). Because of the nature of the product and the means by which it is produced, 252Cf can be produced only in government-owned facilities. It is evident at this time that the Oak Ridge research facility can meet present and projected near-term requirements. The production, shipment, and sales history of 252Cf from ORNL is summarized herein

  10. Californium-252 Neutron Therapy in China

    International Nuclear Information System (INIS)

    Californium-252 brachytherapy, believed to be the most successful source for neutron therapy, gives most of the cures as well as long-term and complication-free survivals. Chinese radiation oncologists were interested in californium neutron therapy (Cf-NT) in the early 1980s, but 252Cf sources for medical use were not available in China until 1992 when a californium joint venture was established by the China Institute of Atomic Energy (Beijing) and the Research Institute for Nuclear Reactors (Dimitrovgrad) of Russia. In 1995, 25 seeds of 252Cf with a strength of 3 μg each were sent to China for preclinical investigation. Three years later, a high dose rate (HDR) 252Cf source was imported and transferred into a home-made remote after-loader for intracavitary treatment in Chongqing, and a clinical trail was started in February 1999. This is the first time that Cf-NT was performed for cancer patients in China. Since then, Cf-NT in China has developed rapidly. It is estimated that one-tenth of those radiation oncology centers with brachytherapy practice will be equipped with californium units in 5 yr. That means more than 30 units will be in use in hospitals. That is significant compared with other countries, but it is just one, on average, for each province or one per 40 million people in China. Progress also has been achieved in the 252Cf treatment delivery equipment. Preliminary clinical trails showed complete response observed in all cases treated, with a rapid clearance of tumors and mild reactions in normal tissues. The short-term results are quite encouraging. To deal with problems due to the demand for Cf-NT in China, attention should be paid to the following particulars: (1) A high-strength miniature source is needed for HDR/MDR interstitial therapy to extend the Cf-NT coverage. (2) Basic work on radiophysics and radiobiology needs to be done, including source calibration, clinical dosimetry, clinical RBE determination, and Cf-NT quality assurance

  11. Californium-252 sales and loans at Oak Ridge National Laboratory

    International Nuclear Information System (INIS)

    The production and distribution in the United States of 252Cf has recently been consolidated at the Oak Ridge National Laboratory (ORNL). The 252Cf Industrial Sales/Loan Program and the 252Cf University Load Program, which were formerly located at the Savannah River Plant (SRP), have been combined with the californium production and distribution activities of the Transuranium Element Production Program at ORNL. Californium-252 is sold to commercial users in the form of bulk californium oxide, palladium-californium alloy pellets, or alloy wires. Neutron source capsules, which are fabricated for loans to DOE or other US government agencies, are still available in all forms previously available. The consolidation of all 252Cf distribution activities at the production site is expected to result in better service to users. In particular, customers for neutrons sources will be ale to select from a wider range of neutron source forms, including custom designs, through a single contact point

  12. Californium-252 encapsulation at the Savannah River Laboratory

    International Nuclear Information System (INIS)

    More than 1 g of the neutron-emitting isotope californium-252 has been encapsulated at SRL for worldwide medical, industrial, and research uses. Bulk sales packages have been prepared for the USDOE sales program since 1971. Doubly-encapsulated sources have been prepared for USDOE's market evaluation program since 1968. Californium-252 sources for loan and sales packages satisfy the criteria for Special Form Radioactive Material. Encapsulation is performed in special neutron-shielded containment facilities at SRL. Development of improved source and shipping package designs and processes is continuing. 17 figures

  13. Production, distribution and applications of californium-252 neutron sources

    International Nuclear Information System (INIS)

    The radioisotope 252Cf is routinely encapsulated into compact, portable, intense neutron sources with a 2.6-yr half-life. A source the size of a person's little finger can emit up to 1011 neutrons s-1. Californium-252 is used commercially as a reliable, cost-effective neutron source for prompt gamma neutron activation analysis (PGNAA) of coal, cement and minerals, as well as for detection and identification of explosives, land mines and unexploded military ordnance. Other uses are neutron radiography, nuclear waste assays, reactor start-up sources, calibration standards and cancer therapy. The inherent safety of source encapsulations is demonstrated by 30 yr of experience and by US Bureau of Mines tests of source survivability during explosions. The production and distribution center for the US Department of Energy (DOE) Californium Program is the Radiochemical Engineering Development Center (REDC) at Oak Ridge National Laboratory (ORNL). DOE sells 252Cf to commercial reencapsulators domestically and internationally. Sealed 252Cf sources are also available for loan to agencies and subcontractors of the US government and to universities for educational, research and medical applications. The REDC has established the Californium User Facility (CUF) for Neutron Science to make its large inventory of 252Cf sources available to researchers for irradiations inside uncontaminated hot cells. Experiments at the CUF include a land mine detection system, neutron damage testing of solid-state detectors, irradiation of human cancer cells for boron neutron capture therapy experiments and irradiation of rice to induce genetic mutations

  14. Production, distribution and applications of californium-252 neutron sources. (United States)

    Martin, R C; Knauer, J B; Balo, P A


    The radioisotope 252Cf is routinely encapsulated into compact, portable, intense neutron sources with a 2.6-yr half-life. A source the size of a person's little finger can emit up to 10(11) neutrons s(-1). Californium-252 is used commercially as a reliable, cost-effective neutron source for prompt gamma neutron activation analysis (PGNAA) of coal, cement and minerals, as well as for detection and identification of explosives, land mines and unexploded military ordinance. Other uses are neutron radiography, nuclear waste assays, reactor start-up sources, calibration standards and cancer therapy. The inherent safety of source encapsulations is demonstrated by 30 yr of experience and by US Bureau of Mines tests of source survivability during explosions. The production and distribution center for the US Department of Energy (DOE) Californium Program is the Radiochemical Engineering Development Center (REDC) at Oak Ridge National Laboratory (ORNL). DOE sells 252Cf to commercial reencapsulators domestically and internationally. Sealed 252Cf sources are also available for loan to agencies and subcontractors of the US government and to universities for educational, research and medical applications. The REDC has established the Californium User Facility (CUF) for Neutron Science to make its large inventory of 252Cf sources available to researchers for irradiations inside uncontaminated hot cells. Experiments at the CUF include a land mine detection system, neutron damage testing of solid-state detectors, irradiation of human cancer cells for boron neutron capture therapy experiments and irradiation of rice to induce genetic mutations. PMID:11003521

  15. Production, Distribution, and Applications of Californium-252 Neutron Sources

    Energy Technology Data Exchange (ETDEWEB)

    Balo, P.A.; Knauer, J.B.; Martin, R.C.


    The radioisotope {sup 252}Cf is routinely encapsulated into compact, portable, intense neutron sources with a 2.6-year half-life. A source the size of a person's little finger can emit up to 10{sup 11} neutrons/s. Californium-252 is used commercially as a reliable, cost-effective neutron source for prompt gamma neutron activation analysis (PGNAA) of coal, cement, and minerals, as well as for detection and identification of explosives, laud mines, and unexploded military ordnance. Other uses are neutron radiography, nuclear waste assays, reactor start-up sources, calibration standards, and cancer therapy. The inherent safety of source encapsulations is demonstrated by 30 years of experience and by U.S. Bureau of Mines tests of source survivability during explosions. The production and distribution center for the U. S Department of Energy (DOE) Californium Program is the Radiochemical Engineering Development Center (REDC) at Oak Ridge National Laboratory (ORNL). DOE sells The radioisotope {sup 252}Cf is routinely encapsulated into compact, portable, intense neutron sources with a 2.6- year half-life. A source the size of a person's little finger can emit up to 10 neutrons/s. Californium-252 is used commercially as a reliable, cost-effective neutron source for prompt gamma neutron activation analysis (PGNAA) of coal, cement, and minerals, as well as for detection and identification of explosives, laud mines, and unexploded military ordnance. Other uses are neutron radiography, nuclear waste assays, reactor start-up sources, calibration standards, and cancer therapy. The inherent safety of source encapsulations is demonstrated by 30 years of experience and by U.S. Bureau of Mines tests of source survivability during explosions. The production and distribution center for the U. S Department of Energy (DOE) Californium Program is the Radiochemical Engineering Development Center (REDC) at Oak Ridge National Laboratory(ORNL). DOE sells {sup 252}Cf to commercial

  16. Production of extra pure curium and californium preparations

    International Nuclear Information System (INIS)

    Preparations of curium-244,245,248 and californium-249,252 are used for the production of ionizing radiation sources for different applications and fundamental nuclear-physical investigations, placing high requirements on the radiochemical and chemical purity of the preparations. Extraction chromatography using di-(2-ethylhexyl)phosphoric acid (D2EHPA) as extractant was chosen to prepare extra pure curium and californium preparations. In order to identify the optimal conditions of Cm-Cf separation and to remove impurities from them (reagent and other impurities), investigations were performed into the effect of impurities (Na+, Ca2+, Al3+, Fe2+, Fe3+ taken as example), extractant and eluent concentration and solution flow rate on the efficiency of mutual purification of Cm and Cf. Both theoretical and experimental estimations were made of the maximum concentration at which the impurities do not affect the process. The conditions chosen allow mutual purification of milligram amounts of Cm and Cf from impurity elements at E(pur) =102 - 103 during a single chromatographic cycle (E(pur) =>103) using a column with 5 - 10 cm3 volume. In this case the production yield exceeds 98%. The purification of milligram amounts of curium and californium from fission products (lanthanides in general, cerium in particular) was performed in D2EHPA-decane-PbO2-HNO3 and D2EHPA-decane-DTPA-H3-Cit extraction chromatography systems. In order to establish the optimal conditions, the effect of [D2EHPA] and eluent on the mutual purification of Cm and Cf and on their purification from cerium and impurity elements was studied in the D2EHPA-decane-PbO2-HNO3 system. During a single chromatographic cycle the mutual purification factors of TPE and of their purification from impurity cations achieve 102-103, from cerium - E(pur) > 10. In the D2EHPA-decane-DTPA-H3Cit system, the effect of concentration of extractant and eluent pH on the efficiency of Cm and Cf purification from lanthanides was

  17. Prompt neutron spectrum of the spontaneous fission of californium-252

    International Nuclear Information System (INIS)

    The californium-252 spontaneous fission neutron spectrum was measured in the energy range of 0.01 to 10 MeV by the time-of-flight technique using various neutron detectors. The measurements of 252Cf neutron spectrum at energies of 0.01 to 5 MeV were performed as a function of fission fragment kinetic energy. The mean neutron spectrum energy in the range of 0.7 to 10 MeV was found from the results of measurements. The irregularity in the 252Cf neutron spectrum in the neutron energy range of less than 0.7 MeV compared to theoretical values is discussed. The mechanism of 252Cf neutron emission is also discussed on the basis of neutron yield angle measurements. 12 references

  18. Oceanography with Uranium-236

    International Nuclear Information System (INIS)

    Bomb fall-out 236U is a new oceanic tracer with great merits: Uranium-236 behaves conservatively in the ocean with a strong correlation to salinity, while the long half-life of 23.5 million years makes it an essentially stable isotope on the time-scales of ocean transport phenomena. A challenge is constraining the overall input from atmospheric bomb testing. Of great help is the possibility to track the 236U evolution back before the times where measurements of this isotope at the lowest levels were possible, by employing coral cores as geological archives. Coverage of 236U measurements in ocean water is still scarce. At VERA two depth profiles and a surface transect from the South Atlantic (GEOTRACES cruise GA10/JC068) have recently been measured for 236U, putting the first ever southern hemisphere data on the map. The specific sampling locations allowed characterizing the major South Atlantic and Southern Ocean water masses for this isotope. (author)

  19. Separation of californium from actinides and lanthanides in aqueous solution by electrochemical formation of amalgams

    International Nuclear Information System (INIS)

    The electrochemical reduction of transneptunium elements (Pu to Cf) and rare earths (Eu, Tm) from aqueous complexing solutions to amalgams was studied over a wide range of cathodic potentials in order to achieve optimal separation of californium. The reduction in acetate media (pH 4.5-4.6) at potentials around -1.7 to -1.9 V1 leads to a quantitative extraction of californium into the mercury phase, while more negative potentials are required for the reduction of the lighter transuranium elements and of the lanthanides. Hence, the optimal conditions for the separation of californium from the investigated actinides and lanthanides were determined. Separation factors α between 25 and 90 were found except in the case of Cf/Eu, where poor values (α varying from 7 to 12) were observed. More negative cathodic potentials decrease the selectivity of the reduction process. A similar study with lithium citrate solutions (pH ∝6) shows that satisfactory separation of californium from lighter and heavier actinides is achievable. A separation factor of 88 is obtained for Cf/Am at -1.98 V. The anodic stripping of mixed amalgams (Pu, Am, Cm, Bk, Tm and Cf) Hg in nitric and acetic acid soultions at potentials ranging from +0.1 to -0.7 V proceeds slowly and proved to be ineffective for the separation of californium from light actinides under conditions described. (orig.)

  20. On-line slurry analyses by californium-252

    International Nuclear Information System (INIS)

    In chemical processing technology on-line activation methods gain an increasing importance for process monitoring and control. A method is described according to which the different fluorspar contents at various strategic points of a flotation plant are determined through neutron activation by 100 μg californium-252. A continuous analytical system for onstream process control of slurries was designed and constructed. A compact facility, called SUSAC, allows continuous application of the method on an industrial scale. The main components of the SUSAC facility are the irradiation and measurement cells. The cells are equipped with multistage countercurrent stirrers ensuring a proper radial and vertical distribution of the sample. The hollow shaft of the stirrer of the irradiation cell houses the Cf-source. The NaI-detector has been installed in a recess in the bottom of the measuring cell. The volumes are 9 dm3 for the irradiation cell, 7.5 dm3 for the measuring cell, 1/2 dm3 for the vonnection line and 4 dm3 for feed and drainage lines including the pump. Investigations on the following topics are discussed: selection of stirrers, residence time, flow rate, pulp density, calibration measurements. (T.G.)

  1. Biomedical neutron research at the Californium User Facility for neutron science

    International Nuclear Information System (INIS)

    The Californium User Facility for Neutron Science has been established at Oak Ridge National Laboratory (ORNL). The Californium User Facility (CUF) is a part of the larger Californium Facility, which fabricates and stores compact 252Cf neutron sources for worldwide distribution. The CUF can provide a cost-effective option for research with 252Cf sources. Three projects at the CUF that demonstrate the versatility of 252Cf for biological and biomedical neutron-based research are described: future establishment of a 252Cf-based neutron activation analysis system, ongoing work to produce miniature high-intensity, remotely afterloaded 252Cf sources for tumor therapy, and a recent experiment that irradiated living human lung cancer cells impregnated with experimental boron compounds to test their effectiveness for boron neutron capture therapy

  2. Biomedical neutron research at the Californium User Facility for neutron science

    Energy Technology Data Exchange (ETDEWEB)

    Martin, R.C. [Oak Ridge National Lab., TN (United States); Byrne, T.E. [Roane State Community College, Harriman, TN (United States); Miller, L.F. [Univ. of Tennessee, Knoxville, TN (United States)


    The Californium User Facility for Neutron Science has been established at Oak Ridge National Laboratory (ORNL). The Californium User Facility (CUF) is a part of the larger Californium Facility, which fabricates and stores compact {sup 252}Cf neutron sources for worldwide distribution. The CUF can provide a cost-effective option for research with {sup 252}Cf sources. Three projects at the CUF that demonstrate the versatility of {sup 252}Cf for biological and biomedical neutron-based research are described: future establishment of a {sup 252}Cf-based neutron activation analysis system, ongoing work to produce miniature high-intensity, remotely afterloaded {sup 252}Cf sources for tumor therapy, and a recent experiment that irradiated living human lung cancer cells impregnated with experimental boron compounds to test their effectiveness for boron neutron capture therapy.

  3. Proposed Californium-252 User Facility for Neutron Science at Oak Ridge National Laboratory

    International Nuclear Information System (INIS)

    The Radiochemical Engineering Development Center (REDC) at ORNL has petitioned to establish a Californium-252 User Facility for Neutron Science for academic, industrial, and governmental researchers. The REDC Californium Facility (CF) stores the national inventory of sealed 252Cf neutron source for university and research loans. Within the CF, the 252Cf storage pool and two uncontaminated hot cells currently in service for the Californium Program will form the physical basis for the User Facility. Relevant applications include dosimetry and experiments for neutron tumor therapy; fast and thermal neutron activation analysis of materials; experimental configurations for prompt gamma neutron activation analysis; neutron shielding and material damage studies; and hardness testing of radiation detectors, cameras, and electronics. A formal User Facility simplifies working arrangements and agreements between US DOE facilities, academia, and commercial interests

  4. Emergence of californium as the second transitional element in the actinide series. (United States)

    Cary, Samantha K; Vasiliu, Monica; Baumbach, Ryan E; Stritzinger, Jared T; Green, Thomas D; Diefenbach, Kariem; Cross, Justin N; Knappenberger, Kenneth L; Liu, Guokui; Silver, Mark A; DePrince, A Eugene; Polinski, Matthew J; Van Cleve, Shelley M; House, Jane H; Kikugawa, Naoki; Gallagher, Andrew; Arico, Alexandra A; Dixon, David A; Albrecht-Schmitt, Thomas E


    A break in periodicity occurs in the actinide series between plutonium and americium as the result of the localization of 5f electrons. The subsequent chemistry of later actinides is thought to closely parallel lanthanides in that bonding is expected to be ionic and complexation should not substantially alter the electronic structure of the metal ions. Here we demonstrate that ligation of californium(III) by a pyridine derivative results in significant deviations in the properties of the resultant complex with respect to that predicted for the free ion. We expand on this by characterizing the americium and curium analogues for comparison, and show that these pronounced effects result from a second transition in periodicity in the actinide series that occurs, in part, because of the stabilization of the divalent oxidation state. The metastability of californium(II) is responsible for many of the unusual properties of californium including the green photoluminescence. PMID:25880116

  5. Fissile analysis of Hanford waste using Californium Multiplier/Delayed Neutron Counter system

    International Nuclear Information System (INIS)

    Measurement of low-level (10 ng/g or lower) fissile material (mainly plutonium) in Hanford waste and process samples is becoming increasingly important. A system has been designed consisting of a Californium Multiplier (CFX) and a Delayed Neutron Counter (DNC) to characterize these samples. This report describes hardware and analytical capability of the CFX/DNC system

  6. Study of the shielding for spontaneous fission sources of Californium-252

    International Nuclear Information System (INIS)

    A shielding study is made to attenuate, until maximum permissible levels, the neutrons radiation and photons emitted by spontaneous fission coming from a source of Californium-252. The compound package by a database (Library DLC-23) and the ANISNW code is used, in it version for personal computer. (Author)

  7. Californium (252Cf) and its use as neutron source in science medicine and technology

    International Nuclear Information System (INIS)

    The application of radionuclides in science and nuclear techniques basically is related to unstable isotopes, which are produced from stable elements in nuclear reactor. Their specifications are various from view point of application . Using of physical and chemical properties of radionuclides in chemistry, for with marking the organic compounds we can exactly explain the mechanism of chemical reactions in medical, biology and bio-chemistry. In these cases the behaviour of radionuclides is very important and the selection of the suitable radionuclides is determined between the elements for investigation aims. The special specification of radio-nuclides analysis such as, half-life, kind of ray and energy should be considered with an special accuracy as well as the laws security regulations from view point of ray-protection should be completely observed mean time working these radio-nuclides. It should be considered that application of radio-isotopes is very important from their special specifications point of view. Applying the radionuclides from technology point of view in sciences and nuclear techniques aren't only limited to three analyses of α, β, and γ, but we can use the share of neutron which are produced from spli ting of heavy nucleus such as Californium252 as a neutron source in the depths of the sea and also determining the concentration of low quantity elements on moon and other spheres. The radioisotope of Californium252 is a neutron useful radiator for investigation in nuclear medical and technology because of automatically rapid split to 3.2% Californium252 radiates 1.34 * 109N/m in each mil/GH which suitable replacement for neutron sources based on (a, n) reaction, for example, Radium-Brellium or Amersium-Brellium. The energy distribution of radiated neutrons from analyzing of Californium252 like the spectrum of neutron which is produced from splitting of U235, Pu239 nucleus has the maximum energy in quantity, En=1 MeV in the range of 1.5 MeV. The

  8. Contribution to clinical dosimetry of californium 252 sources used at Gustave Roussy institute

    International Nuclear Information System (INIS)

    The main characteristics of californium 252 sources are presented in the first part of the report. Dose measurements around Californium sources were performed with a pair of ionization multiplication chambers: the first one has an Aluminium wall and is filled with Argon, the second one a plastic tissue-equivalent gas. A set of experiments was performed in order to investigate the relative influence of beta rays on the response of both chambers. Besides the experimental work a computer program was written to calculate the dose distribution around the actual sources made of a series of small active sources placed in catheters. Theoretical data around small sources can be found in the litterature. The comparison between experimental results and theoretical ones has shown a good agreement. The computer program will be included as a sub-routine in the more general computer program used for patients treated with interstitial therapy

  9. Safety Analysis Report for Packaging (SARP) of the Oak Ridge National Laboratory TRU Californium Shipping Container

    International Nuclear Information System (INIS)

    An analytical evaluation of the Oak Ridge National Laboratory TRU Californium Shipping Container was made in order to demonstrate its compliance with the regulations governing off-site shipment of packages that contain radioactive material. The evaluation encompassed five primary categories: structural integrity, thermal resistance, radiation shielding, nuclear criticality safety, and quality assurance. The results of this evaluation demonstrate that the container complies with the applicable regulations

  10. Emergence of californium as the second transitional element in the actinide series


    Cary, Samantha K.; Vasiliu, Monica; Baumbach, Ryan E.; Stritzinger, Jared T.; GREEN, THOMAS D.; Diefenbach, Kariem; Cross, Justin N.; Knappenberger, Kenneth L.; Liu, Guokui; Silver, Mark A.; DePrince, A. Eugene; Polinski, Matthew J.; Van Cleve, Shelley M.; House, Jane H.; Kikugawa, Naoki


    A break in periodicity occurs in the actinide series between plutonium and americium as the result of the localization of 5f electrons. The subsequent chemistry of later actinides is thought to closely parallel lanthanides in that bonding is expected to be ionic and complexation should not substantially alter the electronic structure of the metal ions. Here we demonstrate that ligation of californium(III) by a pyridine derivative results in significant deviations in the properties of the resu...

  11. 49 CFR 236.563 - Delay time. (United States)


    ... 49 Transportation 4 2010-10-01 2010-10-01 false Delay time. 236.563 Section 236.563 Transportation... Cab Signal Systems Rules and Instructions; Locomotives § 236.563 Delay time. Delay time of automatic... requirements of § 236.24 shall take into consideration the delay time....

  12. 49 CFR 236.588 - Periodic test. (United States)


    ... 49 Transportation 4 2010-10-01 2010-10-01 false Periodic test. 236.588 Section 236.588..., Train Control and Cab Signal Systems Inspection and Tests; Locomotive § 236.588 Periodic test. Except as provided in § 236.586, periodic test of the automatic train stop, train control, or cab signal...

  13. Measurements of integral cross sections in the californium-252 fission neutron spectrum

    International Nuclear Information System (INIS)

    In a low-scattering arrangement cross sections averaged over the californium-252 spontaneous fission neutron spectrum were measured. The reactions 27Al(n,α)46Ti, 47Ti, 48Ti(n,p), 54Fe,56Fe(n,p), 58Ni(n,p), 64Zn(n,p), 115In(n,n') were studied in order to obtain a consistent set of threshold detectors used in fast neutron flux density measurements. Overall uncertainties between 2 and 2.5% could be achieved; corrections due to neutron scattering in source and samples are discussed

  14. Measurement of californium-252 gamma photons depth dose distribution in tissue equivalent material. Vol. 4

    International Nuclear Information System (INIS)

    Phantom of tissue equivalent material with and without bone was used measuring depth dose distribution of gamma-rays from californium-252 source. The source was positioned at center of perspex walled phantom. Depth dose measurements were recorded for X, Y and Z planes at different distances from source. TLD 700 was used for measuring the dose distribution. Results indicate that implantation of bone in tissue equivalent medium cause changes in the gamma depth dose distribution which varies according to variation in bone geometry. 9 figs

  15. 49 CFR 236.564 - Acknowledging time. (United States)


    ... 49 Transportation 4 2010-10-01 2010-10-01 false Acknowledging time. 236.564 Section 236.564..., Train Control and Cab Signal Systems Rules and Instructions; Locomotives § 236.564 Acknowledging time. Acknowledging time of intermittent automatic train-stop device shall be not more than 30 seconds....

  16. 49 CFR 236.712 - Brake pipe. (United States)


    ... 49 Transportation 4 2010-10-01 2010-10-01 false Brake pipe. 236.712 Section 236.712 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION, DEPARTMENT OF... OF SIGNAL AND TRAIN CONTROL SYSTEMS, DEVICES, AND APPLIANCES Definitions § 236.712 Brake pipe. A...

  17. 49 CFR 236.832 - Train. (United States)


    ... 49 Transportation 4 2010-10-01 2010-10-01 false Train. 236.832 Section 236.832 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION, DEPARTMENT OF... OF SIGNAL AND TRAIN CONTROL SYSTEMS, DEVICES, AND APPLIANCES Definitions § 236.832 Train....

  18. 49 CFR 236.833 - Train, opposing. (United States)


    ... 49 Transportation 4 2010-10-01 2010-10-01 false Train, opposing. 236.833 Section 236.833..., MAINTENANCE, AND REPAIR OF SIGNAL AND TRAIN CONTROL SYSTEMS, DEVICES, AND APPLIANCES Definitions § 236.833 Train, opposing. A train, the movement of which is in a direction opposite to and toward another...

  19. 46 CFR 153.236 - Prohibited materials. (United States)


    ... 46 Shipping 5 2010-10-01 2010-10-01 false Prohibited materials. 153.236 Section 153.236 Shipping... BULK LIQUID, LIQUEFIED GAS, OR COMPRESSED GAS HAZARDOUS MATERIALS Design and Equipment Cargo Containment Systems § 153.236 Prohibited materials. When one of the following paragraphs of this section...

  20. 49 CFR 236.742 - Dog, locking. (United States)


    ... 49 Transportation 4 2010-10-01 2010-10-01 false Dog, locking. 236.742 Section 236.742 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION..., MAINTENANCE, AND REPAIR OF SIGNAL AND TRAIN CONTROL SYSTEMS, DEVICES, AND APPLIANCES Definitions § 236.742...

  1. 49 CFR 236.718 - Chart, dog. (United States)


    ... 49 Transportation 4 2010-10-01 2010-10-01 false Chart, dog. 236.718 Section 236.718 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION, DEPARTMENT OF... OF SIGNAL AND TRAIN CONTROL SYSTEMS, DEVICES, AND APPLIANCES Definitions § 236.718 Chart, dog....

  2. 49 CFR 236.743 - Dog, swing. (United States)


    ... 49 Transportation 4 2010-10-01 2010-10-01 false Dog, swing. 236.743 Section 236.743 Transportation... OF SIGNAL AND TRAIN CONTROL SYSTEMS, DEVICES, AND APPLIANCES Definitions § 236.743 Dog, swing. A locking dog mounted in such a manner that it is free to rotate on a trunnion which is riveted to a...

  3. 24 CFR 236.901 - Audit. (United States)


    ... accordance with HUD audit requirements at 24 CFR part 44. ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Audit. 236.901 Section 236.901... AND INTEREST REDUCTION PAYMENT FOR RENTAL PROJECTS Audits § 236.901 Audit. Where a State or...

  4. 36 CFR 2.36 - Gambling. (United States)


    ... 36 Parks, Forests, and Public Property 1 2010-07-01 2010-07-01 false Gambling. 2.36 Section 2.36 Parks, Forests, and Public Property NATIONAL PARK SERVICE, DEPARTMENT OF THE INTERIOR RESOURCE PROTECTION, PUBLIC USE AND RECREATION § 2.36 Gambling. (a) Gambling in any form, or the operation of...

  5. 49 CFR 236.814 - Station, control. (United States)


    ... 49 Transportation 4 2010-10-01 2010-10-01 false Station, control. 236.814 Section 236.814..., MAINTENANCE, AND REPAIR OF SIGNAL AND TRAIN CONTROL SYSTEMS, DEVICES, AND APPLIANCES Definitions § 236.814 Station, control. The place where the control machine of a traffic control system is located....

  6. 49 CFR 236.771 - Machine, control. (United States)


    ... 49 Transportation 4 2010-10-01 2010-10-01 false Machine, control. 236.771 Section 236.771..., MAINTENANCE, AND REPAIR OF SIGNAL AND TRAIN CONTROL SYSTEMS, DEVICES, AND APPLIANCES Definitions § 236.771 Machine, control. An assemblage of manually operated devices for controlling the functions of a...

  7. 49 CFR 236.777 - Operator, control. (United States)


    ... 49 Transportation 4 2010-10-01 2010-10-01 false Operator, control. 236.777 Section 236.777..., MAINTENANCE, AND REPAIR OF SIGNAL AND TRAIN CONTROL SYSTEMS, DEVICES, AND APPLIANCES Definitions § 236.777 Operator, control. An employee assigned to operate the control machine of a traffic control system....

  8. 49 CFR 236.702 - Arm, semaphore. (United States)


    ... 49 Transportation 4 2010-10-01 2010-10-01 false Arm, semaphore. 236.702 Section 236.702 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION..., MAINTENANCE, AND REPAIR OF SIGNAL AND TRAIN CONTROL SYSTEMS, DEVICES, AND APPLIANCES Definitions § 236.702...

  9. 49 CFR 236.703 - Aspect. (United States)


    ... 49 Transportation 4 2010-10-01 2010-10-01 false Aspect. 236.703 Section 236.703 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION, DEPARTMENT OF... OF SIGNAL AND TRAIN CONTROL SYSTEMS, DEVICES, AND APPLIANCES Definitions § 236.703 Aspect....

  10. 33 CFR 236.3 - References. (United States)


    ... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false References. 236.3 Section 236.3 Navigation and Navigable Waters CORPS OF ENGINEERS, DEPARTMENT OF THE ARMY, DEPARTMENT OF DEFENSE WATER... QUALITY § 236.3 References. (a) PL 89-72 (b) ER 1105-2-10 (c) ER 1105-2-200...

  11. 49 CFR 236.105 - Electric lock. (United States)


    ... 49 Transportation 4 2010-10-01 2010-10-01 false Electric lock. 236.105 Section 236.105 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION...: All Systems Inspections and Tests; All Systems § 236.105 Electric lock. Electric lock, except...

  12. 49 CFR 236.793 - Rod, lock. (United States)


    ... 49 Transportation 4 2010-10-01 2010-10-01 false Rod, lock. 236.793 Section 236.793 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION, DEPARTMENT OF... OF SIGNAL AND TRAIN CONTROL SYSTEMS, DEVICES, AND APPLIANCES Definitions § 236.793 Rod, lock. A...

  13. 49 CFR 236.329 - Bolt lock. (United States)


    ... 49 Transportation 4 2010-10-01 2010-10-01 false Bolt lock. 236.329 Section 236.329 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION, DEPARTMENT OF... § 236.329 Bolt lock. Bolt lock shall be so maintained that signal governing movements over switch...

  14. 49 CFR 236.756 - Lock, bolt. (United States)


    ... 49 Transportation 4 2010-10-01 2010-10-01 false Lock, bolt. 236.756 Section 236.756 Transportation... OF SIGNAL AND TRAIN CONTROL SYSTEMS, DEVICES, AND APPLIANCES Definitions § 236.756 Lock, bolt. A mechanical lock so arranged that if a switch, derail or movable-point frog is not in the proper position...

  15. 49 CFR 236.587 - Departure test. (United States)


    ... 49 Transportation 4 2010-10-01 2010-10-01 false Departure test. 236.587 Section 236.587..., Train Control and Cab Signal Systems Inspection and Tests; Locomotive § 236.587 Departure test. (a) The...: (1) Operation over track elements; (2) Operation over test circuit; (3) Use of portable...

  16. 49 CFR 236.376 - Mechanical locking. (United States)


    ... 49 Transportation 4 2010-10-01 2010-10-01 false Mechanical locking. 236.376 Section 236.376 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION... and Tests § 236.376 Mechanical locking. Mechanical locking in interlocking machine shall be...

  17. 49 CFR 236.56 - Shunting sensitivity. (United States)


    ... 49 Transportation 4 2010-10-01 2010-10-01 false Shunting sensitivity. 236.56 Section 236.56 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION...: All Systems Track Circuits § 236.56 Shunting sensitivity. Each track circuit controlling home...

  18. Spontaneous Partitioning of Californium from Curium: Curious Cases from the Crystallization of Curium Coordination Complexes

    Energy Technology Data Exchange (ETDEWEB)

    Cary, Samantha K.; Silver, Mark A.; Liu, Guokui; Wang, Jamie C.; Bogart, Justin A.; Stritzinger, Jared T.; Arico, Alexandra A.; Hanson, Kenneth; Schelter, Eric J.; Albrecht-Schmitt, Thomas E.


    The reaction of 248CmCl3 with excess 2,6-pyridinedicarboxylic acid (DPA) under mild solvothermal conditions results in crystallization of the tris-chelate complex Cm(HDPA)3·H2O. Approximately half of the curium remains in solution at the end of this process, and evaporation of the mother liquor results in crystallization of the bis-chelate complex [Cm(HDPA)- (H2DPA)(H2O)2Cl]Cl·2H2O. 248Cm is the daughter of the α decay of 252Cf and is extracted in high purity from this parent. However, trace amounts of 249,250,251Cf are still present in all samples of 248Cm. During the crystallization of Cm(HDPA)3·H2O and [Cm(HDPA)(H2DPA)(H2O)2Cl]Cl·2H2O, californium(III) spontaneously separates itself from the curium complexes and is found doped within crystals of DPA in the form of Cf(HDPA)3. These results add to the growing body of evidence that the chemistry of californium is fundamentally different from that of earlier actinides.

  19. The production of Neptunium-236g

    International Nuclear Information System (INIS)

    Radiochemical analysis of 237Np is important in a number of fields, such as nuclear forensics, environmental analysis and measurements throughout the nuclear fuel cycle. However analysis is complicated by the lack of a stable isotope of neptunium. Although various tracers have been used, including 235Np, 239Np and even 236Pu, none are entirely satisfactory. However, 236gNp would be a better candidate for a neptunium yield tracer, as its long half-life means that it is useable as both a radiometric and mass spectrometric measurements. This radionuclide is notoriously difficult to prepare, and limited in scope. In this paper, we examine the options for the production of 236gNp, based on work carried out at NPL since 2011. However, this work was primarily aimed at the production of 236Pu, and not 236gNp and therefore the rate of production are based on the levels of 236Pu generated in the irradiation of (i) 238U with protons, (ii) 235U with deuterons, (iii) 236U with protons and (iv) 236U with deuterons. The derivation of a well-defined cross section is complicated by the relevant paucity of information on the variation of the 236mNp:236gNp production ratio with incident particle energy. Furthermore, information on the purity of 236gNp so produced is similarly sparse. Accordingly, the existing data is assessed and a plan for future work is presented. - Highlights: • We review the requirements for chemical yield tracers and the candidate tracers for 237Np analysis. • The current state of nuclear decay data and nuclear structure information for 236gNp and 236mNp are examined. • Existing cross section data for the production of 236Np by the irradiation of 235U, 236U and 238U with protons and deuterons are summarised. • We present the strategies employed at NPL for the recovery of 236Np from irradiated targets. • The results of these irradiations are presented

  20. Dicty_cDB: AFM236 [Dicty_cDB

    Lifescience Database Archive (English)


  1. 236U and Its Measurement With Accelerator Mass Spectrometry

    Institute of Scientific and Technical Information of China (English)


    <正>236U natural occurring isotopic abundance, 236U/238U atom number ratio, is about 10-14. Therefore, 236U is potentially useful as a ‘fingerprint’ for the presence in the environment or nuclear waste of

  2. 49 CFR 236.731 - Controller, circuit. (United States)


    ... 49 Transportation 4 2010-10-01 2010-10-01 false Controller, circuit. 236.731 Section 236.731 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION... Controller, circuit. A device for opening and closing electric circuits....

  3. 49 CFR 236.728 - Circuit, trap. (United States)


    ... 49 Transportation 4 2010-10-01 2010-10-01 false Circuit, trap. 236.728 Section 236.728... Circuit, trap. A term applied to a circuit used where it is desirable to provide a track circuit but where it is impracticable to maintain a track circuit....

  4. 49 CFR 236.726 - Circuit, track. (United States)


    ... 49 Transportation 4 2010-10-01 2010-10-01 false Circuit, track. 236.726 Section 236.726 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION... Circuit, track. An electrical circuit of which the rails of the track form a part....

  5. 49 CFR 236.721 - Circuit, control. (United States)


    ... 49 Transportation 4 2010-10-01 2010-10-01 false Circuit, control. 236.721 Section 236.721 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION... Circuit, control. An electrical circuit between a source of electric energy and a device which it operates....

  6. 49 CFR 236.790 - Release, time. (United States)


    ... 49 Transportation 4 2010-10-01 2010-10-01 false Release, time. 236.790 Section 236.790... Release, time. A device used to prevent the operation of an operative unit until after the expiration of a predetermined time interval after the device has been actuated....

  7. 49 CFR 236.768 - Locking, time. (United States)


    ... 49 Transportation 4 2010-10-01 2010-10-01 false Locking, time. 236.768 Section 236.768... Locking, time. A method of locking, either mechanical or electrical, which, after a signal has been caused to display an aspect to proceed, prevents, until after the expiration of a predetermined...

  8. 49 CFR 236.751 - Interlocking, manual. (United States)


    ... 49 Transportation 4 2010-10-01 2010-10-01 false Interlocking, manual. 236.751 Section 236.751 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION... Interlocking, manual. An arrangement of signals and signal appliances operated from an interlocking machine...

  9. 49 CFR 236.806 - Signal, home. (United States)


    ... 49 Transportation 4 2010-10-01 2010-10-01 false Signal, home. 236.806 Section 236.806 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION... Signal, home. A roadway signal at the entrance to a route or block to govern trains in entering and...

  10. 49 CFR 236.733 - Current, foreign. (United States)


    ... 49 Transportation 4 2010-10-01 2010-10-01 false Current, foreign. 236.733 Section 236.733 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION... Current, foreign. A term applied to stray electric currents which may affect a signaling system, but...

  11. 49 CFR 236.813 - Speed, slow. (United States)


    ... 49 Transportation 4 2010-10-01 2010-10-01 false Speed, slow. 236.813 Section 236.813 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION... Speed, slow. A speed not exceeding 20 miles per hour....

  12. 49 CFR 236.811 - Speed, medium. (United States)


    ... 49 Transportation 4 2010-10-01 2010-10-01 false Speed, medium. 236.811 Section 236.811 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION... Speed, medium. A speed not exceeding 40 miles per hour....

  13. 48 CFR 552.236-80 - Heat. (United States)


    ... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Heat. 552.236-80 Section... SOLICITATION PROVISIONS AND CONTRACT CLAUSES Text of Provisions and Clauses 552.236-80 Heat. As prescribed in 536.570-11, insert the following clause: Heat (APR 1984) Unless otherwise specified or unless...

  14. 8 CFR 236.13 - Ineligible aliens. (United States)


    ... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Ineligible aliens. 236.13 Section 236.13 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS APPREHENSION AND DETENTION OF INADMISSIBLE AND DEPORTABLE ALIENS; REMOVAL OF ALIENS ORDERED REMOVED Family Unity Program §...

  15. 49 CFR 236.757 - Lock, electric. (United States)


    ... 49 Transportation 4 2010-10-01 2010-10-01 false Lock, electric. 236.757 Section 236.757 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION... Lock, electric. A device to prevent or restrict the movement of a lever, a switch or a movable...

  16. 49 CFR 236.765 - Locking, mechanical. (United States)


    ... 49 Transportation 4 2010-10-01 2010-10-01 false Locking, mechanical. 236.765 Section 236.765 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION... Locking, mechanical. An arrangement of locking bars, dogs, tappets, cross locking and other apparatus...

  17. 17 CFR 256.236 - Taxes accrued. (United States)


    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Taxes accrued. 256.236 Section... COMPANY ACT OF 1935 7. Current and Accrued Liabilities § 256.236 Taxes accrued. (a) This account shall be credited with the amount of taxes accrued during the accounting period, corresponding debits being made...

  18. Fast and efficient charge breeding of the Californium rare isotope breeder upgrade electron beam ion source

    Energy Technology Data Exchange (ETDEWEB)

    Ostroumov, P. N., E-mail:; Barcikowski, A.; Dickerson, C. A.; Perry, A.; Sharamentov, S. I.; Vondrasek, R. C.; Zinkann, G. P. [Argonne National Laboratory, Argonne, Illinois 60439 (United States); Pikin, A. I. [Brookhaven National Laboratory, Upton, New York 11973 (United States)


    The Electron Beam Ion Source (EBIS), developed to breed Californium Rare Isotope Breeder Upgrade (CARIBU) radioactive beams at Argonne Tandem Linac Accelerator System (ATLAS), is being tested off-line. A unique property of the EBIS is a combination of short breeding times, high repetition rates, and a large acceptance. Overall, we have implemented many innovative features during the design and construction of the CARIBU EBIS as compared to the existing EBIS breeders. The off-line charge breeding tests are being performed using a surface ionization source that produces singly charged cesium ions. The main goal of the off-line commissioning is to demonstrate stable operation of the EBIS at a 10 Hz repetition rate and a breeding efficiency into single charge state higher than 15%. These goals have been successfully achieved and exceeded. We have measured (20% ± 0.7%) breeding efficiency into the single charge state of 28+ cesium ions with the breeding time of 28 ms. In general, the current CARIBU EBIS operational parameters can provide charge breeding of any ions in the full mass range of periodic table with high efficiency, short breeding times, and sufficiently low charge-to-mass ratio, 1/6.3 for the heaviest masses, for further acceleration in ATLAS. In this paper, we discuss the parameters of the EBIS and the charge breeding results in a pulsed injection mode with repetition rates up to 10 Hz.

  19. Fast and efficient charge breeding of the Californium rare isotope breeder upgrade electron beam ion source

    International Nuclear Information System (INIS)

    The Electron Beam Ion Source (EBIS), developed to breed Californium Rare Isotope Breeder Upgrade (CARIBU) radioactive beams at Argonne Tandem Linac Accelerator System (ATLAS), is being tested off-line. A unique property of the EBIS is a combination of short breeding times, high repetition rates, and a large acceptance. Overall, we have implemented many innovative features during the design and construction of the CARIBU EBIS as compared to the existing EBIS breeders. The off-line charge breeding tests are being performed using a surface ionization source that produces singly charged cesium ions. The main goal of the off-line commissioning is to demonstrate stable operation of the EBIS at a 10 Hz repetition rate and a breeding efficiency into single charge state higher than 15%. These goals have been successfully achieved and exceeded. We have measured (20% ± 0.7%) breeding efficiency into the single charge state of 28+ cesium ions with the breeding time of 28 ms. In general, the current CARIBU EBIS operational parameters can provide charge breeding of any ions in the full mass range of periodic table with high efficiency, short breeding times, and sufficiently low charge-to-mass ratio, 1/6.3 for the heaviest masses, for further acceleration in ATLAS. In this paper, we discuss the parameters of the EBIS and the charge breeding results in a pulsed injection mode with repetition rates up to 10 Hz

  20. Design of a homogeneous subcritical nuclear reactor based on thorium with a source of californium 252

    International Nuclear Information System (INIS)

    Full text: One of the energy alternatives to fossil fuels which do not produce greenhouse gases is the nuclear energy. One of the drawbacks of this alternative is the generation of radioactive wastes of long half-life and its relation to the generation of nuclear materials to produce weapons of mass destruction. An option to these drawbacks of nuclear energy is to use Thorium as part of the nuclear fuel which it becomes in U233 when capturing neutrons, that is a fissile material. In this paper Monte Carlo methods were used to design a homogeneous subcritical reactor based on thorium. As neutron reflector graphite was used. The reactor core is homogeneous and is formed of 70% light water as moderator, 12% of enriched uranium UO2(NO3)4 and 18% of thorium Th(NO3)4 as fuel. To start the nuclear fission chain reaction an isotopic source of californium 252 was used with an intensity of 4.6 x 107 s-1. In the design the value of the effective multiplication factor, whose value turned out keff <1 was calculated. Also, the neutron spectra at different distances from the source and the total fluence were calculated, as well as the values of the ambient dose equivalent in the periphery of the reactor. (Author)

  1. Fast and efficient charge breeding of the Californium rare isotope breeder upgrade electron beam ion source. (United States)

    Ostroumov, P N; Barcikowski, A; Dickerson, C A; Perry, A; Pikin, A I; Sharamentov, S I; Vondrasek, R C; Zinkann, G P


    The Electron Beam Ion Source (EBIS), developed to breed Californium Rare Isotope Breeder Upgrade (CARIBU) radioactive beams at Argonne Tandem Linac Accelerator System (ATLAS), is being tested off-line. A unique property of the EBIS is a combination of short breeding times, high repetition rates, and a large acceptance. Overall, we have implemented many innovative features during the design and construction of the CARIBU EBIS as compared to the existing EBIS breeders. The off-line charge breeding tests are being performed using a surface ionization source that produces singly charged cesium ions. The main goal of the off-line commissioning is to demonstrate stable operation of the EBIS at a 10 Hz repetition rate and a breeding efficiency into single charge state higher than 15%. These goals have been successfully achieved and exceeded. We have measured (20% ± 0.7%) breeding efficiency into the single charge state of 28+ cesium ions with the breeding time of 28 ms. In general, the current CARIBU EBIS operational parameters can provide charge breeding of any ions in the full mass range of periodic table with high efficiency, short breeding times, and sufficiently low charge-to-mass ratio, 1/6.3 for the heaviest masses, for further acceleration in ATLAS. In this paper, we discuss the parameters of the EBIS and the charge breeding results in a pulsed injection mode with repetition rates up to 10 Hz. PMID:26329185

  2. Neutron activation analysis at the Californium User Facility for Neutron Science

    International Nuclear Information System (INIS)

    The Californium User Facility (CUF) for Neutron Science has been established to provide 252Cf-based neutron irradiation services and research capabilities including neutron activation analysis (NAA). A major advantage of the CUF is its accessibility and controlled experimental conditions compared with those of a reactor environment The CUF maintains the world's largest inventory of compact 252Cf neutron sources. Neutron source intensities of ≤ 1011 neutrons/s are available for irradiations within a contamination-free hot cell, capable of providing thermal and fast neutron fluxes exceeding 108 cm-2 s-1 at the sample. Total flux of ≥109 cm-2 s-1 is feasible for large-volume irradiation rabbits within the 252Cf storage pool. Neutron and gamma transport calculations have been performed using the Monte Carlo transport code MCNP to estimate irradiation fluxes available for sample activation within the hot cell and storage pool and to design and optimize a prompt gamma NAA (PGNAA) configuration for large sample volumes. Confirmatory NAA irradiations have been performed within the pool. Gamma spectroscopy capabilities including PGNAA are being established within the CUF for sample analysis

  3. Long-term effects of an intracavitary treatment with californium-252 on normal tissue

    International Nuclear Information System (INIS)

    About one hundred fifty swine were exposed to either radium-226 or californium-252 sources in the uterine cervix to determine an RBE for both acute and long-term effects. That value for early changes in the tissues at risk in the treatment of cervical cancer was between 6.2 and 6.8. The incidence of complications increased with time after exposure, especially among animals treated with 252Cf. Analysis of rectal injury showed that ulceration occurred frequently within a year postexposure at doses between 1600 and 2400 rad calculated at 2 cm lateral to the source midline. Fat necrosis and smooth muscle atrophy, resulting in a local rectal stricture, were delayed changes observed in some animals. The lower ureter was the site for a greater frequency of complications than the GI tract. Ureteral stricture often occurred at doses of 1200 rad from 252Cf and 7000 rad from 226Ra. Observation of delayed effects in the uterine-cervix in animals held up to 4 years postexposure indicate that the RBE for 252Cf may be increased to a value as high as 18, while repair may have even decreased it to about 5.6 in the rectum. Fifty swine are still being observed for long-term effects after doses above 800 rad from 252Cf and 5000 rad from 226Ra

  4. Manganese determination om minerals by activation analysis, using the californium-252 as a neutron source

    International Nuclear Information System (INIS)

    Neutron Activation Analysis, using a Californium-252 neutron source, has been applied for the determination of manganese in ores such as pyrolusite, rodonite (manganese silicate)' and blending used in dry-batteries The favorable nuclear properties of manganese, such as high thermal neutron cross-section for the reaction 55Mn (n.gamma)56 Mn, high concentration of manganese in the matrix and short half - life of 56Mn, are an ideal combination for non-destructive analysis of manganese in ores. Samples and standards of manganese dioxide were irradiated for about 20 minutes, followed by a 4 to 15 minutes decay and counted in a single channel pulse-height discrimination using a NaI(Tl) scintillation detector. Counting time was equal to 10 minutes. The interference of nuclear reactions 56Fe(n,p)56Mn and 59 Co (n, α)56 were studied, as well as problems in connection with neutron shadowing during irradiation, gamma-rays attenuation during counting and influence of granulometry of samples. One sample,was also analysed by wet-chemical method (sodium bismuthate) in order to compare results. As a whole, i t was shown that the analytical method of neutron activation for manganese in ores and blending, is a method simple, rapid and with good precision and accuracy. (author)

  5. Five-year cure of cervical cancer treated using californium-252 neutron brachytherapy

    International Nuclear Information System (INIS)

    Female pelvic carcinoma is one of the common malignancies seen at the University of Kentucky Medical Center and often presents in an advanced stage. In 1976, the authors began to test californium-252 neutron brachytherapy (NT) for its efficacy for control of primary and recurrent advanced uterine, cervix, and vaginal cancers. The first protocol used was 5000-5500 rad of whole pelvis irradiation followed by 1-2 Cf-252 insertions using a single tandem placed in the utero-cervico-vaginal region. Of 27 patients with primary carcinomas treated, 10 are alive and well 5 year later (37%). Two of two recurrent tumors were locally controlled but failed later. These patients had advanced cervical, vaginal, or endometrial carcinomas. In 1977, a transitional year, treatment of only unfavorable stages and presentations with NT was initiated. Similar results were obtained with NT as compared to conventional photon therapy (PT). Further improvement in treatment results can be anticipated as NT brachytherapy is used for advanced cancer therapy by more effective treatment schedules and radiation doses. Cf-252 can be used as a radium substitute and achieved similar rates of tumor control and 5-year survivals. 21 references, 2 tables

  6. Uptake and distribution of californium-252 chloride administered intraperitoneally, intravenously or intratracheally and the effect of in vivo DTPA chelation on intratracheal instillation in the rat

    International Nuclear Information System (INIS)

    The first phase of this investigation, comprising of three groups of animals, was designed to study the fate of californium-252 chloride administered intraperitoneally, intravenously or intratracheally. The second phase, which consisted of two groups of animals, was designed to examine the effectiveness of DTPA chelation therapy in accelerating the excretion and preventing the deposition of californium-252 chloride instilled into the lungs of rats. Immediately following the dose administration of 2 uCi of californium-252 chloride which was dissolved in 0.2 ml of 0.9% NaCl at pH 3.5, each rat was placed in a metabolism cage. Each rat in the first group of phase II was given intraperitoneal injection of CaNa3 DTPA (50 mg/kg) and each rat in the second group was given intraperitoneal injections of 0.9% NaCl. Injections of the DTPA or the NaCl sham were initiated immediately after the intratracheal administration of californium-252 chloride and were continued every three days until sacrifice. Following intraperitoneal, intravenous or intratracheal administration, the whole body retention of californium as a function of time was described by a three component exponential equation. For each mode of administration the short term component exhibited a biological half-life of between 5 and 10 hours; the intermediate component between 4 and 6 days; and the long term component between 200 and 300 days. The organ data obtained following intraperitoneal and intravenous administration were indistinguishable. On day one, the liver retained about 9% of the administered dose and the kidneys retained 2.4%. Retention for these organs decreased to about 1% by day 32. The femurs maintained an almost constant level of 4.5% of the injected dose over the 32 days. The lungs, spleen, heart, and testes showed significant retention of californium

  7. Measurement of 236U in environmental media

    International Nuclear Information System (INIS)

    The long-lived uranium isotope 236U (T1/2=23.4 Ma) is produced by 235U neutron capture and builds up to high levels in nuclear fuel. It has been distributed in the environment as a result of nuclear activities including nuclear explosions, accidents at nuclear plants, dumping of nuclear waste and releases from nuclear facilities. 236U is a potentially useful tracer of irradiated uranium for nuclear safeguards or other applications, due to its virtual absence in natural samples (236U:238U ratio ∼10-10 in uranium ore). We have measured 236U in soil and sediment reference materials (IAEA 375, 135 and 300) by accelerator mass spectrometry (AMS). The AMS system on the ANTARES accelerator has been upgraded to make such measurements possible. The system, including sample preparation procedures, is described and the results discussed

  8. 49 CFR 236.787a - Railroad. (United States)


    ... OF SIGNAL AND TRAIN CONTROL SYSTEMS, DEVICES, AND APPLIANCES Definitions § 236.787a Railroad... Consolidated Rail Corporation on January 1, 1979; and (b) High speed ground transportation systems that...

  9. ENEA results in the international comparison organized by BIPM for the measurament of neutron fluxes of a Californium source

    International Nuclear Information System (INIS)

    During the period between May 1978 and August 1984 under the auspices of Section III of CCEMRI of CIPM it has been carried out the international intercomparison of Californium neutron source emission rate. The previous intercomparison was based on Ra-Be (α -n) source measuraments, which took place between 1959 and 1965, and the results showed a total spread of +- 3%. Owing to the better accuracy achived over the following decade the Ra-Be intercomparison was no longer representative of the state of the art, therefore it was decided to arrange the intercomparison based on Californium which in the meantime reached a wide use in the world. Contributions to the intercomparison were received from fourteen laboratories representative of twelve Nations plus the BIPM. The results put into evidence a considerable advance on accuracy in the neutron source emission rate measuraments. The standard deviation of the residuals obtained from least square fit of normalized data resulted +- 0,57%. In the present report it is widely described the Manganese bath method used at ENEA, CRE Casaccia in Roma, and the experimental procedure followed for its absolute calibration. All measuraments are reported and analysed, including those effectuated for corrective factors determination. The final results obtained at ENEA for the circulated Californium source is (3,457 +- 0,013) 10*H7 neutron/s. The analysis of data from all partecipantes has been effectuated and concluded by J. Axton in March 1986 and the conclusions which have been showed in the present report put in evidence the satisfactory results achived by the ENEA

  10. Feasibility and market potential of protein determination of wheat using californium-252

    International Nuclear Information System (INIS)

    To evaluate the feasibility of protein determination by capture gamma-ray analysis using californium-252 neutrons, an in-situ protein analysis system for use by grain handlers has been examined. Three 227 kilogram (approximately) lots of wheat were used to determine the amount of nitrogen present. Protein analyses by the Kjeldahl method were obtained from samples taken before and after the capture gamma-ray analyses. The 5.267-MeV gamma-ray was selected for use in this study as a compromise between efficiency and interference from other elements. The associated counting equipment was a multichannel analyzer with pulse shaping electronic and analysis computing equipment. A linear regression program was used to compare the regions of interest to the Kjeldahl protein averages. The counts composing each peak were summed and normalized using the total count of the hydrogen peak. The normalized nitrogen percentages indicate a significant correlation between the spectral regions and the Kjeldahl analyses. To a first approximation, the value of wheat is the wheat protein. At the present time, protein testing of wheat is destructive, cumbersome, and time-consuming as compared to the potential for capture gamma-ray analysis testing. Assuming that such a protein analysis unit can analyze 42 tonne of wheat per hour, over 120 units would be needed to monitor one-half the U.S. annual wheat production. A 0.5% improvement in processor realizations and grain throughput value of $167.00 per tonne will result in a projected savings of $150,000 per year per unit

  11. Oxygen enhancement ratio (OER) and therapeutic gain factor (GF) for californium-252 at low dose rate

    International Nuclear Information System (INIS)

    The potential benefit of the introduction of californium-252 in interstitial and intracavitary therapy is related to the greater efficiency of its neutron emission against anoxic cancer cells. In that respect, the oxygen enhancement ratio (OER) of the 252Cf emission has been determined for a continuous low dose rate irradiation. The biological system is growth inhibition in Vicia faba bean roots. A new Vicia faba ''BelB'' strain has been used, which better tolerates long periods (up to about 10 hours) of anoxia. In a first series of experiments, for a 252Cf (Dsub(n+γ)) dose rate of 0.11 Gy.h-1, an OER of 1.4+-0.1 was observed (the γ contribution Dγ to the total absorbed dose Dsub(n+γ) was 0.35 at the position of the root tips). In a second series of experiments, in somewhat different geometrical conditions with a 252Cf (Dsub(n+γ)) dose rate of 0.13 Gy.h-1, an OER of 1.5+-0.1 was observed (Dγ/Dsub(n+γ)=0.42). The OER values observed for similar irradiation times, with iridium-192 γ-rays, were 2.3+-0.2 and 2.6+-0.1 respectively, which leads to therapeutic gain factors (GF) of 1.6 and 1.7 respectively. These GF values are slightly lower than those previously obtained (GF=1.8) on the same system, with d(50)-Be p(75)-Be and 15 MeV neutron beams

  12. Application of TSH bioindicator for studying the biological efficiency of neutrons from californium-252 source

    International Nuclear Information System (INIS)

    The effectiveness of neutrons from a Californium-252 source in the induction of various abnormalities in the Tradescantia clone 4430 stamen hair cells (TSH-assay) was studied. The special attention was paid to check whether any enhancement in effects caused by process of boron neutron capture is visible in the cells enriched with boron ions. Two chemicals (borax and BSH) were applied to introduce boron-10 ions into cells. Inflorescence, normal or pretreated with chemicals containing boron, were irradiated in the air with neutrons from a Cf-252 source at KAERI, Taejon, Korea. To estimate the relative biological effectiveness (RBE) in the induction of gene mutations of the neutron beam under the study, Tradescantia inflorescences, without any chemical pretreatment, were irradiated with various doses of X-rays. The ranges of radiation doses used were 0-0.1 Gy in neutrons and 0-0.5 Gy in X-rays. After the time needed to complete the postirradiation repair Tradescantia cuttings were transferred to Cracow, where screening of gene and lethal; mutations, cell cycle alterations in somatic cells have been done, and dose response relationships were figured. The maximal RBE values were estimated in the range of 4.6-6.8. Alterations of RBE value were observed; from 6.8 to 7.8 in the case of plants pretreated with 240 ppm of B-10 from borax, and 4.6 to 6.1 in the case of 400 ppm of B-10 from BSH. Results showed a slight, although statistically insignificant increase in biological efficacy of radiation from the Cf-252 source in samples pretreated with boron containing chemicals. (author)

  13. Divalent and trivalent gas-phase coordination complexes of californium: evaluating the stability of Cf(ii). (United States)

    Dau, Phuong D; Shuh, David K; Sturzbecher-Hoehne, Manuel; Abergel, Rebecca J; Gibson, John K


    The divalent oxidation state is increasingly stable relative to the trivalent state for the later actinide elements, with californium the first actinide to exhibit divalent chemistry under moderate conditions. Although there is evidence for divalent Cf in solution and solid compounds, there are no reports of discrete complexes in which Cf(II) is coordinated by anionic ligands. Described here is the divalent Cf methanesulfinate coordination complex, Cf(II)(CH3SO2)3(-), prepared in the gas phase by reductive elimination of CH3SO2 from Cf(III)(CH3SO2)4(-). Comparison with synthesis of the corresponding Sm and Cm complexes reveals reduction of Cf(III) and Sm(III), and no evidence for reduction of Cm(III). This reflects the comparative 3+/2+ reduction potentials: Cf(3+) (-1.60 V) ≈ Sm(3+) (-1.55 V) ≫ Cm(3+) (-3.7 V). Association of O2 to the divalent complexes is attributed to formation of superoxides, with recovery of the trivalent oxidation state. The new gas-phase chemistry of californium, now the heaviest element to have been studied in this manner, provides evidence for Cf(II) coordination complexes and similar chemistry of Cf and Sm. PMID:27424652

  14. Hypoxic versus normoxic external-beam irradiation of cervical carcinoma combined with californium-252 neutron brachytherapy. Comparative treatment results of a 5-year randomized study

    Czech Academy of Sciences Publication Activity Database

    Tačev, T.; Vacek, Antonín; Ptáčková, B.; Strnad, V.


    Roč. 181, č. 5 (2005), s. 273-284. ISSN 0179-7158 Institutional research plan: CEZ:AV0Z50040507 Keywords : cervical carcinoma * hypoxyradiotherapy * californium-252 Subject RIV: BO - Biophysics Impact factor: 3.490, year: 2005

  15. 236U measurement with accelerator mass spectrometry at CIAE

    International Nuclear Information System (INIS)

    236U is a long-lived radioactive isotope which is produced principally by thermal neutron capture on 235U. 236U may be potentially applied in geological research and nuclear safeguards. Accelerator mass spectrometry is presently the most sensitive technique for the measurement of 236U and a measurement method for long-lived heavy ion 236U has been developed. The set-up uses a dedicated injector and the newly proposed 208Pb16O2- molecular ions for the simulation of 236U ion transport. A sensitivity of lower than 10-10 has been achieved for the isotopic ratio 236U/238U in present work.

  16. Solving the Hydration Structure of the Heaviest Actinide Aqua Ion Known: The Californium(III) Case

    Energy Technology Data Exchange (ETDEWEB)

    Den Auwer, Ch.; Guillaumont, D. [CEA Marcoule, Nucl Energy Div, Radiochem Proc Dept, SCPS LILA, 30 (France); Galbis, E.; Pappalardo, Rafael R.; Marcos Sanchez, E. [Univ Seville, Dept Quim Fis, E-41012 Seville (Spain); Hernandez-Cobos, J. [Inst Ciencias Fis, Cuernavaca 62251, Morelos (Mexico); Le Naour, C.; Simoni, E. [Univ Paris Sud, Inst Phys Nucl Orsay, Paris (France)


    In summary, the first MC simulation of the trivalent cation of californium, based on an exchangeable hydrated ion-water intermolecular potential, has been shown to extend and improve the hydrated ion model. Likewise, the CfL{sub III}-edge EXAFS spectrum of an acidic 1 mm Cf(ClO{sub 4}){sub 3} aqueous solution recorded under optimized experimental conditions has greatly improved the signal/noise ratio of the only previously recorded spectrum. The comparison of the experimental EXAFS spectrum with the two computed ones, obtained from two different intermolecular potentials that predict eight (BP86) or nine (MP2) water molecules in the first coordination shell, leads to the conclusion that the lowest hydration number is preferred. Then, as Cf{sup III} is the heaviest actinide aqua ion for which there is experimental information, the actinide contraction is supported by the present study. (For U{sup III}, R{sub U-O}=2.56 Angstroms, and CN=9{+-}1; for Pu{sup III}, R{sub Pu-O}=2.51 Angstroms and CN=9{+-}1; for Cm{sup III}, R{sub Cm-O}=2.47 Angstroms and CN=9{+-}1). The role of the second hydration shell is important in defining the structure and dynamics of the Cf{sup III} aqua ion, but the contribution of second-shell water molecules to the EXAFS signal as back-scatters is marginal. Finally, this work gives an illustrative example of the benefits which can be achieved from the combination of experimental X-ray absorption spectroscopy and computer simulations. The usefulness of the simultaneous analysis of the results as well as the importance of the structural statistical average has been clearly demonstrated herein. Each technique independently was not adequate. We believe that this study traces out a still poorly explored combined methodology which may be extremely useful for many other complexes and chemical problems. A systematic theoretical and experimental examination of the other known actinide cations on the same basis should be undertaken to confirm the

  17. 49 CFR 236.764 - Locking, lever operated. (United States)


    ... 49 Transportation 4 2010-10-01 2010-10-01 false Locking, lever operated. 236.764 Section 236.764... Locking, lever operated. The mechanical locking of an interlocking machine which is actuated by means of the lever....

  18. 15 CFR 23.6 - Definitions. (United States)


    ... RECOVERY OF MISSING CHILDREN § 23.6 Definitions. (a) Operating units. Bureaus and other organizational...., programs). (b) Organizational units. The organizational units within the Department of Commerce are: Office of the Secretary Bureau of Economic Analysis Economic Development Administration Bureau of the...

  19. 33 CFR 236.4 - Background. (United States)


    ... QUALITY § 236.4 Background. (a) The role of the Corps of Engineers in the development of water and related... control, beach erosion control and hurricane protection, hydroelectric power, recreation, water supply, water quality, fish and wildlife and low-flow augmentation. Laws, executive orders, and...

  20. 49 CFR 236.1003 - Definitions. (United States)


    ... the Surface Transportation Board (49 CFR part 1201.1-1 (2008)). Cleartext means the un-encrypted text... § 236.1019 or where all trains are limited to restricted speed within a yard or terminal area or on... as other than main line. Medium speed means, Speed, medium, as defined in subpart G of this part....

  1. 49 CFR 236.719 - Circuit, acknowledgment. (United States)


    ..., MAINTENANCE, AND REPAIR OF SIGNAL AND TRAIN CONTROL SYSTEMS, DEVICES, AND APPLIANCES Definitions § 236.719... track rails at each signal in territory where an automatic train stop system or cab signal system of the... engineman at each signal displaying an aspect requiring a stop....

  2. 48 CFR 236.604 - Performance evaluation. (United States)


    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Performance evaluation... Architect-Engineer Services 236.604 Performance evaluation. (a) Preparation of performance reports. Use DD Form 2631, Performance Evaluation (Architect-Engineer), instead of SF 1421. (2) Prepare a...

  3. Resolved resonance parameters for 236Np

    International Nuclear Information System (INIS)

    Multilevel Breit-Wigner parameters were obtained for fission cross-section representation in the 0.01-33 eV energy region from evaluation of a 236Np experimental fission cross-section in the resolved resonance region. (author)

  4. 49 CFR 236.723 - Circuit, double wire; line. (United States)


    ... 49 Transportation 4 2010-10-01 2010-10-01 false Circuit, double wire; line. 236.723 Section 236.723 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD... § 236.723 Circuit, double wire; line. An electric circuit not employing a common return wire; a...

  5. 49 CFR 236.732 - Controller, circuit; switch. (United States)


    ... 49 Transportation 4 2010-10-01 2010-10-01 false Controller, circuit; switch. 236.732 Section 236.732 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD... § 236.732 Controller, circuit; switch. A device for opening and closing electric circuits, operated by...

  6. 49 CFR 236.104 - Shunt fouling circuit. (United States)


    ... 49 Transportation 4 2010-10-01 2010-10-01 false Shunt fouling circuit. 236.104 Section 236.104 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION...: All Systems Inspections and Tests; All Systems § 236.104 Shunt fouling circuit. Shunt fouling...

  7. 49 CFR 236.1035 - Field testing requirements. (United States)


    ... 49 Transportation 4 2010-10-01 2010-10-01 false Field testing requirements. 236.1035 Section 236... Train Control Systems § 236.1035 Field testing requirements. (a) Before any field testing of an... on-track equipment; (4) An analysis of the applicability of the requirements of subparts A through...

  8. 40 CFR 86.236-94 - Engine starting and restarting. (United States)


    ... 40 Protection of Environment 18 2010-07-01 2010-07-01 false Engine starting and restarting. 86.236-94 Section 86.236-94 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR... New Medium-Duty Passenger Vehicles; Cold Temperature Test Procedures § 86.236-94 Engine starting...

  9. 7 CFR 205.236 - Origin of livestock. (United States)


    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Origin of livestock. 205.236 Section 205.236... PROVISIONS NATIONAL ORGANIC PROGRAM Organic Production and Handling Requirements § 205.236 Origin of... management beginning no later than the second day of life; (2) Dairy animals. Milk or milk products must...

  10. 49 CFR 236.23 - Aspects and indications. (United States)


    ... 49 Transportation 4 2010-10-01 2010-10-01 false Aspects and indications. 236.23 Section 236.23...: All Systems Roadway Signals and Cab Signals § 236.23 Aspects and indications. (a) Aspects shall be... conditions: (1) Night aspects of roadway signals, except qualifying appurtenances, shall be shown by...

  11. 7 CFR 23.6 - Plan of Work. (United States)


    ... 7 Agriculture 1 2010-01-01 2010-01-01 false Plan of Work. 23.6 Section 23.6 Agriculture Office of the Secretary of Agriculture STATE AND REGIONAL ANNUAL PLANS OF WORK State Program § 23.6 Plan of Work. (a) A State Annual Plan of Work for carrying out the programs authorized under title V shall...

  12. 27 CFR 46.236 - Articles in a warehouse. (United States)


    ... 27 Alcohol, Tobacco Products and Firearms 2 2010-04-01 2010-04-01 false Articles in a warehouse. 46.236 Section 46.236 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU... Tubes Held for Sale on April 1, 2009 Filing Requirements § 46.236 Articles in a warehouse. (a)...

  13. 49 CFR 236.780 - Plunger, facing point lock. (United States)


    ... 49 Transportation 4 2010-10-01 2010-10-01 false Plunger, facing point lock. 236.780 Section 236.780 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD... § 236.780 Plunger, facing point lock. That part of a facing point lock which secures the lock rod to...

  14. 49 CFR 236.809 - Signal, slotted mechanical. (United States)


    ... 49 Transportation 4 2010-10-01 2010-10-01 false Signal, slotted mechanical. 236.809 Section 236.809 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD... § 236.809 Signal, slotted mechanical. A mechanically operated signal with an electromagnetic...

  15. 49 CFR 236.758 - Lock, electric, forced drop. (United States)


    ... 49 Transportation 4 2010-10-01 2010-10-01 false Lock, electric, forced drop. 236.758 Section 236.758 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD... § 236.758 Lock, electric, forced drop. An electric lock in which the locking member is...

  16. 49 CFR 236.752 - Joint, rail, insulated. (United States)


    ... 49 Transportation 4 2010-10-01 2010-10-01 false Joint, rail, insulated. 236.752 Section 236.752..., MAINTENANCE, AND REPAIR OF SIGNAL AND TRAIN CONTROL SYSTEMS, DEVICES, AND APPLIANCES Definitions § 236.752 Joint, rail, insulated. A joint in which electrical insulation is provided between adjoining rails....

  17. 49 CFR 236.562 - Minimum rail current required. (United States)


    ... 49 Transportation 4 2010-10-01 2010-10-01 false Minimum rail current required. 236.562 Section 236..., INSPECTION, MAINTENANCE, AND REPAIR OF SIGNAL AND TRAIN CONTROL SYSTEMS, DEVICES, AND APPLIANCES Automatic Train Stop, Train Control and Cab Signal Systems Rules and Instructions; Locomotives § 236.562...

  18. 49 CFR 236.711 - Bond, rail joint. (United States)


    ... 49 Transportation 4 2010-10-01 2010-10-01 false Bond, rail joint. 236.711 Section 236.711..., MAINTENANCE, AND REPAIR OF SIGNAL AND TRAIN CONTROL SYSTEMS, DEVICES, AND APPLIANCES Definitions § 236.711 Bond, rail joint. A metallic connection attached to adjoining rails to insure electrical conductivity....

  19. 49 CFR 236.59 - Insulated rail joints. (United States)


    ... 49 Transportation 4 2010-10-01 2010-10-01 false Insulated rail joints. 236.59 Section 236.59..., MAINTENANCE, AND REPAIR OF SIGNAL AND TRAIN CONTROL SYSTEMS, DEVICES, AND APPLIANCES Rules and Instructions: All Systems Track Circuits § 236.59 Insulated rail joints. Insulated rail joints shall be...

  20. Design, construction, and characterization of a facility for neutron capture gamma ray analysis of sulfur in coal using californium-252

    International Nuclear Information System (INIS)

    A study of neutron capture gamma ray analysis of sulfur in coal using californium-252 as a neutron source is reported. Both internal and external target geometries are investigated. The facility designed for and used in this study is described. The external target geometry is found to be inappropriate because of the low thermal neutron flux at the sample location, which must be outside the biological shielding. The internal target geometry is found to have a sufficient thermal neutron flux, but an excessive gamma ray background. A water filled plastic facility, rather than the paraffin filled steel one used in this study, is suggested as a means of increasing flexibility and decreasing the beackground in the internal target geometry

  1. First 236U data from the Arctic Ocean and use of 236U/238U and 129I/236U as a new dual tracer (United States)

    Casacuberta, N.; Masqué, P.; Henderson, G.; Rutgers van-der-Loeff, M.; Bauch, D.; Vockenhuber, C.; Daraoui, A.; Walther, C.; Synal, H.-A.; Christl, M.


    The first dataset of 236U/238U in the water column of the Arctic Ocean (AO) is presented and shows the widest range of ratios reported so far in the open ocean, from (5 ± 5) to (3840 ± 260) ×10-12. Surface samples and depth profiles were collected during two GEOTRACES expeditions in 2011-2012 and analyzed for the concentrations of 236U and 129I, with the aim of investigating whether the combination of 236U/238U and 129I/236U can be used as a new oceanographic tool in the AO. Results show that the distributions of the 236U/238U and 129I/236U atomic ratios are consistent with the different water masses in the AO. High 236U/238U and 129I/236U ratios in the upper water column (> 2000 ×10-12 and >200, respectively) illustrate the penetration of Atlantic waters (AW) into the AO. Lower values were found in Pacific waters (PW) and deep waters of the AO. Rivers seem to represent a temporally and spatially-constrained third anthropogenic source of 236U but more data are needed to confirm this. In a simple mixing model, the combination of 236U/238U and 129I/236U reveals a high contribution (>99%) of natural background waters (pre-nuclear era) in the deep and bottom waters of the Amerasian basin, indicating an apparent water mass renewal time of >1000 years. Despite the relatively high apparent age of the Amerasian Basin deep waters, this work shows the potential of using the dual-tracer approach as a new oceanographic tool in the Arctic Ocean.

  2. 49 CFR Appendix A to Part 236 - Civil Penalties 1 (United States)


    ... right to assess a penalty of up to $100,000 for any violation where circumstances warrant. See 49 CFR... controller or point detector 1,000 2,000 236.104Shunt fouling circuit 1,000 2,000 236.105Electric lock 1,000...,000 2,000 236.312Movable bridge, interlocking of signal appliances with bridge devices: (a)...

  3. Neutron absorption cross section of uranium-236

    International Nuclear Information System (INIS)

    U-236 neutron absorption was measured as a function of neutron time-of-flight from 20 eV to 1 MeV. The neutron flux was monitored with a 6Li glass scintillator. Average cross sections from 3 keV to 1 MeV were derived. Estimated uncertainties were less than 5% below 600 keV and increased to 9.5% at 1 MeV. Resonance parametrization from 20 eV to a few keV remains to be done. 17 refs., 5 figs., 3 tabs

  4. Operational experience with the Argonne National Laboratory Californium Rare Ion Breeder Upgrade facility and electron cyclotron resonance charge breeder (United States)

    Vondrasek, R.; Clark, J.; Levand, A.; Palchan, T.; Pardo, R.; Savard, G.; Scott, R.


    The Californium Rare Ion Breeder Upgrade (CARIBU) of the Argonne National Laboratory Argonne Tandem Linac Accelerator System (ATLAS) facility provides low-energy and accelerated neutron-rich radioactive beams to address key nuclear physics and astrophysics questions. A 350 mCi 252Cf source produces fission fragments which are thermalized and collected by a helium gas catcher into a low-energy particle beam with a charge of 1+ or 2+. An electron cyclotron resonance (ECR) ion source functions as a charge breeder in order to raise the ion charge sufficiently for acceleration in the ATLAS linac. The ECR charge breeder has achieved stable beam charge breeding efficiencies of 10.1% for 23Na7+, 17.9% for 39K10+, 15.6% for 84Kr17+, and 12.4% for 133Cs27+. For the radioactive beams, a charge breeding efficiency of 11.7% has been achieved for 143Cs27+ and 14.7% for 143Ba27+. The typical breeding times are 10 ms/charge state, but the source can be tuned such that this value increases to 100 ms/charge state with the best breeding efficiency corresponding to the longest breeding times—the variation of efficiencies with breeding time will be discussed. Efforts have been made to characterize and reduce the background contaminants present in the ion beam through judicious choice of q/m combinations. Methods of background reduction are being investigated based upon plasma chamber cleaning and vacuum practices.

  5. Long-term effects of an intracavitary treatment with californium-252 on normal tissue. [Swine, /sup 226/Ra

    Energy Technology Data Exchange (ETDEWEB)

    Sullivan, M.F.; Beamer, J.L.; Mahony, T.D.; Cross, F.T.; Lund, J.E.; Endres, G.W.R.


    About one hundred fifty swine were exposed to either radium-226 or californium-252 sources in the uterine cervix to determine an RBE for both acute and long-term effects. That value for early changes in the tissues at risk in the treatment of cervical cancer was between 6.2 and 6.8. The incidence of complications increased with time after exposure, especially among animals treated with /sup 252/Cf. Analysis of rectal injury showed that ulceration occurred frequently within a year postexposure at doses between 1600 and 2400 rad calculated at 2 cm lateral to the source midline. Fat necrosis and smooth muscle atrophy, resulting in a local rectal stricture, were delayed changes observed in some animals. The lower ureter was the site for a greater frequency of complications than the GI tract. Ureteral stricture often occurred at doses of 1200 rad from /sup 252/Cf and 7000 rad from /sup 226/Ra. Observation of delayed effects in the uterine-cervix in animals held up to 4 years postexposure indicate that the RBE for /sup 252/Cf may be increased to a value as high as 18, while repair may have even decreased it to about 5.6 in the rectum. Fifty swine are still being observed for long-term effects after doses above 800 rad from /sup 252/Cf and 5000 rad from /sup 226/Ra.

  6. 49 CFR 236.722 - Circuit, cut-in. (United States)


    ... 49 Transportation 4 2010-10-01 2010-10-01 false Circuit, cut-in. 236.722 Section 236.722 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION... Circuit, cut-in. A roadway circuit at the entrance to automatic train stop, train control or cab...

  7. 49 CFR 236.54 - Minimum length of track circuit. (United States)


    ... 49 Transportation 4 2010-10-01 2010-10-01 false Minimum length of track circuit. 236.54 Section... Instructions: All Systems Track Circuits § 236.54 Minimum length of track circuit. When a track circuit shorter than maximum inner wheelbase of any locomotive or car operated over such track circuit is used...

  8. 49 CFR 236.786 - Principle, closed circuit. (United States)


    ... 49 Transportation 4 2010-10-01 2010-10-01 false Principle, closed circuit. 236.786 Section 236.786 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION... Principle, closed circuit. The principle of circuit design where a normally energized electric circuit...

  9. 49 CFR 236.817 - Switch, electro-pneumatic. (United States)


    ... 49 Transportation 4 2010-10-01 2010-10-01 false Switch, electro-pneumatic. 236.817 Section 236.817 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION... Switch, electro-pneumatic. A switch operated by an electro-pneumatic switch-and-lock movement....

  10. 49 CFR 236.837 - Valve, electro-pneumatic. (United States)


    ... 49 Transportation 4 2010-10-01 2010-10-01 false Valve, electro-pneumatic. 236.837 Section 236.837 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION... Valve, electro-pneumatic. A valve electrically operated which, when operated, will permit or...

  11. 49 CFR 236.17 - Pipe for operating connections, requirements. (United States)


    ... 49 Transportation 4 2010-10-01 2010-10-01 false Pipe for operating connections, requirements. 236... Rules and Instructions: All Systems General § 236.17 Pipe for operating connections, requirements. (a) Steel or wrought-iron pipe one inch or larger, or members of equal strength, shall be used for...

  12. 48 CFR 52.236-8 - Other Contracts. (United States)


    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Other Contracts. 52.236-8... AND FORMS SOLICITATION PROVISIONS AND CONTRACT CLAUSES Text of Provisions and Clauses 52.236-8 Other Contracts. As prescribed in 36.508, insert the following clause: Other Contracts (APR 1984) The...

  13. 48 CFR 236.203 - Government estimate of construction costs. (United States)


    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Government estimate of...-ENGINEER CONTRACTS Special Aspects of Contracting for Construction 236.203 Government estimate of construction costs. Follow the procedures at PGI 236.203 for handling the Government estimate of...

  14. 49 CFR 236.1043 - Task analysis and basic requirements. (United States)


    ... 49 Transportation 4 2010-10-01 2010-10-01 false Task analysis and basic requirements. 236.1043... Train Control Systems § 236.1043 Task analysis and basic requirements. (a) Training structure and... of work, etc.), task(s), and desired success rate; (2) Based on a formal task analysis, identify...

  15. 49 CFR 236.810 - Spectacle, semaphore arm. (United States)


    ... 49 Transportation 4 2010-10-01 2010-10-01 false Spectacle, semaphore arm. 236.810 Section 236.810 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION... Spectacle, semaphore arm. That part of a semaphore arm which holds the roundels and to which the blade...

  16. 48 CFR 852.236-78 - Government supervision. (United States)


    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Government supervision. 852.236-78 Section 852.236-78 Federal Acquisition Regulations System DEPARTMENT OF VETERANS AFFAIRS... Government supervision. As prescribed in 836.572, insert the following clause: Government Supervision...

  17. 8 CFR 236.2 - Confined aliens, incompetents, and minors. (United States)


    ... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Confined aliens, incompetents, and minors. 236.2 Section 236.2 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS APPREHENSION AND DETENTION OF INADMISSIBLE AND DEPORTABLE ALIENS; REMOVAL OF ALIENS ORDERED REMOVED...

  18. Dicty_cDB: SFB236 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SF (Link to library) SFB236 (Link to dictyBase) - - - Contig-U15759-1 SFB236P (Link to Original ... CP000901_3754( CP000901 |pid:none) Yersinia pestis Angola , complet... 35 5.3 (Q65G12) RecName: Full=tRNA (gu ...

  19. 48 CFR 52.236-12 - Cleaning Up. (United States)


    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Cleaning Up. 52.236-12 Section 52.236-12 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION (CONTINUED... Cleaning Up. As prescribed in 36.512, insert the following clause: Cleaning Up (APR 1984) The...

  20. 49 CFR 236.759 - Lock, facing point. (United States)


    ... 49 Transportation 4 2010-10-01 2010-10-01 false Lock, facing point. 236.759 Section 236.759... Lock, facing point. A mechanical lock for a switch, derail, or movable-point frog, comprising a plunger stand and a plunger which engages a lock rod attached to the switch point to lock the operated unit....

  1. 8 CFR 236.16 - Travel outside the United States. (United States)


    ... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Travel outside the United States. 236.16... Program § 236.16 Travel outside the United States. An alien granted Family Unity Program benefits who intends to travel outside the United States temporarily must apply for advance authorization using Form...

  2. First data of Uranium-236 in the North Sea

    International Nuclear Information System (INIS)

    In this paper we present the first 236U-measurements from North Sea water samples. The measurements are performed within an ongoing project that intends to map the distribution of 236U in the Atlantic Ocean and thus to explore the potential of 236U as a new oceanic tracer. We describe the latest modifications of the low energy ETH AMS system TANDY that allow determining the concentrations of both 238U and 236U and the 236U/238U ratio during only one AMS measurement. Further, we present our chemical preparation procedure and, finally, the first 236U data from the North Sea is discussed in detail. A simple conceptual model is used to simulate the temporal evolution of the 236U-concentration in the North Sea. The simulated water mass residence time is in good agreement with independent oceanographic data. Based on these initial results we conclude that anthropogenic 236U has a large potential as a new transient and extremely conservative tracer in Oceanography.

  3. 49 CFR 236.775 - Movement, switch-and-lock. (United States)


    ... 49 Transportation 4 2010-10-01 2010-10-01 false Movement, switch-and-lock. 236.775 Section 236.775 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION..., MAINTENANCE, AND REPAIR OF SIGNAL AND TRAIN CONTROL SYSTEMS, DEVICES, AND APPLIANCES Definitions §...

  4. 24 CFR 236.750 - Form of lease. (United States)


    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Form of lease. 236.750 Section 236... lease. (a) Lease form. Eligible tenants shall be required to execute a lease in a form approved by the Commissioner. (b) Prohibited lease provisions. Lease clauses of the nature described below shall not...

  5. 236U and its measurement with accelerator mass spectrometry

    International Nuclear Information System (INIS)

    236U is a long-lived radionuclide with half-life of 2.342(3) x 107 a. The ratio of 236U/238U is about 10-14 in the natural Uranium. The origin and production of 236U in globe are introduced and estimated in this paper, respectively. The major applications of 236U as a 100-million year neutron flux integrator, as a 'fingerprint' for monitoring nuclear environment and nuclear activity,and as a tracer in geological studies are briefly summarized. The accelerator mass spectrometry(AMS) measurement of 236U in the world and the research on HI-13 tandem accelerator at China Institute of Atomic Energy(CIAE) is also mentioned in this paper. (authors)

  6. Results with the electron cyclotron resonance charge breeder for the 252Cf fission source project (Californium Rare Ion Breeder Upgrade) at Argonne Tandem Linac Accelerator System

    International Nuclear Information System (INIS)

    The construction of the Californium Rare Ion Breeder Upgrade, a new radioactive beam facility for the Argonne Tandem Linac Accelerator System (ATLAS), is nearing completion. The facility will use fission fragments from a 1 Ci 252Cf source; thermalized and collected into a low-energy particle beam by a helium gas catcher. In order to reaccelerate these beams, an existing ATLAS electron cyclotron resonance (ECR) ion source was redesigned to function as an ECR charge breeder. Thus far, the charge breeder has been tested with stable beams of rubidium and cesium achieving charge breeding efficiencies of 9.7% into 85Rb17+ and 2.9% into 133Cs20+.

  7. Excess of (236)U in the northwest Mediterranean Sea. (United States)

    Chamizo, E; López-Lora, M; Bressac, M; Levy, I; Pham, M K


    In this work, we present first (236)U results in the northwestern Mediterranean. (236)U is studied in a seawater column sampled at DYFAMED (Dynamics of Atmospheric Fluxes in the Mediterranean Sea) station (Ligurian Sea, 43°25'N, 07°52'E). The obtained (236)U/(238)U atom ratios in the dissolved phase, ranging from about 2×10(-9) at 100m depth to about 1.5×10(-9) at 2350m depth, indicate that anthropogenic (236)U dominates the whole seawater column. The corresponding deep-water column inventory (12.6ng/m(2) or 32.1×10(12) atoms/m(2)) exceeds by a factor of 2.5 the expected one for global fallout at similar latitudes (5ng/m(2) or 13×10(12) atoms/m(2)), evidencing the influence of local or regional (236)U sources in the western Mediterranean basin. On the other hand, the input of (236)U associated to Saharan dust outbreaks is evaluated. An additional (236)U annual deposition of about 0.2pg/m(2) based on the study of atmospheric particles collected in Monaco during different Saharan dust intrusions is estimated. The obtained results in the corresponding suspended solids collected at DYFAMED station indicate that about 64% of that (236)U stays in solution in seawater. Overall, this source accounts for about 0.1% of the (236)U inventory excess observed at DYFAMED station. The influence of the so-called Chernobyl fallout and the radioactive effluents produced by the different nuclear installations allocated to the Mediterranean basin, might explain the inventory gap, however, further studies are necessary to come to a conclusion about its origin. PMID:27262827

  8. Ab initio full-potential study of mechanical properties and magnetic phase stability of californium monopnictides (CfN and CfP) (United States)

    Amari, S.; Bouhafs, B.


    Based on the first-principles methods, the structural, elastic, electronic, properties and magnetic ordering of californium monopnictides CfX (X = P) have been studied using the full-potential augmented plane wave plus local orbitals (FP-L/APW + lo) method within the framework of density functional theory (DFT). The electronic exchange correlation energy is described by generalized gradient approximation GGA and GGA+U (U is the Hubbard correction). The GGA+U method is applied to the rare-earth 5f states. We have calculated the lattice parameters, bulk modulii and the first pressure derivatives of the bulk modulii. The elastic properties of the studied compounds are only investigated in the most stable calculated phase. In order to gain further information, we have calculated Young's modulus, shear modulus, anisotropy factor and Kleinman parameter by the aid of the calculated elastic constants. The results mainly show that californium monopnictides CfX (X = P) have an antiferromagnetic spin ordering. Density of states (DOS) and charge densities for both compounds are also computed in the NaCl (B1) structure.

  9. 49 CFR Appendix B to Part 236 - Risk Assessment Criteria (United States)


    ..., MAINTENANCE, AND REPAIR OF SIGNAL AND TRAIN CONTROL SYSTEMS, DEVICES, AND APPLIANCES Pt. 236, App. B Appendix... considered: (1) Track plan infrastructure, switches, rail crossings at grade and highway-rail grade...

  10. 49 CFR 236.766 - Locking, movable bridge. (United States)


    ..., MAINTENANCE, AND REPAIR OF SIGNAL AND TRAIN CONTROL SYSTEMS, DEVICES, AND APPLIANCES Definitions § 236.766 Locking, movable bridge. The rail locks, bridge locks, bolt locks, circuit controllers, and electric...

  11. 49 CFR 236.58 - Turnout, fouling section. (United States)


    ..., MAINTENANCE, AND REPAIR OF SIGNAL AND TRAIN CONTROL SYSTEMS, DEVICES, AND APPLIANCES Rules and Instructions: All Systems Track Circuits § 236.58 Turnout, fouling section. Rail joints within the fouling...

  12. 3C236 Radio Source, Interrupted?

    CERN Document Server

    O'Dea, C P; Baum, S A; Sparks, W B; Martel, A R; Allen, M G; Macchetto, F D; Miley, G K; Dea, Christopher P. O'; Koekemoer, Anton M.; Baum, Stefi A.; Sparks, William B.; Martel, Andre R.; Allen, Mark G.; Macchetto, Ferdinando D.; Miley, George K.


    We present new HST STIS/MAMA near-UV images and archival WFPC2 V and R band images which reveal the presence of four star forming regions in an arc along the edge of the dust lane in the giant (4 Mpc) radio galaxy 3C236. Two of the star forming regions are relatively young with ages of order 1E7 yr, while the other two are older with ages of order 1E8 - 1E9 yr which is comparable to the estimated age of the giant radio source. Based on dynamical and spectral aging arguments, we suggest that the fuel supply to the AGN was interrupted for 1E7 yr and has now been restored, resulting in the formation of the inner 2 kpc scale radio source. This time scale is similar to that of the age of the youngest of the star forming regions. We suggest that the transport of gas in the disk is non-steady and that this produces both the multiple episodes of star formation in the disk as well as the multiple epochs of radio source activity. If the inner radio source and the youngest star forming region are related by the same eve...

  13. Anatomy of a controversy: Application of the Langevin technique to the analysis of the Californium-252 Source-Driven Noise Analysis method for subcriticality determination

    International Nuclear Information System (INIS)

    The expressions for the power spectral density of the noise equivalent sources have been calculated explicitly for the (a) stochastic transport equation, (b) the one-speed transport equaton, (c) the one-speed P1 equations, (d) the one-speed diffusion equation and (e) the point kinetic equation. The stochastic nature of Fick's law in (d) has been emphasized. The Langevin technique has been applied at various levels of approximation to the interpretation of the Californium-252 Source-Driven Noise Analysis (CSDNA) experiment for determining the reactivity in subcritical media. The origin of the controversy surrounding this method has been explained. The foundations of the CSDNA method as a viable experimental technique to infer subcriticality from a measured ratio of power spectral densities of the outputs of two neutron detectors and a third external source detector has been examined by solving the one-speed stochastic diffusion equation for a point external Californium-252 source and two detectors in an infinite medium. The expression relating reactivity to the measured ratio of PSDs was found to depend implicitly on k itself. Through a numerical analysis fo this expression, the authors have demonstrated that for a colinear detector-source-detector configuration for neutron detectors far from the source, the expression for the subcritical multiplication factor becomes essentially insensitive to k, hence, demonstrating some possibility for the viability of this technique. However, under more realistic experimental conditions, i.e., for finite systems in which diffusion theroy is not applicable, the measurement of the subcritical multiplication factor from a single measured ratio of PSDs, without extensive transport calculations, remains doubtful

  14. Application of SCGE assay, classical cytogenetics and FISH for studying in vitro californium-252 neutrons irradiations and BSH pretreatment on human lymphocytes

    International Nuclear Information System (INIS)

    Recently, there has been observed a tendency to apply various energy neutrons for tumor therapy and particularly low energy neutrons from various sources, including californium-252 source, for cancer radiotherapy based on the neutron capture. In this study peripheral blood lymphocytes were used as a model for human cells and three methods were applied to assess the effectiveness of californium-252 neutrons irradiations in vitro in normal cells or pre-treated with compound enriched in B-10 ion. Human blood samples or isolated lymphocytes were irradiated with neutrons from isotopic 252Cf source at the Faculty of Nuclear Physics and Technics at University of Mining and Metallurgy (both neutron source and samples were placed in polyethylene block). Chemical pretreatment with BSH (Na210B12H11SH) was done to introduce boron-10 ion into cells in order to check any enhancement effect due to the process of boron neutron capture. Comet assay was done to investigate the DNA damage. Classical cytogenetics was applied to assess the frequencies of unstable aberrations (dicentrics and rings). Fluorescence in situ hybridization (FISH) with probes for chromosomes 1, 4 (14.3% of whole genome) and pancentromeric probe was performed to evaluate the frequencies of stable aberrations. Linear (or close to linear) increase of DNA damage and aberration frequency was observed with dose of radiation both for lymphocytes untreated or pre-treated with BSH. Very little differences (statistically insignificant) due to radiation dose and BSH pretreatment were observed in the frequencies of SCEs detected in the second mitosis. There is no significant difference between boron pre-treated and not treated cells, and even slightly higher effects were observed in case of the highest dose without BSH pretreatment. The level of translocations observed is comparable with the frequencies of dicentrics and rings. (author)

  15. Plutonium-236 traces determination in plutonium-238 by α spectrometry

    International Nuclear Information System (INIS)

    Two methods are described in this report for the determination of plutonium-236 traces in plutonium-238 by a spectrometry using semi-conductor detectors. The first method involves a direct comparison of the areas under the peaks of the α spectra of plutonium-236 and plutonium-238. The electrolytic preparation of the sources is carried out after preliminary purification of the plutonium. The second method makes it possible to determine the 236Pu/238Pu ratio by comparing the areas of the α peaks of uranium-232 and uranium-234, which are the decay products of the two plutonium isotopes respectively. The uranium in the source, also deposited by electrolysis, is separated from a 1 mg amount of plutonium either by a T.L.A. extraction, or by the use of ion-exchange resins. The report ends with a discussion of the results obtained with plutonium of two different origins. (authors)


    International Nuclear Information System (INIS)

    The principle of the proposed experiment is to irradiate very pure actinide samples in the Advanced Test Reactor (ATR) at INL and, after a given time, determine the amount of the different transmutation products. The determination of the nuclide densities before and after neutron irradiation will allow inference of effective neutron capture cross-sections. This approach has been used in the past and the novelty of this experiment is that the atom densities of the different transmutation products will be determined using the Accelerator Mass Spectroscopy (AMS) technique at the ATLAS facility located at ANL. It is currently planned to irradiate the following isotopes: 232Th, 235U, 236U, 238U, 237Np, 238Pu, 239Pu, 240Pu, 241Pu, 242Pu, 241Am, 243Am and 248Cm.

  17. Dicty_cDB: CHE236 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHE236 (Link to dictyBase) - - - Contig-U13888-1 CHE236P (Link to Original ... 5523_1( AY615523 |pid:none) Gallus gallus neuronal tryptophan ... ... 258 2e-67 BC013458_1( BC013458 |pid:none) Mus ... lanine hydroxy... 256 9e-67 (Q0EAB8) RecName: Full=Tryptophan ... 5-hydroxylase 2; EC=1... 256 9e-67 (Q8IWU9) RecNam ...

  18. 49 CFR 236.338 - Mechanical locking required in accordance with locking sheet and dog chart. (United States)


    ... locking sheet and dog chart. 236.338 Section 236.338 Transportation Other Regulations Relating to... in accordance with locking sheet and dog chart. Mechanical locking shall be in accordance with locking sheet and dog chart currently in effect....

  19. Californium-252 neutron sources

    International Nuclear Information System (INIS)

    Major production programs for the Savannah River reactors and the High Flux Isotopes Reactor at Oak Ridge have made 252Cf one of the most available and, at the USAEC's sales price of $10/μg, one of the least-expensive isotopic neutron sources. Reactor production has totaled approximately 2 g, and, based on expected demand, an additional 10 g will be produced in the next decade. The approximately 800 mg chemically separated to date has been used to prepare over 600 neutron sources. Most, about 500, have been medical sources containing 1 to 5 μg of 252Cf plated in needles for experimental cancer therapy studies. The remainder have generally been point sources containing 10 μg to 12 mg of oxide for activation, well logging, or radiography uses. Bulk sources have also been supplied to the commercial encapsulators. The latest development has been the production of 252Cf cermet wire which can be cut into almost contamination-free lengths of the desired 252Cf content. Casks are available for transport of sources up to 50 mg. Subcritical assemblies have been developed to multiply the source neutrons by a factor of 10 to 40, and collimators and thermalizers have also been extensively developed to shape the neutron flux and energy distributions for special applications. (U.S.)

  20. Calculations of Nuclear Astrophysics and Californium Fission Neutron Spectrum Averaged Cross Section Uncertainties Using ENDF/B-VII.1, JEFF-3.1.2, JENDL-4.0 and Low-fidelity Covariances

    International Nuclear Information System (INIS)

    Nuclear astrophysics and californium fission neutron spectrum averaged cross sections and their uncertainties for ENDF materials have been calculated. Absolute values were deduced with Maxwellian and Mannhart spectra, while uncertainties are based on ENDF/B-VII.1, JEFF-3.1.2, JENDL-4.0 and Low-Fidelity covariances. These quantities are compared with available data, independent benchmarks, EXFOR library, and analyzed for a wide range of cases. Recommendations for neutron cross section covariances are given and implications are discussed

  1. 8 CFR 236.1 - Apprehension, custody, and detention. (United States)


    ... an order under 8 CFR part 240 becomes final, request amelioration of the conditions under which he or... of removal. Algeria 1 1 Arrangements with the countries listed in 8 CFR 236.1(e) provide that U.S... Kiribati Kuwait Kyrgyzstan Malaysia Malta Mauritius Moldova Mongolia Nigeria Philippines Poland 4...

  2. 49 CFR 236.907 - Product Safety Plan (PSP). (United States)


    ... addressed during the life cycle of the product, including maximum threshold limits for each hazard (for... necessary security measures for the product over its life-cycle; (16) A complete description of each warning... 49 Transportation 4 2010-10-01 2010-10-01 false Product Safety Plan (PSP). 236.907 Section...

  3. 49 CFR 236.917 - Retention of records. (United States)


    ...: (i) For the life-cycle of the product, adequate documentation to demonstrate that the PSP meets the...-Based Signal and Train Control Systems § 236.917 Retention of records. (a) What life-cycle and... safety-relevant hazard? After the product is placed in service, the railroad shall maintain a database...

  4. 48 CFR 236.201 - Evaluation of contractor performance. (United States)


    ... CONTRACTS Special Aspects of Contracting for Construction 236.201 Evaluation of contractor performance. (a) Preparation of performance evaluation reports. Use DD Form 2626, Performance Evaluation (Construction... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Evaluation of...

  5. 48 CFR 52.236-17 - Layout of Work. (United States)


    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Layout of Work. 52.236-17... Layout of Work. As prescribed in 36.517, insert the following clause in solicitations and contracts when... need for accurate work layout and for siting verification during work performance: Layout of Work...

  6. Mass and abundance 236U sensitivities at CIRCE (United States)

    De Cesare, M.; De Cesare, N.; D'Onofrio, A.; Fifield, L. K.; Gialanella, L.; Terrasi, F.


    The actinides (e.g. 236U and xPu isotopes) are present in environmental samples at the ultra trace level since atmospheric tests of NWs (Nuclear Weapons) performed in the past, deliberate dumping of nuclear waste, nuclear fuel reprocessing, on a large scale and operation of NPPs (Nuclear Power Plants) on a small scale have led to the release of a wide range of radioactive nuclides in the environment. Their detection requires the most sensitive AMS (Accelerator Mass Spectrometry) techniques and at the Center for Isotopic Research on Cultural and Environmental heritage (CIRCE) in Caserta, Italy, an upgraded actinide AMS system, based on a 3-MV pelletron tandem accelerator, has been operated. In this paper the progress made in order to push the 236U mass sensitivity and 236U/238U isotopic ratio down to the natural levels is reported. A uranium contamination mass of about 0.05 μg and a 236U/238U isotopic ratio sensitivities at the level of 3.2 × 10-13 are presently achievable.

  7. 7 CFR 58.236 - Pasteurization and heat treatment. (United States)


    ... destruction. Condensed milk products made from pasteurized milk may be transported to a drying plant, provided... Service 1 Operations and Operating Procedures § 58.236 Pasteurization and heat treatment. All milk and buttermilk used in the manufacture of dry milk products and modified dry milk products shall be...

  8. 48 CFR 1852.236-73 - Hurricane plan. (United States)


    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Hurricane plan. 1852.236-73... Hurricane plan. As prescribed in 1836.570(c), insert the following clause: Hurricane Plan (DEC 1988) In the event of a hurricane warning, the Contractor shall— (a) Inspect the area and place all...

  9. 48 CFR 52.236-13 - Accident Prevention. (United States)


    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Accident Prevention. 52....236-13 Accident Prevention. As prescribed in 36.513, insert the following clause: Accident Prevention... the Secretary of Labor at 29 CFR part 1926 and 29 CFR part 1910; and (3) Ensure that any...

  10. 48 CFR 852.236-87 - Accident prevention. (United States)


    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Accident prevention. 852... Accident prevention. As prescribed in 836.513, insert the following clause: Accident Prevention (SEP 1993....236-13, Accident Prevention. However, only the Contracting Officer may issue an order to stop all...

  11. 48 CFR 652.236-70 - Accident Prevention. (United States)


    ... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Accident Prevention. 652... SOLICITATION PROVISIONS AND CONTRACT CLAUSES Texts of Provisions and Clauses 652.236-70 Accident Prevention. As prescribed in 636.513, insert the following clause: Accident Prevention (APR 2004) (a) General....

  12. 27 CFR 40.236 - Release from customs custody. (United States)


    ... 27 Alcohol, Tobacco Products and Firearms 2 2010-04-01 2010-04-01 false Release from customs... on Tobacco Products § 40.236 Release from customs custody. The release of tobacco products from customs custody, in bond, for transfer to the premises of a tobacco products factory, shall be...

  13. 49 CFR 236.554 - Rate of pressure reduction; equalizing reservoir or brake pipe. (United States)


    ... or brake pipe. 236.554 Section 236.554 Transportation Other Regulations Relating to Transportation...; Locomotives § 236.554 Rate of pressure reduction; equalizing reservoir or brake pipe. The equalizing-reservoir pressure or brake-pipe pressure reduction during an automatic brake application shall be at a rate not...

  14. 49 CFR 236.330 - Locking dog of switch-and-lock movement. (United States)


    ... 49 Transportation 4 2010-10-01 2010-10-01 false Locking dog of switch-and-lock movement. 236.330 Section 236.330 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD... Rules and Instructions § 236.330 Locking dog of switch-and-lock movement. Locking dog of...

  15. 49 CFR 236.560 - Contact element, mechanical trip type; location with respect to rail. (United States)


    ... 49 Transportation 4 2010-10-01 2010-10-01 false Contact element, mechanical trip type; location with respect to rail. 236.560 Section 236.560 Transportation Other Regulations Relating to... Instructions; Locomotives § 236.560 Contact element, mechanical trip type; location with respect to...

  16. 48 CFR 452.236-74 - Control of Erosion, Sedimentation, and Pollution. (United States)


    ..., Sedimentation, and Pollution. 452.236-74 Section 452.236-74 Federal Acquisition Regulations System DEPARTMENT OF....236-74 Control of Erosion, Sedimentation, and Pollution. As prescribed in 436.574, insert the following clause: Control of Erosion, Sedimentation, and Pollution (NOV 1996) (a) Operations shall...

  17. 48 CFR 252.236-7012 - Military construction on Kwajalein Atoll-evaluation preference. (United States)


    ... Kwajalein Atoll-evaluation preference. 252.236-7012 Section 252.236-7012 Federal Acquisition Regulations... Kwajalein Atoll—evaluation preference. As prescribed in 236.570(c)(2), use the following provision: Military Construction on Kwajalein Atoll—Evaluation Preference (MAR 1998) (a) Definitions. As used in this provision—...

  18. Recoil distance lifetimes of rotational states in 236U

    International Nuclear Information System (INIS)

    Half-lives for members of the 236U ground-state rotational band have been measured by the recoil-distance method following Coulomb excitation with 40Ar8+ projectiles. The B (E2, I→I-2) values in units of e2 b2 determined from the half-lives of the 4+, 6+, 8+, 10+, and 12+ states are 3.03+-0.20, 3.28+-0.19, 3.42+-0.28, 3.11+-0.30, and 3.34+2.23/sub em-dash//sub 0//sub .9//sub 5/, respectively. Transition quadrupole moments Q20(I/subi/→I/subf/) deduced from the lifetimes are constant within experimental error and thus support the characterization of 236U as a good rotor to spin 12+

  19. Dicty_cDB: SHD236 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SH (Link to library) SHD236 (Link to dictyBase) - - - Contig-U16371-1 - (Link to Original site) ... Oryzias latipes DNA, clone: ola1-242I19.F, genomic survey ... sequence. 54 0.004 1 DE092915 |DE092915.1 Oryzias ... latipes DNA, clone: ola1-209J09.R, genomic survey ... sequence. 54 0.004 1 DE086252 |DE086252.1 Oryzias ...

  20. Value of 236U to actinide-only burnup credit

    International Nuclear Information System (INIS)

    The US Department of Energy (DOE) submitted a topical report to the US Nuclear Regulatory Commission (NRC) in May 1995 in order to gain approval of a method for criticality analysis of transport packages that takes account for the change in actinide isotopes with burnup [pressurized water reactors (PWRs) only]. Historically, the NRC has conservatively assumed that the fuel was in its initial conditions (without any burnable absorbers). In order to permit credit for the changes in actinide content, the NRC has required validation of the depletion and criticality codes for spent nuclear fuel, justification of conservative depletion modeling, and finally confirmation measurements before loading. The NRC requested additional information on March 22, 1996. The DOE responded by a revision of the topical report in May 1997. The NRC again responded with another set of requests of additional information in April 1998. In that set of questions, the NRC challenged the use of 236U in burnup credit. Uranium-236 is not found in any significant amount in any available critical experiments. The authors explore the value of 236U to actinide-only burnup credit

  1. Depth distributions of 236U and 137Cs in the Japan Sea: the potential of 236U as a new oceanographic tracer

    International Nuclear Information System (INIS)

    We present the feasibility of using 236U as a tracer for oceanic circulation. Depth profiles of 236U in seawater from seven sites in the Japan Sea allowed assessing the potential of this predominantly artificial uranium isotope. The isotope ratio 236U/238U decreased from ca. 1.3×10–9 in the surface water to ca. 0.2×10–9 close above the sea floor, corresponding to 236U concentrations of ca. 1.0×107 and ca. 1.5×106 atoms/kg, respectively. 236U depth profiles are nearly proportional to those of 137Cs measured in the same water samples. They reveal a generally smooth depth trend with a slightly higher concentration of 236U and 137Cs in the northern area at depths below 2500 m. The cumulative inventory of dissolved 236U in the water column is estimated to be ca. 1.6×1013 atoms/m2, which is similar to the level of global fallout in Japan, 1.8×1013 atoms/m2. Our results indicate that 236U behaves conservatively in seawater, with potential advantages over other tracers for seawater circulation. (author)

  2. Californium interrogation prompt neutron (CIPN) instrument for non-destructive assay of spent nuclear fuel-Design concept and experimental demonstration (United States)

    Henzlova, D.; Menlove, H. O.; Rael, C. D.; Trellue, H. R.; Tobin, S. J.; Park, Se-Hwan; Oh, Jong-Myeong; Lee, Seung-Kyu; Ahn, Seong-Kyu; Kwon, In-Chan; Kim, Ho-Dong


    This paper presents results of the first experimental demonstration of the Californium Interrogation Prompt Neutron (CIPN) instrument developed within a multi-year effort launched by the Next Generation Safeguards Initiative Spent Fuel Project of the United States Department of Energy. The goals of this project focused on developing viable non-destructive assay techniques with capabilities to improve an independent verification of spent fuel assembly characteristics. For this purpose, the CIPN instrument combines active and passive neutron interrogation, along with passive gamma-ray measurements, to provide three independent observables. This paper describes the initial feasibility demonstration of the CIPN instrument, which involved measurements of four pressurized-water-reactor spent fuel assemblies with different levels of burnup and two initial enrichments. The measurements were performed at the Post-Irradiation Examination Facility at the Korea Atomic Energy Institute in the Republic of Korea. The key aim of the demonstration was to evaluate CIPN instrument performance under realistic deployment conditions, with the focus on a detailed assessment of systematic uncertainties that are best evaluated experimentally. The measurements revealed good positioning reproducibility, as well as a high degree of insensitivity of the CIPN instrument's response to irregularities in a radial burnup profile. Systematic uncertainty of individual CIPN instrument signals due to assembly rotation was found to be orientation in the instrument.

  3. Quantum efficiency measurements in the swept charge device CCD236

    International Nuclear Information System (INIS)

    The e2v technologies plc. CCD236 is a Swept Charge Device (SCD) designed as a large area (20 mm × 20 mm) soft X-ray detector for spectroscopy in the range 0.8 keV to 10 keV. It benefits from improvements in design over the previous generation, the e2v CCD54, such as: a 4 times increased detector area, a reduction in split X-ray events due to the 100 μm × 100 μm 'pixel' size, and improvements to radiation hardness. The CCD236 will be used in India's Chandrayaan-2 Large Soft X-ray Spectrometer (CLASS) instrument and China's Hard X-ray Modulation Telescope (HXMT). Measurements of the Quantum Efficiency (QE) have been obtained relative to a NIST calibrated photodiode over the energy range 0.2 keV to 1.9 keV, using the BESSY II X-ray synchrotron in Berlin. Two X-ray event counting methods are described and compared, and QE for soft X-ray interaction is reported. Uniformity of QE across the device is also investigated at energies between 0.52 keV and 1.5 keV in different areas of the detector. This work will enable the actual number of photons incident on the detectors to be calculated, thus ensuring that the CCD236 detectors provide valuable scientific data during use. By comparing the QE methods in this paper with the event processing techniques to be used with CLASS, an estimate of the instrument-specific QE for CLASS can be provided

  4. Biological Efficiency of Californium-252 Source Evaluated by Comet Assay, Classical Cytogenetics and FISH in Human Lymphocytes Irradiated without and with BSH Pretreatment

    International Nuclear Information System (INIS)

    Biological effectiveness of californium-252 source was evaluated after irradiations in vitro of normal or pre-treated with compound enriched in B-10 ion cells. Peripheral blood lymphocytes were used as a model for human cells. DNA and chromosomal damage were studied to compare biological effectiveness of irradiation. Human blood samples or isolated lymphocytes were irradiated with the isotopic source of 252Cf, at the Faculty of Physics and Nuclear Techniques at the University of Mining and Metallurgy (both neutron source and samples were placed in ''infinite'' polyethylene block). Chemical pretreatment with Na210B12H11SH (BSH) was performed to introduce boron-10 ion into cells in order to check any enhancement effect due to the process of boron neutron capture. Single cell gel electrophoresis also known as the Comet assay was done to investigate the DNA damage. Classical cytogenetic analysis was applied to assess the frequencies of unstable aberrations (dicentrics, rings and a centric fragments). To evaluate the frequencies of stable aberrations the fluorescence in situ hybridisation (FISH) with probes for chromosomes 1, 4 (14.3% of the whole genome) was performed. Linear (or close to linear) increase with radiation dose were observed for the DNA damage and aberration frequencies in lymphocytes both untreated or pre-treated with BSH. Levels of translocations evaluated for the whole genome were comparable with the frequencies of dicentrics and rings. No significant differences were detected due to radiation dose in the frequencies of sister chromatid exchanges (SCE) detected in the second mitosis. No statistically significant differences were observed in various biological end-points between normal or boron pre-treated cells. (author)

  5. First measurements of 236U concentrations and 236U/239Pu isotopic ratios in a Southern Hemisphere soil far from nuclear test or reactor sites

    International Nuclear Information System (INIS)

    The variation of the 236U and 239Pu concentrations as a function of depth has been studied in a soil profile at a site in the Southern Hemisphere well removed from nuclear weapon test sites. Total inventories of 236U and 239Pu as well as the 236U/239Pu isotopic ratio were derived. For this investigation a soil core from an undisturbed forest area in the Herbert River catchment (17°30′ – 19°S) which is located in north-eastern Queensland (Australia) was chosen. The chemical separation of U and Pu was carried out with a double column which has the advantage of the extraction of both elements from a relatively large soil sample (∼20 g) within a day. The samples were measured by Accelerator Mass Spectrometry using the 14UD pelletron accelerator at the Australian National University. The highest atom concentrations of both 236U and 239Pu were found at a depth of 2–3 cm. The 236U/239Pu isotopic ratio in fallout at this site, as deduced from the ratio of the 236U and 239Pu inventories, is 0.085 ± 0.003 which is clearly lower than the Northern Hemisphere value of ∼0.2. The 236U inventory of (8.4 ± 0.3) × 1011 at/m2 was more than an order of magnitude lower than values reported for the Northern Hemisphere. The 239Pu activity concentrations are in excellent agreement with a previous study and the 239+240Pu inventory was (13.85 ± 0.29) Bq/m2. The weighted mean 240Pu/239Pu isotopic ratio of 0.142 ± 0.005 is slightly lower than the value for global fallout, but our results are consistent with the average ratio of 0.173 ± 0.027 for the southern equatorial region (0–30°S). - Highlights: • Exploration of uranium-236 (236U) and plutonium-239 (239Pu) in the Southern Hemisphere by accelerator mass spectrometry. • We report the depth profile for both isotopes from a forest site well removed from nuclear test or reactor sites. • 236U and 239Pu were deposited at the same time due to nuclear weapons tests but show a slightly different depth dependence. • The


    The report discusses miscibility, solubility, viscosity, and density data for the refrigerant hydrofluorocarbon (HFC)-236ea (or R-236ea) and four lubricants supplied by Exxon Corporation. Such data are needed to determine the suitability of refrigerant/lubricant combinations for ...

  7. 49 CFR 236.13 - Spring switch; selection of signal control circuits through circuit controller. (United States)


    ... circuits through circuit controller. 236.13 Section 236.13 Transportation Other Regulations Relating to...; selection of signal control circuits through circuit controller. The control circuits of signals governing... circuit controller, or through the contacts of relay repeating the position of such circuit...

  8. 49 CFR 236.74 - Protection of insulated wire; splice in underground wire. (United States)


    ... underground wire. 236.74 Section 236.74 Transportation Other Regulations Relating to Transportation (Continued... wire; splice in underground wire. Insulated wire shall be protected from mechanical injury. The insulation shall not be punctured for test purposes. Splice in underground wire shall have...

  9. Key Issue of Ultra-trace Environmental Samples by ~(236)U/~(238)U-AMS Method

    Institute of Scientific and Technical Information of China (English)


    The accurate determination of uranium-236 in samples at ultra-low level is critical. Combined with AMS , reducing the background effects throughout the experiment is quite necessary. Therefore, some advances on the determination of 236U by accelerator mass spectrometry

  10. 49 CFR 236.53 - Track circuit feed at grade crossing. (United States)


    ... 49 Transportation 4 2010-10-01 2010-10-01 false Track circuit feed at grade crossing. 236.53... Instructions: All Systems Track Circuits § 236.53 Track circuit feed at grade crossing. At grade crossing with... current track circuit shall feed away from the crossing....

  11. 49 CFR 236.531 - Trip arm; height and distance from rail. (United States)


    ... 49 Transportation 4 2010-10-01 2010-10-01 false Trip arm; height and distance from rail. 236.531... Train Stop, Train Control and Cab Signal Systems Rules and Instructions; Roadway § 236.531 Trip arm; height and distance from rail. Trip arm of automatic train stop device when in the stop position shall...

  12. 24 CFR 236.260 - Request by Commissioner for assignment of mortgage. (United States)



  13. 49 CFR 236.340 - Electromechanical interlocking machine; locking between electrical and mechanical levers. (United States)


    ... between electrical and mechanical levers. 236.340 Section 236.340 Transportation Other Regulations... Electromechanical interlocking machine; locking between electrical and mechanical levers. In electro-mechanical interlocking machine, locking between electric and mechanical levers shall be maintained so that...

  14. 48 CFR 236.274 - Restriction on acquisition of steel for use in military construction projects. (United States)


    ..., Division E), do not acquire, or allow a contractor to acquire, steel for any construction project or... of steel for use in military construction projects. 236.274 Section 236.274 Federal Acquisition... CONTRACTING CONSTRUCTION AND ARCHITECT-ENGINEER CONTRACTS Special Aspects of Contracting for Construction...


    The report gives results of an investigation of the operation of a centrifugal compressor--part of a chlorofluorocarbon (CFC)-114 chiller installation--with the new refrigerant hydrofluorocarbon (HFC)-236ea, a proposed alternative to CFC-114. A large set of CFC-236ea operating da...

  16. 49 CFR 236.16 - Electric lock, main track releasing circuit. (United States)


    ... 49 Transportation 4 2010-10-01 2010-10-01 false Electric lock, main track releasing circuit. 236... Rules and Instructions: All Systems General § 236.16 Electric lock, main track releasing circuit. When an electric lock releasing circuit is provided on the main track to permit a train or an engine...

  17. 49 CFR 236.306 - Facing point lock or switch-and-lock movement. (United States)


    ... 49 Transportation 4 2010-10-01 2010-10-01 false Facing point lock or switch-and-lock movement. 236... Interlocking Standards § 236.306 Facing point lock or switch-and-lock movement. Facing point lock or switch-and-lock movement shall be provided for mechanically operated switch, movable-point frog, or...

  18. 49 CFR 236.7 - Circuit controller operated by switch-and-lock movement. (United States)


    ... 49 Transportation 4 2010-10-01 2010-10-01 false Circuit controller operated by switch-and-lock movement. 236.7 Section 236.7 Transportation Other Regulations Relating to Transportation (Continued... switch-and-lock movement. Circuit controller operated by switch-and-lock movement shall be maintained...

  19. 49 CFR 236.557 - Receiver; location with respect to rail. (United States)


    ... 49 Transportation 4 2010-10-01 2010-10-01 false Receiver; location with respect to rail. 236.557 Section 236.557 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD...; location with respect to rail. (a) Receiver of intermittent inductive automatic train stop device of...

  20. 49 CFR 236.529 - Roadway element inductor; height and distance from rail. (United States)


    ... rail. 236.529 Section 236.529 Transportation Other Regulations Relating to Transportation (Continued... THE INSTALLATION, INSPECTION, MAINTENANCE, AND REPAIR OF SIGNAL AND TRAIN CONTROL SYSTEMS, DEVICES, AND APPLIANCES Automatic Train Stop, Train Control and Cab Signal Systems Rules and...

  1. 24 CFR 236.755 - Housing owner's obligation under contract to report tenant income increase. (United States)


    ... income resulting in the tenant's ability to pay the approved basic monthly rental (plus, where applicable... contract to report tenant income increase. 236.755 Section 236.755 Housing and Urban Development... report tenant income increase. The rental assistance contract shall contain a provision obligating...

  2. Feasibility of using 236U to reconstruct close-in fallout deposition from the Hiroshima atomic bomb

    International Nuclear Information System (INIS)

    The first results on the feasibility of using 236U to reconstruct the level and spatial distribution of close-in fallout deposition from the Hiroshima A-bomb are reported, coupled with the use of global fallout 137Cs and 239+240Pu. The results for global fallout 236U in soil samples (0-30 cm) from Ishikawa prefecture showed that the deposition density of 236U from the global fallout can be accurately evaluated using AMS. All deposited 236U, 137Cs and 239+240Pu appeared to have been recovered using 30-cm cores. It was also noted from the depth profiles for 236U/239+240Pu and 236U/137Cs ratios that the downward behavior of 236U in the soil was apparently similar to that of 239+240Pu, while the 137Cs was liable to be retained in upper layers compared with 236U and 239+240Pu. The accumulated levels were 1.78 x 1013 atoms m-2 for 236U, 4340 Bq m-2 for 137Cs and 141 Bq m-2 for 239+240Pu. The ratios of 236U/137Cs and 236U/239+240Pu were (4.10 ± 0.12) x 109 and (1.26 ± 0.04) x 1011 atoms Bq-1, respectively. Results of 236U, 137Cs and 239+240Pu measurements for the seven soil cores (0-30 cm) from Hiroshima were discussed on the basis of ratios of 236U/137Cs and 236U/239+240Pu by comparing with those from the background area in Ishikawa, indicating that the global fallout dominates the current level of 236U accumulation in soil in the Black-rain area around Hiroshima after the Hiroshima bomb, and the contribution of the close-in fallout 236U produced by the Hiroshima A-bomb seems difficult to observe.

  3. 33 CFR 110.236 - Pacific Ocean off Barbers Point, Island of Oahu, Hawaii: Offshore pipeline terminal anchorages. (United States)


    ..., Island of Oahu, Hawaii: Offshore pipeline terminal anchorages. 110.236 Section 110.236 Navigation and... Grounds § 110.236 Pacific Ocean off Barbers Point, Island of Oahu, Hawaii: Offshore pipeline terminal... vessels of over 100 gross tons shall not approach within 1,000 yards at a speed in excess of 6 knots....

  4. Neutron Capture Cross Sections of 236U and 234U

    International Nuclear Information System (INIS)

    Accurate neutron capture cross sections of the actinide elements at neutron energies up to 1 MeV are needed to better interpret archived nuclear test data, for post-detonation nuclear attribution, and the Advanced Fuel Cycle Initiative. The Detector for Advance Neutron Capture Experiments, DANCE, has unique capabilities that allow the differentiation of capture gamma rays from fission gamma rays and background gamma rays from scattered neutrons captured by barium isotopes in the barium fluoride scintillators. The DANCE array has a high granularity, 160 scintillators, high efficiency, and nearly 4-π solid angle. Through the use of cuts in cluster multiplicity and calorimetric energy the capture gamma-rays are differentiated from other sources of gamma rays. The preliminary results for the capture cross sections of 236U are in agreement with the ENDF/B-VI evaluation. The preliminary results for 234U lower are than ENDF/B-VI evaluation and are closer to older evaluations

  5. Primary result of 236U measurement with accelerator mass spectrometry at CIAE

    International Nuclear Information System (INIS)

    The rare isotope 236U has a half-life of 2.342(3) x 107 years, and is produced principally by thermal neutron capture on 235U. The isotopic atom ratio of 236U/238U depends on the integral thermal neutron flux received by the material of interest. 236U is potentially useful as a 'fingerprint' for indicating the presence of neutron-irradiated uranium usually originating from nuclear activity. By extracting negative molecular ion UO- from the uranium oxide target, simulating the 236U16O- beam transport with 238U16O- and 208Pb162 O- pilot molecular ion beam, transporting the 236U-containing ion beam with a high resolution injection magnet analyzer and electrostatic analyzer system, and finally identifying and detecting 236U with a time-of-flight detector (TOF), a method for AMS (Accelerator Mass Spectrometry) measurement of 236U was established on the HI-13 Accelerator AMS system at China Institute of Atomic Energy. (authors)


    The report gives results of miscibility, solubility, and viscosity measurements of refrigerant R-236ea with three potential lubricants. (NOTE: The data were needed to determine the suitability of refrigerant/lubricant combinations for use in refrigeration systems.) The lubricants...

  7. 33 CFR 2.36 - Navigable waters of the United States, navigable waters, and territorial waters. (United States)


    ... GUARD, DEPARTMENT OF HOMELAND SECURITY GENERAL JURISDICTION Jurisdictional Terms § 2.36 Navigable waters... used in sections 311 and 312 of the Federal Water Pollution Control Act, as amended, 33 U.S.C. 1321...

  8. 49 CFR 236.10 - Electric locks, force drop type; where required. (United States)


    ... 49 Transportation 4 2010-10-01 2010-10-01 false Electric locks, force drop type; where required... Rules and Instructions: All Systems General § 236.10 Electric locks, force drop type; where required... the forced drop type....

  9. Measurement of the natural 36Cl and 236U uranium mineral with accelerator mass spectrometry

    International Nuclear Information System (INIS)

    The concentration of the natural ultra-trace radionuclides 36Cl and 236U in the uranium depended on the neutron flux. In this article, a method for measuring 36Cl and 236U in the same uranium mineral with accelerator mass spectrometry was developed in China Institute of Atomic Energy, providing a protocol of the potential application of 236U in uranium mining, environmental, and geological research. The two samples were from Guangxi and Shanxi province, China, and their ratios 36Cl/Cl and 236U/238U were measured. More experimental data conduced to understand the natural nuclides in the uranium mineral. We plan to conduct more efforts on the research. (authors)

  10. 49 CFR 236.328 - Plunger of facing-point lock. (United States)


    ... Rules and Instructions § 236.328 Plunger of facing-point lock. Plunger of lever operated facing-point lock shall have at least 8-inch stroke. When lock lever is in unlocked position the end of the...

  11. Amendment of the Measurement of Low Abundance 236U by Mass Spectrometry

    International Nuclear Information System (INIS)

    The low abundance isotope 236U is easily disturbed by strong peak tails in the measurement of Mass Spectrometry. So, the measurement of 236U is amended with the Background Amendment (BGA) tail calibration method and the dynamic background method. BGA method was used to measure the signal at 235.5 and 236.5 mass number, these signal could be regarded as strong peak tails which was eliminated in the measurement data. When 236U abundance was low, BGA calibration method had good effect, the emendation to measurement reached 2.24%, the amended value was more close to nominal value, and the effect of dynamic background amendment method is not significant. (authors)

  12. 17 CFR 230.236 - Exemption of shares offered in connection with certain transactions. (United States)


    ... stock dividend, stock split, reverse stock split, conversion, merger or similar transaction, shall be... Exemptions § 230.236 Exemption of shares offered in connection with certain transactions. Shares of stock...

  13. Fission barriers of 237 to 240 plutonium isotopes with the 236U(α,xn) reactions

    International Nuclear Information System (INIS)

    Excitation functions for the reactions 236U(α,xn)sup(240-x)Pu have been measured for x=2, 3, 4. The production of 236U targets as well as the chemical separation of Pu from the irradied targets are given. Experimental results have been analysed using the preequilibrium mechanism (PREEQ code) and the statistical model description of fission through a double humped barrier (GIVAB code)

  14. Measurement of the neutron capture cross section of 236U

    International Nuclear Information System (INIS)

    In this paper we describe the 236U(n, γ) reaction cross section measurement at the GELINA white pulsed neutron source of the Inst. for Reference Materials and Measurements (IRMM) in Geel. The sample was placed in the neutron beam at a flight station located at a nominal distance of 30 m from the neutron source. Neutron capture gamma rays were detected by two C6D6-based liquid scintillator gamma-ray detectors as a function of the neutron time-of-flight using the pulse height weighting technique. The pulse height weighting function has been derived from Monte Carlo simulations of the detector response to mono-energetic gamma rays. The shape of the neutron flux was measured with a 10B chamber, placed about 60 cm upstream in the neutron beam. The capture yield in the resolved resonance region up to 3 keV has been derived and will be presented here. The analysis of the capture yield in terms of R-matrix resonance parameters is planned for the near future. (authors)

  15. The first transect of U-236 in the North Atlantic Ocean

    International Nuclear Information System (INIS)

    New developments in accelerator mass spectrometry (AMS) allow determining very low-levels of anthropogenic 236U in Ocean waters. As a result, the potential of using the 236U/238U ratio as a new conservative and transient tracer in oceanography is now being tested. In this study 236U/238U ratios and 236U concentrations were determined in 90 3L seawater samples, collected from 9 depth profiles during the Dutch GEOTRACES cruise GA02 in 2010 along the Northwest Atlantic Ocean (from equator to 64 circle N). The 236U/238U ratios ranged from (44±15).10-12 to (1477±91).10-12. Higher values correspond to North Atlantic water masses (i.e. Labrador Sea Water (LSW) and North East Atlantic Deep Water (NEADW)), which have higher input from global fallout and possibly an additional contribution from the European nuclear reprocessing plants. In contrast, lower 236U values are representative of southern water masses such as Antarctic Bottom Water (AABW) and Antarctic Intermediate Water (AAIW). To explore the potential of this new tracer in oceanography it is compared to other transient tracers (e.g. CFCs) used so far to quantify oceanic processes such as water mass mixing and deep water formation rates.

  16. MANTRA: An Integral Reactor Physics Experiment to Infer Actinide Capture Cross-sections from Thorium to Californium with Accelerator Mass Spectrometry

    Energy Technology Data Exchange (ETDEWEB)

    G. Youinou; C. McGrath; G. Imel; M. Paul; R. Pardo; F. Kondev; M. Salvatores; G. Palmiotti


    The principle of the proposed experiment is to irradiate very pure actinide samples in the Advanced Test Reactor at INL and, after a given time, determine the amount of the different transmutation products. The determination of the nuclide densities before and after neutron irradiation will allow inference of effective neutron capture cross-sections. This approach has been used in the past and the novelty of this experiment is that the atom densities of the different transmutation products will be determined using the Accelerator Mass Spectrometry technique at the ATLAS facility located at ANL. It is currently planned to irradiate the following isotopes: 232Th, 235U, 236U, 238U, 237Np, 238Pu, 239Pu, 240Pu, 241Pu, 242Pu, 241Am, 243Am, 244Cm and 248Cm.

  17. MANTRA: An Integral Reactor Physics Experiment to Infer Actinide Capture Cross-sections from Thorium to Californium with Accelerator Mass Spectrometry

    International Nuclear Information System (INIS)

    The principle of the proposed experiment is to irradiate very pure actinide samples in the Advanced Test Reactor at INL and, after a given time, determine the amount of the different transmutation products. The determination of the nuclide densities before and after neutron irradiation will allow inference of effective neutron capture cross-sections. This approach has been used in the past and the novelty of this experiment is that the atom densities of the different transmutation products will be determined using the Accelerator Mass Spectrometry technique at the ATLAS facility located at ANL. It is currently planned to irradiate the following isotopes: 232Th, 235U, 236U, 238U, 237Np, 238Pu, 239Pu, 240Pu, 241Pu, 242Pu, 241Am, 243Am, 244Cm and 248Cm.

  18. Californium Recovery from Palladium Wire

    Energy Technology Data Exchange (ETDEWEB)

    Burns, Jon D. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States)


    The recovery of 252Cf from palladium-252Cf cermet wires was investigated to determine the feasibility of implementing it into the cermet wire production operation at Oak Ridge National Laboratory’s Radiochemical Engineering Development Center. The dissolution of Pd wire in 8 M HNO3 and trace amounts of HCl was studied at both ambient and elevated temperatures. These studies showed that it took days to dissolve the wire at ambient temperature and only 2 hours at 60°C. Adjusting the ratio of the volume of solvent to the mass of the wire segment showed little change in the kinetics of dissolution, which ranged from 0.176 mL/mg down to 0.019 mL/mg. A successful chromatographic separation of 153Gd, a surrogate for 252Cf, from Pd was demonstrated using AG 50x8 cation exchange resin with a bed volume of 0.5 mL and an internal diameter of 0.8 cm.

  19. Deposition of 236U from atmospheric nuclear testing in Washington state (USA) and the Pechora region (Russian Arctic)

    International Nuclear Information System (INIS)

    Stratospheric fallout-derived 236U has been detected by sector field ICPMS at two field locations for which our laboratory possessed available archived samples: A) four soil cores from Washington state (northwestern USA) and B) sediment cores from three small lakes in the Pechora region (Russian Arctic). Four Washington state soil cores exhibit 236U inventories of 8.1 ± 1.3, 11.1 ± 0.9, 18 ± 2, and 30.2 ± 3.9 Tatoms/m2; the respective 239Pu contents are 52.9 ± 3.5, 67 ± 3, 71 ± 2, and 151 ± 2 Tatoms/m2. A 236U/239Pu atom ratio of 0.19 ± 0.04 (1 SD) has been determined from the Washington state soil cores. The three Pechora region lake cores each exhibit coincident maxima in their 236U and 239Pu atom concentration profiles. The 236U/238U atom ratios are controlled by two independent factors; 236U is from fallout deposition and 238U concentrations are a property of the geochemical distribution of naturally occurring U. A 236U/238U atom ratio as high as 8.9 × 10−6 has been observed for acid-leached soils containing Pu solely derived from bomb-test fallout. Accordingly, a non-zero 236U background from stratospheric fallout must be recognized and taken into account when detectable 236U is used to infer specific local or regional influences of reactor-irradiated U. -- Highlights: ► The isotope 236U, originating from atmospheric nuclear weapons tests, has been identified at two locations in the Northern Hemisphere. ► Peak 236U concentrations match peak 239Pu concentrations in sediment cores. ► The 236U/239Pu atom ratio is 0.19 ± 0.04

  20. Recommendation on changing interfaces of W-058 and W-236A

    International Nuclear Information System (INIS)

    This position paper recommends changes to improve the interface between the Cross-Site Transfer System (Project W-058) and the Multi-Function Waste Tank Facility (Project W-236A) to handle planned waste retrieval and storage operations. Appendix A includes cost estimates and schedule impacts for each project. The cost estimates, schedule impacts, and this position paper will be the basis for writing a change request to formally implement these changes on Project W-236A and Project W-058/W-028. Recommendations are made on pipeline rerouting, pump and configuration, and flushing configuration

  1. Chronology of Pu isotopes and {sup 236}U in an Arctic ice core

    Energy Technology Data Exchange (ETDEWEB)

    Wendel, C.C., E-mail: [Isotope Laboratory, Department of Plant and Environmental Sciences, Agricultural University of Norway, P.O. Box 5003, N-1432 Aas (Norway); Oughton, D.H., E-mail: [Isotope Laboratory, Department of Plant and Environmental Sciences, Agricultural University of Norway, P.O. Box 5003, N-1432 Aas (Norway); Lind, O.C., E-mail: [Isotope Laboratory, Department of Plant and Environmental Sciences, Agricultural University of Norway, P.O. Box 5003, N-1432 Aas (Norway); Skipperud, L., E-mail: [Isotope Laboratory, Department of Plant and Environmental Sciences, Agricultural University of Norway, P.O. Box 5003, N-1432 Aas (Norway); Fifield, L.K., E-mail: [Department of Nuclear Physics, Australian National University, Canberra ACT 0200 (Australia); Isaksson, E., E-mail: [Norwegian Polar Institute, Fram Centre, Hjalmar Johansens Gate 14, N9296 Tromsø (Norway); Tims, S.G., E-mail: [Department of Nuclear Physics, Australian National University, Canberra ACT 0200 (Australia); Salbu, B., E-mail: [Isotope Laboratory, Department of Plant and Environmental Sciences, Agricultural University of Norway, P.O. Box 5003, N-1432 Aas (Norway)


    In the present work, state of the art isotopic fingerprinting techniques are applied to an Arctic ice core in order to quantify deposition of U and Pu, and to identify possible tropospheric transport of debris from former Soviet Union test sites Semipalatinsk (Central Asia) and Novaya Zemlya (Arctic Ocean). An ice core chronology of {sup 236}U, {sup 239}Pu, and {sup 240}Pu concentrations, and atom ratios, measured by accelerator mass spectrometry in a 28.6 m deep ice core from the Austfonna glacier at Nordaustlandet, Svalbard is presented. The ice core chronology corresponds to the period 1949 to 1999. The main sources of Pu and {sup 236}U contamination in the Arctic were the atmospheric nuclear detonations in the period 1945 to 1980, as global fallout, and tropospheric fallout from the former Soviet Union test sites Novaya Zemlya and Semipalatinsk. Activity concentrations of {sup 239+240}Pu ranged from 0.008 to 0.254 mBq cm{sup −2} and {sup 236}U from 0.0039 to 0.053 μBq cm{sup −2}. Concentrations varied in concordance with {sup 137}Cs concentrations in the same ice core. In contrast to previous published results, the concentrations of Pu and {sup 236}U were found to be higher at depths corresponding to the pre-moratorium period (1949 to 1959) than to the post-moratorium period (1961 and 1962). The {sup 240}Pu/{sup 239}Pu ratio ranged from 0.15 to 0.19, and {sup 236}U/{sup 239}Pu ranged from 0.18 to 1.4. The Pu atom ratios ranged within the limits of global fallout in the most intensive period of nuclear atmospheric testing (1952 to 1962). To the best knowledge of the authors the present work is the first publication on biogeochemical cycles with respect to {sup 236}U concentrations and {sup 236}U/{sup 239}Pu atom ratios in the Arctic and in ice cores. - Highlights: • Concentrations and atom ratios of Pu and {sup 236}U determined in an Arctic ice core. • Concentrations of U and Pu found to be higher pre- than post-moratorium. • U and Pu concentrations

  2. Design of a homogeneous subcritical nuclear reactor based on thorium with a source of californium 252; Diseno de un reactor nuclear subcritico homogeneo a base de Torio con una fuente de Californio 252

    Energy Technology Data Exchange (ETDEWEB)

    Delgado H, C. E.; Vega C, H. R. [Universidad Autonoma de Zacatecas, Unidad Academica de Estudios Nucleares, Cipres No. 10, Fracc. La Penuela, 98068 Zacatecas, Zac. (Mexico); Sajo B, L., E-mail: [Universidad Simon Bolivar, Laboratorio de Fisica Nuclear, Apdo. 89000, 1080A Caracas (Venezuela, Bolivarian Republic of)


    Full text: One of the energy alternatives to fossil fuels which do not produce greenhouse gases is the nuclear energy. One of the drawbacks of this alternative is the generation of radioactive wastes of long half-life and its relation to the generation of nuclear materials to produce weapons of mass destruction. An option to these drawbacks of nuclear energy is to use Thorium as part of the nuclear fuel which it becomes in U{sup 233} when capturing neutrons, that is a fissile material. In this paper Monte Carlo methods were used to design a homogeneous subcritical reactor based on thorium. As neutron reflector graphite was used. The reactor core is homogeneous and is formed of 70% light water as moderator, 12% of enriched uranium UO{sub 2}(NO{sub 3}){sub 4} and 18% of thorium Th(NO{sub 3}){sub 4} as fuel. To start the nuclear fission chain reaction an isotopic source of californium 252 was used with an intensity of 4.6 x 10{sup 7} s{sup -1}. In the design the value of the effective multiplication factor, whose value turned out k{sub eff} <1 was calculated. Also, the neutron spectra at different distances from the source and the total fluence were calculated, as well as the values of the ambient dose equivalent in the periphery of the reactor. (Author)

  3. Manganese determination om minerals by activation analysis, using the californium-252 as a neutron source; Determinacao de manganes em minerios, por analise por ativacao, usando californio-252 como fonte de neutrons

    Energy Technology Data Exchange (ETDEWEB)

    Cardoso, Antonio


    Neutron Activation Analysis, using a Californium-252 neutron source, has been applied for the determination of manganese in ores such as pyrolusite, rodonite (manganese silicate)' and blending used in dry-batteries The favorable nuclear properties of manganese, such as high thermal neutron cross-section for the reaction {sup 55}Mn (n.gamma){sup 56} Mn, high concentration of manganese in the matrix and short half - life of {sup 56}Mn, are an ideal combination for non-destructive analysis of manganese in ores. Samples and standards of manganese dioxide were irradiated for about 20 minutes, followed by a 4 to 15 minutes decay and counted in a single channel pulse-height discrimination using a NaI(Tl) scintillation detector. Counting time was equal to 10 minutes. The interference of nuclear reactions {sup 56}Fe(n,p){sup 56}Mn and {sup 59} Co (n, {alpha}){sup 56} were studied, as well as problems in connection with neutron shadowing during irradiation, gamma-rays attenuation during counting and influence of granulometry of samples. One sample,was also analysed by wet-chemical method (sodium bismuthate) in order to compare results. As a whole, i t was shown that the analytical method of neutron activation for manganese in ores and blending, is a method simple, rapid and with good precision and accuracy. (author)


    The report gives results of miscibility, solubility, viscosity, and density measurements for refrigerant R-236fa and two potential lubricants . (The data are needed to determine the suitability of refrigerant/lubricant combinations for use in refrigeration systems.) The tested oi...

  5. 49 CFR 236.5 - Design of control circuits on closed circuit principle. (United States)


    ... 49 Transportation 4 2010-10-01 2010-10-01 false Design of control circuits on closed circuit..., AND APPLIANCES Rules and Instructions: All Systems General § 236.5 Design of control circuits on closed circuit principle. All control circuits the functioning of which affects safety of train...

  6. 10 CFR 72.236 - Specific requirements for spent fuel storage cask approval and fabrication. (United States)


    ... 10 Energy 2 2010-01-01 2010-01-01 false Specific requirements for spent fuel storage cask approval... REQUIREMENTS FOR THE INDEPENDENT STORAGE OF SPENT NUCLEAR FUEL, HIGH-LEVEL RADIOACTIVE WASTE, AND REACTOR-RELATED GREATER THAN CLASS C WASTE Approval of Spent Fuel Storage Casks § 72.236 Specific requirements...

  7. CMS Control Room during early morning collisions at 2.36 TeV.

    CERN Multimedia

    Richard Breedon (CMS)


    CMS recorded around 15000 collisions at 2.36 TeV with the whole detector operational, including the inner silicon systems (strips and pixels). A relatively quiet control room was still witness to excitement during the first online event displays of the collisions.

  8. 49 CFR 236.1017 - Independent third party verification and validation. (United States)


    ... that consideration of the methodology used in the risk assessment (§ 236.913(g)(2)(vii)) shall apply only to the extent that a comparative risk assessment was required. To the extent practicable, FRA... system supplier and vendor. An entity that is owned or controlled by the supplier or vendor, that...

  9. 49 CFR 236.327 - Switch, movable-point frog or split-point derail. (United States)


    ... 49 Transportation 4 2010-10-01 2010-10-01 false Switch, movable-point frog or split-point derail..., AND APPLIANCES Interlocking Rules and Instructions § 236.327 Switch, movable-point frog or split-point derail. Switch, movable-point frog, or split-point derail equipped with lock rod shall be maintained...

  10. 49 CFR 236.206 - Battery or power supply with respect to relay; location. (United States)


    ... 49 Transportation 4 2010-10-01 2010-10-01 false Battery or power supply with respect to relay..., AND APPLIANCES Automatic Block Signal Systems Standards § 236.206 Battery or power supply with respect to relay; location. The battery or power supply for each signal control relay circuit, where an...

  11. 8 CFR 236.18 - Termination of Family Unity Program benefits. (United States)


    ... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Termination of Family Unity Program... REMOVED Family Unity Program § 236.18 Termination of Family Unity Program benefits. (a) Grounds for termination. The Service may terminate benefits under the Family Unity Program whenever the necessity for...

  12. 49 CFR 236.1005 - Requirements for Positive Train Control systems. (United States)


    ... of the receiving train; (iv) Any movable bridge within the route ahead is not in a position to allow permissive indication for a train movement pursuant to § 236.312; and (v) A hazard detector integrated into... falling rock or undermining of the track structure due to high water or displacement of a bridge...


    The report gives results of an evaluation of the heat transfer performance of pure hydrofluorocarbon (HFC)-236ea for high performance enhanced tubes which had not been previously used in Navy shipboard chillers. Shell-side heat transfer coefficient data are presented for condensa...


    The report gives results of a heat transfer evaluation of the refrigerants hexafluoropropane (HFC-236ea) and 1,1,2,2-dichloro-tetrafluoroethane (CFC-114). (NOTE: With the mandatory phase-out of chlorofluorocarbons (CFCs), as dictated by the Montreal Protocol and Clean Air Act Ame...


    The report gives results of an evaluation of the shell-side heat transfer performance of hydrofluorocarbon (HFC)-236fa, which is considered to be a potential substitute for chlorofluorocarbon (CFC)-114 in Navy shipboard chillers, for both conventional finned [1024- and 1575-fpm (...

  16. 49 CFR 236.314 - Electric lock for hand-operated switch or derail. (United States)


    ... 49 Transportation 4 2010-10-01 2010-10-01 false Electric lock for hand-operated switch or derail..., AND APPLIANCES Interlocking Standards § 236.314 Electric lock for hand-operated switch or derail. Electric lock shall be provided for each hand-operated switch or derail within interlocking limits,...

  17. 49 CFR 236.207 - Electric lock on hand-operated switch; control. (United States)


    ... 49 Transportation 4 2010-10-01 2010-10-01 false Electric lock on hand-operated switch; control..., AND APPLIANCES Automatic Block Signal Systems Standards § 236.207 Electric lock on hand-operated switch; control. Electric lock on hand-operated switch shall be controlled so that it cannot be...

  18. Interaction of the HII region S236 with the surrounding medium

    International Nuclear Information System (INIS)

    The HII region S236 has been observed in the continuum at 50 cm wavelength and in the recombination line H166α at 10 selected positions. A mean electron temperature of 7600 K is derived for the nebula and the measured velocity pattern is explained qualitatively in terms of a gas flow from the molecular cloud. (Auth.)

  19. A year-by-year record of 236-U/238-U in coral as a step towards establishing 236-U from nuclear weapons testing fall-out as oceanic tracer

    International Nuclear Information System (INIS)

    Since uranium is known to behave conservatively in ocean waters, 236-U has great potential in application as oceanic tracer. 236-U (t1/2=23.4 Ma) was introduced into the oceans by atmospheric nuclear weapon testing with amount estimates ranging from 700 kg to 1500 kg. Thus a resulting initial average 236-U/238-U ratio of at least 5e-9 is expected for an oceanic mixed layer depth of 100 m. This ratio is already higher than the natural pre-nuclear background, which is expected to be at 10e-14 levels. Even the elevated ratios of global stratospheric fall-out are beyond the capabilities of ICPMS and TIMS methods. However, the exceptional sensitivity and ultra-low background for 236-U of the Vienna Environmental Research Accelerator's Accelerator Mass Spectrometry system allows us to measure down to 10-13 detection limits. We present a year-by-year record of 236-U/238-U for a Caribbean coral core covering years 1944 to 2006, thus allowing to us put constraints on the oceanic input of 236-U by atmospheric testing. Moreover modeling of the results also demonstrates the capabilities of 236-U as oceanic tracer.

  20. C-2-Aryl O-substituted HI-236 derivatives as non-nucleoside HIV-1 reverse-transcriptase inhibitors


    Hunter, Roger; Younis, Yassir; Muhanji, Clare I; Curtin, Tanith-lea; Naidoo, Kevin J.; Petersen, Melissa; Bailey, Christopher M.; Basavapathruni, Aravind; Anderson, Karen S.


    Several novel thiourea derivatives of the NNRTI HI-236 substituted at the C-2 oxygen of the phenyl ring have been synthesized and evaluated for their inhibitory activity against HIV-1 (IIIB) replication in MT-2 cell cultures. The compounds were synthesized in order to fine-tune the activity of HI-236 as well as to gain insight into spatial characteristics in the pocket pertaining to the positional choice of tether in the design of [NRTI]-tether-[HI-236] bifunctional inhibitors. Two of the thi...

  1. Depth profile of 236U/238U in soil samples in La Palma, Canary Islands


    Srncik, M.; P. Steier; Wallner, G.


    The vertical distribution of the 236U/238U isotopic ratio was investigated in soil samples from three different locations on La Palma (one of the seven Canary Islands, Spain). Additionally the 240Pu/239Pu atomic ratio, as it is a well establish tool for the source identification, was determined. The radiochemical procedure consisted of a U separation step by extraction chromatography using UTEVA® Resin (Eichrom Technologies, Inc.). Afterwards Pu was separated from Th and Np by anion exchange ...

  2. The SOFIA experiment: Measurement of 236U fission fragment yields in inverse kinematics

    Directory of Open Access Journals (Sweden)

    Grente L.


    Full Text Available The SOFIA (Studies On FIssion with Aladin experiment aims at measuring fission-fragments isotopic yields with high accuracy using inverse kinematics at relativistic energies. This experimental technique allows to fully identify the fission fragments in nuclear charge and mass number, thus providing very accurate isotopic yields for low energy fission of a large variety of fissioning systems. This report focuses on the latest results obtained with this set-up concerning electromagnetic-induced fission of 236U.

  3. Draft Genome Sequence of Pseudomonas simiae Strain 2-36, an In Vitro Antagonist of Rhizoctonia solani and Gaeumannomyces graminis


    Adam, Zaky; Chen, Qing; Xu, Renlin; Diange, Adolf E.; Bromfield, Eden S. P.; Tambong, James Tabi


    Pseudomonas simiae 2-36, isolated from a field plot under long-term mineral fertilization, exhibited strong in vitro antagonistic activities against Rhizoctonia solani and Gaeumannomyces graminis. We report here the draft genome sequence of Pseudomonas simiae 2-36, consisting of 6.4 Mbp with a 60.25% G+C content and 5,790 predicted protein-coding sequences.

  4. 小儿热性惊厥236例临床分析%Clinical Analysis of 236 Cases With Febrile Convulsion

    Institute of Scientific and Technical Information of China (English)

    薛慧敏; 卢宪梅; 李文


    目的 探讨小儿热性惊厥(febrile convulsion,FC)的临床特点,为该病的防治提供依据.方法 回顾性分析2006年1月至2008年2月山东省济南市第三人民医院收治的236例小儿热性惊厥患儿的临床资料.结果 本组236例热性惊厥患儿经治疗后,未再次出现惊厥症状,其中86例惊厥难以完全控制患儿,给予地西泮+苯巴比妥钠联合治疗,疗效满意.患儿平均住院时间为5 d.出院后随访1年,复发为45例,其中复发1次为32例,2次以上为13例,共6例(2.5%)确诊为癫痫.结论 小儿热性惊厥的发作与高热密切相关,感染性疾病为主要基础疾病.对该病进行积极的综合治疗,预后一般较好.对于极少数有发展为癫痫的高危热性惊厥患儿,可采取适当干预措施,但不能随意对其长期预防性使用抗癫痫药物.

  5. Anthropogenic 236U at Rocky Flats, Ashtabula river harbor, and Mersey estuary: three case studies by sector inductively coupled plasma mass spectrometry

    International Nuclear Information System (INIS)

    236U (t1/2=2.3x107 y) is formed as a result of thermal neutron capture by 235U. In naturally occurring U ores, where a high neutron flux is present from spontaneous fission of 238U, 236U/238U atom ratios are ∼10-4 ppm. In the natural Earth's crust, unaffected by nuclear fallout, these ratios are expected to be on the order of 10-8 ppm. Reactor-irradiated U, however, exhibits high 236U/238U atom ratios approaching 104 ppm. As a result, the presence of very small quantities of reactor-irradiated U will significantly enhance the 'background' 236U/238U atom ratio. When sufficiently elevated 236U/238U ratios are present, the determination of 236U/238U by rapid inductively coupled plasma mass spectrometric (ICPMS) methods is attractive. We have used sector ICPMS at medium resolving power (R=3440) to measure 236U/238U atom ratios with a determination limit of 0.2 ppm. The limiting factors in the measurement are the 235U1H+ isobar and background signal at m/z 236 arising from the 238U+ peak tail. Based upon the analysis of replicates and considerations of possible systematic errors, uncertainties of ±5% are found for 236U/238U atom ratios of 1-100 ppm. This procedure has been demonstrated in studies of anthropogenic 236U in the environment at three locations: (a) offsite soils from the vicinity of the Rocky Flats Environmental Technology site (Golden, Colorado, USA); (b) sediments from the Ashtabula River (Ohio, USA); and (c) sediments from the Mersey estuary (Liverpool, UK). In each of these three locations, definite plumes of elevated 236U/238U are identified and characterized. Maximum 236U/238U atom ratios observed in RFETS-vicinity soils, the Ashtabula River, and the Mersey Estuary are 2.8, 140, and 4.4 ppm, respectively

  6. Fueling the central engine of radio galaxies. II. The footprints of AGN feedback on the ISM of 3C 236

    CERN Document Server

    Labiano, A; Combes, F; Usero, A; Soria-Ruiz, R; Tremblay, G; Neri, R; Fuente, A; Morganti, R; Oosterloo, T


    Aims: We study the emission of molecular gas in 3C236, a FR II radio source at z~0.1, and search for the footprints of AGN feedback. 3C236 shows signs of a reactivation of its AGN triggered by a recent minor merger episode. Observations have also previously identified an extreme HI outflow in this source. Methods: The IRAM PdBI has been used to study the distribution and kinematics of molecular gas in 3C236 by imaging with high spatial resolution the emission of the 12CO(2-1) line in the nucleus of the galaxy. We have searched for outflow signatures in the CO map. We have also derived the SFR in 3C236 using data available from the literature at UV, optical and IR wavelengths, to determine the star-formation efficiency of molecular gas. Results: The CO emission in 3C236 comes from a spatially resolved 2.6 kpc disk with a regular rotating pattern. Within the limits imposed by the sensitivity and velocity coverage of the CO data, we do not detect any outflow signatures in the cold molecular gas. The disk has a c...

  7. AMS measurements of global fallout U-236 and Pu in an ombrotrophic peat profile: evidence for their post depositional migration

    International Nuclear Information System (INIS)

    U-236, Pu-239, Pu-240, Pu-241 and Pu-242 were analysed in an ombrotrophic peat core representing the last 80 years of atmospheric deposition. The determination of these isotopes at femtogram and attogram levels was possible by using ultra-clean laboratory procedures and accelerator mass spectrometry. Since the Pu isotopic composition characteristic for global fallout, as well as anthropogenic U-236, were identified in peat samples pre-dating the period of atmospheric atom bomb testing, migration of Pu and U within the peat profile is clearly indicated. The vertical profile of the U-236/U-238 isotopic ratio represents the first observation of the U-236 bomb peak in a terrestrial environment. Comparing the abundances of the global fallout derived U-236 and Pu-239 along the peat core, the post depositional migration of plutonium exceeds that of uranium. These results highlight, for the first time, the mobility of Pu and U in a peat bog with implications for their migration in other acidic, organic rich environments.

  8. AMS measurements of global fallout U-236 and Pu in an ombrotrophic peat profile: evidence for their post depositional migration

    Energy Technology Data Exchange (ETDEWEB)

    Quinto, Francesca; Hrnecek, Erich; Krachler, Michael [European Commission Joint Research Centre, Institute for Transuranium Elements, P.O. Box 2340, 76125 Karlsruhe (Germany); Shotyk, William [Department of Renewable Resources, University of Alberta, 839 General Services Building, Edmonton, AB (Canada); Steier, Peter; Winkler, Stephan; Golser, Robin [VERA Laboratory, Faculty of Physics, University of Vienna, Waehringer Strasse 17, A-1090 Vienna (Austria)


    U-236, Pu-239, Pu-240, Pu-241 and Pu-242 were analysed in an ombrotrophic peat core representing the last 80 years of atmospheric deposition. The determination of these isotopes at femtogram and attogram levels was possible by using ultra-clean laboratory procedures and accelerator mass spectrometry. Since the Pu isotopic composition characteristic for global fallout, as well as anthropogenic U-236, were identified in peat samples pre-dating the period of atmospheric atom bomb testing, migration of Pu and U within the peat profile is clearly indicated. The vertical profile of the U-236/U-238 isotopic ratio represents the first observation of the U-236 bomb peak in a terrestrial environment. Comparing the abundances of the global fallout derived U-236 and Pu-239 along the peat core, the post depositional migration of plutonium exceeds that of uranium. These results highlight, for the first time, the mobility of Pu and U in a peat bog with implications for their migration in other acidic, organic rich environments.

  9. Measurement of 236U on the 1 MV AMS system at the Centro Nacional de Aceleradores (CNA)

    International Nuclear Information System (INIS)

    In this paper we present the first comprehensive analysis of the 1 MV AMS system at the Centro Nacional de Aceleradores (CNA, Seville, Spain) for 236U studies in environmental samples. In the last years, this radionuclide has become key in the AMS community, due to the very demanding 236U/238U abundance sensitivities required for general applications. As we demonstrate, the AMS system at the CNA is able to achieve sensitivity for the 236U/238U ratio of about 3 × 10−11 despite its compact design. The use of “239Pu”/238U ratio as a proxy for “236U”/235U background correction is proposed and tested with natural samples that were also studied on the 600 kV Tandy AMS system at the ETH Zürich. This correction is significant in the CNA case, due to the low mass resolving power of the low-energy spectrometer and to the lack of a third filter on the high-energy side. With the measurement of reference solutions supplied by the Institute for Reference Materials and Methods (IRMM-075), and reference natural matrixes provided by the International Atomic Energy Agency (IAEA-Soil-6, IAEA-375; 384; 386 and IAEA-RGU), we show that the 1 MV AMS system at the CNA can be routinely used for determinations of anthropogenic 236U at environmental levels

  10. Measurement of {sup 236}U on the 1 MV AMS system at the Centro Nacional de Aceleradores (CNA)

    Energy Technology Data Exchange (ETDEWEB)

    Chamizo, E. [Centro Nacional de Aceleradores (Universidad de Sevilla, Consejo Superior de Investigaciones Científicas, Junta de Andalucía), Thomas Alva Edison 7, 41092 Seville (Spain); Christl, M. [Laboratory of Ion Beam Physics, ETH Zurich, Otto Stern Weg 5, CH-8093 Zurich (Switzerland); Fifield, L.K. [Department of Nuclear Physics, Research School of Physics and Engineering, The Australian National University, ACT 2601 (Australia)


    In this paper we present the first comprehensive analysis of the 1 MV AMS system at the Centro Nacional de Aceleradores (CNA, Seville, Spain) for {sup 236}U studies in environmental samples. In the last years, this radionuclide has become key in the AMS community, due to the very demanding {sup 236}U/{sup 238}U abundance sensitivities required for general applications. As we demonstrate, the AMS system at the CNA is able to achieve sensitivity for the {sup 236}U/{sup 238}U ratio of about 3 × 10{sup −11} despite its compact design. The use of “{sup 239}Pu”/{sup 238}U ratio as a proxy for “{sup 236}U”/{sup 235}U background correction is proposed and tested with natural samples that were also studied on the 600 kV Tandy AMS system at the ETH Zürich. This correction is significant in the CNA case, due to the low mass resolving power of the low-energy spectrometer and to the lack of a third filter on the high-energy side. With the measurement of reference solutions supplied by the Institute for Reference Materials and Methods (IRMM-075), and reference natural matrixes provided by the International Atomic Energy Agency (IAEA-Soil-6, IAEA-375; 384; 386 and IAEA-RGU), we show that the 1 MV AMS system at the CNA can be routinely used for determinations of anthropogenic {sup 236}U at environmental levels.

  11. Detection of UH3+ and ThH3+ molecules and 236U background studies with low-energy AMS

    International Nuclear Information System (INIS)

    The performance of the TANDY AMS facility (0.6 MV) at ETH Zurich has been significantly improved for actinides with the installation of an additional 130° magnet on the high-energy side. The background originating from neighboring masses is reduced by three orders of magnitude in the new setup, leading to an abundance sensitivity of 10−10. This now allows 236U/238U measurements down to the 10−12 level. Systematic studies of the possible background for 236U3+ at the compact TANDY system show that actinide–hydride molecules in charge state 3+ do exist. (232Th1H)3+, (235U1H)3+ and (238U1H)3+ can cause a severe background at masses 233, 236, and 239, respectively. The existence of the (232Th1H)3+ molecule was verified unambiguously by analyzing its breakup. The actinide–hydride molecules can be destroyed efficiently using higher stripper pressures. At an ion energy of 1.2 MeV an overall efficiency of more than 10−4 can be achieved using a gas ionization detector. The high efficiency in combination with the low background opens the spectrum of possible applications to both anthropogenic (236U/238U = 10−7 to 10−9) and natural samples (236U/238U −10).

  12. Charge transfer inefficiency in the pre- and post-irradiated Swept Charge Device CCD236

    International Nuclear Information System (INIS)

    This paper describes the mapping of spectral response of an e2v technologies Swept Charge Device (SCD) CCD236 pre and post irradiation with a 10 MeV equivalent proton fluence of 5.0 × 108 protons cm−2. The CCD236 is a large area (4.4 cm2) X-ray detector which will be used in India's Chandrayaan-2 Large Soft X-ray Spectrometer (CLASS) and China's Hard X-ray Modulation Telescope (HXMT). To enable the suppression of surface dark current, clocking is performed continuously resulting in a linear readout. As such the flat field illumination used to measure any change in spectral response over a conventional Charge-Coupled Devices (CCDs) is not possible. An alternative masking technique has been used to expose pinpoint regions of the device to Mn-Kα and Mn-Kβ X-rays, enabling a local map of spectral response to be built up over the device. This novel approach allows for an estimation of the Charge Transfer Inefficiency (CTI) of the device to be made by allowing the creation of a CTI scatter plot similar to that typically observed in conventional CCDs

  13. Evaluation of the US Army DT-236 battlefield personnel dosimetry system

    International Nuclear Information System (INIS)

    Performance characteristics of the US Army DT-236 battlefield personnel dosimetry system were evaluated using the Health Physics Research Reactor at Oak Ridge National Laboratory. The DT-236 dosimeter is designed to measure total (neutron plus gamma) radiation dose using a radiophotoluminescent (RPL) detector for gamma rays and a silicon diode for fast neutrons. Areas considered in this evaluation included preirradiation dose indication; accuracy and precision of total, gamma, and neutron dose measurements; fading; angular response; temperature dependence; and relative dosimeter response in air and on various body locations. Experimental results for a variety of radiation fields and dose levels indicate that the existing system overestimates total, neutron, and gamma radiation doses in air by about 20 to 60% relative to reference values. Associated measurement precisions were about +-5% of the means for doses above approximately 0.5 Gy. Fading characteristics, angular dependence, and temperature dependence of the RPL and diode systems were consistent with results expected based on detector characteristics and previous performance studies. Recommendations to improve existing reader performance and measurement accuracy are also presented

  14. In-beam spectroscopy of the Kπ = 0- bands in 230-236U

    International Nuclear Information System (INIS)

    The Kπ = 0- bands in even uranium nuclei were studied in the compound reactions 231Pa(p,2n)230U, 230,232Th(α,2n)232,234U and 236U(d,pn)236U. In-beam γ-rays were measured in coincidence with conversion-electrons, which were detected with an iron-free orange spectrometer. The negative-parity levels are observed up to intermediate spins (I-). In addition, the 1- and 3- levels in 230U were confirmed by a decay study with an isotope separated 230Pa source. For the heavier isotopes (A > or approx. 232) the properties of the Kπ = 0- bands (energies and γ-branchings) are consistent with a vibrational character of these bands. For 230U the Kπ = 0- band lies at rather low energy (E(1-) = 367 keV), and the level spacings within this band are very similar to those of the isotones 228Th and 226Ra, which might indicate the onset of a stable octupole deformation. (orig.)

  15. Position paper: Live load design criteria for Project W-236A Multi-Function Waste Tank Facility

    International Nuclear Information System (INIS)

    The purpose of this paper is to discuss the live loads applied to the underground storage tanks of the Multi Function Waste Tank Facility, and to provide the basis for Project W-236A live load criteria. Project 236A provides encompasses building a Weather Enclosure over the two underground storage tanks at the 200-West area. According to the Material Handling Study, the Groves AT 1100 crane used within the Weather Enclosure will have a gross vehicle weight of 66.5 tons. Therefore, a 100-ton concentrated live load is being used for the planning of the construction of the Weather Enclosure

  16. The regulatory effect of SC-236 (4-[5-(4-chlorophenyl)-3-(trifluoromethyl)-1-pyrazol-1-l] benzenesulfonamide) on stem cell factor induced migration of mast cells

    International Nuclear Information System (INIS)

    SC-236 (4-[5-(4-chlorophenyl)-3-(trifluoromethyl)-1-pyrazol-1-]benzenesulfonamide; C16H11ClF3N3O2S), is a highly selective cyclooxygenase (COX)-2 inhibitor. Recently, there have been reports that SC-236 protects against cartilage damage in addition to reducing inflammation and pain in osteoarthritis. However, the mechanism involved in the inflammatory allergic reaction has not been examined. Mast cells accumulation can be related to inflammatory conditions, including allergic rhinitis, asthma, and rheumatoid arthritis. The aim of the present study is to investigate the effects of SC-236 on stem cell factor (SCF)-induced migration, morphological alteration, and cytokine production of rat peritoneal mast cells (RPMCs). We observed that SCF significantly induced the migration and morphological alteration. The ability of SCF to enhance migration and morphological alteration was abolished by treatment with SC-236. In addition, production of tumor necrosis factor (TNF)-α, interleukin (IL)-1β, and vascular endothelial growth factor (VEGF) production induced by SCF was significantly inhibited by treatment with SC-236. Previous work has demonstrated that SCF-induced migration and cytokine production of mast cells require p38 MAPK activation. We also showed that SC-236 suppresses the SCF-induced p38 MAPK activation in RPMCs. These data suggest that SC-236 inhibits migration and cytokine production through suppression of p38 MAPK activation. These results provided new insight into the pharmacological actions of SC-236 and its potential therapeutic role in the treatment of inflammatory allergic diseases


    Institute of Scientific and Technical Information of China (English)

    张博; 左计学; 钟福春; 吕金升


    With analysis on the solar ejector cooling system and comparison with the common refrigerants, a new refrigerant of R236fa to the solar ejector cooling system was suggested. The operation of the ejector cooling system was simulated with a mathematical model. In order to verify the theoretical simulation, an experimental study of the system using refrigerant R236fa, R141b and R123 was carried out with the evaporator temperature (5-10℃) , condenser temperature (30-36℃) and generator temperature (82-94℃). It was found that the optimum COP ( =0.413) of the ejector cooling system, the optimum COPsc ( =0.243) and cooling capacity ( =11.90kW) of the overall solar ejector cooling system could be obtained in the system using refrigerant R236fa.%对太阳能喷射制冷系统进行理论分析,并通过与常用工质的比较,提出以R236fa作为太阳能喷射制冷系统的制冷剂.建立计算模型,模拟以R236fa作为制冷剂太阳能喷射制冷系统的运行性能.结合理论分析,蒸发温度在5 ~ 10℃,冷凝温度在30~36℃,发生温度在82 ~ 94℃之间变化时,分别对以R236fa、R141b和R123为制冷剂的太阳能喷射制冷系统进行实验研究.结果表明,典型空调工况条件下,R236fa作为制冷剂的喷射制冷系统COP为0.413;太阳能喷射制冷系统的性能系数COPsc可达0.243,系统的制冷量为11.90kW.


    The paper gives results of tests of both HFC-236ea and CFC-114 at a range of temperatures covering surface craft and submarine chiller conditions. vaporating temperatures ranged from 1.7 to 12.8 C, and condensing temperatures from 40.6 to 65.6 C, in order to develop a nine-point ...

  19. 49 CFR 236.1020 - Exclusion of track segments for implementation due to cessation of PIH materials service or... (United States)


    ... procedures and using the same methodology as required for safety and security route analysis under 49 CFR 172... OF SIGNAL AND TRAIN CONTROL SYSTEMS, DEVICES, AND APPLIANCES Positive Train Control Systems § 236... railroad shall also establish that the remaining risk arising from rail operations on the track...

  20. 49 CFR 236.1013 - PTC Development Plan and Notice of Product Intent content requirements and Type Approval. (United States)


    ... 49 Transportation 4 2010-10-01 2010-10-01 false PTC Development Plan and Notice of Product Intent... TRAIN CONTROL SYSTEMS, DEVICES, AND APPLIANCES Positive Train Control Systems § 236.1013 PTC Development Plan and Notice of Product Intent content requirements and Type Approval. (a) For a PTC system...

  1. Evaluation of neutron-induced reactions on 236Pu for JENDL-3.3

    International Nuclear Information System (INIS)

    Cross sections and energy-angular distributions of emitted neutrons were evaluated for the neuron-incident reactions on 236Pu in the incident energy range of 10 eV to 20 MeV by using a statistical model combined with a coupled channel optical model. The calculated results were compiled to the latest evaluated nuclear data library JENDL-3.3 in the ENDF-6 format. The unresolved resonance region is assumed to be from 10 eV to 30 keV, and the averaged resonance parameters were obtained to reproduce the calculated cross sections. Maxwell temperature for fission neutron spectra were estimated from a systematics with a correction for prefission neutrons. (author)

  2. Determination of 236Np(n,f) cross-section using surrogate ratio method

    International Nuclear Information System (INIS)

    Surrogate strategy is widely used to determine (n,f) cross-sections. Hybrid ratio approach is used to get 236Np(n,f) cross-section for which there is no experimental data available beyond 7 MeV till date. 237Np and 239Pu are produced over the similar excitation energy range (20.4-25.4 MeV) using 235U(6Li,α)237Np and 235U(6Li,d)239Pu reactions respectively. The ground state Q values for these two reactions are 7.707 MeV and - 6.718 respectively. Hence 237Np and 239Pu can be populated at overlapping excitation energies in 6Li + 235U transfer reactions for bombarding energies around 44.4 MeV. Fission probabilities of these two compound nuclei are measured and the desired cross-sections are determined using the following formula based on Weisskopf-Ewing approximation. Measurements were carried out using 44.4 MeV 6Li beam (from BARC-TIFR Pelletron) and 1.6 mg/cm2 thick 235U target (with 4.5 mg/cm2 thick Ni-Cu backing). Four telescopes (ΔE-E) made of silicon surface barrier detectors, used to detect light charged particles, were kept 100 apart covering 700-1000. A large area silicon detector (with a solid angle ∼ 33 msr and an angular coverage of 1540- 1660) was used to detect fission fragments. Two monitor detectors were placed at forward angles. Results for 236Np(n,f) cross sections using the yields from the forward most telescope are shown. Contributions from Ni-Cu backing in inclusive counts have been subtracted out. The experimental results are consistent with the EMPIRE3.1 calculations

  3. Kalorimetrische Tieftemperaturdetektoren für niederenergetische (E 1 MeV/amu) Schwerionen und ihr erster Einsatz in der Beschleuniger-Massenspektrometrie zur Spurenanalyse von 236 U


    Kraft-Bermuth, Saskia


    Im Rahmen der vorliegenden Arbeit wurden zum ersten Mal kalorimetrische Tieftemperatur-Detektoren in der Beschleuniger-Massenspektrometrie (Accelerator Mass Spectrometry AMS), einer Standard-Methode zur Bestimmung kleinster Isotopenverhältnisse, eingesetzt, um das Isotopenverhältnis von 236U zu 238U zu bestimmen. Das Uran-Isotop 236U entsteht in der Neutroneneinfang-Reaktion 235U(n,gamma)236U und kann daher als Monitor-Nuklid für Neutronenflüsse verwendet werden. Die Detektoren bestehen a...

  4. Angular distribution of fission fragments from 236U(d,pf)

    International Nuclear Information System (INIS)

    Complete text of publication follows. 236U is the only isotope in the actinide region in which transmission fission resonances observed and at the same time a superdeformed fission isomer is well-established. We have been investigating these transmission resonances for several years. The aim of our latest experiment was to measure the angular distribution of the fission fragments in order to determine the spin and K-values of the resonances and to improve the statistics compared to the previous experiment. An experiment was performed to study the fission resonances of 236U at the Munich Tandem Laboratory using 235U(d,p) reaction at 13 MeV. A 235U2O3 target was used with a thickness of 90 μg/cm2. The outgoing proton energy was determined by a Q3D magnetic spectrometer at an angle 139.4 deg. An energy resolution of ΔE = 5keV was achieved. Fission fragments were detected by two position sensitive avalanche detectors (PSAD) consisting of two wire planes corresponding to horizontal and vertical directions. Thus, the spatial positions of the fragments and their angular correlation with respect to the recoil axis could be determined. High resolution measurement of the angular distribution allowed us to determine the spin and K-values of the observed resonances individually. The angular correlation was parametrized with coefficients a2 and a4 of even Legendre polynomials. Fig. 1b) shows the a2 coefficient belonging to the different resonances. The a2 values are agree with the values of Ref. [4], which were used to determine the K-values in the data analysis of the previous experiment. The most interesting energy region is around 5.1 MeV, where hyperdeformed resonances were identified recently in contrast to the superdeformed interpretation published so far. The high-resolution excitation energy spectrum, which was deduced from the proton kinetic energy is shown in Fig. 1a). A combined analysis of the energy spectrum and the angular distribution confirms that the

  5. Fission Fragment Angular Distributions in the $^{234}$U(n,f) and $^{236}$U(n,f) reactions

    CERN Multimedia

    We propose to measure the fission fragment angular distribution (FFAD) of the $^{234}$U(n,f) and $^{236}$U (n,f) reactions with the PPAC detection setup used in previous n_TOF-14 experiment. This experiment would take advantage of the high resolution of the n_TOF facility to investigate the FFAD behaviour in the pronounced vibrational resonances that have been observed between 0.1 and 2 MeV for the thorium cycle isotopes. In addition, the angular distribution of these isotopes will be measured for the first time beyond 14 MeV. Furthermore, the experiment will also provide the fission cross section with reduced statistical uncertainty, extending the $^{236}$U(n,f) data up to 1 GeV

  6. The c.-237_236GA>TT THAP1 Sequence Variant Does Not Increase Risk for Primary Dystonia (United States)

    Xiao, Jianfeng; Zhao, Yu; Bastian, Robert W.; Perlmutter, Joel S.; Racette, Brad A.; Tabbal, Samer D.; Karimi, Morvarid; Paniello, Randal C.; Wszolek, Zbigniew K.; Uitti, Ryan J.; Van Gerpen, Jay A.; Simon, David K.; Tarsy, Daniel; Hedera, Peter; Truong, Daniel D.; Frei, Karen P.; Blitzer, Andrew; Rudzińska, Monika; Pfeiffer, Ronald F.; Le, Carrie; LeDoux, Mark S.


    Sequence variants in coding and non-coding regions of THAP1 have been associated with primary dystonia. In this study, 1446 Caucasian subjects with mainly adult-onset primary dystonia and 1520 controls were genotyped for a variant located in the 5’-untranslated region of THAP1 (c.-237_236GA>TT). Minor allele frequencies were 62/2892 (2.14%) and 55/3040 (1.81%) in subjects with dystonia and controls, respectively (P = 0.202). Subgroup analyses by gender and anatomical distribution also failed to attain statistical significance. In addition, there was no effect of the TT variant on expression levels of THAP1 transcript or protein. Our findings indicate that the c.-237_236GA>TT THAP1 sequence variant does not increase risk for adult-onset primary dystonia in Caucasians. PMID:21370264

  7. Efficacy and safety of the HAA regimen as induction chemotherapy in 236 de novo acute myeloid leukemia

    Institute of Scientific and Technical Information of China (English)



    Objective To evaluate the efficacy and safety of the HAA regimen (homoharringtonine,cytarabine and aclarubicin) as induction chemotherapy in de novo acute myeloid leukemia (AML) .Methods The efficacy and safety of 236 de novo AML patients who received the HAA regimen as induction chemotherapy were retrospectively analyzed.The complete remission (CR) rate was assayed.Kaplan-Meier method was used to estimate overall survival (OS) and relapse free survival (RFS) ,and the differ-

  8. The energy dependence of the average number of prompt neutrons resulting from the neutron fission of U236

    International Nuclear Information System (INIS)

    The paper gives the numerical results of measurements of the average number of prompt neutrons per fission, #betta#-barsub(p), from neutron-induced fission of 236U in the 0.8 - 6.0 MeV range. An analysis of corrections and errors is given and a curve is recommended for #betta#-barsub(p) as a function of neutron energy. The estimated measurement accuracy is approximately 1%. (author)

  9. He stripping for AMS of 236U and other actinides using a 3 MV tandem accelerator (United States)

    Winkler, Stephan R.; Steier, Peter; Buchriegler, Josef; Lachner, Johannes; Pitters, Johanna; Priller, Alfred; Golser, Robin


    Interest in the long-lived radioisotope 236U (t1/2 = 23.4 million years) has significantly increased recently, due to the emergence of environmental and earth science applications. Presently, only a few (AMS) accelerator mass spectrometry instruments are suited for this measurement. One major limitation is the relatively low total detection efficiency (on the order of 10-4), which is partly caused by a low stripping yield of the positive ion charge state selected after the tandem accelerator. It has been shown that high yield can be achieved using helium as stripper gas for uranium ion energies below 0.35 MeV. Here we investigate the potential of He stripping of U at the 3-MV tandem accelerator VERA. Phenomenological charge state distributions for U and Th are presented for terminal voltages from 1.0 to 1.7 MV. These terminal voltages provide better background rejection than possible below 1 MeV, and are suited to the widely used 1-3 MV workhorses of many accelerator mass spectrometry laboratories. The methods can be applied to other actinides also.

  10. Tank 241-TX-118, core 236 analytical results for the final report

    International Nuclear Information System (INIS)

    This document is the analytical laboratory report for tank 241-TX-118 push mode core segments collected between April 1, 1998 and April 13, 1998. The segments were subsampled and analyzed in accordance with the Tank 241-TX-118 Push Mode Core sampling and Analysis Plan (TSAP) (Benar, 1997), the Safety Screening Data Quality Objective (DQO) (Dukelow, et al., 1995), the Data Quality Objective to Support Resolution of the Organic Complexant Safety Issue (Organic DQO) (Turner, et al, 1995) and the Historical Model Evaluation Data Requirements (Historical DQO) (Sipson, et al., 1995). The analytical results are included in the data summary table (Table 1). None of the samples submitted for Differential Scanning Calorimetry (DSC) and Total Organic Carbon (TOC) exceeded notification limits as stated in the TSAP (Benar, 1997). One sample exceeded the Total Alpha Activity (AT) analysis notification limit of 38.4microCi/g (based on a bulk density of 1.6), core 236 segment 1 lower half solids (S98T001524). Appropriate notifications were made. Plutonium 239/240 analysis was requested as a secondary analysis. The statistical results of the 95% confidence interval on the mean calculations are provided by the Tank Waste Remediation Systems Technical Basis Group in accordance with the Memorandum of Understanding (Schreiber, 1997) and are not considered in this report

  11. Functions and requirements for Project W-236B, Initial Pretreatment Module: Revision 1

    International Nuclear Information System (INIS)

    Hanford Site tank waste supernatants will be pretreated to separate the low-level and high-level fractions. The low-level waste fraction, containing the bulk of the chemical constituents, must be processed into a vitrified waste product which will be disposed of onsite, in a safe, environmentally sound, and cost effective manner. The high-level waste fraction separated during supernatant pretreatment (primarily cesium) will be recombined with an additional high-level waste fraction generated from pretreatment of the tank waste sludges and solids. This combined high-level waste fraction will be immobilized as glass and disposed in a geological repository. The purpose of this document is to establish the functional requirements baseline for Project W-236B, Initial Pretreatment Module, by defining the level 5 and 6 functions and requirements for the project. A functional analysis approach has been used to break down the program functions and associated physical requirements that each function must meet. As the systems engineering process evolves, the design requirements document will replace this preliminary functions and requirements document. The design requirements document (DRD) will identify key decisions and associated uncertainties that impact the project. A revision of this document to a DRD is not expected to change the performance requirements or open issues. However, additional requirements and issues may be identified

  12. (236)U and (239,)(240)Pu ratios from soils around an Australian nuclear weapons test site. (United States)

    Tims, S G; Froehlich, M B; Fifield, L K; Wallner, A; De Cesare, M


    The isotopes (236)U, (239)Pu and (240)Pu are present in surface soils as a result of global fallout from nuclear weapons tests carried out in the 1950's and 1960's. These isotopes potentially constitute artificial tracers of recent soil erosion and sediment movement. Only Accelerator Mass Spectrometry has the requisite sensitivity to measure all three isotopes at these environmental levels. Coupled with its relatively high throughput capabilities, this makes it feasible to conduct studies of erosion across the geographical extent of the Australian continent. In the Australian context, however, global fallout is not the only source of these isotopes. As part of its weapons development program the United Kingdom carried out a series of atmospheric and surface nuclear weapons tests at Maralinga, South Australia in 1956 and 1957. The tests have made a significant contribution to the Pu isotopic abundances present in the region around Maralinga and out to distances ∼1000 km, and impact on the assessment techniques used in the soil and sediment tracer studies. Quantification of the relative fallout contribution derived from detonations at Maralinga is complicated owing to significant contamination around the test site from numerous nuclear weapons safety trials that were also carried out around the site. We show that (236)U can provide new information on the component of the fallout that is derived from the local nuclear weapons tests, and highlight the potential of (236)U as a new fallout tracer. PMID:26141189

  13. Depth distributions of uranium-236 and cesium-137 in the Japan/East Sea; toward the potential use as a new oceanic circulation tracer (United States)

    Sakaguchi, A.; Kadokura, A.; Steier, P.; Takahashi, Y.; Shizuma, K.; Yamamoto, M.


    137Cs (T1/2=30.2 y) has been spread all over the world as a fission product of atmospheric nuclear weapons tests in the 1960s. This nuclide has been used as a powerful tool for oceanography due to the well-defined origin and conservative behaviour in water . However, the number of atoms has decayed already to one thirds compared with its initial levels, and it will become more difficult to measure. In this situation, we focus on 236U (T1/2=2.342-107 y) as a candidate for a new isotopic tracer for oceanography. The detection of 236U in the environment has become possible only recently, by the development of measuring techniques with high sensitivity based on AMS. Our group showed that global fallout from bomb tests contains 236U, which might be produced as nuclear reactions of 235U(n,γ) and/or 238U(n,3n). So 236U has been therefore globally distributed in the surface environment. Thus, 236U has a similar potential as a tracer for environmental dynamics as 137Cs, especially for oceanography. In this study, a comprehensive attempt was made to measure the concentration of 236U in marine samples such as water, suspended solid and bottom sediments to clarify the environmental behaviour of this isotope. Furthermore, the discussion of the circulation of deep and bottom water in "Miniature Ocean", the Japan Sea, has been attempted. Bottom sediments (4 sites) and seawater samples (7 sites) were collected from the Japan Sea. The sediment core was cut into 1 cm segments from the surface to 5 cm in depth within a few hours after the sampling. About 20 L of seawater samples were collected from some depths in each site, and immediately after the sampling, the water was filtered with 0.45 μm pore-size membrane-filters. After the appropriate pre-treatment for each sample, uranium isotope and 137Cs were measured with AMS and Ge-detector, respectively. 236U was successfully detected for all seawater samples, and 236U/238U atom ratios in seawater were in the range of (0

  14. The c.-237_236GA>TT THAP1 Sequence Variant Does Not Increase Risk for Primary Dystonia


    Xiao, Jianfeng; Zhao, Yu; Robert W. Bastian; Perlmutter, Joel S.; Racette, Brad A.; Tabbal, Samer D.; Karimi, Morvarid; Paniello, Randal C.; Wszolek, Zbigniew K.; Uitti, Ryan J; Van Gerpen, Jay A; Simon, David K; Tarsy, Daniel; Hedera, Peter; Truong, Daniel D.


    Sequence variants in coding and non-coding regions of THAP1 have been associated with primary dystonia. In this study, 1446 Caucasian subjects with mainly adult-onset primary dystonia and 1520 controls were genotyped for a variant located in the 5’-untranslated region of THAP1 (c.-237_236GA>TT). Minor allele frequencies were 62/2892 (2.14%) and 55/3040 (1.81%) in subjects with dystonia and controls, respectively (P = 0.202). Subgroup analyses by gender and anatomical distribution also failed ...

  15. Determination of 236Np(n,f) and 238Pu(n,f) cross-sections using surrogate reactions

    International Nuclear Information System (INIS)

    Cross sectional data for 236Np(n,f) reaction is not available for neutron energies beyond 4.32 MeV. In this work, we have determined the cross-section of the above reaction for the neutron energy range En=10-18 MeV using ‘Hybrid Surrogate Ratio’ method via 235U(6Li, α)237Np and 235U(6Li,d)239Pu reactions. The cross-sections for 238Pu(n,f) reaction available in literature have been used as a reference for the above surrogate method

  16. The most compact scission configuration of fragments from low energy fission of 234U and 236U

    International Nuclear Information System (INIS)

    Using a time of flight technique, the maximal values of the kinetic energy as a function of the primary mass of fragments from low energy fission of 234U and 236U were measured by Signarbieux et al. From calculations of scission configurations, one can conclude that, for those two fissioning systems, the maximal values of the total kinetic energy corresponding to fragmentations (42Mo62, 50Sn80) and (42Mo64, 50Sn80) respectively, are equal to the available energy, and that their scission configurations are composed of a spherical heavy fragment and a prolate light fragment, both in their ground state. (author).

  17. Measurement of the U-236(n, f) cross section in the neutron energy range from 0.5 eV up to 25 keV


    Wagemans, Cyrillus; De Smet, Liesbeth; Vermote, Sofie; Heyse, Jan


    The U-236(n,f) cross section has been measured in the energy range from 0.5 eV to 25 keV at the Geel Electron Linear Accelerator neutron time-of-flight facility of the Institute for Reference Materials and Measurements in Geel, Belgium. A highly enriched U-236 sample was mounted back-to-back with a B-10 sample in the center of a Frisch-gridded ionization chamber, hence realizing a 2 pi detection geometry. A U-235(n,f) cross-section control measurement was performed in the same experimental co...

  18. Deep-UV 236.5 nm laser by fourth-harmonic generation of a single-crystal fiber Nd:YAG oscillator


    Deyra, Loïc; Martial, Igor; Didierjean, Julien; Balembois, François; Georges, Patrick


    International audience We demonstrate a deep-UV laser at 236.5 nm based on extracavity fourth-harmonic generation of a Q-switched Nd: YAG single-crystal fiber laser at 946 nm. We first compare two nonlinear crystals available for second-harmonic generation: LBO and BiBO. The best results at 473 nm are obtained with a BiBO crystal, with an average output power of 3.4 W at 20 kHz, corresponding to a second-harmonic generation efficiency of 38%. This blue laser is frequency-converted to 236.5...

  19. Observation of the Therapeutic Effect of Perindopril on 236 Cases of Acute Myocardial Infarction%培哚普利治疗急性心肌梗塞236例的效果观察

    Institute of Scientific and Technical Information of China (English)

    黄震华; 朱雅琴; 朱文敏; 许左隽; 顾燕



  20. 20 CFR 1002.236 - How is the employee's rate of pay determined when he or she returns from a period of service? (United States)


    ... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false How is the employee's rate of pay determined... and Benefits Rate of Pay § 1002.236 How is the employee's rate of pay determined when he or she returns from a period of service? The employee's rate of pay is determined by applying the same...

  1. Lightcurves and Derived Rotation Periods for 18 Melpomene, 234 Barbara 236 Honoria, 520 Franziska, and 525 Adelaide (United States)

    Pilcher, Frederick


    From new lightcurves obtained near their 2014 oppositions rotation periods and amplitudes are found for 18 Melpomene 11.571 ± 0.002 hours, 0.16 ± 0.02 magnitudes; 234 Barbara 26.473 ± 0.002 hours, amplitude 0.16 ± 0.02 magnitudes; 236 Honoria 12.336 ± 0.001 hours, 0.23 ± 0.02 magnitudes; 520 Franziska 16.507 ± 0.001 hours, 0.35 ± 0.02 magnitudes; and 525 Adelaide 19.967 ± 0.001 hours, amplitude 0.35 ± 0.03 magnitudes near celestial longitude 180 degrees and 0.02 ± 0.01 magnitudes at celestial longitude 57 degrees, latitude -4 degrees. The amplitude - aspect method strongly suggests the latter position lies within a few degrees of one of the two rotational poles.

  2. Angular correlation between the heavy fragments and the light charged particles in tripartition of 236U and 252Cf

    International Nuclear Information System (INIS)

    The energy distributions and relative intensities of protons, deuterons, tritons and alpha-particles emitted along the fission axis during thermal neutron fission of 236U are measured simultaneously with the energies of the two fission fragments. The mass distributions of the fragments, the total kinetic energy (TKE), the dependence of the mean TKE on the fragment mass, as well as the mean kinetic energy dependence of polar particles on the fragment mass and energy are deduced from these data. Although some experimental results agree remarkably well with the hypothesis that polar particles are evaporated in-flight from fission fragments, the general conclusion is that these particles are emitted according to some other mechanism

  3. Detection of UH{sup 3+} and ThH{sup 3+} molecules and {sup 236}U background studies with low-energy AMS

    Energy Technology Data Exchange (ETDEWEB)

    Lachner, Johannes, E-mail: [Laboratory of Ion Beam Physics, ETH Zurich (Switzerland); Christl, Marcus; Vockenhuber, Christof; Synal, Hans-Arno [Laboratory of Ion Beam Physics, ETH Zurich (Switzerland)


    The performance of the TANDY AMS facility (0.6 MV) at ETH Zurich has been significantly improved for actinides with the installation of an additional 130 Degree-Sign magnet on the high-energy side. The background originating from neighboring masses is reduced by three orders of magnitude in the new setup, leading to an abundance sensitivity of 10{sup -10}. This now allows {sup 236}U/{sup 238}U measurements down to the 10{sup -12} level. Systematic studies of the possible background for {sup 236}U{sup 3+} at the compact TANDY system show that actinide-hydride molecules in charge state 3+ do exist. ({sup 232}Th{sup 1}H){sup 3+}, ({sup 235}U{sup 1}H){sup 3+} and ({sup 238}U{sup 1}H){sup 3+} can cause a severe background at masses 233, 236, and 239, respectively. The existence of the ({sup 232}Th{sup 1}H){sup 3+} molecule was verified unambiguously by analyzing its breakup. The actinide-hydride molecules can be destroyed efficiently using higher stripper pressures. At an ion energy of 1.2 MeV an overall efficiency of more than 10{sup -4} can be achieved using a gas ionization detector. The high efficiency in combination with the low background opens the spectrum of possible applications to both anthropogenic ({sup 236}U/{sup 238}U = 10{sup -7} to 10{sup -9}) and natural samples ({sup 236}U/{sup 238}U < 10{sup -10}).

  4. 特克斯河流域近236a降水变化及其趋势预测%Variation and Prediction Trend of Precipitation Series for the Tekes River Basin during the Last 236 Years

    Institute of Scientific and Technical Information of China (English)

    陈峰; 袁玉江; 魏文寿; 喻树龙; 范子昂; 张瑞波; 张同文; 尚华明


    根据2006年采自特克斯河流域6个采样点的树轮样本研制的树轮宽度年表与气象资料,通过相关普查发现,特克斯河流域树轮标准化年表与上年7月至当年6月的降水存在显著的正相关,最高单相关系数为0.727.用库尔克尔也灭,小白代的树轮宽度标准化年表序列,可较好地重建该地区最近236 a的降水序列,方差解释量达54%,并通过交叉检验表明重建结果是稳定可靠的.近236 a,特克斯河流域上年7月至当年6月降水经历了8个偏湿阶段和8个偏干阶段,同时重建降水序列具有10.3 a、7.5 a、6.0 a、3.0 a、2.1 a的变化准周期,并在1790年,1911年,1929年,1974年发生过降水突变.采用毛毛虫-奇异谱分析法(Caterpillar-ssa)对该地区未来20 a的降水的自然变化进行预测.结果表明,21世纪的最初几年降水量将延续20世纪90年代以来增加的趋势,之后出现下降,并在2013~2016年前后最低值出现.

  5. Determination of 236U and transuranium elements in depleted uranium ammunition by α-spectrometry and ICP-MS

    International Nuclear Information System (INIS)

    It is well known that ammunition containing depleted uranium (DU) was used by NATO during the Balkan conflict. To evaluate the origin of DU (the enrichment of natural uranium or the reprocessing of spent nuclear fuel) it is necessary to directly detect the presence of activation products (236U, 239Pu, 240Pu, 241Am, and 237Np) in the ammunition. In this work the analysis of actinides by α-spectrometry was compared with that by inductively coupled plasma mass spectrometry (ICP-MS) after selective separation of ultratraces of transuranium elements from the uranium matrix. 242Pu and 243Am were added to calculate the chemical yield. Plutonium was separated from uranium by extraction chromatography, using tri-n-octylamine (TNOA), with a decontamination factor higher than 106; after elution plutonium was determined by ICP-MS (239Pu and 240Pu) and α-spectrometry (239+240Pu) after electroplating. The concentration of Pu in two DU penetrator samples was 7 x 10-12 g g-1 and 2 x 10-11 g g-1. The 240Pu/239Pu isotope ratio in one penetrator sample (0.12±0.04) was significantly lower than the 240Pu/239Pu ratios found in two soil samples from Kosovo (0.35±0.10 and 0.27±0.07). 241Am was separated by extraction chromatography, using di(2-ethylhexyl)phosphoric acid (HDEHP), with a decontamination factor as high as 107. The concentration of 241Am in the penetrator samples was 2.7 x 10-14 g g-1 and -15 g g-1. In addition 237Np was detected at ultratrace levels. In general, ICP-MS and α-spectrometry results were in good agreement.The presence of anthropogenic radionuclides (236U, 239Pu,240Pu, 241Am, and 237Np) in the penetrators indicates that at least part of the uranium originated from the reprocessing of nuclear fuel. Because the concentrations of radionuclides are very low, their radiotoxicological effect is negligible. (orig.)

  6. Sequential Injection Method for Rapid and Simultaneous Determination of 236U, 237Np, and Pu Isotopes in Seawater

    DEFF Research Database (Denmark)

    Qiao, Jixin; Hou, Xiaolin; Steier, Peter;


    target analytes, whereupon plutonium and neptunium were simultaneously isolated and purified on TEVA, while uranium was collected on UTEVA. The separation behavior of U, Np, and Pu on TEVA–UTEVA columns was investigated in detail in order to achieve high chemical yields and complete purification...... for the radionuclides of interest. 242Pu was used as a chemical yield tracer for both plutonium and neptunium. 238U was quantified in the sample before the separation for deducing the 236U concentration from the measured 236U/238U atomic ratio in the separated uranium target using accelerator mass spectrometry....... Plutonium isotopes and 237Np were measured using inductively coupled plasma mass spectrometry after separation. The analytical results indicate that the developed method is robust and efficient, providing satisfactory chemical yields (70–100%) of target analytes and relatively short analytical time (8 h/sample)....

  7. Biological, chemical and other data collected aboard the THOMAS G. THOMPSON during cruise TN236 in the South Pacific Ocean from 2009-06-12 to 2009-07-08 (NODC Accession 0104353) (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — NODC accession 0104353 includes biological, chemical, optical, physical and underway data collected aboard the THOMAS G. THOMPSON during cruise TN236 in the South...

  8. Determination of plutonium isotopes in urine samples from radiation workers using 236Pu tracer, anion exchange resin and alpha spectrometry

    International Nuclear Information System (INIS)

    Bioassay technique is used for the estimation of actinides present in the body based on their excretion rate through body fluids. For occupational radiation workers urine assay is the preferred method for monitoring of chronic internal exposure. Determination of low concentrations of actinides such as plutonium, americium and uranium at low level of mBq in urine by alpha spectrometry requires pre-concentration of large volumes of urine. This paper deals with standardization of analytical method for the determination of Pu-isotopes in urine samples using anion exchange resin and 236Pu tracer for radiochemical recovery. The method involves oxidation of urine followed by co-precipitation of plutonium along with calcium phosphate. Separation of Pu was carried out by Amberlite, IRA-400, anion exchange resin. Pu-fraction was electrodeposited and activity estimated using tracer recovery by alpha spectrometer. Twenty routine urine samples of radiation workers were analyzed and consistent radiochemical tracer recovery was obtained in the range 74-96% with a mean and standard deviation of 85 and 6% respectively. (author)

  9. Molecular Hydrogen in the Damped Lyman-alpha System towards GRB 120815A at z=2.36

    CERN Document Server

    Krühler, T; Fynbo, J P U; Vreeswijk, P M; Schmidl, S; Malesani, D; Christensen, L; De Cia, A; Hjorth, J; Jakobsson, P; Kann, D A; Kaper, L; Vergani, S D; Afonso, P M J; Covino, S; Postigo, A de Ugarte; D'Elia, V; Filgas, R; Goldoni, P; Greiner, J; Hartoog, O E; Milvang-Jensen, B; Nardini, M; Piranomonte, S; Rossi, A; Sánchez-Ramírez, R; Schady, P; Schulze, S; Sudilovsky, V; Tanvir, N R; Tagliaferri, G; Watson, D J; Wiersema, K; Wijers, R A M J; Xu, D


    [Abridged] Molecular hydrogen H_2 is a key requirement for star-formation, frequently observed along sightlines in the Galaxy and to the Magellanic Clouds, but notoriously hard to detect directly beyond z ~ 0. In the DLAs associated with long gamma-ray bursts (GRBs), which are tightly linked to vigorous star-formation, H_2 has remained largely elusive, and has been unequivocally detected only towards GRB 080607 and possibly towards GRB 060206. Here, we present the discovery of H_2-rich gas, including the presence of vibrationally-excited H_2^* in the optical spectrum of the afterglow of GRB 120815A at z=2.36 obtained with X-shooter at the VLT. The galactic environment of GRB 120815A is characterized by a strong DLA with log(N(H)/cm^-2) = 21.95 +/- 0.10, prominent H_2 absorption in the Lyman-Werner bands (log(N(H_2)/cm^-2) = 20.53 +/- 0.04) and thus a molecular gas fraction log f(H_2)=-1.14 +/- 0.10. The distance d between the absorbing neutral gas and GRB 120815A is constrained via photo-excitation modeling o...

  10. Gamma-Ray Emission Spectra as a Constraint on Calculations of 234 , 236 , 238U Neutron-Capture Cross Sections (United States)

    Ullmann, J. L.; Krticka, M.; Kawano, T.; Bredeweg, T. A.; Baramsai, B.; Couture, A.; Haight, R. C.; Jandel, M.; Mosby, S.; O'Donnell, J. M.; Rundberg, R. S.; Vieira, D. J.; Wilhelmy, J. B.; Becker, J. A.; Wu, C. Y.; Chyzh, A.


    Calculations of the neutron-capture cross section at low neutron energies (10 eV through 100's of keV) are very sensitive to the nuclear level density and radiative strength function. These quantities are often poorly known, especially for radioactive targets, and actual measurements of the capture cross section are usually required. An additional constraint on the calculation of the capture cross section is provided by measurements of the cascade gamma spectrum following neutron capture. Recent measurements of 234 , 236 , 238U(n, γ) emission spectra made using the DANCE 4 π BaF2 array at the Los Alamos Neutron Science Center will be presented. Calculations of gamma-ray spectra made using the DICEBOX code and of the capture cross section made using the CoH3 code will also be presented. These techniques may be also useful for calculations of more unstable nuclides. This work was performed with the support of the U.S. Department of Energy, National Nuclear Security Administration by Los Alamos National Security, LLC (Contract DE-AC52-06NA25396) and Lawrence Livermore National Security, LLC (Contract DE-AC52-07NA2734).

  11. Numerical methods to analyze alpha spectra and application to the study of neptunium 237 and neptunium 236

    International Nuclear Information System (INIS)

    A set of numerical methods to analize alpha spectra measured with semiconductor detectors are presented. The methods can be divided in two groups, the first being based in the X2 minimization ands the second in the use of the Fourier Transform. The methods based in the minimization of X2 can, in turn, be divided according to the model used to fit the spectra. Some of them use a monoenergetic line for the intercomparison with the other peaks in the same spectrum. The others take into account the analytical function developed to represent an alpha line. Both allow the determination of positions and areas of the components, as well as the uncertainties of the results. The Fast Fourier Transform is applied to the second group of methods, which include the smoothing of experimental data, and the deconvolution of spectra. Examples are given of the application of these methods to real spectra. The alpha spectra of 237Np and 236Np are studied by using some of the methods described in this work. (Author)

  12. A 233U/236U/242Pu/244Pu spike for isotopic and isotope dilution analysis by mass spectrometry with internal calibration

    International Nuclear Information System (INIS)

    The Khlopin Radium Institute prepared on behalf of the IAEA a synthetic mixture of 233U, 236U, 242Pu and 244Pu isotopes. The isotopic composition and elemental concentration of uranium and plutonium were certified on the basis of analyses done by four laboratories of the IAEA Network, using mass spectrometry with internal standardization. The certified values for 233U/236U ratio and the 236U chemical concentration have a coefficient of variation of 0.05%. The latter is fixed by the uncertainty in the 235U/238U ratio of NBS500 used as internal standard. The coefficients of variation of the 244Pu/242Pu ratio and the 242Pu chemical concentration are respectively 0.10% and 0.16% and limited by the uncertainty in the 240Pu/239Pu ratio of NBS947. This four isotope mixture was used as an internal standard as well as a spike, to analyze 30 batches of LWR spent fuel solutions. The repeatability of the mass spectrometric measurements have a coefficient of variation of 0.025% for the uranium concentration, and of 0.039% for the plutonium concentration. The spiking and treatment errors had a coefficient of variation of 0.048%. (author). Refs, figs and tabs

  13. Transverse momentum and pseudorapidity distributions of charged hadrons in pp collisions at $\\sqrt{s}$ = 0.9 and 2.36 TeV

    CERN Document Server

    Khachatryan, Vardan; Tumasyan, Armen; Adam, Wolfgang; Bergauer, Thomas; Dragicevic, Marko; Erö, Janos; Friedl, Markus; Fruehwirth, Rudolf; Ghete, Vasile Mihai; Hammer, Josef; Haensel, Stephan; Hoch, Michael; Hörmann, Natascha; Hrubec, Josef; Jeitler, Manfred; Kasieczka, Gregor; Krammer, Manfred; Liko, Dietrich; Mikulec, Ivan; Pernicka, Manfred; Rohringer, Herbert; Schöfbeck, Robert; Strauss, Josef; Taurok, Anton; Teischinger, Florian; Waltenberger, Wolfgang; Walzel, Gerhard; Widl, Edmund; Wulz, Claudia-Elisabeth; Mossolov, Vladimir; Shumeiko, Nikolai; Suarez Gonzalez, Juan; Benucci, Leonardo; De Wolf, Eddi A.; Hashemi, Majid; Janssen, Xavier; Maes, Thomas; Mucibello, Luca; Ochesanu, Silvia; Rougny, Romain; Selvaggi, Michele; Van Haevermaet, Hans; Van Mechelen, Pierre; Van Remortel, Nick; Adler, Volker; Beauceron, Stephanie; D'Hondt, Jorgen; Devroede, Olivier; Kalogeropoulos, Alexis; Maes, Joris; Mozer, Matthias Ulrich; Tavernier, Stefaan; Van Doninck, Walter; Van Mulders, Petra; Villella, Ilaria; Chabert, Eric Christian; Charaf, Otman; Clerbaux, Barbara; De Lentdecker, Gilles; Dero, Vincent; Elgammal, Sherif; Gay, Arnaud; Hammad, Gregory Habib; Marage, Pierre Edouard; Vander Velde, Catherine; Vanlaer, Pascal; Wickens, John; Grunewald, Martin; Klein, Benjamin; Marinov, Andrey; Ryckbosch, Dirk; Thyssen, Filip; Tytgat, Michael; Vanelderen, Lukas; Verwilligen, Piet; Walsh, Sinead; Basegmez, Suzan; Bruno, Giacomo; Caudron, Julien; Cortina Gil, Eduardo; De Favereau De Jeneret, Jerome; Delaere, Christophe; Demin, Pavel; Favart, Denis; Giammanco, Andrea; Grégoire, Ghislain; Hollar, Jonathan; Lemaitre, Vincent; Liao, Jingying; Militaru, Otilia; Ovyn, Severine; Piotrzkowski, Krzysztof; Quertenmont, Loic; Schul, Nicolas; Beliy, Nikita; Caebergs, Thierry; Daubie, Evelyne; Herquet, Philippe; Alves, Gilvan; Pol, Maria Elena; Henrique Gomes E Souza, Moacyr; Carvalho, Wagner; Da Costa, Eliza Melo; De Jesus Damiao, Dilson; De Oliveira Martins, Carley; Fonseca De Souza, Sandro; Mundim, Luiz; Oguri, Vitor; Santoro, Alberto; Silva Do Amaral, Sheila Mara; Sznajder, Andre; Torres Da Silva De Araujo, Felipe; De Almeida Dias, Flavia; Ferreira Dias, Marco Andre; Tomei, Thiago; De Moraes Gregores, Eduardo; Da Cunha Marinho, Franciole; Novaes, Sergio F.; Padula, Sandra; Damgov, Jordan; Darmenov, Nikolay; Dimitrov, Lubomir; Genchev, Vladimir; Iaydjiev, Plamen; Piperov, Stefan; Stoykova, Stefka; Sultanov, Georgi; Trayanov, Rumen; Vankov, Ivan; Dimitrov, Anton; Hadjiiska, Roumyana; Kozhuharov, Venelin; Litov, Leander; Mateev, Matey; Pavlov, Borislav; Petkov, Peicho; Chen, Guo-Ming; Chen, He-Sheng; Jiang, Chun-Hua; Liang, Dong; Liang, Song; Meng, Xiangwei; Tao, Junquan; Wang, Jian; Wang, Jian; Wang, Xianyou; Wang, Zheng; Xiao, Hong; Zang, Jingjing; Zhang, Zhen; Ban, Yong; Guo, Shuang; Hu, Zhen; Mao, Yajun; Qian, Si-Jin; Teng, Haiyun; Zhu, Bo; Carrillo Montoya, Camilo Andres; Gomez Moreno, Bernardo; Ocampo Rios, Alberto Andres; Sanabria, Juan Carlos; Godinovic, Nikola; Lelas, Karlo; Plestina, Roko; Polic, Dunja; Puljak, Ivica; Antunovic, Zeljko; Dzelalija, Mile; Brigljevic, Vuko; Duric, Senka; Kadija, Kreso; Morovic, Srecko; Attikis, Alexandros; Fereos, Reginos; Galanti, Mario; Mousa, Jehad; Papadakis, Antonakis; Ptochos, Fotios; Razis, Panos A.; Tsiakkouri, Demetra; Zinonos, Zinonas; Hektor, Andi; Kadastik, Mario; Kannike, Kristjan; Müntel, Mait; Raidal, Martti; Rebane, Liis; Eerola, Paula; Czellar, Sandor; Härkönen, Jaakko; Heikkinen, Mika Aatos; Karimäki, Veikko; Kinnunen, Ritva; Klem, Jukka; Kortelainen, Matti J.; Lampén, Tapio; Lassila-Perini, Kati; Lehti, Sami; Lindén, Tomas; Luukka, Panja-Riina; Mäenpää, Teppo; Tuominen, Eija; Tuominiemi, Jorma; Tuovinen, Esa; Ungaro, Donatella; Wendland, Lauri; Banzuzi, Kukka; Korpela, Arja; Tuuva, Tuure; Sillou, Daniel; Besancon, Marc; Dejardin, Marc; Denegri, Daniel; Descamps, Julien; Fabbro, Bernard; Faure, Jean-Louis; Ferri, Federico; Ganjour, Serguei; Gentit, François-Xavier; Givernaud, Alain; Gras, Philippe; Hamel de Monchenault, Gautier; Jarry, Patrick; Locci, Elizabeth; Malcles, Julie; Marionneau, Matthieu; Millischer, Laurent; Rander, John; Rosowsky, André; Rousseau, Delphine; Titov, Maksym; Verrecchia, Patrice; Baffioni, Stephanie; Bianchini, Lorenzo; Broutin, Clementine; Busson, Philippe; Charlot, Claude; Dobrzynski, Ludwik; Granier de Cassagnac, Raphael; Haguenauer, Maurice; Miné, Philippe; Paganini, Pascal; Sirois, Yves; Thiebaux, Christophe; Zabi, Alexandre; Agram, Jean-Laurent; Besson, Auguste; Bloch, Daniel; Bodin, David; Brom, Jean-Marie; Cardaci, Marco; Conte, Eric; Drouhin, Frédéric; Ferro, Cristina; Fontaine, Jean-Charles; Gelé, Denis; Goerlach, Ulrich; Greder, Sebastien; Juillot, Pierre; Le Bihan, Anne-Catherine; Mikami, Yoshinari; Ripp-Baudot, Isabelle; Speck, Joaquim; Van Hove, Pierre; Baty, Clement; Bedjidian, Marc; Bondu, Olivier; Boudoul, Gaelle; Boumediene, Djamel; Brun, Hugues; Chanon, Nicolas; Chierici, Roberto; Contardo, Didier; Depasse, Pierre; El Mamouni, Houmani; Fay, Jean; Gascon, Susan; Ille, Bernard; Kurca, Tibor; Le Grand, Thomas; Lethuillier, Morgan; Mirabito, Laurent; Perries, Stephane; Tosi, Silvano; Tschudi, Yohann; Verdier, Patrice; Roinishvili, Vladimir; Anagnostou, Georgios; Edelhoff, Matthias; Feld, Lutz; Heracleous, Natalie; Hindrichs, Otto; Jussen, Ruediger; Klein, Katja; Merz, Jennifer; Mohr, Niklas; Ostapchuk, Andrey; Pandoulas, Demetrios; Perieanu, Adrian; Raupach, Frank; Sammet, Jan; Schael, Stefan; Sprenger, Daniel; Weber, Hendrik; Weber, Martin; Wittmer, Bruno; Actis, Oxana; Bender, Walter; Biallass, Philipp; Erdmann, Martin; Frangenheim, Jens; Hebbeker, Thomas; Hinzmann, Andreas; Hoepfner, Kerstin; Hof, Carsten; Kirsch, Matthias; Klimkovich, Tatsiana; Kreuzer, Peter; Lanske, Dankfried; Merschmeyer, Markus; Meyer, Arnd; Pieta, Holger; Reithler, Hans; Schmitz, Stefan Antonius; Sowa, Michael; Steggemann, Jan; Teyssier, Daniel; Zeidler, Clemens; Bontenackels, Michael; Davids, Martina; Duda, Markus; Flügge, Günter; Geenen, Heiko; Giffels, Manuel; Haj Ahmad, Wael; Heydhausen, Dirk; Kress, Thomas; Kuessel, Yvonne; Linn, Alexander; Nowack, Andreas; Perchalla, Lars; Pooth, Oliver; Sauerland, Philip; Stahl, Achim; Thomas, Maarten; Tornier, Daiske; Zoeller, Marc Henning; Aldaya Martin, Maria; Behrens, Ulf; Borras, Kerstin; Campbell, Alan; Castro, Elena; Dammann, Dirk; Eckerlin, Guenter; Flossdorf, Alexander; Flucke, Gero; Geiser, Achim; Hauk, Johannes; Jung, Hannes; Kasemann, Matthias; Katkov, Igor; Kleinwort, Claus; Kluge, Hannelies; Knutsson, Albert; Kuznetsova, Ekaterina; Lange, Wolfgang; Lohmann, Wolfgang; Mankel, Rainer; Marienfeld, Markus; Meyer, Andreas Bernhard; Mnich, Joachim; Olzem, Jan; Parenti, Andrea; Schmidt, Ringo; Schoerner-Sadenius, Thomas; Sen, Niladri; Stein, Matthias; Volyanskyy, Dmytro; Wissing, Christoph; Zeuner, Wolfram Dietrich; Autermann, Christian; Draeger, Jula; Eckstein, Doris; Enderle, Holger; Gebbert, Ulla; Kaschube, Kolja; Kaussen, Gordon; Klanner, Robert; Mura, Benedikt; Naumann-Emme, Sebastian; Nowak, Friederike; Sander, Christian; Schleper, Peter; Schröder, Matthias; Schum, Torben; Stadie, Hartmut; Steinbrück, Georg; Thomsen, Jan; Wolf, Roger; Bauer, Julia; Blüm, Peter; Buege, Volker; Cakir, Altan; Chwalek, Thorsten; Daeuwel, Daniel; De Boer, Wim; Dierlamm, Alexander; Dirkes, Guido; Feindt, Michael; Frey, Martin; Gruschke, Jasmin; Hackstein, Christoph; Hartmann, Frank; Heinrich, Michael; Hoffmann, Karl-Heinz; Honc, Simon; Kuhr, Thomas; Martschei, Daniel; Mueller, Steffen; Müller, Thomas; Niegel, Martin; Oberst, Oliver; Oehler, Andreas; Ott, Jochen; Peiffer, Thomas; Piparo, Danilo; Quast, Gunter; Rabbertz, Klaus; Renz, Manuel; Sabellek, Andreas; Saout, Christophe; Scheurer, Armin; Schieferdecker, Philipp; Schilling, Frank-Peter; Schott, Gregory; Simonis, Hans-Jürgen; Stober, Fred-Markus Helmut; Wagner-Kuhr, Jeannine; Zeise, Manuel; Zhukov, Valery; Ziebarth, Eva Barbara; Daskalakis, Georgios; Geralis, Theodoros; Karafasoulis, Konstantinos; Kyriakis, Aristotelis; Loukas, Demetrios; Markou, Athanasios; Markou, Christos; Mavrommatis, Charalampos; Petrakou, Eleni; Zachariadou, Aikaterini; Agapitos, Antonis; Gouskos, Loukas; Katsas, Panagiotis; Panagiotou, Apostolos; Saganis, Konstantinos; Xaxiris, Evangelos; Evangelou, Ioannis; Kokkas, Panagiotis; Manthos, Nikolaos; Papadopoulos, Ioannis; Triantis, Frixos A.; Aranyi, Attila; Bencze, Gyorgy; Boldizsar, Laszlo; Debreczeni, Gergely; Hajdu, Csaba; Horvath, Dezso; Krajczar, Krisztian; Laszlo, Andras; Sikler, Ferenc; Vesztergombi, Gyorgy; Beni, Noemi; Molnar, Jozsef; Palinkas, Jozsef; Szillasi, Zoltan; Veszpremi, Viktor; Kapusi, Anita; Raics, Peter; Trocsanyi, Zoltan Laszlo; Ujvari, Balazs; Bansal, Sunil; Beri, Suman Bala; Bhatnagar, Vipin; Jindal, Monika; Kaur, Manjit; Kohli, Jatinder Mohan; Mehta, Manuk Zubin; Nishu, Nishu; Saini, Lovedeep Kaur; Sharma, Archana; Sharma, Richa; Singh, Anil; Singh, Jas Bir; Singh, Supreet Pal; Ahuja, Sudha; Bhattacharya, Satyaki; Chauhan, Sushil; Choudhary, Brajesh C.; Gupta, Pooja; Jain, Sandhya; Jain, Shilpi; Kumar, Ashok; Ranjan, Kirti; Shivpuri, Ram Krishen; Choudhury, Rajani Kant; Dutta, Dipanwita; Kailas, Swaminathan; Kataria, Sushil Kumar; Mohanty, Ajit Kumar; Pant, Lalit Mohan; Shukla, Prashant; Suggisetti, Praveenkumar; Aziz, Tariq; Guchait, Monoranjan; Gurtu, Atul; Maity, Manas; Majumder, Devdatta; Majumder, Gobinda; Mazumdar, Kajari; Nayak, Aruna; Saha, Anirban; Sudhakar, Katta; Wickramage, Nadeesha; Banerjee, Sudeshna; Dugad, Shashikant; Mondal, Naba Kumar; Arfaei, Hessamaddin; Bakhshiansohi, Hamed; Fahim, Ali; Jafari, Abideh; Mohammadi Najafabadi, Mojtaba; Moshaii, Ahmad; Paktinat Mehdiabadi, Saeid; Zeinali, Maryam; Felcini, Marta; Abbrescia, Marcello; Barbone, Lucia; Colaleo, Anna; Creanza, Donato; De Filippis, Nicola; De Palma, Mauro; Fedele, Francesca; Fiore, Luigi; Iaselli, Giuseppe; Lusito, Letizia; Maggi, Giorgio; Maggi, Marcello; Manna, Norman; Marangelli, Bartolomeo; My, Salvatore; Nuzzo, Salvatore; Pierro, Giuseppe Antonio; Pompili, Alexis; Pugliese, Gabriella; Romano, Francesco; Roselli, Giuseppe; Selvaggi, Giovanna; Silvestris, Lucia; Tupputi, Salvatore; Zito, Giuseppe; Abbiendi, Giovanni; Bonacorsi, Daniele; Braibant-Giacomelli, Sylvie; Capiluppi, Paolo; Cavallo, Francesca Romana; Codispoti, Giuseppe; Cuffiani, Marco; Dallavalle, Gaetano-Marco; Fabbri, Fabrizio; Fanfani, Alessandra; Fasanella, Daniele; Giacomelli, Paolo; Giunta, Marina; Grandi, Claudio; Marcellini, Stefano; Masetti, Gianni; Montanari, Alessandro; Navarria, Francesco; Odorici, Fabrizio; Perrotta, Andrea; Rossi, Antonio; Rovelli, Tiziano; Siroli, Gianni; Travaglini, Riccardo; Albergo, Sebastiano; Chiorboli, Massimiliano; Costa, Salvatore; Potenza, Renato; Tricomi, Alessia; Tuve, Cristina; Barbagli, Giuseppe; Broccolo, Giuseppe; Ciulli, Vitaliano; Civinini, Carlo; D'Alessandro, Raffaello; Focardi, Ettore; Frosali, Simone; Gallo, Elisabetta; Genta, Chiara; Landi, Gregorio; Lenzi, Piergiulio; Meschini, Marco; Paoletti, Simone; Sguazzoni, Giacomo; Tropiano, Antonio; Bianco, Stefano; Colafranceschi, Stefano; Fabbri, Franco; Lanaro, Armando; Piccolo, Davide; Fabbricatore, Pasquale; Musenich, Riccardo; Benaglia, Andrea; Cerati, Giuseppe Benedetto; De Guio, Federico; Ghezzi, Alessio; Govoni, Pietro; Malberti, Martina; Malvezzi, Sandra; Martelli, Arabella; Menasce, Dario; Miccio, Vincenzo; Moroni, Luigi; Negri, Pietro; Paganoni, Marco; Pedrini, Daniele; Pullia, Antonino; Ragazzi, Stefano; Redaelli, Nicola; Sala, Silvano; Salerno, Roberto; Tabarelli de Fatis, Tommaso; Tancini, Valentina; Taroni, Silvia; Cimmino, Anna; De Gruttola, Michele; Fabozzi, Francesco; Iorio, Alberto Orso Maria; Lista, Luca; Lomidze, David; Noli, Pasquale; Paolucci, Pierluigi; Azzi, Patrizia; Bacchetta, Nicola; Bellan, Paolo; Biasotto, Massimo; Carlin, Roberto; Checchia, Paolo; De Mattia, Marco; Dorigo, Tommaso; Fanzago, Federica; Gasparini, Fabrizio; Giubilato, Piero; Gonella, Franco; Gulmini, Michele; Lacaprara, Stefano; Maron, Gaetano; Mattiazzo, Serena; Meneguzzo, Anna Teresa; Passaseo, Marina; Pegoraro, Matteo; Pozzobon, Nicola; Ronchese, Paolo; Torassa, Ezio; Tosi, Mia; Vanini, Sara; Ventura, Sandro; Zotto, Pierluigi; Baesso, Paolo; Berzano, Umberto; Pagano, Davide; Ratti, Sergio P.; Riccardi, Cristina; Torre, Paola; Vitulo, Paolo; Viviani, Claudio; Biasini, Maurizio; Bilei, Gian Mario; Caponeri, Benedetta; Fanò, Livio; Lariccia, Paolo; Lucaroni, Andrea; Mantovani, Giancarlo; Nappi, Aniello; Santocchia, Attilio; Servoli, Leonello; Volpe, Roberta; Azzurri, Paolo; Bagliesi, Giuseppe; Bernardini, Jacopo; Boccali, Tommaso; Bocci, Andrea; Borrello, Laura; Castaldi, Rino; Dell'Orso, Roberto; Dutta, Suchandra; Fiori, Francesco; Foà, Lorenzo; Gennai, Simone; Giassi, Alessandro; Kraan, Aafke; Ligabue, Franco; Lomtadze, Teimuraz; Martini, Luca; Messineo, Alberto; Palla, Fabrizio; Palmonari, Francesco; Sarkar, Subir; Segneri, Gabriele; Serban, Alin Titus; Spagnolo, Paolo; Tenchini, Roberto; Tonelli, Guido; Venturi, Andrea; Verdini, Piero Giorgio; Barone, Luciano; Cavallari, Francesca; Del Re, Daniele; Di Marco, Emanuele; Diemoz, Marcella; Franci, Daniele; Grassi, Marco; Longo, Egidio; Organtini, Giovanni; Palma, Alessandro; Pandolfi, Francesco; Paramatti, Riccardo; Rahatlou, Shahram; Rovelli, Chiara; Amapane, Nicola; Arcidiacono, Roberta; Argiro, Stefano; Arneodo, Michele; Biino, Cristina; Borgia, Maria Assunta; Botta, Cristina; Cartiglia, Nicolo; Castello, Roberto; Cerminara, Gianluca; Costa, Marco; Dellacasa, Giulio; Demaria, Natale; Graziano, Alberto; Mariotti, Chiara; Marone, Matteo; Maselli, Silvia; Migliore, Ernesto; Mila, Giorgia; Monaco, Vincenzo; Musich, Marco; Obertino, Maria Margherita; Pastrone, Nadia; Romero, Alessandra; Ruspa, Marta; Sacchi, Roberto; Solano, Ada; Staiano, Amedeo; Trocino, Daniele; Vilela Pereira, Antonio; Ambroglini, Filippo; Belforte, Stefano; Cossutti, Fabio; Della Ricca, Giuseppe; Gobbo, Benigno; Penzo, Aldo; Chang, Sunghyun; Chung, Jin Hyuk; Kim, Dong Hee; Kim, Gui Nyun; Kong, Dae Jung; Park, Hyangkyu; Son, Dong-Chul; Kim, Jaeho; Song, Sanghyeon; Jung, Seung Yong; Hong, Byung-Sik; Kim, Hyunchul; Kim, Ji Hyun; Lee, Kyong Sei; Moon, Dong Ho; Park, Sung Keun; Rhee, Han-Bum; Sim, Kwang Souk; Kim, Jangho; Choi, Minkyoo; Park, Inkyu; Choi, Suyong; Choi, Young-Il; Choi, Young Kyu; Goh, Junghwan; Jo, Youngkwon; Kwon, Jeongteak; Lee, Jongseok; Lee, Sungeun; Janulis, Mindaugas; Martisiute, Dalia; Petrov, Pavel; Sabonis, Tomas; Castilla Valdez, Heriberto; Sánchez Hernández, Alberto; Carrillo Moreno, Salvador; Salazar Ibarguen, Humberto Antonio; Casimiro Linares, Edgar; Morelos Pineda, Antonio; Allfrey, Philip; Krofcheck, David; Aumeyr, Thomas; Butler, Philip H.; Signal, Tony; Williams, Jennifer C.; Ahmad, Muhammad; Ahmed, Ijaz; Asghar, Muhammad Irfan; Hoorani, Hafeez R.; Khan, Wajid Ali; Khurshid, Taimoor; Qazi, Shamona; Cwiok, Mikolaj; Dominik, Wojciech; Doroba, Krzysztof; Konecki, Marcin; Krolikowski, Jan; Frueboes, Tomasz; Gokieli, Ryszard; Górski, Maciej; Kazana, Malgorzata; Nawrocki, Krzysztof; Szleper, Michal; Wrochna, Grzegorz; Zalewski, Piotr; Almeida, Nuno; Bargassa, Pedrame; David Tinoco Mendes, Andre; Faccioli, Pietro; Ferreira Parracho, Pedro Guilherme; Gallinaro, Michele; Musella, Pasquale; Ribeiro, Pedro Quinaz; Seixas, Joao; Silva, Pedro; Varela, Joao; Wöhri, Hermine Katharina; Altsybeev, Igor; Belotelov, Ivan; Bunin, Pavel; Finger, Miroslav; Finger Jr., Michael; Golutvin, Igor; Kamenev, Alexey; Karjavin, Vladimir; Kozlov, Guennady; Lanev, Alexander; Moisenz, Petr; Palichik, Vladimir; Perelygin, Victor; Shmatov, Sergey; Smirnov, Vitaly; Vishnevskiy, Alexander; Volodko, Anton; Zarubin, Anatoli; Ivanov, Yury; Kim, Victor; Levchenko, Petr; Obrant, Gennady; Shcheglov, Yury; Shchetkovskiy, Alexander; Smirnov, Igor; Sulimov, Valentin; Vavilov, Sergey; Vorobyev, Alexey; Andreev, Yuri; Gninenko, Sergei; Golubev, Nikolai; Karneyeu, Anton; Kirsanov, Mikhail; Krasnikov, Nikolai; Matveev, Viktor; Pashenkov, Anatoli; Toropin, Alexander; Troitsky, Sergey; Epshteyn, Vladimir; Gavrilov, Vladimir; Ilina, Natalia; Kaftanov, Vitali; Kossov, Mikhail; Krokhotin, Andrey; Kuleshov, Sergey; Oulianov, Alexei; Safronov, Grigory; Semenov, Sergey; Shreyber, Irina; Stolin, Viatcheslav; Vlasov, Evgueni; Zhokin, Alexander; Boos, Edouard; Dubinin, Mikhail; Dudko, Lev; Ershov, Alexander; Gribushin, Andrey; Kodolova, Olga; Lokhtin, Igor; Petrushanko, Sergey; Sarycheva, Ludmila; Savrin, Viktor; Vardanyan, Irina; Dremin, Igor; Kirakosyan, Martin; Konovalova, Nina; Rusakov, Sergey V.; Vinogradov, Alexey; Azhgirey, Igor; Bitioukov, Sergei; Datsko, Kirill; Kachanov, Vassili; Konstantinov, Dmitri; Krychkine, Victor; Petrov, Vladimir; Ryutin, Roman; Slabospitsky, Sergey; Sobol, Andrei; Sytine, Alexandre; Tourtchanovitch, Leonid; Troshin, Sergey; Tyurin, Nikolay; Uzunian, Andrey; Volkov, Alexey; Adzic, Petar; Djordjevic, Milos; Maletic, Dimitrije; Puzovic, Jovan; Aguilar-Benitez, Manuel; Alcaraz Maestre, Juan; Arce, Pedro; Battilana, Carlo; Calvo, Enrique; Cepeda, Maria; Cerrada, Marcos; Chamizo Llatas, Maria; Colino, Nicanor; De La Cruz, Begona; Diez Pardos, Carmen; Fernandez Bedoya, Cristina; Fernández Ramos, Juan Pablo; Ferrando, Antonio; Flix, Jose; Fouz, Maria Cruz; Garcia-Abia, Pablo; Gonzalez Lopez, Oscar; Goy Lopez, Silvia; Hernandez, Jose M.; Josa, Maria Isabel; Merino, Gonzalo; Puerta Pelayo, Jesus; Romero, Luciano; Santaolalla, Javier; Willmott, Carlos; Albajar, Carmen; de Trocóniz, Jorge F; Cuevas, Javier; Fernandez Menendez, Javier; Gonzalez Caballero, Isidro; Lloret Iglesias, Lara; Vizan Garcia, Jesus Manuel; Cabrillo, Iban Jose; Calderon, Alicia; Chuang, Shan-Huei; Diaz Merino, Irma; Diez Gonzalez, Carlos; Duarte Campderros, Jordi; Fernandez, Marcos; Gomez, Gervasio; Gonzalez Sanchez, Javier; Gonzalez Suarez, Rebeca; Jorda, Clara; Lobelle Pardo, Patricia; Lopez Virto, Amparo; Marco, Jesus; Marco, Rafael; Martinez Rivero, Celso; Martinez Ruiz del Arbol, Pablo; Matorras, Francisco; Rodrigo, Teresa; Ruiz Jimeno, Alberto; Scodellaro, Luca; Sobron Sanudo, Mar; Vila, Ivan; Vilar Cortabitarte, Rocio; Abbaneo, Duccio; Auffray, Etiennette; Baillon, Paul; Ball, Austin; Barney, David; Beaudette, Florian; Beccati, Barbara; Bellan, Riccardo; Benedetti, Daniele; Benelli, Gabriele; Bernet, Colin; Bialas, Wojciech; Bloch, Philippe; Bolognesi, Sara; Bona, Marcella; Breuker, Horst; Bunkowski, Karol; Camporesi, Tiziano; Cano, Eric; Cattai, Ariella; Christiansen, Tim; Coarasa Perez, Jose Antonio; Covarelli, Roberto; Curé, Benoît; Dahms, Torsten; De Roeck, Albert; Elliott-Peisert, Anna; Funk, Wolfgang; Gaddi, Andrea; Gerwig, Hubert; Gigi, Dominique; Gill, Karl; Giordano, Domenico; Glege, Frank; Gowdy, Stephen; Guiducci, Luigi; Gutleber, Johannes; Hartl, Christian; Harvey, John; Hegner, Benedikt; Henderson, Conor; Hoffmann, Hans Falk; Holzner, André; Honma, Alan; Huhtinen, Mika; Innocente, Vincenzo; Janot, Patrick; Lecoq, Paul; Leonidopoulos, Christos; Lourenco, Carlos; Macpherson, Alick; Maki, Tuula; Malgeri, Luca; Mannelli, Marcello; Masetti, Lorenzo; Meijers, Frans; Meridiani, Paolo; Mersi, Stefano; Meschi, Emilio; Moser, Roland; Mulders, Martijn; Noy, Matthew; Orimoto, Toyoko; Orsini, Luciano; Perez, Emmanuelle; Petrilli, Achille; Pfeiffer, Andreas; Pierini, Maurizio; Pimiä, Martti; Racz, Attila; Rolandi, Gigi; Rovere, Marco; Ryjov, Vladimir; Sakulin, Hannes; Schäfer, Christoph; Schlatter, Wolf-Dieter; Schwick, Christoph; Segoni, Ilaria; Sharma, Archana; Siegrist, Patrice; Simon, Michal; Sphicas, Paraskevas; Spiga, Daniele; Spiropulu, Maria; Stöckli, Fabian; Traczyk, Piotr; Tropea, Paola; Tsirou, Andromachi; Veres, Gabor Istvan; Vichoudis, Paschalis; Voutilainen, Mikko; Zanetti, Marco; Bertl, Willi; Deiters, Konrad; Erdmann, Wolfram; Gabathuler, Kurt; Horisberger, Roland; Ingram, Quentin; Kaestli, Hans-Christian; König, Stefan; Kotlinski, Danek; Langenegger, Urs; Meier, Frank; Renker, Dieter; Rohe, Tilman; Sibille, Jennifer; Starodumov, Andrei; Betev, Botjo; Caminada, Lea; Casella, Maria Chiara; Chen, Zhiling; Cittolin, Sergio; Dambach, Sarah; Dissertori, Günther; Dittmar, Michael; Eggel, Christina; Eugster, Jürg; Freudenreich, Klaus; Grab, Christoph; Hervé, Alain; Hintz, Wieland; Lecomte, Pierre; Lustermann, Werner; Marchica, Carmelo; Milenovic, Predrag; Moortgat, Filip; Nardulli, Alessandro; Nessi-Tedaldi, Francesca; Pape, Luc; Pauss, Felicitas; Punz, Thomas; Rizzi, Andrea; Ronga, Frederic Jean; Sala, Leonardo; Sanchez, Ann - Karin; Sawley, Marie-Christine; Schinzel, Dietrich; Sordini, Viola; Stieger, Benjamin; Tauscher, Ludwig; Thea, Alessandro; Theofilatos, Konstantinos; Treille, Daniel; Trüb, Peter; Weber, Matthias; Wehrli, Lukas; Weng, Joanna; Amsler, Claude; Chiochia, Vincenzo; De Visscher, Simon; Ivova Rikova, Mirena; Regenfus, Christian; Robmann, Peter; Rommerskirchen, Tanja; Schmidt, Alexander; Snoek, Hella; Tsirigkas, Dimitrios; Wilke, Lotte; Chang, Yuan-Hann; Chen, E Augustine; Chen, Wan-Ting; Go, Apollo; Kuo, Chia-Ming; Li, Syue-Wei; Lin, Willis; Liu, Ming-Hsiung; Wu, Jing-Han; Bartalini, Paolo; Chang, Paoti; Chang, You-Hao; Chao, Yuan; Chen, Kai-Feng; Hou, George Wei-Shu; Hsiung, Yee; Lei, Yeong-Jyi; Lin, Sheng-Wen; Lu, Rong-Shyang; Shiu, Jing-Ge; Tzeng, Yeng-Ming; Ueno, Koji; Wang, Chin-chi; Wang, Minzu; Adiguzel, Aytul; Ayhan, Aydin; Bakirci, Mustafa Numan; Cerci, Salim; Demir, Zahide; Dozen, Candan; Dumanoglu, Isa; Eskut, Eda; Girgis, Semiray; Gurpinar, Emine; Karaman, Turker; Kayis Topaksu, Aysel; Kurt, Pelin; Önengüt, Gülsen; Ozdemir, Kadri; Ozturk, Sertac; Polatöz, Ayse; Sahin, Ozge; Sengul, Ozden; Sogut, Kenan; Tali, Bayram; Topakli, Huseyin; Uzun, Dilber; Vergili, Latife Nukhet; Vergili, Mehmet; Akin, Ilina Vasileva; Aliev, Takhmasib; Bilmis, Selcuk; Deniz, Muhammed; Gamsizkan, Halil; Guler, Ali Murat; Ocalan, Kadir; Serin, Meltem; Sever, Ramazan; Surat, Ugur Emrah; Zeyrek, Mehmet; Deliomeroglu, Mehmet; Demir, Durmus; Gülmez, Erhan; Halu, Arda; Isildak, Bora; Kaya, Mithat; Kaya, Ozlem; Ozkorucuklu, Suat; Sonmez, Nasuf; Levchuk, Leonid; Bell, Peter; Bostock, Francis; Brooke, James John; Cheng, Teh Lee; Cussans, David; Frazier, Robert; Goldstein, Joel; Hansen, Maria; Heath, Greg P.; Heath, Helen F.; Hill, Christopher; Huckvale, Benedickt; Jackson, James; Kreczko, Lukasz; Mackay, Catherine Kirsty; Metson, Simon; Newbold, Dave M.; Nirunpong, Kachanon; Smith, Vincent J.; Ward, Simon; Basso, Lorenzo; Bell, Ken W.; Brew, Christopher; Brown, Robert M.; Camanzi, Barbara; Cockerill, David J.A.; Coughlan, John A.; Harder, Kristian; Harper, Sam; Kennedy, Bruce W.; Shepherd-Themistocleous, Claire; Tomalin, Ian R.; Womersley, William John; Worm, Steven; Bainbridge, Robert; Ball, Gordon; Ballin, Jamie; Beuselinck, Raymond; Buchmuller, Oliver; Colling, David; Cripps, Nicholas; Davies, Gavin; Della Negra, Michel; Foudas, Costas; Fulcher, Jonathan; Futyan, David; Hall, Geoffrey; Hays, Jonathan; Iles, Gregory; Karapostoli, Georgia; Lyons, Louis; MacEvoy, Barry C.; Magnan, Anne-Marie; Marrouche, Jad; Nash, Jordan; Nikitenko, Alexander; Papageorgiou, Anastasios; Pesaresi, Mark; Petridis, Konstantinos; Pioppi, Michele; Raymond, David Mark; Rompotis, Nikolaos; Rose, Andrew; Ryan, Matthew John; Seez, Christopher; Sharp, Peter; Stoye, Markus; Tapper, Alexander; Tourneur, Stephane; Vazquez Acosta, Monica; Virdee, Tejinder; Wakefield, Stuart; Wardrope, David; Whyntie, Tom; Barrett, Matthew; Chadwick, Matthew; Cole, Joanne; Hobson, Peter R.; Khan, Akram; Kyberd, Paul; Leslie, Dawn; Reid, Ivan; Teodorescu, Liliana; Bose, Tulika; Clough, Andrew; Heister, Arno; St. John, Jason; Lawson, Philip; Lazic, Dragoslav; Rohlf, James; Sulak, Lawrence; Andrea, Jeremy; Avetisyan, Aram; Bhattacharya, Saptaparna; Chou, John Paul; Cutts, David; Esen, Selda; Kukartsev, Gennadiy; Landsberg, Greg; Narain, Meenakshi; Nguyen, Duong; Speer, Thomas; Tsang, Ka Vang; Breedon, Richard; Calderon De La Barca Sanchez, Manuel; Cebra, Daniel; Chertok, Maxwell; Conway, John; Cox, Peter Timothy; Dolen, James; Erbacher, Robin; Friis, Evan; Ko, Winston; Kopecky, Alexandra; Lander, Richard; Liu, Haidong; Maruyama, Sho; Miceli, Tia; Nikolic, Milan; Pellett, Dave; Robles, Jorge; Searle, Matthew; Smith, John; Squires, Michael; Tripathi, Mani; Vasquez Sierra, Ricardo; Veelken, Christian; Andreev, Valeri; Arisaka, Katsushi; Cline, David; Cousins, Robert; Erhan, Samim; Farrell, Chris; Hauser, Jay; Ignatenko, Mikhail; Jarvis, Chad; Rakness, Gregory; Schlein, Peter; Tucker, Jordan; Valuev, Vyacheslav; Wallny, Rainer; Babb, John; Chandra, Avdhesh; Clare, Robert; Ellison, John Anthony; Gary, J William; Hanson, Gail; Jeng, Geng-Yuan; Kao, Shih-Chuan; Liu, Feng; Liu, Hongliang; Luthra, Arun; Nguyen, Harold; Shen, Benjamin C.; Stringer, Robert; Sturdy, Jared; Wilken, Rachel; Wimpenny, Stephen; Andrews, Warren; Branson, James G.; Dusinberre, Elizabeth; Evans, David; Golf, Frank; Kelley, Ryan; Lebourgeois, Matthew; Letts, James; Mangano, Boris; Muelmenstaedt, Johannes; Norman, Matthew; Padhi, Sanjay; Petrucciani, Giovanni; Pi, Haifeng; Pieri, Marco; Ranieri, Riccardo; Sani, Matteo; Sharma, Vivek; Simon, Sean; Vartak, Adish; Würthwein, Frank; Yagil, Avraham; Barge, Derek; Blume, Michael; Campagnari, Claudio; D'Alfonso, Mariarosaria; Danielson, Thomas; Garberson, Jeffrey; Incandela, Joe; Justus, Christopher; Kalavase, Puneeth; Koay, Sue Ann; Kovalskyi, Dmytro; Krutelyov, Vyacheslav; Lamb, James; Lowette, Steven; Pavlunin, Viktor; Rebassoo, Finn; Ribnik, Jacob; Richman, Jeffrey; Rossin, Roberto; Stuart, David; To, Wing; Vlimant, Jean-Roch; Witherell, Michael; Apresyan, Artur; Bornheim, Adolf; Bunn, Julian; Gataullin, Marat; Litvine, Vladimir; Ma, Yousi; Newman, Harvey B.; Rogan, Christopher; Timciuc, Vladlen; Veverka, Jan; Wilkinson, Richard; Yang, Yong; Zhu, Ren-Yuan; Akgun, Bora; Carroll, Ryan; Ferguson, Thomas; Jang, Dong Wook; Jun, Soon Yung; Paulini, Manfred; Russ, James; Terentyev, Nikolay; Vogel, Helmut; Vorobiev, Igor; Cumalat, John Perry; Dinardo, Mauro Emanuele; Drell, Brian Robert; Ford, William T.; Heyburn, Bernadette; Luiggi Lopez, Eduardo; Nauenberg, Uriel; Stenson, Kevin; Ulmer, Keith; Wagner, Stephen Robert; Zang, Shi-Lei; Agostino, Lorenzo; Alexander, James; Blekman, Freya; Cassel, David; Chatterjee, Avishek; Das, Souvik; Eggert, Nicholas; Gibbons, Lawrence Kent; Heltsley, Brian; Hopkins, Walter; Khukhunaishvili, Aleko; Kreis, Benjamin; Patterson, Juliet Ritchie; Puigh, Darren; Ryd, Anders; Shi, Xin; Sun, Werner; Teo, Wee Don; Thom, Julia; Vaughan, Jennifer; Weng, Yao; Wittich, Peter; Biselli, Angela; Cirino, Guy; Winn, Dave; Albrow, Michael; Apollinari, Giorgio; Atac, Muzaffer; Bakken, Jon Alan; Banerjee, Sunanda; Bauerdick, Lothar A.T.; Beretvas, Andrew; Berryhill, Jeffrey; Bhat, Pushpalatha C.; Binkley, Morris; Bloch, Ingo; Borcherding, Frederick; Burkett, Kevin; Butler, Joel Nathan; Chetluru, Vasundhara; Cheung, Harry; Chlebana, Frank; Cihangir, Selcuk; Demarteau, Marcel; Eartly, David P.; Elvira, Victor Daniel; Fisk, Ian; Freeman, Jim; Gottschalk, Erik; Green, Dan; Gutsche, Oliver; Hahn, Alan; Hanlon, Jim; Harris, Robert M.; James, Eric; Jensen, Hans; Johnson, Marvin; Joshi, Umesh; Klima, Boaz; Kousouris, Konstantinos; Kwan, Simon; Limon, Peter; Lueking, Lee; Lykken, Joseph; Maeshima, Kaori; Marraffino, John Michael; Mason, David; McBride, Patricia; Miao, Ting; Mishra, Kalanand; Mrenna, Stephen; Newman-Holmes, Catherine; O'Dell, Vivian; Prokofyev, Oleg; Sexton-Kennedy, Elizabeth; Sharma, Seema; Smith, Richard P.; Soha, Aron; Spalding, William J.; Spiegel, Leonard; Tan, Ping; Tkaczyk, Slawek; Uplegger, Lorenzo; Vaandering, Eric Wayne; Vidal, Richard; Whitmore, Juliana; Wu, Weimin; Yumiceva, Francisco; Yun, Jae Chul; Acosta, Darin; Avery, Paul; Bourilkov, Dimitri; Chen, Mingshui; Di Giovanni, Gian Piero; Dobur, Didar; Drozdetskiy, Alexey; Field, Richard D.; Fu, Yu; Furic, Ivan-Kresimir; Gartner, Joseph; Kim, Bockjoo; Klimenko, Sergey; Konigsberg, Jacobo; Korytov, Andrey; Kotov, Khristian; Kropivnitskaya, Anna; Kypreos, Theodore; Matchev, Konstantin; Mitselmakher, Guenakh; Pakhotin, Yuriy; Piedra Gomez, Jonatan; Prescott, Craig; Rapsevicius, Valdas; Remington, Ronald; Schmitt, Michael; Scurlock, Bobby; Wang, Dayong; Yelton, John; Zakaria, Mohammed; Ceron, Cristobal; Gaultney, Vanessa; Kramer, Laird; Lebolo, Luis Miguel; Linn, Stephan; Markowitz, Pete; Martinez, German; Rodriguez, Jorge Luis; Adams, Todd; Askew, Andrew; Chen, Jie; Dharmaratna, Welathantri G.D.; Diamond, Brendan; Gleyzer, Sergei V; Haas, Jeff; Hagopian, Sharon; Hagopian, Vasken; Jenkins, Merrill; Johnson, Kurtis F.; Prosper, Harrison; Sekmen, Sezen; Guragain, Samir; Hohlmann, Marcus; Kalakhety, Himali; Mermerkaya, Hamit; Ralich, Robert; Vodopiyanov, Igor; Adams, Mark Raymond; Anghel, Ioana Maria; Apanasevich, Leonard; Bazterra, Victor Eduardo; Betts, Russell Richard; Callner, Jeremy; Cavanaugh, Richard; Dragoiu, Cosmin; Garcia-Solis, Edmundo Javier; Gerber, Cecilia Elena; Hofman, David Jonathan; Khalatian, Samvel; Mironov, Camelia; Shabalina, Elizaveta; Smoron, Agata; Varelas, Nikos; Akgun, Ugur; Albayrak, Elif Asli; Bilki, Burak; Cankocak, Kerem; Chung, Kwangzoo; Clarida, Warren; Duru, Firdevs; Lae, Chung Khim; McCliment, Edward; Merlo, Jean-Pierre; Mestvirishvili, Alexi; Moeller, Anthony; Nachtman, Jane; Newsom, Charles Ray; Norbeck, Edwin; Olson, Jonathan; Onel, Yasar; Ozok, Ferhat; Sen, Sercan; Wetzel, James; Yetkin, Taylan; Yi, Kai; Barnett, Bruce Arnold; Blumenfeld, Barry; Bonato, Alessio; Eskew, Christopher; Fehling, David; Giurgiu, Gavril; Gritsan, Andrei; Guo, Zijin; Hu, Guofan; Maksimovic, Petar; Rappoccio, Salvatore; Swartz, Morris; Tran, Nhan Viet; Baringer, Philip; Bean, Alice; Grachov, Oleg; Murray, Michael; Radicci, Valeria; Sanders, Stephen; Wood, Jeffrey Scott; Zhukova, Victoria; Bandurin, Dmitry; Barfuss, Anne-fleur; Bolton, Tim; Chakaberia, Irakli; Kaadze, Ketino; Maravin, Yurii; Shrestha, Shruti; Svintradze, Irakli; Wan, Zongru; Gronberg, Jeffrey; Lange, David; Wright, Douglas; Baden, Drew; Boutemeur, Madjid; Eno, Sarah Catherine; Ferencek, Dinko; Hadley, Nicholas John; Kellogg, Richard G.; Kirn, Malina; Kunori, Shuichi; Rossato, Kenneth; Rumerio, Paolo; Santanastasio, Francesco; Skuja, Andris; Temple, Jeffrey; Tonjes, Marguerite; Tonwar, Suresh C.; Twedt, Elizabeth; Alver, Burak; Bauer, Gerry; Bendavid, Joshua; Busza, Wit; Butz, Erik; Cali, Ivan Amos; Chan, Matthew; D'Enterria, David; Everaerts, Pieter; Gomez Ceballos, Guillelmo; Goncharov, Maxim; Hahn, Kristan Allan; Harris, Philip; Kim, Yongsun; Klute, Markus; Lee, Yen-Jie; Li, Wei; Loizides, Constantinos; Luckey, Paul David; Ma, Teng; Nahn, Steve; Paus, Christoph; Roland, Christof; Roland, Gunther; Rudolph, Matthew; Stephans, George; Sumorok, Konstanty; Sung, Kevin; Wenger, Edward Allen; Wyslouch, Bolek; Xie, Si; Yilmaz, Yetkin; Yoon, Sungho; Cole, Perrie; Cooper, Seth; Cushman, Priscilla; Dahmes, Bryan; De Benedetti, Abraham; Dudero, Phillip Russell; Franzoni, Giovanni; Haupt, Jason; Klapoetke, Kevin; Kubota, Yuichi; Mans, Jeremy; Petyt, David; Rekovic, Vladimir; Rusack, Roger; Sasseville, Michael; Singovsky, Alexander; Cremaldi, Lucien Marcus; Godang, Romulus; Kroeger, Rob; Perera, Lalith; Rahmat, Rahmat; Sanders, David A; Sonnek, Peter; Summers, Don; Bloom, Kenneth; Bose, Suvadeep; Butt, Jamila; Claes, Daniel R.; Dominguez, Aaron; Eads, Michael; Keller, Jason; Kelly, Tony; Kravchenko, Ilya; Lazo-Flores, Jose; Lundstedt, Carl; Malbouisson, Helena; Malik, Sudhir; Snow, Gregory R.; Baur, Ulrich; Iashvili, Ia; Kharchilava, Avto; Kumar, Ashish; Smith, Kenneth; Strang, Michael; Alverson, George; Barberis, Emanuela; Baumgartel, Darin; Boeriu, Oana; McCauley, Thomas; Musienko, Yuri; Reucroft, Steve; Swain, John; Taylor, Lucas; Wood, Darien; Anastassov, Anton; Kubik, Andrew; Ofierzynski, Radoslaw Adrian; Pozdnyakov, Andrey; Schmitt, Michael; Stoynev, Stoyan; Velasco, Mayda; Won, Steven; Antonelli, Louis; Berry, Douglas; Hildreth, Michael; Jessop, Colin; Karmgard, Daniel John; Kolb, Jeff; Kolberg, Ted; Lannon, Kevin; Lynch, Sean; Marinelli, Nancy; Morse, David Michael; Ruchti, Randy; Valls, Nil; Warchol, Jadwiga; Wayne, Mitchell; Ziegler, Jill; Bylsma, Ben; Durkin, Lloyd Stanley; Gu, Jianhui; Killewald, Phillip; Ling, Ta-Yung; Williams, Grayson; Adam, Nadia; Berry, Edmund; Elmer, Peter; Gerbaudo, Davide; Halyo, Valerie; Hunt, Adam; Jones, John; Laird, Edward; Lopes Pegna, David; Marlow, Daniel; Medvedeva, Tatiana; Mooney, Michael; Olsen, James; Piroué, Pierre; Stickland, David; Tully, Christopher; Werner, Jeremy Scott; Zuranski, Andrzej; Acosta, Jhon Gabriel; Huang, Xing Tao; Lopez, Angel; Mendez, Hector; Oliveros, Sandra; Ramirez Vargas, Juan Eduardo; Zatzerklyaniy, Andriy; Alagoz, Enver; Barnes, Virgil E.; Bolla, Gino; Bortoletto, Daniela; Everett, Adam; Garfinkel, Arthur F.; Gecse, Zoltan; Gutay, Laszlo; Jones, Matthew; Koybasi, Ozhan; Laasanen, Alvin T.; Leonardo, Nuno; Liu, Chang; Maroussov, Vassili; Merkel, Petra; Miller, David Harry; Neumeister, Norbert; Potamianos, Karolos; Sedov, Alexey; Shipsey, Ian; Silvers, David; Yoo, Hwi Dong; Zheng, Yu; Jindal, Pratima; Parashar, Neeti; Cuplov, Vesna; Ecklund, Karl Matthew; Geurts, Frank J.M.; Liu, Jinghua H.; Matveev, Mikhail; Morales, Jafet; Padley, Brian Paul; Redjimi, Radia; Roberts, Jay; Betchart, Burton; Bodek, Arie; Chung, Yeon Sei; de Barbaro, Pawel; Demina, Regina; Flacher, Henning; Garcia-Bellido, Aran; Gotra, Yury; Han, Jiyeon; Harel, Amnon; Korjenevski, Sergey; Miner, Daniel Carl; Orbaker, Douglas; Petrillo, Gianluca; Vishnevskiy, Dmitry; Zielinski, Marek; Bhatti, Anwar; Demortier, Luc; Goulianos, Konstantin; Hatakeyama, Kenichi; Lungu, Gheorghe; Mesropian, Christina; Yan, Ming; Atramentov, Oleksiy; Gershtein, Yuri; Halkiadakis, Eva; Hits, Dmitry; Lath, Amitabh; Rose, Keith; Schnetzer, Steve; Somalwar, Sunil; Stone, Robert; Thomas, Scott; Cerizza, Giordano; Hollingsworth, Matthew; Spanier, Stefan; Yang, Zong-Chang; York, Andrew; Asaadi, Jonathan; Eusebi, Ricardo; Gurrola, Alfredo; Kamon, Teruki; Khotilovich, Vadim; Nguyen, Chi Nhan; Pivarski, James; Safonov, Alexei; Sengupta, Sinjini; Toback, David; Weinberger, Michael; Akchurin, Nural; Jeong, Chiyoung; Lee, Sung Won; Popescu, Sorina; Roh, Youn; Sill, Alan; Volobouev, Igor; Wigmans, Richard; Yazgan, Efe; Brownson, Eric; Engh, Daniel; Florez, Carlos; Johns, Willard; Sheldon, Paul; Arenton, Michael Wayne; Balazs, Michael; Buehler, Marc; Conetti, Sergio; Cox, Bradley; Hirosky, Robert; Ledovskoy, Alexander; Neu, Christopher; Yohay, Rachel; Gollapinni, Sowjanya; Gunthoti, Kranti; Harr, Robert; Karchin, Paul Edmund; Mattson, Mark; Anderson, Michael; Bachtis, Michail; Bellinger, James Nugent; Carlsmith, Duncan; Dasu, Sridhara; Efron, Jonathan; Flood, Kevin; Gray, Lindsey; Grogg, Kira Suzanne; Grothe, Monika; Hall-Wilton, Richard; Klabbers, Pamela; Klukas, Jeffrey; Lazaridis, Christos; Leonard, Jessica; Loveless, Richard; Mohapatra, Ajit; Polese, Giovanni; Reeder, Don; Savin, Alexander; Smith, Wesley H.; Swanson, Joshua; Weinberg, Marc


    Measurements of inclusive charged-hadron transverse-momentum and pseudorapidity distributions are presented for proton-proton collisions at sqrt(s) = 0.9 and 2.36 TeV. The data were collected with the CMS detector during the LHC commissioning in December 2009. For non-single-diffractive interactions, the average charged-hadron transverse momentum is measured to be 0.46 +/- 0.01 (stat.) +/- 0.01 (syst.) GeV/c at 0.9 TeV and 0.50 +/- 0.01 (stat.) +/- 0.01 (syst.) GeV/c at 2.36 TeV, for pseudorapidities between -2.4 and +2.4. At these energies, the measured pseudorapidity densities in the central region, dN(charged)/d(eta) for |eta| < 0.5, are 3.48 +/- 0.02 (stat.) +/- 0.13 (syst.) and 4.47 +/- 0.04 (stat.) +/- 0.16 (syst.), respectively. The results at 0.9 TeV are in agreement with previous measurements and confirm the expectation of near equal hadron production in p-pbar and pp collisions. The results at 2.36 TeV represent the highest-energy measurements at a particle collider to date.

  14. Deep-UV 236.5  nm laser by fourth-harmonic generation of a single-crystal fiber Nd:YAG oscillator. (United States)

    Deyra, Loïc; Martial, Igor; Didierjean, Julien; Balembois, François; Georges, Patrick


    We demonstrate a deep-UV laser at 236.5 nm based on extracavity fourth-harmonic generation of a Q-switched Nd:YAG single-crystal fiber laser at 946 nm. We first compare two nonlinear crystals available for second-harmonic generation: LBO and BiBO. The best results at 473 nm are obtained with a BiBO crystal, with an average output power of 3.4 W at 20 kHz, corresponding to a second-harmonic generation efficiency of 38%. This blue laser is frequency-converted to 236.5 nm in a BBO crystal with an overall fourth-harmonic generation yield of 6.5%, corresponding to an average output power of 600 mW at 20 kHz. This represents an order of magnitude increase in average power and energy compared to previously reported pulsed lasers at 236.5 nm. This work opens the possibility of LIDAR detection of dangerous compounds for military or civilian applications. PMID:24978960

  15. Detection of RtN236T Mutation Associated with Adefovir Dipivoxil Resistance in Hepatitis B Infected Patients with YMDD Mutations in Tehran

    Directory of Open Access Journals (Sweden)

    Seyed Hamid Reza Monavari


    Full Text Available Background Objectives: The risk of adefovir dipivoxil resistance emergence has increased in lamivudine-resistant hepatitis B infected patients. The mutations known as causing adefovir resistance, rtN236T and rtA181V/T, are detected within the D and B functional domain of the HBV polymerase, respectively. In this study, we intended to determine the pre-existing adefovir-resistance mutations in patients infected with LAM resistant mutants prior to starting adefovir therapy.Material and Methods: The study included 30 patients with chronic hepatitis B with lamivudine resistance mutations in the YMDD motif that experienced viral breakthrough.Results: After alignment of protein coding sequences, the rtN236T mutation was observed in two (6.6 % patients, while twenty-eight others had neither rtN236T, nor rtA181V/T mutation. All 30 patients were infected with genotype D of hepatitis B virus.Conclusions: The early detection of LAM-resistance mutations may allow a timely chance of therapy to avoid hepatitis flare-up. This data suggests that monitoring of ADV-resistance mutations in ADV naive patients can be considered in selecting the appropriate anti-viral regimen.

  16. Stopping of 236 keV - 3.019 MeV protons in mylar and polypropylene films (United States)

    Damache, S.; Ouichaoui, S.; Belhout, A.; Medouni, A.; Toumert, I.


    The stopping powers of polypropylene and mylar polymers for protons have been accurately measured over the energy intervals Ep=(0.352-3.009) MeV and Ep=(0.236-3.019) MeV, respectively. Ab initio calculations using the Sigmund-Schinner binary collision theory for electronic stopping yielded S( E) values fairly consistent with the measured data that show no noticeable deviations from the Bragg-Kleeman additivity rule. The data have also been analyzed in the framework of the modified Bethe-Bloch theory assuming additivity. Values of the mean excitation and ionization potential, I, and of the Barkas parameter, b, have been deduced for the two polymers and for their (C, O) atomic constituents by adopting values of these parameters recommended in the ICRU-49 report for the H element. Thus, the respective I-values {(56.90 ± 0.72) eV, (79.92 ± 1.30) eV} for the two polymers and the same b-value 1.39 for their (C, O) atomic constituents have been determined by adopting for H the value b=1.8, while the I-values {(81.73 ± 1.38) eV, (109.46 ± 6.55) eV} have been deduced for the (C, O) constituents by adopting for H the value I=19.2 eV. Priorily, the shell, Barkas and Bloch corrections to the calculated S( E) values have been evaluated for both polymers over the explored respective energy ranges. The obtained results are discussed in comparison with previous ones when reported in the literature to our knowledge.

  17. Isobaric heat capacities of R245fa and R236fa in liquid phase at temperatures from (315 to 365) K and pressures up to 5.5 MPa

    International Nuclear Information System (INIS)

    Highlights: • Isobaric heat capacity for compressed liquid R245fa and R236fa were measured. • Experimental data was correlated to an empirical equation. • Comparison was carried out between present data and latest equation of states. - Abstract: Isobaric heat capacities of compressed liquid 1,1,1,3,3-pentafluoropropane (R245fa) and 1,1,1,3,3,3-hexafluoropropane (R236fa) were measured by scanning calorimetry. The experimental system basically consists of a calvet calorimeter (Setaram C80) and a pressure balance unit. A total of 55 data points for liquid R245fa and 52 data points for liquid R236fa were obtained at temperatures from (315 to 365) K and pressures up to 5.5 MPa. The uncertainties for the heat capacity of R245fa and R236fa were estimated to be (1.8 and 1.6)%, respectively. The experimental data was correlated to an empirical equation, the form of which was decided by stepwise fit method. The average absolute percentage deviations between the data points and the equation were (0.23 and 0.10)% for R245fa and R236fa

  18. Accurate measurements of fission-fragment yields in 234,235,236,238U(γ,f) with the SOFIA set-up (United States)

    Chatillon, A.; Taïeb, J.; Martin, J.-F.; Pellereau, E.; Boutoux, G.; Gorbinet, T.; Grente, L.; Bélier, G.; Laurent, B.; Alvarez-Pol, H.; Ayyad, Y.; Benlliure, J.; Caamaño, M.; Audouin, L.; Casarejos, E.; Cortina-Gil, D.; Farget, F.; Fernández-Domínguez, B.; Heinz, A.; Jurado, B.; Kelić-Heil, A.; Kurz, N.; Lindberg, S.; Löher, B.; Nociforo, C.; Paradela, C.; Pietri, S.; Ramos, D.; Rodriguez-Sanchez, J.-L.; Rodrìguez-Tajes, C.; Rossi, D.; Schmidt, K.-H.; Simon, H.; Tassan-Got, L.; Törnqvist, H.; Vargas, J.; Voss, B.; Weick, H.; Yan, Y.


    SOFIA (Studies On Fission with Aladin) is a new experimental set-up dedicated to accurate measurement of fission-fragments isotopic yields. It is located at GSI, the only place to use inverse kinematics at relativistic energies in order to study the (γ,f) electromagnetic-induced fission. The SOFIA set-up is a large-acceptance magnetic spectrometer, which allows to fully identify both fission fragments in coincidence on the whole fission-fragment range. This paper will report on fission yields obtained in 234,235,236,238U(γ,f) reactions.

  19. Bose-Einstein correlations with CMS detector at the LHC at √s = 0.9 and 2.36 TeV

    International Nuclear Information System (INIS)

    Bose-Einstein correlations between identical particles are measured using samples of proton-proton collisions at 0.9 and 2.36 TeV centre-of-mass energy, recorded by the CMS experiment at the CERN Large Hadron Collider. The signal is observed in the form of an enhancement of pairs of the same-sign charged particles with small relative momentum. A significant increase of the size of the correlated particle emission region with the particle multiplicity in the event is observed

  20. Accurate measurements of fission-fragment yields in 234,235,236,238U(γ,f with the SOFIA set-up

    Directory of Open Access Journals (Sweden)

    Chatillon A.


    Full Text Available SOFIA (Studies On Fission with Aladin is a new experimental set-up dedicated to accurate measurement of fission-fragments isotopic yields. It is located at GSI, the only place to use inverse kinematics at relativistic energies in order to study the (γ,f electromagnetic-induced fission. The SOFIA set-up is a large-acceptance magnetic spectrometer, which allows to fully identify both fission fragments in coincidence on the whole fission-fragment range. This paper will report on fission yields obtained in 234,235,236,238U(γ,f reactions.

  1. Survey of potential markets for devices using Californium-252

    International Nuclear Information System (INIS)

    Potential applications for devices or systems containing 252Cf in the years from 1975 to 1980 are estimated. The estimated number of devices and associated business value were derived from a survey of 46 industrial, educational and governmental organizations conducted from Jan. to May, 1975. Applications for devices and systems based on 252Cf are expected to increase by a factor of 7 in the 6-y period from 1975 to 1980. The annual business value of 252Cf devices should increase from 1.5 million dollars in 1975 to 10.8 million dollars in 1980. The potential European market should be several times as large as the US market, based on actual sales of 252Cf, which have been two to four times greater in Europe than in the US

  2. The protective cell petrus for the production of californium 252

    International Nuclear Information System (INIS)

    The alpha, beta, gamma, neutron cell which is described in the present paper is devoted to the transplutonium element production and study. It is located at the CEN in Fontenay-aux-Roses (France). The 4 feet ordinary concrete shielding made of stacked blocs allows the manipulation of radioactive sources as high as 1000 curies of 1 MeV gamma rays and with a fast neutrons flux of 109 The airtight alpha containment box is equipped with two transfer systems, one consists of a parallelepiped shaped airtight box located in a turntable, the other uses standard cylindrical containers made of polyethylene. The general equipment and the main setting up are also described. (authors)

  3. Californium-252 neutron activation facility at the Savannah River Laboratory

    International Nuclear Information System (INIS)

    A neutron irradiation facility has been established to develop new analytical methods and for the support of research programs. A major component of this facility is a 252Cf source which provides both fission spectrum and thermal neutrons. (U.S.)

  4. Californium-252 brachytherapy for anal and ano-rectal carcinoma

    International Nuclear Information System (INIS)

    Surgery has historically been the standard treatment for anal, ano-rectal and rectal carcinoma but is prone to local or regional failure. Over the past 15 years there has been increasing interest in and success with radiation therapy and combined chemoradiotherapy for treatment of anal and ano-rectal cancers. Cf-252 brachytherapy combined with external beam teletherapy has been investigated for anal and ano-rectal lesions at the Univ. of Kentucky with encouraging results

  5. Mobile equipment for neutron radiography using a californium-252 source

    International Nuclear Information System (INIS)

    The basic requirements for successful neutron radiography are first summarised and the use of 252Cf is placed in perspective by comparing its properties with those of sources based on the Be (γ, n) and Be (α, n) reactions which have a broadly similar range of applications. The more essential design features of mobile neutron radiography equipment are next examined in some detail, to show how the often conflicting requirements of optimum beam production and adequate shielding may be reconciled. An assembly with a maximum dimension around 1 m with a source of 1 mg is used as an example. The design data used are reproduced in graphical form to permit designs to be scaled to suit the source available and the requirements. The selection of suitable image recorders for 252Cf radiography is discussed with the conclusion that the gadolinium foil-film combinations are likely to remain the normal choice. Demonstration radiographs are presented with particular reference to the location of residual casting sand in gas-cooled turbine blades. Finally, it is suggested that other applications for mobile 252Cf-based neutron radiography equipment will be found in the ordnance, aero-space, chemical and nuclear fuel manufacturing industries. (author)

  6. Automated absolute activation analysis with californium-252 sources

    Energy Technology Data Exchange (ETDEWEB)

    MacMurdo, K.W.; Bowman, W.W.


    A 100-mg /sup 252/Cf neutron activation analysis facility is used routinely at the Savannah River Laboratory for multielement analysis of many solid and liquid samples. An absolute analysis technique converts counting data directly to elemental concentration without the use of classical comparative standards and flux monitors. With the totally automated pneumatic sample transfer system, cyclic irradiation-decay-count regimes can be pre-selected for up to 40 samples, and samples can be analyzed with the facility unattended. An automatic data control system starts and stops a high-resolution gamma-ray spectrometer and/or a delayed-neutron detector; the system also stores data and controls output modes. Gamma ray data are reduced by three main programs in the IBM 360/195 computer: the 4096-channel spectrum and pertinent experimental timing, counting, and sample data are stored on magnetic tape; the spectrum is then reduced to a list of significant photopeak energies, integrated areas, and their associated statistical errors; and the third program assigns gamma ray photopeaks to the appropriate neutron activation product(s) by comparing photopeak energies to tabulated gamma ray energies. Photopeak areas are then converted to elemental concentration by using experimental timing and sample data, calculated elemental neutron capture rates, absolute detector efficiencies, and absolute spectroscopic decay data. Calculational procedures have been developed so that fissile material can be analyzed by cyclic neutron activation and delayed-neutron counting procedures. These calculations are based on a 6 half-life group model of delayed neutron emission; calculations include corrections for delayed neutron interference from /sup 17/O. Detection sensitivities of < or = 400 ppB for natural uranium and 8 ppB (< or = 0.5 (nCi/g)) for /sup 239/Pu were demonstrated with 15-g samples at a throughput of up to 140 per day. Over 40 elements can be detected at the sub-ppM level.

  7. Californium-based neutron radiography for corrosion detection in aircraft

    International Nuclear Information System (INIS)

    In support of an overall program aimed at minimizing disassembly and reducing inspection time during aircraft maintenance, a series of projects has been carried out to determine the feasibility of applying neutron radiographic techniques to the nondestructive (NDT) inspection of aircraft and aircraft components. These investigations have clearly demonstrated the superiority of neutron radiography over all other NDT techniques in its ability to detect surface and subsurface corrosion in aircraft structure. This capability is particularly significant where the corrosion is hidden behind thick metallic structural members. The neutron radiographic technique has been applied successfully to detect corrosion in the wing tank of E-2C, C-130, and DC-9 aircraft; rear stabilators of F-4 and F-111 aircraft; aft spar, starboard and port wing, and rudder of the F-8; fuselage skin of the 727; rotary blades of AH-1 and SH-3 helicopters; rotary tail flaps of the UH-2 helicopter; and nose landing gear of A-7 aircraft

  8. Automated absolute activation analysis with californium-252 sources

    International Nuclear Information System (INIS)

    A 100-mg 252Cf neutron activation analysis facility is used routinely at the Savannah River Laboratory for multielement analysis of many solid and liquid samples. An absolute analysis technique converts counting data directly to elemental concentration without the use of classical comparative standards and flux monitors. With the totally automated pneumatic sample transfer system, cyclic irradiation-decay-count regimes can be pre-selected for up to 40 samples, and samples can be analyzed with the facility unattended. An automatic data control system starts and stops a high-resolution gamma-ray spectrometer and/or a delayed-neutron detector; the system also stores data and controls output modes. Gamma ray data are reduced by three main programs in the IBM 360/195 computer: the 4096-channel spectrum and pertinent experimental timing, counting, and sample data are stored on magnetic tape; the spectrum is then reduced to a list of significant photopeak energies, integrated areas, and their associated statistical errors; and the third program assigns gamma ray photopeaks to the appropriate neutron activation product(s) by comparing photopeak energies to tabulated gamma ray energies. Photopeak areas are then converted to elemental concentration by using experimental timing and sample data, calculated elemental neutron capture rates, absolute detector efficiencies, and absolute spectroscopic decay data. Calculational procedures have been developed so that fissile material can be analyzed by cyclic neutron activation and delayed-neutron counting procedures. These calculations are based on a 6 half-life group model of delayed neutron emission; calculations include corrections for delayed neutron interference from 17O. Detection sensitivities of 239Pu were demonstrated with 15-g samples at a throughput of up to 140 per day. Over 40 elements can be detected at the sub-ppM level

  9. X-ray measurement of electron and magnetic-field energy densities in the west lobe of the giant radio galaxy 3C 236

    CERN Document Server

    Isobe, Naoki


    X-ray emission associated with the west lobe of the giant radio galaxy, 3C 236, was investigated with the Suzaku observatory, to evaluate the energetics in the lobe. After removing contamination from X-ray sources detected with Chandra and subtracting the X-ray and non-X-ray backgrounds, the Suzaku spectrum from the lobe was reproduced by a power-low model with a photon index of $\\Gamma = 2.23_{-0.38-0.12}^{+0.44+0.14}$ where the first and second errors represent the statistical and systematic ones, respectively. Within the errors, the X-ray index was consistent with the radio synchrotron one, $\\Gamma_{\\rm R} = 1.74 \\pm 0.07$, estimated in the 326 -- 2695 MHz range. This agreement supports that the X-ray emission is attributed to the inverse-Compton (IC) radiation from the synchrotron electrons filling the lobe, where the cosmic microwave background photons are up-scattered. This result made 3C 236 the largest radio galaxy, of which the lobe has ever been probed through the IC X-ray photons. When the photon i...

  10. Measurement of the (236)U(n,f) cross section from 170 MeV to 2 MeV at the CERN n_TOF Facility

    Energy Technology Data Exchange (ETDEWEB)

    Sarmento, R. [Instituto Tecnologico e Nuclear, Sacavem, Portugal; Goncalves, I. F. [Instituto Tecnologico e Nuclear, Sacavem, Portugal; Vaz, P. [Instituto Tecnologico e Nuclear (ITN), Lisbon, Portugal; Carrapico, C. [Instituto Tecnologico e Nuclear (ITN), Lisbon, Portugal; Carrillo de Albornoz, A. [Instituto Tecnologico e Nuclear, Sacavem, Portugal; Marques, L. [Instituto Tecnologico e Nuclear, Sacavem, Portugal; Salgado, J. [Instituto Tecnologico e Nuclear, Sacavem, Portugal; Tavora, L. [Instituto Tecnologico e Nuclear, Sacavem, Portugal; Calviani, M. [CERN, Geneva, Switzerland; Andriamonje, S. [CERN, Geneva, Switzerland; Chiaveri, E. [CERN, Geneva, Switzerland; Guerrero, C. [CERN, Geneva, Switzerland; Vlachoudis, V. [CERN, Geneva, Switzerland; Colonna, N. [Instituto Nazionale di Fisica Nucleare, Bari, Italy; Barbagallo, M. [Instituto Nazionale di Fisica Nucleare, Bari, Italy; Marrone, S. [Instituto Nazionale di Fisica Nucleare, Bari, Italy; Tagliente, G. [Instituto Nazionale di Fisica Nucleare, Bari, Italy; Terlizzi, R. [Instituto Nazionale di Fisica Nucleare, Bari, Italy; Belloni, F. [Instituto Nazionale de Fisica Nucleare, Trieste, Italy; Fuji, K. [Instituto Nazionale de Fisica Nucleare, Trieste, Italy; Milazzo, P. M. [Instituto Nazionale de Fisica Nucleare, Trieste, Italy; Moreau, C. [Instituto Nazionale de Fisica Nucleare, Trieste, Italy; Alvarez-Velarde, F. [Centro de Investigaciones Energeticas Medioambientales y Technol., Madrid, Spain; Cano-Ott, D. [CIEMAT, Madrid; Gonzalez-Romero, E. [CIEMAT, Madrid; Guerrero, C. [Centro de Investigaciones Energeticas Medioambientales y Technol., Madrid, Spain; Martinez, T. [Centro de Investigaciones Energeticas Medioambientales y Technol., Madrid, Spain; Mendoza, E. [Centro de Investigaciones Energeticas Medioambientales y Technol., Madrid, Spain; Villamarin, D. [Centro de Investigaciones Energeticas Medioambientales y Technol., Madrid, Spain; Vicente, M. C. [Centro de Investigaciones Energeticas Medioambientales y Technol., Madrid, Spain; Andrzejewski, Jozef [ORNL; Karamanis, D. [University of Ioannina, Greece; Marganiec, J. [University of Lodz; Assimakopoulos, P. A. [University of Ioannina, Greece; Karadimos, D. [University of Ioannina, Greece; Papachristodoulou, C. [University of Ioannina, Greece; Patronis, N. [University of Ioannina, Greece; Audouin, L. [Universite Paris XI, Orsay, France; David, S. [CNRS, Orsay, France; Ferrant, L. [Universite Paris XI, Orsay, France; Isaev, S. [CNRS/IN2P3, Orsay, France; Stephan, C. [CNRS/IN2P3, Orsay, France; Tassan-Got, L. [CNRS/IN2P3, Orsay, France; Badurek, G. [Vienna University of Technology, Austria; Jericha, E. [Vienna University of Technology, Austria; Leeb, H. [Vienna University of Technology, Austria; Oberhummer, H. [Vienna University of Technology, Austria; Pigni, M. T. [Vienna University of Technology, Austria; Baumann, P. [CNRS, Strasbourg, France; Kerveno, M. [CNRS, Strasbourg, France; Lukic, S. [CNRS, Strasbourg, France; Rudolf, G. [CNRS, Strasbourg, France; Becvar, F. [Charles University, Prague, Czech Republic; Krticka, M. [Charles University, Prague, Czech Republic; Calvino, F. [Universidad Politecnica de Madrid, Spain; Capote, R. [International Atomic Energy Agency (IAEA); Frais-Koelbl, H. [International Atomic Energy Agency (IAEA); Griesmayer, E. [International Atomic Energy Agency (IAEA); Mengoni, A. [International Atomic Energy Agency (IAEA); Praena, J. [University of Seville; Capote, R. [University of Seville; Lozano, M. [University of Seville; Quesada, J. [University of Seville; Cennini (et al.), P. [INFN, Laboratori Nazionali di Legnaro, Italy; Chapel, V. [University of Ciombra, Portugal; Ferreira-Marques, R. [University of Ciombra, Portugal; Lindote, A. [University of Ciombra, Portugal; Lopes, I. [University of Ciombra, Portugal; Neves, F. [University of Ciombra, Portugal; et al.


    The neutron-induced fission cross section of {sup 236}U was measured at the neutron Time-of-Flight (n-TOF) facility at CERN relative to the standard {sup 235}U(n,f) cross section for neutron energies ranging from above thermal to several MeV. The measurement, covering the full range simultaneously, was performed with a fast ionization chamber, taking advantage of the high resolution of the n-TOF spectrometer. The n-TOF results confirm that the first resonance at 5.45 eV is largely overestimated in some nuclear data libraries. The resonance triplet around 1.2 keV was measured with high resolution and resonance parameters were determined with good accuracy. Resonances at high energy have also been observed and characterized and different values for the cross section are provided for the region between 10 keV and the fission threshold. The present work indicates various shortcomings of the current nuclear data libraries in the subthreshold region and provides the basis for an accurate re-evaluation of the {sup 236}U(n,f) cross section, which is of great relevance for the development of emerging or innovative nuclear reactor technologies.

  11. On the energy balance and on dynamical aspects of proton induced fission of 235,236,238U by coincident spectroscopy of neutrons and fragments

    International Nuclear Information System (INIS)

    An improved experimental set up has been developed and applied to the measurement of neutrons in coincidence with fragments originating in proton induced fission of heavy nuclei. The reaction systems studied were p+235,236,238U for Ep = 12.84 MeV and Ep = 20.4 MeV. Data interpretation focuses on the following aspects: 1. Neutron multiplicities and average kinetic energies were studied as a function of fragment mass and total kinetic energies of these fragments. 2. The isotropic (i.e. the prefission plus scission) neutrons reveal a dependence of their multiplicities on the primary excitation energy E*CN that indicates a preference of the neutron over the fission exit channel with increasing E*CN not found in statistical model calculations. 3. A consistent analysis of all existing data for p+235,236,238U covering the interval 18 MeV ≤ E*CN ≤ 30 MeV in terms of neutron multiplicities and nuclear temperatures yields that pre- and postfission neutrons carry away comparable fractions of the additional energy ΔE*CN. 4. The total energy released in neutron and fragment emission is shown for p+238U (Ep = 20.4 MeV) to compare with the energy expected from mass tables for the fragmentations selected to within 2-3%. (orig.)

  12. Charged-particle multiplicity measurement in proton-proton collisions at $\\sqrt{s}$ = 0.9 and 2.36 TeV with ALICE at LHC

    CERN Document Server

    Aamodt, K; Abeysekara, U; Abrahantes Quintana, A; Abramyan, A; Adamová, D; Aggarwal, M M; Aglieri Rinella, G; Agocs, A G; Aguilar Salazar, S; Ahammed, Z; Ahmad, A; Ahmad, N; Ahn, S U; Akimoto, R; Akindinov, A; Aleksandrov, D; Alessandro, B; Alfaro Molina, R; Alici, A; Almaráz Aviña, E; Alme, J; Altini, V; Altinpinar, S; Alt, T; Andrei, C; Andronic, A; Anelli, G; Angelov, V; Anson, C; Anticic, T; Antinori, F; Antinori, S; Antipin, K; Antonczyk, D; Antonioli, P; Anzo, A; Aphecetche, L; Appelshäuser, H; Arcelli, S; Arceo, R; Arend, A; Armesto, N; Arnaldi, R; Aronsson, T; Arsene, I C; Asryan, A; Augustinus, A; Averbeck, R; Awes, T C; Äystö, J; Azmi, M D; Bablok, S; Bach, M; Badalà, A; Baek, Y W; Bagnasco, S; Bailhache, R; Bala, R; Baldisseri, A; Baldi, A; Bán, J; Barbera, R; Barile, F; Barnaföldi, G G; Barnby, L; Barret, V; Bartke, J; Basile, M; Basmanov, V; Bastid, N; Bathen, B; Batigne, G; Batyunya, B; Baumann, C; Bearden, I G; Becker, B; Belikov, I; Bellwied, R; Belmont-Moreno, E; Belogianni, A; Benhabib, L; Beolé, S; Berceanu, I; Bercuci, A; Berdermann, E; Berdnikov, Y; Betev, L; Bhasin, A; Bhati, A K; Bianchi, L; Bianchin, C; Bianchi, N; Bielcík, J; Bielcíková, J; Bilandzic, A; Bimbot, L; Biolcati, E; Blanc, A; Blanco, F; Blanco, F; Blau, D; Blume, C; Boccioli, M; Bock, N; Bogdanov, A; Bøggild, H; Bogolyubsky, M; Bohm, J; Boldizsár, L; Bombara, M; Bombonati, C; Bondila, M; Borel, H; Borshchov, V; Borisov, A; Bortolin, C; Bose, S; Bosisio, L; Bossú, F; Botje, M; Böttger, S; Bourdaud, G; Boyer, B; Braun, M; Braun-Munzinger, P; Bravina, L; Bregant, M; Breitner, T; Bruckner, G; Bruna, E; Bruno, G E; Brun, R; Budnikov, D; Buesching, H; Buncic, P; Busch, O; Buthelezi, Z; Caffarri, D; Caines, H; Cai, X; Camacho, E; Camerini, P; Campbell, M; Canoa Roman, V; Capitani, G P; Cara Romeo, G; Carena, F; Carena, W; Carminati, F; Casanova Díaz, A; Caselle, M; Castillo Castellanos, J; Castillo Hernandez, J F; Catanescu, V; Cattaruzza, E; Cavicchioli, C; Cerello, P; Chambert, V; Chang, B; Chapeland, S; Charpy, A; Charvet, J L; Chattopadhyay, S; Chattopadhyay, S; Cherney, M; Cheshkov, C; Cheynis, B; Chiavassa, E; Chibante Barroso, V; Chinellato, D D; Chochula, P; Choi, K; Chojnacki, M; Christakoglou, P; Christensen, C H; Christiansen, P; Chujo, T; Chuman, F; Cicalo, C; Cifarelli, L; Cindolo, F; Cleymans, J; Cobanoglu, O; Coffin, J P; Coli, S; Colla, A; Conesa Balbastre, G; Conesa del Valle, Z; Conner, E S; Constantin, P; Contin, G; Contreras, J G; Cormier, T M; Corrales Morales, Y; Cortese, P; Cortés Maldonado, I; Cosentino, M R; Costa, F; Cotallo, M E; Crescio, E; Crochet, P; Cuautle, E; Cunqueiro, L; Cussonneau, J; Dainese, A; Dalsgaard, H H; Danu, A; Dash, A; Dash, S; Das, I; Das, S; de Barros, G O V; De Caro, A; de Cataldo, G; de Cuveland, J; De Falco, A; de Gaspari, M; de Groot, J; De Gruttola, D; de Haas, A P; De Marco, N; De Pasquale, S; De Remigis, R; de Rooij, R; de Vaux, G; Delagrange, H; Dellacasa, G; Deloff, A; Demanov, V; Dénes, E; Deppman, A; D'Erasmo, G; Derkach, D; Devaux, A; Di Bari, D; Di Giglio, C; Di Liberto, S; Di Mauro, A; Di Nezza, P; Dialinas, M; Díaz, L; Díaz, R; Dietel, T; Divià, R; Djuvsland, Ø; Dobretsov, V; Dobrin, A; Dobrowolski, T; Domínguez, I; Don, D M M; Don 46 O Dordic, D M M; Dönigus, B; Dubey, A K; Dubuisson, J; Ducroux, L; Dupieux, P; Dutta Majumdar, A K; Dutta Majumdar, M R; Elia, D; Emschermann, D; Enokizono, A; Espagnon, B; Estienne, M; Esumi, S; Evans, D; Evrard, S; Eyyubova, G; Fabjan, C W; Fabris, D; Faivre, J; Falchieri, D; Fantoni, A; Fasel, M; Fateev, O; Fearick, R; Fedunov, A; Fehlker, D; Fekete, V; Felea, D; Fenton-Olsen, B; Feofilov, G; Fernández Téllez, A; Ferreiro, E G; Ferretti, A; Ferretti, R; Figueredo, M A S; Filchagin, S; Fini, R; Fionda, F M; Fiore, E M; Floris, M; Fodor, Z; Foertsch, S; Foka, P; Fokin, S; Formenti, F; Fragiacomo, E; Fragkiadakis, M; Frankenfeld, U; Frolov, A; Fuchs, U; Furano, F; Furget, C; Fusco Girard, M; Gaardhøje, J J; Gadrat, S; Gagliardi, M; Gago, A; Gallio, M; Ganoti, P; Ganti, M S; Garabatos, C; García Trapaga, C; Gebelein, J; Gemme, R; Germain, M; Gheata, A; Gheata, M; Ghidini, B; Ghosh, P; Giraudo, G; Giubellino, P; Gladysz-Dziadus, E; Glasow, R; Glässel, P; Glenn, A; Gomez Jiménez, R; González Santos, H; González-Trueba, L H; González-Zamora, P; Gorbunov, S; Gorbunov, Y; Gotovac, S; Gottschlag, H; Grabski, V; Grajcarek, R; Grelli, A; Grigoras, A; Grigoras, C; Grigoriev, V; Grigoryan, A; Grigoryan, S; Grinyov, B; Grion, N; Gros, P; Grosse-Oetringhaus, J F; Grossiord, J Y; Grosso, R; Guber, F; Guernane, R; Guerzoni, B; Gulbrandsen, K; Gulkanyan, H; Gunji, T; Gupta, A; Gupta, R; Gustafsson, H A; Gutbrod, H; Haaland, Ø; Hadjidakis, C; Haiduc, M; Hamagaki, H; Hamar, G; Hamblen, J; Han, B H; Harris, J W; Hartig, M; Harutyunyan, A; Hasch, D; Hasegan, D; Hatzifotiadou, D; Hayrapetyan, A; Heide, M; Heinz, M; Helstrup, H; Herghelegiu, A; Hernández, C; Herrera Corral, G; Herrmann, N; Hetland, K F; Hicks, B; Hiei, A; Hille, P T; Hippolyte, B; Horaguchi, T; Hori, Y; Hristov, P; Hrivnácová, I; Huber, S; Humanic, T J; Hu, S; Huang, M; Hutter, D; Hwang, D S; Ichou, R; Ilkaev, R; Ilkiv, I; Inaba, M; Innocenti, P G; Ippolitov, M; Irfan, M; Ivan, C; Ivanov, A; Ivanov, M; Ivanov, V; Iwasaki, T; Jacholkowski, A; Jacobs, P; Jancurová, L; Jangal, S; Janik, R; Jena, C; Jena, S; Jirden, L; Jones, G T; Jones, P G; Jovanovic, P; Jung, H; Jung, W; Jusko, A; Kaidalov, A B; Kalcher, S; Kalinák, P; Kalisky, M; Kalliokoski, T; Kalweit, A; Kamal, A; Kamermans, R; Kanaki, K; Kang, E; Kang, J H; Kapitan, J; Kaplin, V; Kapusta, S; Karavichev, O; Karavicheva, T; Karpechev, E; Kazantsev, A; Kebschull, U; Keidel, R; Khan, M M; Khan, S A; Khanzadeev, A; Kharlov, Y; Kikola, D; Kileng, B; Kim, D J; Kim, D S; Kim, D W; Kim, H N; Kim, J H; Kim, J; Kim, J S; Kim, M; Kim, M; Kim, S H; Kim, S; Kim, Y; Kirsch, S; Kiselev, S; Kisel, I; Kisiel, A; Klay, J L; Klein-Bösing, C; Klein, J; Kliemant, M; Klovning, A; Kluge, A; Kniege, S; Koch, K; Kolevatov, R; Kolojvari, A; Kondratiev, V; Kondratyeva, N; Konevskih, A; Kornas, E; Kour, R; Kowalski, M; Kox, S; Kozlov, K; Králik, I; Kral, J; Kramer, F; Kraus, I; Kravcáková, A; Krawutschke, T; Krivda, M; Krumbhorn, D; Krus, M; Kryshen, E; Krzewicki, M; Kucheriaev, Y; Kuhn, C; Kuijer, P G; Kumar, L; Kumar, N; Kupczak, R; Kurashvili, P; Kurepin, A; Kurepin, A N; Kuryakin, A; Kushpil, S; Kushpil, V; Kutouski, M; Kvaerno, H; Kweon, M J; Kwon, Y; La Rocca, P; Lackner, F; Ladrón de Guevara, P; Lafage, V; Lal, C; Lara, C; La Rocca, P; Larsen, D T; Laurenti, G; Lazzeroni, C; Le Bornec, Y; Le Bris, N; Lee, H; Lee, K S; Lee, S C; Lefèvre, F; Lehnert, J; Leistam, L; Lenhardt, M; Lenti, V; León, H; León Monzón, I; León Vargas, H; Lévai, P; Li, X; Li, Y; Lietava, R; Lindal, S; Lindenstruth, V; Lippmann, C; Lisa, M A; Listratenko, O; Liu, L; Li, Y; Loginov, V; Lohn, S; López Noriega, M; López-Ramírez, R; López Torres, E; Lopez, X; Løvhøiden, G; Lozea Feijo Soares, A; Lu, S; Lunardon, M; Luparello, G; Luquin, L; Lutz, J R; Ma, K; Ma, R; Madagodahettige-Don, D M; Maevskaya, A; Mager, M; Mahapatra, D P; Maire, A; Makhlyueva, I; Mal'Kevich, D; Malaev, M; Malagalage, K J; Maldonado Cervantes, I; Malek, M; Malkiewicz, T; Malzacher, P; Mamonov, A; Manceau, L; Mangotra, L; Manko, V; Manso, F; Manzari, V; Mao, Y; Mares, J; Margagliotti, G V; Margotti, A; Marín, A; Martashvili, I; Martinengo, P; Martínez Hernandez, M I; Martínez Davalos, A; Martínez García, G; Martínez, M I; Maruyama, Y; Ma, R; Marzari Chiesa, A; Masciocchi, S; Masera, M; Masetti, M; Masoni, A; Massacrier, L; Mastromarco, M; Mastroserio, A; Matthews, Z L; Matyja, A; Mayani, D; Mazza, G; Mazzoni, M A; Meddi, F; Menchaca-Rocha, A; Mendez Lorenzo, P; Meoni, M; Mercado Pérez, J; Mereu, P; Miake, Y; Michalon, A; Miftakhov, N; Milosevic, J; Minafra, F; Mischke, A; Miskowiec, D; Mitu, C; Mizoguchi, K; Mlynarz, J; Mohanty, B; Molnar, L; Mondal, M M; Montaño Zetina, L; Monteno, M; Montes, E; Morando, M; Moretto, S; Morsch, A; Moukhanova, T; Muccifora, V; Mudnic, E; Muhuri, S; Müller, H; Munhoz, M G; Munoz, J; Musa, L; Musso, A; Nandi, B K; Nania, R; Nappi, E; Navach, F; Navin, S; Nayak, T K; Nazarenko, S; Nazarov, G; Nedosekin, A; Nendaz, F; Newby, J; Nianine, A; Nicassio, M; Nielsen, B S; Nikolaev, S; Nikolic, V; Nikulin, S; Nikulin, V; Nilsen, B S; Nilsson, M S; Noferini, F; Nomokonov, P; Nooren, G; Novitzky, N; Nyatha, A; Nygaard, C; Nyiri, A; Nystrand, J; Ochirov, A; Odyniec, G; Oeschler, H; Oinonen, M; Okada, K; Okada, Y; Oldenburg, M; Oleniacz, J; Oppedisano, C; Orsini, F; Ortíz Velázquez, A; Ortona, G; Oskamp, C J; Oskarsson, A; Osmic, F; Österman, L; Ostrowski, P; Otterlund, I; Otwinowski, J; Øvrebekk, G; Oyama, K; Ozawa, K; Pachmayer, Y; Pachr, M; Padilla, F; Pagano, P; Paic, G; Painke, F; Pajares, C; Pal, S K; Pal, S; Palaha, A; Palmeri, A; Panse, R; Papikyan, V; Pappalardo, G S; Park, W J; Pastircák, B; Pastore, C; Paticchio, V; Pavlinov, A; Pawlak, T; Peitzmann, T; Pepato, A; Pereira, H; Peressounko, D; Pérez, C; Perini, D; Perrino, D; Peryt, W; Peschek, J; Pesci, A; Peskov, V; Pestov, Y; Peters, A J; Petrácek, V; Petridis, A; Petris, M; Petrovici, M; Petrov, P; Petta, C; Peyré, J; Piano, S; Piccotti, A; Pikna, M; Pillot, P; Pinazza, O; Pinsky, L; Pitz, N; Piuz, F; Platt, R; Ploskon, M; Pluta, J; Pocheptsov, T; Pochybova, S; Podesta Lerma, P L M; Poggio, F; Poghosyan, M G; Polák, K; Polichtchouk, B; Polozov, P; Polyakov, V; Pommeresch, B; Pop, A; Posa, F; Pospísil, V; Potukuchi, B; Pouthas, J; Prasad, S K; Preghenella, R; Prino, F; Pruneau, C A; Pshenichnov, I; Puddu, G; Pujahari, P; Pulvirenti, A; Punin, A; Punin, V; Putis, M; Putschke, J; Quercigh, E; Rachevski, A; Rademakers, A; Radomski, S; Räihä, T S; Rak, J; Rakotozafindrabe, A; Ramello, L; Ramírez Reyes, A; Rammler, M; Raniwala, R; Raniwala, S; Räsänen, S; Rashevskaya, I; Rath, S; Read, K F; Real, J S; Redlich, K; Renfordt, R; Reolon, A R; Reshetin, A; Rettig, F; Revol, J P; Reygers, K; Ricaud, H; Riccati, L; Ricci, R A; Richter, M; Riedler, P; Riegler, W; Riggi, F; Rivetti, A; Rodriguez Cahuantzi, M; Røed, K; Röhrich, D; Román López, S; Romita, R; Ronchetti, F; Rosinský, P; Rosnet, P; Rossegger, S; Rossi, A; Roukoutakis, F; Rousseau, S; Roy, C; Roy, P; Rubio-Montero, A J; Rui, R; Rusanov, I; Russo, G; Ryabinkin, E; Rybicki, A; Sadovsky, S; Safarík, K; Sahoo, R; Saini, J; Saiz, P; Sakata, D; Salgado, C A; Salgueiro Dominques da Silva, R; Salur, S; Samanta, T; Sambyal, S; Samsonov, V; Sándor, L; Sandoval, A; Sano, M; Sano, S; Santo, R; Santoro, R; Sarkamo, J; Saturnini, P; Scapparone, E; Scarlassara, F; Scharenberg, R P; Schiaua, C; Schicker, R; Schindler, H; Schmidt, C; Schmidt, H R; Schossmaier, K; Schreiner, S; Schuchmann, S; Schukraft, J; Schutz, Y; Schwarz, K; Schweda, K; Scioli, G; Scomparin, E; Segato, G; Semenov, D; Senyukov, S; Seo, J; Serci, S; Serkin, L; Serradilla, E; Sevcenco, A; Sgura, I; Shabratova, G; Shahoyan, R; Sharkov, G; Sharma, N; Sharma, S; Shigaki, K; Shimomura, M; Shtejer, K; Sibiriak, Y; Siciliano, M; Sicking, E; Siddi, E; Siemiarczuk, T; Silenzi, A; Silvermyr, D; Simili, E; Simonetti, G; Singaraju, R; Singhal, V; Singh, R; Sinha, B C; Sinha, T; Sitar, B; Sitta, M; Skaali, T B; Skjerdal, K; Smakal, R; Smirnov, N; Snellings, R; Snow, H; Søgaard, C; Soloviev, A; Soltveit, H K; Soltz, R; Sommer, W; Son, C W; Son, H; Song, M; Soos, C; Soramel, F; Soyk, D; Spyropoulou-Stassinaki, M; Srivastava, B K; Stachel, J; Staley, F; Stan, E; Stefanek, G; Stefanini, G; Steinbeck, T; Stenlund, E; Steyn, G; Stocco, D; Stock, R; Stolpovsky, P; Strmen, P; Suaide, A A P; Subieta Vásquez, M A; Sugitate, T; Suire, C; Sumbera, M; Susa, T; Swoboda, D; Symons, J; Szanto de Toledo, A; Szarka, I; Szostak, A; Szuba, M; Tadel, M; Tagridis, C; Takahara, A; Takahashi, J; Tanabe, R; Tapia Takaki, J D; Taureg, H; Tauro, A; Tavlet, M; Tejeda Muñoz, G; Telesca, A; Terrevoli, C; Thäder, J; Tieulent, R; Tlusty, D; Toia, A; Tolyhy, T; Torcato de Matos, C; Torii, H; Torralba, G; Toscano, L; Tosello, F; Tournaire, A; Traczyk, T; Tribedy, P; Tröger, G; Truesdale, D; Trzaska, W H; Tsiledakis, G; Tsilis, E; Tsuji, T; Tumkin, A; Turrisi, R; Turvey, A; Tveter, T S; Tydesjö, H; Tywoniuk, K; Ulery, J; Ullaland, K; Uras, A; Urbán, J; Urciuoli, G M; Usai, G L; Vacchi, A; Vala, M; Valencia Palomo, L; Vallero, S; van den Brink, A; van der Kolk, N; Vande Vyvre, P; van Leeuwen, M; Vannucci, L; Vargas, A; Varma, R; Vasiliev, A; Vassiliev, I; Vasileiou, M; Vechernin, V; Venaruzzo, M; Vercellin, E; Vergara, S; Vernet, R; Verweij, M; Vetlitskiy, I; Vickovic, L; Viesti, G; Vikhlyantsev, O; Vilakazi, Z; Villalobos Baillie, O; Vinogradov, A; Vinogradov, L; Vinogradov, Y; Virgili, T; Viyogi, Y P; Vodopianov, A; Voloshin, K; Voloshin, S; Volpe, G; von Haller, B; Vranic, D; Vrláková, J; Vulpescu, B; Wagner, B; Wagner, V; Wallet, L; Wang, D; Wang, Y; Wan, R; Watanabe, K; Wen, Q; Wessels, J; Westerhoff, U; Wiechula, J; Wikne, J; Wilk, A; Wilk, G; Williams, M C S; Willis, N; Windelband, B; Xu, C; Yang, C; Yang, H; Yasnopolskiy, S; Yermia, F; Yi, J; Yin, Z; Yokoyama, H; Yoo, I-K; Yuan, X; Yurevich, V; Yushmanov, I; Zabrodin, E; Zagreev, B; Zalite, A; Zampolli, C; Zanevsky, Yu; Zaporozhets, S; Zarochentsev, A; Závada, P; Zbroszczyk, H; Zelnicek, P; Zenin, A; Zepeda, A; Zgura, I; Zhalov, M; Zhang, X; Zhou, D; Zhou, S; Zhu, J; Zichichi, A; Zinchenko, A; Zinovjev, G; Zoccarato, Y; Zychácek, V; Zynovyev, M


    Charged-particle production was studied in proton-proton collisions collected at the LHC with the ALICE detector at centre-of-mass energies 0.9 TeV and 2.36 TeV in the pseudorapidity range |eta| < 1.4. In the central region (|eta| < 0.5), at 0.9 TeV, we measure charged-particle pseudorapidity density dNch/deta = 3.02 +- 0.01 (stat.) +0.08 -0.05 (syst.) for inelastic interactions, and dNch/deta = 3.58 +- 0.01 (stat.) +0.12 -0.12 (syst.) for non-single-diffractive interactions. At 2.36 TeV, we find dNch/deta = 3.77 +- 0.01 (stat.) +0.25 -0.12 (syst.) for inelastic, and dNch/deta = 4.43 +- 0.01 (stat.) +0.17 -0.12 (syst.) for non-single-diffractive collisions. The relative increase in charged-particle multiplicity from the lower to higher energy is 24.7% +- 0.5% (stat.) +5.7% -2.8% (syst.) for inelastic and 23.7% +- 0.5% (stat.) +4.6% -1.1% (syst.) for non-single-diffractive interactions. This increase is consistent with that reported by the CMS collaboration for non-single-diffractive events and larger th...

  13. Thermodynamic performance of an auto-cascade ejector refrigeration cycle with mixed refrigerant R32 + R236fa

    International Nuclear Information System (INIS)

    In this paper, an auto-cascade ejector refrigeration cycle (ACERC) is proposed to obtain lower refrigeration temperature based on conventional ejector refrigeration and auto-cascade refrigeration principle. The thermodynamic performance of ACERC is investigated theoretically. The zeotropic refrigerant mixture R32 + R236fa is used as its working fluid. A parametric analysis is conducted to evaluate the effects of some thermodynamic parameters on the cycle performance. The study shows that refrigerant mixture composition, condenser outlet temperature and evaporation pressure have effects on performance of ACERC. The theoretical results also indicate that the ACERC can achieve the lowest refrigeration temperature at the temperature level of −30 °C. The application of zeotropic refrigerant mixture auto-cascade refrigeration in the ejector refrigeration cycle can provide a new way to obtain lower refrigeration temperature utilizing low-grade thermal energy. - Highlights: • An auto-cascade ejector refrigerator with R32 + R236fa mixed refrigerant is proposed. • The cycle can obtain a refrigeration temperature at −30 °C temperature range. • The effects of some thermodynamic parameters on the cycle performance are evaluated

  14. Kommentarer til opdateret risikovurdering og ansøgning. Gossypium hirsutum (281-24-236/3006-210-23), Insect resistance by Bt-toxin (lepidoptera) X Insect resistance by Bt-toxin (coleoptera); herbicide tolerance to glyphosate. Modtaget 03-04-2006, deadline 02-05-2006, svar 07-04-2006

    DEFF Research Database (Denmark)

    Kjellsson, Gøsta; Strandberg, Morten Tune; Christensen, Christian Dam


    "DMUs konklusioner vedr. den økologiske risikovurdering af den genmodificerede, insektresistente bomuldshybrid mellem event 281-24-236 og 3006-210-23. Den genmodificerede bomuldskrydsning 281-24-236/3006-210-23, adskiller sig fra konventionel bomuld ved at have indsat gener der gør planterne...

  15. Actinides AMS at CIRCE and 236U and Pu measurements of structural and environmental samples from in and around a mothballed nuclear power plant (United States)

    De Cesare, M.; Fifield, L. K.; Sabbarese, C.; Tims, S. G.; De Cesare, N.; D'Onofrio, A.; D'Arco, A.; Esposito, A. M.; Petraglia, A.; Roca, V.; Terrasi, F.


    Accelerator mass spectrometry (AMS) is presently the most sensitive technique for the measurement of long-lived actinides, e.g. 236U and 239Pu. A new actinide line is in operation at the Center for Isotopic Research on Cultural and Environmental heritage (CIRCE) in Caserta, Italy. Using the actinide line a uranium mass sensitivity of around 4 μg has been reached measuring with a 16-strip silicon detector, and a 239Pu background level of below 0.1 fg has been obtained. In this work we also discuss preliminary results for environmental and structural samples from in and around the Garigliano nuclear power plant (GNPP), presently in the decommissioning phase. Measurements on environmental samples from the vicinity of the plant allow the assessment of contamination, if any, over the years. Measurements of structural samples from the plant are relevant to the optimization of the decommissioning program for the GNPP.

  16. Actinides AMS at CIRCE and 236U and Pu measurements of structural and environmental samples from in and around a mothballed nuclear power plant

    International Nuclear Information System (INIS)

    Accelerator mass spectrometry (AMS) is presently the most sensitive technique for the measurement of long-lived actinides, e.g. 236U and 239Pu. A new actinide line is in operation at the Center for Isotopic Research on Cultural and Environmental heritage (CIRCE) in Caserta, Italy. Using the actinide line a uranium mass sensitivity of around 4 μg has been reached measuring with a 16-strip silicon detector, and a 239Pu background level of below 0.1 fg has been obtained. In this work we also discuss preliminary results for environmental and structural samples from in and around the Garigliano nuclear power plant (GNPP), presently in the decommissioning phase. Measurements on environmental samples from the vicinity of the plant allow the assessment of contamination, if any, over the years. Measurements of structural samples from the plant are relevant to the optimization of the decommissioning program for the GNPP.

  17. A combined model for the pseudorapidity distributions in p-p collisions at center-of-mass energies from 23.6 to 7000 GeV

    CERN Document Server

    Jiang, Zhi-Jin; Wang, Jie


    In p-p collisions, the produced charge particles consist of two leading particles and those frozen out from the hot and dense matter created in collisions. The two leading particles are respectively in the projectile and target fragmentation region, which, in this paper, are conventionally supposed to have Gaussian rapidity distributions. The hot and dense matter is assumed to expand according to the unified hydrodynamics, a hydro model which unifies the features of Landau and Hwa-Bjorken model, and freeze out into charged particles from a space-like hypersurface with a fixed proper time of Tau_FO. The rapidity distribution of this part of charged particles can be derived out analytically. The combined contribution from both leading particles and unified hydrodynamics is then compared against the experimental data performed in a wide now available center-of-mass energy region from 23.6 to 7000 GeV. The model predictions are in well consistent with experimental measurements.

  18. Charged particle multiplicities in pp interactions at sqrt(s) = 0.9, 2.36, and 7 TeV

    Energy Technology Data Exchange (ETDEWEB)

    Khachatryan, V. [Yerevan Physics Institute (Aremenia); et al.,


    Measurements of primary charged hadron multiplicity distributions are presented for non-single-diffractive events in proton-proton collisions at centre-of-mass energies of sqrt(s) = 0.9, 2.36, and 7 TeV, in five pseudorapidity ranges from |eta|<0.5 to |eta|<2.4. The data were collected with the minimum-bias trigger of the CMS experiment during the LHC commissioning runs in 2009 and the 7 TeV run in 2010. The multiplicity distribution at sqrt(s) = 0.9 TeV is in agreement with previous measurements. At higher energies the increase of the mean multiplicity with sqrt(s) is underestimated by most event generators. The average transverse momentum as a function of the multiplicity is also presented. The measurement of higher-order moments of the multiplicity distribution confirms the violation of Koba-Nielsen-Olesen scaling that has been observed at lower energies.

  19. Determination of protolytic equilibria for methyl 3-azido-6-iodo-2,3,6-trideoxy-α- D- arabino-hexopyranoside by ab initio and spectrophotometric methods (United States)

    Dąbrowska, Aleksandra; Makowski, Mariusz; Jacewicz, Dagmara; Chylewska, Agnieszka; Chmurzyński, Lech


    UV absorption spectra of methyl 3-azido-6-iodo-2,3,6-trideoxy-α- D- arabino-hexopyranoside were recorded over a wide pH range. On this basis, a relationship between absorbance and pH was plotted, from which deprotonation equilibrium constants of this compound were determined. Further, quantum-mechanical calculations were performed at the ab initio level both in the gas phase by using the Restricted Hartree Fock (RHF), Møller-Plesset (MP2) methods and under consideration of solvation effects within the Polarizable Continuum Model (PCM), which enabled location of preferred protonation and deprotonation centers of this compound. The results provided the basis for discussion of the influence of substituents in the sugar ring on protolytic equilibria occurring in aqueous solutions of 3-azido-2,3-dideoxy sugars.

  20. The use of 59Ni, 99Tc, and 236U to monitor the release of radionuclides from objects containing spent nuclear fuel dumped in the Kara Sea

    International Nuclear Information System (INIS)

    Between 1965 and 1981, five objects and six naval reactor pressure vessels (RPVs) from four former Soviet Union submarines and a special container from the icebreaker Lenin, all containing damaged spent nuclear fuel (SNF) were dumped in a variety of containments, at four sites in the Kara Sea. The International Atomic Energy Agency initiated the International Arctic Seas Assessment Project (IASAP) to study the possible health and environmental effects from disposal of these objects. One outcome of the IASAP was an estimation of the radionuclide inventory and their release rates from these objects. A follow-on concern is the ability to detect the radionuclides released into the water column. The work reported here is the feasibility of using the long-lived radionuclides 59Ni, 99Tc, and 236U encased within these objects, to monitor the breakdown of the containments due to corrosion

  1. Charged particle multiplicities in pp interactions at $\\sqrt{s}$ = 0.9, 2.36, and 7 TeV

    CERN Document Server

    Khachatryan, Vardan; Tumasyan, Armen; Adam, Wolfgang; Bergauer, Thomas; Dragicevic, Marko; Erö, Janos; Fabjan, Christian; Friedl, Markus; Fruehwirth, Rudolf; Ghete, Vasile Mihai; Hammer, Josef; Haensel, Stephan; Hartl, Christian; Hoch, Michael; Hörmann, Natascha; Hrubec, Josef; Jeitler, Manfred; Kasieczka, Gregor; Kiesenhofer, Wolfgang; Krammer, Manfred; Liko, Dietrich; Mikulec, Ivan; Pernicka, Manfred; Rohringer, Herbert; Schöfbeck, Robert; Strauss, Josef; Taurok, Anton; Teischinger, Florian; Waltenberger, Wolfgang; Walzel, Gerhard; Widl, Edmund; Wulz, Claudia-Elisabeth; Mossolov, Vladimir; Shumeiko, Nikolai; Suarez Gonzalez, Juan; Benucci, Leonardo; Ceard, Ludivine; Cerny, Karel; De Wolf, Eddi A.; Janssen, Xavier; Maes, Thomas; Mucibello, Luca; Ochesanu, Silvia; Roland, Benoit; Rougny, Romain; Selvaggi, Michele; Van Haevermaet, Hans; Van Mechelen, Pierre; Van Remortel, Nick; Adler, Volker; Beauceron, Stephanie; Blekman, Freya; Blyweert, Stijn; D'Hondt, Jorgen; Devroede, Olivier; Kalogeropoulos, Alexis; Maes, Joris; Maes, Michael; Tavernier, Stefaan; Van Doninck, Walter; Van Mulders, Petra; Van Onsem, Gerrit Patrick; Villella, Ilaria; Charaf, Otman; Clerbaux, Barbara; De Lentdecker, Gilles; Dero, Vincent; Gay, Arnaud; Hammad, Gregory Habib; Hreus, Tomas; Marage, Pierre Edouard; Thomas, Laurent; Vander Velde, Catherine; Vanlaer, Pascal; Wickens, John; Costantini, Silvia; Grunewald, Martin; Klein, Benjamin; Marinov, Andrey; Ryckbosch, Dirk; Thyssen, Filip; Tytgat, Michael; Vanelderen, Lukas; Verwilligen, Piet; Walsh, Sinead; Zaganidis, Nicolas; Basegmez, Suzan; Bruno, Giacomo; Caudron, Julien; De Favereau De Jeneret, Jerome; Delaere, Christophe; Demin, Pavel; Favart, Denis; Giammanco, Andrea; Grégoire, Ghislain; Hollar, Jonathan; Lemaitre, Vincent; Liao, Junhui; Militaru, Otilia; Ovyn, Severine; Pagano, Davide; Pin, Arnaud; Piotrzkowski, Krzysztof; Quertenmont, Loic; Schul, Nicolas; Beliy, Nikita; Caebergs, Thierry; Daubie, Evelyne; Alves, Gilvan; De Jesus Damiao, Dilson; Pol, Maria Elena; Henrique Gomes E Souza, Moacyr; Carvalho, Wagner; Da Costa, Eliza Melo; De Oliveira Martins, Carley; Fonseca De Souza, Sandro; Mundim, Luiz; Nogima, Helio; Oguri, Vitor; Prado Da Silva, Wanda Lucia; Santoro, Alberto; Silva Do Amaral, Sheila Mara; Sznajder, Andre; Torres Da Silva De Araujo, Felipe; De Almeida Dias, Flavia; Ferreira Dias, Marco Andre; Tomei, Thiago; De Moraes Gregores, Eduardo; Da Cunha Marinho, Franciole; Novaes, Sergio F.; Padula, Sandra; Darmenov, Nikolay; Dimitrov, Lubomir; Genchev, Vladimir; Iaydjiev, Plamen; Piperov, Stefan; Rodozov, Mircho; Stoykova, Stefka; Sultanov, Georgi; Tcholakov, Vanio; Trayanov, Rumen; Vankov, Ivan; Dyulendarova, Milena; Hadjiiska, Roumyana; Kozhuharov, Venelin; Litov, Leander; Marinova, Evelina; Mateev, Matey; Pavlov, Borislav; Petkov, Peicho; Bian, Jian-Guo; Chen, Guo-Ming; Chen, He-Sheng; Jiang, Chun-Hua; Liang, Dong; Liang, Song; Wang, Jian; Wang, Jian; Wang, Xianyou; Wang, Zheng; Yang, Min; Zang, Jingjing; Zhang, Zhen; Ban, Yong; Guo, Shuang; Li, Wenbo; Mao, Yajun; Qian, Si-Jin; Teng, Haiyun; Zhu, Bo; Cabrera, Andrés; Gomez Moreno, Bernardo; Ocampo Rios, Alberto Andres; Osorio Oliveros, Andres Felipe; Sanabria, Juan Carlos; Godinovic, Nikola; Lelas, Damir; Lelas, Karlo; Plestina, Roko; Polic, Dunja; Puljak, Ivica; Antunovic, Zeljko; Dzelalija, Mile; Brigljevic, Vuko; Duric, Senka; Kadija, Kreso; Morovic, Srecko; Attikis, Alexandros; Fereos, Reginos; Galanti, Mario; Mousa, Jehad; Nicolaou, Charalambos; Ptochos, Fotios; Razis, Panos A.; Rykaczewski, Hans; Assran, Yasser; Mahmoud, Mohammed; Hektor, Andi; Kadastik, Mario; Kannike, Kristjan; Müntel, Mait; Raidal, Martti; Rebane, Liis; Azzolini, Virginia; Eerola, Paula; Czellar, Sandor; Härkönen, Jaakko; Heikkinen, Mika Aatos; Karimäki, Veikko; Kinnunen, Ritva; Klem, Jukka; Kortelainen, Matti J.; Lampén, Tapio; Lassila-Perini, Kati; Lehti, Sami; Lindén, Tomas; Luukka, Panja-Riina; Mäenpää, Teppo; Tuominen, Eija; Tuominiemi, Jorma; Tuovinen, Esa; Ungaro, Donatella; Wendland, Lauri; Banzuzi, Kukka; Korpela, Arja; Tuuva, Tuure; Sillou, Daniel; Besancon, Marc; Dejardin, Marc; Denegri, Daniel; Fabbro, Bernard; Faure, Jean-Louis; Ferri, Federico; Ganjour, Serguei; Gentit, François-Xavier; Givernaud, Alain; Gras, Philippe; Hamel de Monchenault, Gautier; Jarry, Patrick; Locci, Elizabeth; Malcles, Julie; Marionneau, Matthieu; Millischer, Laurent; Rander, John; Rosowsky, André; Shreyber, Irina; Titov, Maksym; Verrecchia, Patrice; Baffioni, Stephanie; Beaudette, Florian; Bianchini, Lorenzo; Bluj, Michal; Broutin, Clementine; Busson, Philippe; Charlot, Claude; Dobrzynski, Ludwik; Granier de Cassagnac, Raphael; Haguenauer, Maurice; Miné, Philippe; Mironov, Camelia; Ochando, Christophe; Paganini, Pascal; Porteboeuf, Sarah; Sabes, David; Salerno, Roberto; Sirois, Yves; Thiebaux, Christophe; Wyslouch, Bolek; Zabi, Alexandre; Agram, Jean-Laurent; Andrea, Jeremy; Besson, Auguste; Bloch, Daniel; Bodin, David; Brom, Jean-Marie; Cardaci, Marco; Chabert, Eric Christian; Collard, Caroline; Conte, Eric; Drouhin, Frédéric; Ferro, Cristina; Fontaine, Jean-Charles; Gelé, Denis; Goerlach, Ulrich; Greder, Sebastien; Juillot, Pierre; Karim, Mehdi; Le Bihan, Anne-Catherine; Mikami, Yoshinari; Van Hove, Pierre; Fassi, Farida; Mercier, Damien; Baty, Clement; Beaupere, Nicolas; Bedjidian, Marc; Bondu, Olivier; Boudoul, Gaelle; Boumediene, Djamel; Brun, Hugues; Chanon, Nicolas; Chierici, Roberto; Contardo, Didier; Depasse, Pierre; El Mamouni, Houmani; Falkiewicz, Anna; Fay, Jean; Gascon, Susan; Ille, Bernard; Kurca, Tibor; Le Grand, Thomas; Lethuillier, Morgan; Mirabito, Laurent; Perries, Stephane; Sordini, Viola; Tosi, Silvano; Tschudi, Yohann; Verdier, Patrice; Xiao, Hong; Roinishvili, Vladimir; Anagnostou, Georgios; Edelhoff, Matthias; Feld, Lutz; Heracleous, Natalie; Hindrichs, Otto; Jussen, Ruediger; Klein, Katja; Merz, Jennifer; Mohr, Niklas; Ostapchuk, Andrey; Perieanu, Adrian; Raupach, Frank; Sammet, Jan; Schael, Stefan; Sprenger, Daniel; Weber, Hendrik; Weber, Martin; Wittmer, Bruno; Ata, Metin; Bender, Walter; Erdmann, Martin; Frangenheim, Jens; Hebbeker, Thomas; Hinzmann, Andreas; Hoepfner, Kerstin; Hof, Carsten; Klimkovich, Tatsiana; Klingebiel, Dennis; Kreuzer, Peter; Lanske, Dankfried; Magass, Carsten; Masetti, Gianni; Merschmeyer, Markus; Meyer, Arnd; Papacz, Paul; Pieta, Holger; Reithler, Hans; Schmitz, Stefan Antonius; Sonnenschein, Lars; Steggemann, Jan; Teyssier, Daniel; Bontenackels, Michael; Davids, Martina; Duda, Markus; Flügge, Günter; Geenen, Heiko; Giffels, Manuel; Haj Ahmad, Wael; Heydhausen, Dirk; Kress, Thomas; Kuessel, Yvonne; Linn, Alexander; Nowack, Andreas; Perchalla, Lars; Pooth, Oliver; Rennefeld, Jörg; Sauerland, Philip; Stahl, Achim; Thomas, Maarten; Tornier, Daiske; Zoeller, Marc Henning; Aldaya Martin, Maria; Behrenhoff, Wolf; Behrens, Ulf; Bergholz, Matthias; Borras, Kerstin; Cakir, Altan; Campbell, Alan; Castro, Elena; Dammann, Dirk; Eckerlin, Guenter; Eckstein, Doris; Flossdorf, Alexander; Flucke, Gero; Geiser, Achim; Glushkov, Ivan; Hauk, Johannes; Jung, Hannes; Kasemann, Matthias; Katkov, Igor; Katsas, Panagiotis; Kleinwort, Claus; Kluge, Hannelies; Knutsson, Albert; Krücker, Dirk; Kuznetsova, Ekaterina; Lange, Wolfgang; Lohmann, Wolfgang; Mankel, Rainer; Marienfeld, Markus; Melzer-Pellmann, Isabell-Alissandra; Meyer, Andreas Bernhard; Mnich, Joachim; Mussgiller, Andreas; Olzem, Jan; Parenti, Andrea; Raspereza, Alexei; Raval, Amita; Schmidt, Ringo; Schoerner-Sadenius, Thomas; Sen, Niladri; Stein, Matthias; Tomaszewska, Justyna; Volyanskyy, Dmytro; Walsh, Roberval; Wissing, Christoph; Autermann, Christian; Bobrovskyi, Sergei; Draeger, Jula; Enderle, Holger; Gebbert, Ulla; Kaschube, Kolja; Kaussen, Gordon; Klanner, Robert; Mura, Benedikt; Naumann-Emme, Sebastian; Nowak, Friederike; Pietsch, Niklas; Sander, Christian; Schettler, Hannes; Schleper, Peter; Schröder, Matthias; Schum, Torben; Schwandt, Joern; Srivastava, Ajay Kumar; Stadie, Hartmut; Steinbrück, Georg; Thomsen, Jan; Wolf, Roger; Bauer, Julia; Buege, Volker; Chwalek, Thorsten; De Boer, Wim; Dierlamm, Alexander; Dirkes, Guido; Feindt, Michael; Gruschke, Jasmin; Hackstein, Christoph; Hartmann, Frank; Heindl, Stefan Michael; Heinrich, Michael; Held, Hauke; Hoffmann, Karl-Heinz; Honc, Simon; Kuhr, Thomas; Martschei, Daniel; Mueller, Steffen; Müller, Thomas; Niegel, Martin; Oberst, Oliver; Oehler, Andreas; Ott, Jochen; Peiffer, Thomas; Piparo, Danilo; Quast, Gunter; Rabbertz, Klaus; Ratnikov, Fedor; Renz, Manuel; Saout, Christophe; Scheurer, Armin; Schieferdecker, Philipp; Schilling, Frank-Peter; Schott, Gregory; Simonis, Hans-Jürgen; Stober, Fred-Markus Helmut; Troendle, Daniel; Wagner-Kuhr, Jeannine; Zeise, Manuel; Zhukov, Valery; Ziebarth, Eva Barbara; Daskalakis, Georgios; Geralis, Theodoros; Kesisoglou, Stilianos; Kyriakis, Aristotelis; Loukas, Demetrios; Manolakos, Ioannis; Markou, Athanasios; Markou, Christos; Mavrommatis, Charalampos; Petrakou, Eleni; Gouskos, Loukas; Mertzimekis, Theodoros; Panagiotou, Apostolos; Evangelou, Ioannis; Foudas, Costas; Kokkas, Panagiotis; Manthos, Nikolaos; Papadopoulos, Ioannis; Patras, Vaios; Triantis, Frixos A.; Aranyi, Attila; Bencze, Gyorgy; Boldizsar, Laszlo; Debreczeni, Gergely; Hajdu, Csaba; Horvath, Dezso; Kapusi, Anita; Krajczar, Krisztian; Laszlo, Andras; Sikler, Ferenc; Vesztergombi, Gyorgy; Beni, Noemi; Molnar, Jozsef; Palinkas, Jozsef; Szillasi, Zoltan; Veszpremi, Viktor; Raics, Peter; Trocsanyi, Zoltan Laszlo; Ujvari, Balazs; Bansal, Sunil; Beri, Suman Bala; Bhatnagar, Vipin; Dhingra, Nitish; Jindal, Monika; Kaur, Manjit; Kohli, Jatinder Mohan; Mehta, Manuk Zubin; Nishu, Nishu; Saini, Lovedeep Kaur; Sharma, Archana; Singh, Anil; Singh, Jas Bir; Singh, Supreet Pal; Ahuja, Sudha; Bhattacharya, Satyaki; Choudhary, Brajesh C.; Gupta, Pooja; Jain, Sandhya; Jain, Shilpi; Kumar, Ashok; Shivpuri, Ram Krishen; Choudhury, Rajani Kant; Dutta, Dipanwita; Kailas, Swaminathan; Kataria, Sushil Kumar; Mohanty, Ajit Kumar; Pant, Lalit Mohan; Shukla, Prashant; Suggisetti, Praveenkumar; Aziz, Tariq; Guchait, Monoranjan; Gurtu, Atul; Maity, Manas; Majumder, Devdatta; Majumder, Gobinda; Mazumdar, Kajari; Mohanty, Gagan Bihari; Saha, Anirban; Sudhakar, Katta; Wickramage, Nadeesha; Banerjee, Sudeshna; Dugad, Shashikant; Mondal, Naba Kumar; Arfaei, Hessamaddin; Bakhshiansohi, Hamed; Etesami, Seyed Mohsen; Fahim, Ali; Hashemi, Majid; Jafari, Abideh; Khakzad, Mohsen; Mohammadi, Abdollah; Mohammadi Najafabadi, Mojtaba; Paktinat Mehdiabadi, Saeid; Safarzadeh, Batool; Zeinali, Maryam; Abbrescia, Marcello; Barbone, Lucia; Calabria, Cesare; Colaleo, Anna; Creanza, Donato; De Filippis, Nicola; De Palma, Mauro; Dimitrov, Anton; Fedele, Francesca; Fiore, Luigi; Iaselli, Giuseppe; Lusito, Letizia; Maggi, Giorgio; Maggi, Marcello; Manna, Norman; Marangelli, Bartolomeo; My, Salvatore; Nuzzo, Salvatore; Pacifico, Nicola; Pierro, Giuseppe Antonio; Pompili, Alexis; Pugliese, Gabriella; Romano, Francesco; Roselli, Giuseppe; Selvaggi, Giovanna; Silvestris, Lucia; Trentadue, Raffaello; Tupputi, Salvatore; Zito, Giuseppe; Abbiendi, Giovanni; Benvenuti, Alberto; Bonacorsi, Daniele; Braibant-Giacomelli, Sylvie; Capiluppi, Paolo; Castro, Andrea; Cavallo, Francesca Romana; Cuffiani, Marco; Dallavalle, Gaetano-Marco; Fabbri, Fabrizio; Fanfani, Alessandra; Fasanella, Daniele; Giacomelli, Paolo; Giunta, Marina; Grandi, Claudio; Marcellini, Stefano; Meneghelli, Marco; Montanari, Alessandro; Navarria, Francesco; Odorici, Fabrizio; Perrotta, Andrea; Rossi, Antonio; Rovelli, Tiziano; Siroli, Gianni; Travaglini, Riccardo; Albergo, Sebastiano; Cappello, Gigi; Chiorboli, Massimiliano; Costa, Salvatore; Tricomi, Alessia; Tuve, Cristina; Barbagli, Giuseppe; Ciulli, Vitaliano; Civinini, Carlo; D'Alessandro, Raffaello; Focardi, Ettore; Frosali, Simone; Gallo, Elisabetta; Genta, Chiara; Lenzi, Piergiulio; Meschini, Marco; Paoletti, Simone; Sguazzoni, Giacomo; Tropiano, Antonio; Benussi, Luigi; Bianco, Stefano; Colafranceschi, Stefano; Fabbri, Franco; Piccolo, Davide; Fabbricatore, Pasquale; Musenich, Riccardo; Benaglia, Andrea; Cerati, Giuseppe Benedetto; De Guio, Federico; Di Matteo, Leonardo; Ghezzi, Alessio; Malberti, Martina; Malvezzi, Sandra; Martelli, Arabella; Massironi, Andrea; Menasce, Dario; Moroni, Luigi; Paganoni, Marco; Pedrini, Daniele; Ragazzi, Stefano; Redaelli, Nicola; Sala, Silvano; Tabarelli de Fatis, Tommaso; Tancini, Valentina; Buontempo, Salvatore; Carrillo Montoya, Camilo Andres; Cimmino, Anna; De Cosa, Annapaola; De Gruttola, Michele; Fabozzi, Francesco; Iorio, Alberto Orso Maria; Lista, Luca; Merola, Mario; Noli, Pasquale; Paolucci, Pierluigi; Azzi, Patrizia; Bacchetta, Nicola; Bellan, Paolo; Biasotto, Massimo; Bisello, Dario; Branca, Antonio; Carlin, Roberto; Checchia, Paolo; Conti, Enrico; De Mattia, Marco; Dorigo, Tommaso; Fanzago, Federica; Gasparini, Fabrizio; Giubilato, Piero; Gresele, Ambra; Lacaprara, Stefano; Lazzizzera, Ignazio; Margoni, Martino; Meneguzzo, Anna Teresa; Nespolo, Massimo; Perrozzi, Luca; Pozzobon, Nicola; Ronchese, Paolo; Simonetto, Franco; Torassa, Ezio; Tosi, Mia; Vanini, Sara; Ventura, Sandro; Zotto, Pierluigi; Zumerle, Gianni; Baesso, Paolo; Berzano, Umberto; Riccardi, Cristina; Torre, Paola; Vitulo, Paolo; Viviani, Claudio; Biasini, Maurizio; Bilei, Gian Mario; Caponeri, Benedetta; Fanò, Livio; Lariccia, Paolo; Lucaroni, Andrea; Mantovani, Giancarlo; Menichelli, Mauro; Nappi, Aniello; Santocchia, Attilio; Servoli, Leonello; Taroni, Silvia; Valdata, Marisa; Volpe, Roberta; Azzurri, Paolo; Bagliesi, Giuseppe; Bernardini, Jacopo; Boccali, Tommaso; Broccolo, Giuseppe; Castaldi, Rino; D'Agnolo, Raffaele Tito; Dell'Orso, Roberto; Fiori, Francesco; Foà, Lorenzo; Giassi, Alessandro; Kraan, Aafke; Ligabue, Franco; Lomtadze, Teimuraz; Martini, Luca; Messineo, Alberto; Palla, Fabrizio; Palmonari, Francesco; Sarkar, Subir; Segneri, Gabriele; Serban, Alin Titus; Spagnolo, Paolo; Tenchini, Roberto; Tonelli, Guido; Venturi, Andrea; Verdini, Piero Giorgio; Barone, Luciano; Cavallari, Francesca; Del Re, Daniele; Di Marco, Emanuele; Diemoz, Marcella; Franci, Daniele; Grassi, Marco; Longo, Egidio; Organtini, Giovanni; Palma, Alessandro; Pandolfi, Francesco; Paramatti, Riccardo; Rahatlou, Shahram; Amapane, Nicola; Arcidiacono, Roberta; Argiro, Stefano; Arneodo, Michele; Biino, Cristina; Botta, Cristina; Cartiglia, Nicolo; Castello, Roberto; Costa, Marco; Demaria, Natale; Graziano, Alberto; Mariotti, Chiara; Marone, Matteo; Maselli, Silvia; Migliore, Ernesto; Mila, Giorgia; Monaco, Vincenzo; Musich, Marco; Obertino, Maria Margherita; Pastrone, Nadia; Pelliccioni, Mario; Romero, Alessandra; Ruspa, Marta; Sacchi, Roberto; Sola, Valentina; Solano, Ada; Staiano, Amedeo; Trocino, Daniele; Vilela Pereira, Antonio; Ambroglini, Filippo; Belforte, Stefano; Cossutti, Fabio; Della Ricca, Giuseppe; Gobbo, Benigno; Montanino, Damiana; Penzo, Aldo; Heo, Seong Gu; Chang, Sunghyun; Chung, Jin Hyuk; Kim, Dong Hee; Kim, Gui Nyun; Kim, Ji Eun; Kong, Dae Jung; Park, Hyangkyu; Son, Dohhee; Son, Dong-Chul; Kim, Jaeho; Kim, Jae Yool; Song, Sanghyeon; Choi, Suyong; Hong, Byung-Sik; Jo, Mihee; Kim, Hyunchul; Kim, Ji Hyun; Kim, Tae Jeong; Lee, Kyong Sei; Moon, Dong Ho; Park, Sung Keun; Rhee, Han-Bum; Seo, Eunsung; Shin, Seungsu; Sim, Kwang Souk; Choi, Minkyoo; Kang, Seokon; Kim, Hyunyong; Park, Chawon; Park, Inkyu; Park, Sangnam; Ryu, Geonmo; Choi, Young-Il; Choi, Young Kyu; Goh, Junghwan; Lee, Jongseok; Lee, Sungeun; Seo, Hyunkwan; Yu, Intae; Bilinskas, Mykolas Jurgis; Grigelionis, Ignas; Janulis, Mindaugas; Martisiute, Dalia; Petrov, Pavel; Sabonis, Tomas; Castilla Valdez, Heriberto; De La Cruz Burelo, Eduard; Lopez-Fernandez, Ricardo; Sánchez Hernández, Alberto; Villasenor-Cendejas, Luis Manuel; Carrillo Moreno, Salvador; Vazquez Valencia, Fabiola; Salazar Ibarguen, Humberto Antonio; Casimiro Linares, Edgar; Morelos Pineda, Antonio; Reyes-Santos, Marco A.; Allfrey, Philip; Krofcheck, David; Tam, Jason; Butler, Philip H.; Doesburg, Robert; Silverwood, Hamish; Ahmad, Muhammad; Ahmed, Ijaz; Asghar, Muhammad Irfan; Hoorani, Hafeez R.; Khan, Wajid Ali; Khurshid, Taimoor; Qazi, Shamona; Cwiok, Mikolaj; Dominik, Wojciech; Doroba, Krzysztof; Kalinowski, Artur; Konecki, Marcin; Krolikowski, Jan; Frueboes, Tomasz; Gokieli, Ryszard; Górski, Maciej; Kazana, Malgorzata; Nawrocki, Krzysztof; Romanowska-Rybinska, Katarzyna; Szleper, Michal; Wrochna, Grzegorz; Zalewski, Piotr; Almeida, Nuno; David Tinoco Mendes, Andre; Faccioli, Pietro; Ferreira Parracho, Pedro Guilherme; Gallinaro, Michele; Sá Martins, Pedro; Musella, Pasquale; Nayak, Aruna; Ribeiro, Pedro Quinaz; Seixas, Joao; Silva, Pedro; Varela, Joao; Wöhri, Hermine Katharina; Belotelov, Ivan; Bunin, Pavel; Finger, Miroslav; Finger Jr., Michael; Golutvin, Igor; Kamenev, Alexey; Karjavin, Vladimir; Kozlov, Guennady; Lanev, Alexander; Moisenz, Petr; Palichik, Vladimir; Perelygin, Victor; Shmatov, Sergey; Smirnov, Vitaly; Volodko, Anton; Zarubin, Anatoli; Bondar, Nikolai; Golovtsov, Victor; Ivanov, Yury; Kim, Victor; Levchenko, Petr; Murzin, Victor; Oreshkin, Vadim; Smirnov, Igor; Sulimov, Valentin; Uvarov, Lev; Vavilov, Sergey; Vorobyev, Alexey; Andreev, Yuri; Gninenko, Sergei; Golubev, Nikolai; Kirsanov, Mikhail; Krasnikov, Nikolai; Matveev, Viktor; Pashenkov, Anatoli; Toropin, Alexander; Troitsky, Sergey; Epshteyn, Vladimir; Gavrilov, Vladimir; Kaftanov, Vitali; Kossov, Mikhail; Krokhotin, Andrey; Lychkovskaya, Natalia; Safronov, Grigory; Semenov, Sergey; Stolin, Viatcheslav; Vlasov, Evgueni; Zhokin, Alexander; Boos, Edouard; Dubinin, Mikhail; Dudko, Lev; Ershov, Alexander; Gribushin, Andrey; Kodolova, Olga; Lokhtin, Igor; Obraztsov, Stepan; Petrushanko, Sergey; Sarycheva, Ludmila; Savrin, Viktor; Snigirev, Alexander; Andreev, Vladimir; Azarkin, Maksim; Dremin, Igor; Kirakosyan, Martin; Rusakov, Sergey V.; Vinogradov, Alexey; Azhgirey, Igor; Bitioukov, Sergei; Grishin, Viatcheslav; Kachanov, Vassili; Konstantinov, Dmitri; Korablev, Andrey; Krychkine, Victor; Petrov, Vladimir; Ryutin, Roman; Slabospitsky, Sergey; Sobol, Andrei; Tourtchanovitch, Leonid; Troshin, Sergey; Tyurin, Nikolay; Uzunian, Andrey; Volkov, Alexey; Adzic, Petar; Djordjevic, Milos; Krpic, Dragomir; Milosevic, Jovan; Aguilar-Benitez, Manuel; Alcaraz Maestre, Juan; Arce, Pedro; Battilana, Carlo; Calvo, Enrique; Cepeda, Maria; Cerrada, Marcos; Colino, Nicanor; De La Cruz, Begona; Diez Pardos, Carmen; Fernandez Bedoya, Cristina; Fernández Ramos, Juan Pablo; Ferrando, Antonio; Flix, Jose; Fouz, Maria Cruz; Garcia-Abia, Pablo; Gonzalez Lopez, Oscar; Goy Lopez, Silvia; Hernandez, Jose M.; Josa, Maria Isabel; Merino, Gonzalo; Puerta Pelayo, Jesus; Redondo, Ignacio; Romero, Luciano; Santaolalla, Javier; Willmott, Carlos; Albajar, Carmen; Codispoti, Giuseppe; de Trocóniz, Jorge F; Cuevas, Javier; Fernandez Menendez, Javier; Folgueras, Santiago; Gonzalez Caballero, Isidro; Lloret Iglesias, Lara; Vizan Garcia, Jesus Manuel; Brochero Cifuentes, Javier Andres; Cabrillo, Iban Jose; Calderon, Alicia; Chamizo Llatas, Maria; Chuang, Shan-Huei; Duarte Campderros, Jordi; Felcini, Marta; Fernandez, Marcos; Gomez, Gervasio; Gonzalez Sanchez, Javier; Gonzalez Suarez, Rebeca; Jorda, Clara; Lobelle Pardo, Patricia; Lopez Virto, Amparo; Marco, Jesus; Marco, Rafael; Martinez Rivero, Celso; Matorras, Francisco; Munoz Sanchez, Francisca Javiela; Piedra Gomez, Jonatan; Rodrigo, Teresa; Ruiz Jimeno, Alberto; Scodellaro, Luca; Sobron Sanudo, Mar; Vila, Ivan; Vilar Cortabitarte, Rocio; Abbaneo, Duccio; Auffray, Etiennette; Auzinger, Georg; Baillon, Paul; Ball, Austin; Barney, David; Bell, Alan James; Benedetti, Daniele; Bernet, Colin; Bialas, Wojciech; Bloch, Philippe; Bocci, Andrea; Bolognesi, Sara; Breuker, Horst; Brona, Grzegorz; Bunkowski, Karol; Camporesi, Tiziano; Cano, Eric; Cerminara, Gianluca; Christiansen, Tim; Coarasa Perez, Jose Antonio; Covarelli, Roberto; Curé, Benoît; D'Enterria, David; Dahms, Torsten; De Roeck, Albert; Duarte Ramos, Fernando; Elliott-Peisert, Anna; Funk, Wolfgang; Gaddi, Andrea; Gennai, Simone; Georgiou, Georgios; Gerwig, Hubert; Gigi, Dominique; Gill, Karl; Giordano, Domenico; Glege, Frank; Gomez-Reino Garrido, Robert; Gouzevitch, Maxime; Govoni, Pietro; Gowdy, Stephen; Guiducci, Luigi; Hansen, Magnus; Harvey, John; Hegeman, Jeroen; Hegner, Benedikt; Henderson, Conor; Hoffmann, Hans Falk; Honma, Alan; Innocente, Vincenzo; Janot, Patrick; Karavakis, Edward; Lecoq, Paul; Leonidopoulos, Christos; Lourenco, Carlos; Macpherson, Alick; Maki, Tuula; Malgeri, Luca; Mannelli, Marcello; Masetti, Lorenzo; Meijers, Frans; Mersi, Stefano; Meschi, Emilio; Moser, Roland; Mozer, Matthias Ulrich; Mulders, Martijn; Nesvold, Erik; Nguyen, Matthew; Orimoto, Toyoko; Orsini, Luciano; Perez, Emmanuelle; Petrilli, Achille; Pfeiffer, Andreas; Pierini, Maurizio; Pimiä, Martti; Polese, Giovanni; Racz, Attila; Rolandi, Gigi; Rommerskirchen, Tanja; Rovelli, Chiara; Rovere, Marco; Sakulin, Hannes; Schäfer, Christoph; Schwick, Christoph; Segoni, Ilaria; Sharma, Archana; Siegrist, Patrice; Simon, Michal; Sphicas, Paraskevas; Spiga, Daniele; Spiropulu, Maria; Stöckli, Fabian; Stoye, Markus; Tropea, Paola; Tsirou, Andromachi; Tsyganov, Andrey; Veres, Gabor Istvan; Vichoudis, Paschalis; Voutilainen, Mikko; Zeuner, Wolfram Dietrich; Bertl, Willi; Deiters, Konrad; Erdmann, Wolfram; Gabathuler, Kurt; Horisberger, Roland; Ingram, Quentin; Kaestli, Hans-Christian; König, Stefan; Kotlinski, Danek; Langenegger, Urs; Meier, Frank; Renker, Dieter; Rohe, Tilman; Sibille, Jennifer; Starodumov, Andrei; Bortignon, Pierluigi; Caminada, Lea; Chen, Zhiling; Cittolin, Sergio; Dissertori, Günther; Dittmar, Michael; Eugster, Jürg; Freudenreich, Klaus; Grab, Christoph; Hervé, Alain; Hintz, Wieland; Lecomte, Pierre; Lustermann, Werner; Marchica, Carmelo; Martinez Ruiz del Arbol, Pablo; Meridiani, Paolo; Milenovic, Predrag; Moortgat, Filip; Nef, Pascal; Nessi-Tedaldi, Francesca; Pape, Luc; Pauss, Felicitas; Punz, Thomas; Rizzi, Andrea; Ronga, Frederic Jean; Sala, Leonardo; Sanchez, Ann - Karin; Sawley, Marie-Christine; Stieger, Benjamin; Tauscher, Ludwig; Thea, Alessandro; Theofilatos, Konstantinos; Treille, Daniel; Urscheler, Christina; Wallny, Rainer; Weber, Matthias; Wehrli, Lukas; Weng, Joanna; Aguiló, Ernest; Amsler, Claude; Chiochia, Vincenzo; De Visscher, Simon; Favaro, Carlotta; Ivova Rikova, Mirena; Millan Mejias, Barbara; Regenfus, Christian; Robmann, Peter; Schmidt, Alexander; Snoek, Hella; Wilke, Lotte; Chang, Yuan-Hann; Chen, Kuan-Hsin; Chen, Wan-Ting; Dutta, Suchandra; Go, Apollo; Kuo, Chia-Ming; Li, Syue-Wei; Lin, Willis; Liu, Ming-Hsiung; Liu, Zong-kai; Lu, Yun-Ju; Wu, Jing-Han; Yu, Shin-Shan; Bartalini, Paolo; Chang, Paoti; Chang, You-Hao; Chang, Yu-Wei; Chao, Yuan; Chen, Kai-Feng; Hou, George Wei-Shu; Hsiung, Yee; Kao, Kai-Yi; Lei, Yeong-Jyi; Lu, Rong-Shyang; Shiu, Jing-Ge; Tzeng, Yeng-Ming; Wang, Minzu; Adiguzel, Aytul; Bakirci, Mustafa Numan; Cerci, Salim; Dozen, Candan; Dumanoglu, Isa; Eskut, Eda; Girgis, Semiray; Gökbulut, Gül; Güler, Yalcin; Gurpinar, Emine; Hos, Ilknur; Kangal, Evrim Ersin; Karaman, Turker; Kayis Topaksu, Aysel; Nart, Alisah; Önengüt, Gülsen; Ozdemir, Kadri; Ozturk, Sertac; Polatöz, Ayse; Sogut, Kenan; Tali, Bayram; Topakli, Huseyin; Uzun, Dilber; Vergili, Latife Nukhet; Vergili, Mehmet; Zorbilmez, Caglar; Akin, Ilina Vasileva; Aliev, Takhmasib; Bilmis, Selcuk; Deniz, Muhammed; Gamsizkan, Halil; Guler, Ali Murat; Ocalan, Kadir; Ozpineci, Altug; Serin, Meltem; Sever, Ramazan; Surat, Ugur Emrah; Yildirim, Eda; Zeyrek, Mehmet; Deliomeroglu, Mehmet; Demir, Durmus; Gülmez, Erhan; Halu, Arda; Isildak, Bora; Kaya, Mithat; Kaya, Ozlem; Özbek, Melih; Ozkorucuklu, Suat; Sonmez, Nasuf; Levchuk, Leonid; Bell, Peter; Bostock, Francis; Brooke, James John; Cheng, Teh Lee; Clement, Emyr; Cussans, David; Frazier, Robert; Goldstein, Joel; Grimes, Mark; Hansen, Maria; Hartley, Dominic; Heath, Greg P.; Heath, Helen F.; Huckvale, Benedickt; Jackson, James; Kreczko, Lukasz; Metson, Simon; Newbold, Dave M.; Nirunpong, Kachanon; Poll, Anthony; Senkin, Sergey; Smith, Vincent J.; Ward, Simon; Basso, Lorenzo; Bell, Ken W.; Belyaev, Alexander; Brew, Christopher; Brown, Robert M.; Camanzi, Barbara; Cockerill, David J.A.; Coughlan, John A.; Harder, Kristian; Harper, Sam; Kennedy, Bruce W.; Olaiya, Emmanuel; Petyt, David; Radburn-Smith, Benjamin Charles; Shepherd-Themistocleous, Claire; Tomalin, Ian R.; Womersley, William John; Worm, Steven; Bainbridge, Robert; Ball, Gordon; Ballin, Jamie; Beuselinck, Raymond; Buchmuller, Oliver; Colling, David; Cripps, Nicholas; Cutajar, Michael; Davies, Gavin; Della Negra, Michel; Fulcher, Jonathan; Futyan, David; Guneratne Bryer, Arlo; Hall, Geoffrey; Hatherell, Zoe; Hays, Jonathan; Iles, Gregory; Karapostoli, Georgia; Lyons, Louis; Magnan, Anne-Marie; Marrouche, Jad; Nandi, Robin; Nash, Jordan; Nikitenko, Alexander; Papageorgiou, Anastasios; Pesaresi, Mark; Petridis, Konstantinos; Pioppi, Michele; Raymond, David Mark; Rompotis, Nikolaos; Rose, Andrew; Ryan, Matthew John; Seez, Christopher; Sharp, Peter; Sparrow, Alex; Tapper, Alexander; Tourneur, Stephane; Vazquez Acosta, Monica; Virdee, Tejinder; Wakefield, Stuart; Wardrope, David; Whyntie, Tom; Barrett, Matthew; Chadwick, Matthew; Cole, Joanne; Hobson, Peter R.; Khan, Akram; Kyberd, Paul; Leslie, Dawn; Martin, William; Reid, Ivan; Teodorescu, Liliana; Hatakeyama, Kenichi; Bose, Tulika; Carrera Jarrin, Edgar; Clough, Andrew; Fantasia, Cory; Heister, Arno; St. John, Jason; Lawson, Philip; Lazic, Dragoslav; Rohlf, James; Sperka, David; Sulak, Lawrence; Avetisyan, Aram; Bhattacharya, Saptaparna; Chou, John Paul; Cutts, David; Esen, Selda; Ferapontov, Alexey; Heintz, Ulrich; Jabeen, Shabnam; Kukartsev, Gennadiy; Landsberg, Greg; Narain, Meenakshi; Nguyen, Duong; Segala, Michael; Speer, Thomas; Tsang, Ka Vang; Borgia, Maria Assunta; Breedon, Richard; Calderon De La Barca Sanchez, Manuel; Cebra, Daniel; Chauhan, Sushil; Chertok, Maxwell; Conway, John; Cox, Peter Timothy; Dolen, James; Erbacher, Robin; Friis, Evan; Ko, Winston; Kopecky, Alexandra; Lander, Richard; Liu, Haidong; Maruyama, Sho; Miceli, Tia; Nikolic, Milan; Pellett, Dave; Robles, Jorge; Schwarz, Thomas; Searle, Matthew; Smith, John; Squires, Michael; Tripathi, Mani; Vasquez Sierra, Ricardo; Veelken, Christian; Andreev, Valeri; Arisaka, Katsushi; Cline, David; Cousins, Robert; Deisher, Amanda; Duris, Joseph; Erhan, Samim; Farrell, Chris; Hauser, Jay; Ignatenko, Mikhail; Jarvis, Chad; Plager, Charles; Rakness, Gregory; Schlein, Peter; Tucker, Jordan; Valuev, Vyacheslav; Babb, John; Clare, Robert; Ellison, John Anthony; Gary, J William; Giordano, Ferdinando; Hanson, Gail; Jeng, Geng-Yuan; Kao, Shih-Chuan; Liu, Feng; Liu, Hongliang; Luthra, Arun; Nguyen, Harold; Pasztor, Gabriella; Satpathy, Asish; Shen, Benjamin C.; Stringer, Robert; Sturdy, Jared; Sumowidagdo, Suharyo; Wilken, Rachel; Wimpenny, Stephen; Andrews, Warren; Branson, James G.; Dusinberre, Elizabeth; Evans, David; Golf, Frank; Holzner, André; Kelley, Ryan; Lebourgeois, Matthew; Letts, James; Mangano, Boris; Muelmenstaedt, Johannes; Padhi, Sanjay; Palmer, Christopher; Petrucciani, Giovanni; Pi, Haifeng; Pieri, Marco; Ranieri, Riccardo; Sani, Matteo; Sharma, Vivek; Simon, Sean; Tu, Yanjun; Vartak, Adish; Würthwein, Frank; Yagil, Avraham; Barge, Derek; Bellan, Riccardo; Campagnari, Claudio; D'Alfonso, Mariarosaria; Danielson, Thomas; Geffert, Paul; Incandela, Joe; Justus, Christopher; Kalavase, Puneeth; Koay, Sue Ann; Kovalskyi, Dmytro; Krutelyov, Vyacheslav; Lowette, Steven; Mccoll, Nickolas; Pavlunin, Viktor; Rebassoo, Finn; Ribnik, Jacob; Richman, Jeffrey; Rossin, Roberto; Stuart, David; To, Wing; Vlimant, Jean-Roch; Bornheim, Adolf; Bunn, Julian; Chen, Yi; Gataullin, Marat; Kcira, Dorian; Litvine, Vladimir; Ma, Yousi; Mott, Alexander; Newman, Harvey B.; Rogan, Christopher; Timciuc, Vladlen; Traczyk, Piotr; Veverka, Jan; Wilkinson, Richard; Yang, Yong; Zhu, Ren-Yuan; Akgun, Bora; Carroll, Ryan; Ferguson, Thomas; Iiyama, Yutaro; Jang, Dong Wook; Jun, Soon Yung; Liu, Yueh-Feng; Paulini, Manfred; Russ, James; Terentyev, Nikolay; Vogel, Helmut; Vorobiev, Igor; Cumalat, John Perry; Dinardo, Mauro Emanuele; Drell, Brian Robert; Edelmaier, Christopher; Ford, William T.; Heyburn, Bernadette; Luiggi Lopez, Eduardo; Nauenberg, Uriel; Smith, James; Stenson, Kevin; Ulmer, Keith; Wagner, Stephen Robert; Zang, Shi-Lei; Agostino, Lorenzo; Alexander, James; Chatterjee, Avishek; Das, Souvik; Eggert, Nicholas; Fields, Laura Johanna; Gibbons, Lawrence Kent; Heltsley, Brian; Hopkins, Walter; Khukhunaishvili, Aleko; Kreis, Benjamin; Kuznetsov, Valentin; Nicolas Kaufman, Gala; Patterson, Juliet Ritchie; Puigh, Darren; Riley, Daniel; Ryd, Anders; Shi, Xin; Sun, Werner; Teo, Wee Don; Thom, Julia; Thompson, Joshua; Vaughan, Jennifer; Weng, Yao; Winstrom, Lucas; Wittich, Peter; Biselli, Angela; Cirino, Guy; Winn, Dave; Abdullin, Salavat; Albrow, Michael; Anderson, Jacob; Apollinari, Giorgio; Atac, Muzaffer; Bakken, Jon Alan; Banerjee, Sunanda; Bauerdick, Lothar A.T.; Beretvas, Andrew; Berryhill, Jeffrey; Bhat, Pushpalatha C.; Bloch, Ingo; Borcherding, Frederick; Burkett, Kevin; Butler, Joel Nathan; Chetluru, Vasundhara; Cheung, Harry; Chlebana, Frank; Cihangir, Selcuk; Demarteau, Marcel; Eartly, David P.; Elvira, Victor Daniel; Fisk, Ian; Freeman, Jim; Gao, Yanyan; Gottschalk, Erik; Green, Dan; Gunthoti, Kranti; Gutsche, Oliver; Hahn, Alan; Hanlon, Jim; Harris, Robert M.; Hirschauer, James; Hooberman, Benjamin; James, Eric; Jensen, Hans; Johnson, Marvin; Joshi, Umesh; Khatiwada, Rakshya; Kilminster, Benjamin; Klima, Boaz; Kousouris, Konstantinos; Kunori, Shuichi; Kwan, Simon; Limon, Peter; Lipton, Ron; Lykken, Joseph; Maeshima, Kaori; Marraffino, John Michael; Mason, David; McBride, Patricia; McCauley, Thomas; Miao, Ting; Mishra, Kalanand; Mrenna, Stephen; Musienko, Yuri; Newman-Holmes, Catherine; O'Dell, Vivian; Popescu, Sorina; Pordes, Ruth; Prokofyev, Oleg; Saoulidou, Niki; Sexton-Kennedy, Elizabeth; Sharma, Seema; Soha, Aron; Spalding, William J.; Spiegel, Leonard; Tan, Ping; Taylor, Lucas; Tkaczyk, Slawek; Uplegger, Lorenzo; Vaandering, Eric Wayne; Vidal, Richard; Whitmore, Juliana; Wu, Weimin; Yang, Fan; Yumiceva, Francisco; Yun, Jae Chul; Acosta, Darin; Avery, Paul; Bourilkov, Dimitri; Chen, Mingshui; Di Giovanni, Gian Piero; Dobur, Didar; Drozdetskiy, Alexey; Field, Richard D.; Fisher, Matthew; Fu, Yu; Furic, Ivan-Kresimir; Gartner, Joseph; Goldberg, Sean; Kim, Bockjoo; Klimenko, Sergey; Konigsberg, Jacobo; Korytov, Andrey; Kropivnitskaya, Anna; Kypreos, Theodore; Matchev, Konstantin; Mitselmakher, Guenakh; Muniz, Lana; Pakhotin, Yuriy; Prescott, Craig; Remington, Ronald; Schmitt, Michael; Scurlock, Bobby; Sellers, Paul; Skhirtladze, Nikoloz; Wang, Dayong; Yelton, John; Zakaria, Mohammed; Ceron, Cristobal; Gaultney, Vanessa; Kramer, Laird; Lebolo, Luis Miguel; Linn, Stephan; Markowitz, Pete; Martinez, German; Rodriguez, Jorge Luis; Adams, Todd; Askew, Andrew; Bandurin, Dmitry; Bochenek, Joseph; Chen, Jie; Diamond, Brendan; Gleyzer, Sergei V; Haas, Jeff; Hagopian, Sharon; Hagopian, Vasken; Jenkins, Merrill; Johnson, Kurtis F.; Prosper, Harrison; Sekmen, Sezen; Veeraraghavan, Venkatesh; Baarmand, Marc M.; Dorney, Brian; Guragain, Samir; Hohlmann, Marcus; Kalakhety, Himali; Ralich, Robert; Vodopiyanov, Igor; Adams, Mark Raymond; Anghel, Ioana Maria; Apanasevich, Leonard; Bai, Yuting; Bazterra, Victor Eduardo; Betts, Russell Richard; Callner, Jeremy; Cavanaugh, Richard; Dragoiu, Cosmin; Garcia-Solis, Edmundo Javier; Gerber, Cecilia Elena; Hofman, David Jonathan; Khalatyan, Samvel; Lacroix, Florent; O'Brien, Christine; Silvestre, Catherine; Smoron, Agata; Strom, Derek; Varelas, Nikos; Akgun, Ugur; Albayrak, Elif Asli; Bilki, Burak; Cankocak, Kerem; Clarida, Warren; Duru, Firdevs; Lae, Chung Khim; McCliment, Edward; Merlo, Jean-Pierre; Mermerkaya, Hamit; Mestvirishvili, Alexi; Moeller, Anthony; Nachtman, Jane; Newsom, Charles Ray; Norbeck, Edwin; Olson, Jonathan; Onel, Yasar; Ozok, Ferhat; Sen, Sercan; Wetzel, James; Yetkin, Taylan; Yi, Kai; Barnett, Bruce Arnold; Blumenfeld, Barry; Bonato, Alessio; Eskew, Christopher; Fehling, David; Giurgiu, Gavril; Gritsan, Andrei; Guo, Zijin; Hu, Guofan; Maksimovic, Petar; Rappoccio, Salvatore; Swartz, Morris; Tran, Nhan Viet; Whitbeck, Andrew; Baringer, Philip; Bean, Alice; Benelli, Gabriele; Grachov, Oleg; Murray, Michael; Noonan, Daniel; Radicci, Valeria; Sanders, Stephen; Wood, Jeffrey Scott; Zhukova, Victoria; Bolton, Tim; Chakaberia, Irakli; Ivanov, Andrew; Makouski, Mikhail; Maravin, Yurii; Shrestha, Shruti; Svintradze, Irakli; Wan, Zongru; Gronberg, Jeffrey; Lange, David; Wright, Douglas; Baden, Drew; Boutemeur, Madjid; Eno, Sarah Catherine; Ferencek, Dinko; Gomez, Jaime; Hadley, Nicholas John; Kellogg, Richard G.; Kirn, Malina; Lu, Ying; Mignerey, Alice; Rossato, Kenneth; Rumerio, Paolo; Santanastasio, Francesco; Skuja, Andris; Temple, Jeffrey; Tonjes, Marguerite; Tonwar, Suresh C.; Twedt, Elizabeth; Alver, Burak; Bauer, Gerry; Bendavid, Joshua; Busza, Wit; Butz, Erik; Cali, Ivan Amos; Chan, Matthew; Dutta, Valentina; Everaerts, Pieter; Gomez Ceballos, Guillelmo; Goncharov, Maxim; Hahn, Kristan Allan; Harris, Philip; Kim, Yongsun; Klute, Markus; Lee, Yen-Jie; Li, Wei; Loizides, Constantinos; Luckey, Paul David; Ma, Teng; Nahn, Steve; Paus, Christoph; Roland, Christof; Roland, Gunther; Rudolph, Matthew; Stephans, George; Sumorok, Konstanty; Sung, Kevin; Wenger, Edward Allen; Xie, Si; Yang, Mingming; Yilmaz, Yetkin; Yoon, Sungho; Zanetti, Marco; Cole, Perrie; Cooper, Seth; Cushman, Priscilla; Dahmes, Bryan; De Benedetti, Abraham; Dudero, Phillip Russell; Franzoni, Giovanni; Haupt, Jason; Klapoetke, Kevin; Kubota, Yuichi; Mans, Jeremy; Rekovic, Vladimir; Rusack, Roger; Sasseville, Michael; Singovsky, Alexander; Cremaldi, Lucien Marcus; Godang, Romulus; Kroeger, Rob; Perera, Lalith; Rahmat, Rahmat; Sanders, David A; Summers, Don; Bloom, Kenneth; Bose, Suvadeep; Butt, Jamila; Claes, Daniel R.; Dominguez, Aaron; Eads, Michael; Keller, Jason; Kelly, Tony; Kravchenko, Ilya; Lazo-Flores, Jose; Lundstedt, Carl; Malbouisson, Helena; Malik, Sudhir; Snow, Gregory R.; Baur, Ulrich; Godshalk, Andrew; Iashvili, Ia; Kharchilava, Avto; Kumar, Ashish; Smith, Kenneth; Alverson, George; Barberis, Emanuela; Baumgartel, Darin; Boeriu, Oana; Chasco, Matthew; Kaadze, Ketino; Reucroft, Steve; Swain, John; Wood, Darien; Zhang, Jinzhong; Anastassov, Anton; Kubik, Andrew; Odell, Nathaniel; Ofierzynski, Radoslaw Adrian; Pollack, Brian; Pozdnyakov, Andrey; Schmitt, Michael; Stoynev, Stoyan; Velasco, Mayda; Won, Steven; Antonelli, Louis; Berry, Douglas; Hildreth, Michael; Jessop, Colin; Karmgard, Daniel John; Kolb, Jeff; Kolberg, Ted; Lannon, Kevin; Luo, Wuming; Lynch, Sean; Marinelli, Nancy; Morse, David Michael; Pearson, Tessa; Ruchti, Randy; Slaunwhite, Jason; Valls, Nil; Warchol, Jadwiga; Wayne, Mitchell; Ziegler, Jill; Bylsma, Ben; Durkin, Lloyd Stanley; Gu, Jianhui; Hill, Christopher; Killewald, Phillip; Kotov, Khristian; Ling, Ta-Yung; Rodenburg, Marissa; Williams, Grayson; Adam, Nadia; Berry, Edmund; Elmer, Peter; Gerbaudo, Davide; Halyo, Valerie; Hebda, Philip; Hunt, Adam; Jones, John; Laird, Edward; Lopes Pegna, David; Marlow, Daniel; Medvedeva, Tatiana; Mooney, Michael; Olsen, James; Piroué, Pierre; Quan, Xiaohang; Saka, Halil; Stickland, David; Tully, Christopher; Werner, Jeremy Scott; Zuranski, Andrzej; Acosta, Jhon Gabriel; Huang, Xing Tao; Lopez, Angel; Mendez, Hector; Oliveros, Sandra; Ramirez Vargas, Juan Eduardo; Zatserklyaniy, Andriy; Alagoz, Enver; Barnes, Virgil E.; Bolla, Gino; Borrello, Laura; Bortoletto, Daniela; Everett, Adam; Garfinkel, Arthur F.; Gecse, Zoltan; Gutay, Laszlo; Jones, Matthew; Koybasi, Ozhan; Laasanen, Alvin T.; Leonardo, Nuno; Liu, Chang; Maroussov, Vassili; Merkel, Petra; Miller, David Harry; Neumeister, Norbert; Potamianos, Karolos; Shipsey, Ian; Silvers, David; Svyatkovskiy, Alexey; Yoo, Hwi Dong; Zablocki, Jakub; Zheng, Yu; Jindal, Pratima; Parashar, Neeti; Boulahouache, Chaouki; Cuplov, Vesna; Ecklund, Karl Matthew; Geurts, Frank J.M.; Liu, Jinghua H.; Morales, Jafet; Padley, Brian Paul; Redjimi, Radia; Roberts, Jay; Zabel, James; Betchart, Burton; Bodek, Arie; Chung, Yeon Sei; de Barbaro, Pawel; Demina, Regina; Eshaq, Yossof; Flacher, Henning; Garcia-Bellido, Aran; Goldenzweig, Pablo; Gotra, Yury; Han, Jiyeon; Harel, Amnon; Miner, Daniel Carl; Orbaker, Douglas; Petrillo, Gianluca; Vishnevskiy, Dmitry; Zielinski, Marek; Bhatti, Anwar; Demortier, Luc; Goulianos, Konstantin; Lungu, Gheorghe; Mesropian, Christina; Yan, Ming; Atramentov, Oleksiy; Barker, Anthony; Duggan, Daniel; Gershtein, Yuri; Gray, Richard; Halkiadakis, Eva; Hidas, Dean; Hits, Dmitry; Lath, Amitabh; Panwalkar, Shruti; Patel, Rishi; Richards, Alan; Rose, Keith; Schnetzer, Steve; Somalwar, Sunil; Stone, Robert; Thomas, Scott; Cerizza, Giordano; Hollingsworth, Matthew; Spanier, Stefan; Yang, Zong-Chang; York, Andrew; Asaadi, Jonathan; Eusebi, Ricardo; Gilmore, Jason; Gurrola, Alfredo; Kamon, Teruki; Khotilovich, Vadim; Montalvo, Roy; Nguyen, Chi Nhan; Pivarski, James; Safonov, Alexei; Sengupta, Sinjini; Tatarinov, Aysen; Toback, David; Weinberger, Michael; Akchurin, Nural; Bardak, Cemile; Damgov, Jordan; Jeong, Chiyoung; Kovitanggoon, Kittikul; Lee, Sung Won; Mane, Poonam; Roh, Youn; Sill, Alan; Volobouev, Igor; Wigmans, Richard; Yazgan, Efe; Appelt, Eric; Brownson, Eric; Engh, Daniel; Florez, Carlos; Gabella, William; Johns, Willard; Kurt, Pelin; Maguire, Charles; Melo, Andrew; Sheldon, Paul; Velkovska, Julia; Arenton, Michael Wayne; Balazs, Michael; Boutle, Sarah; Buehler, Marc; Conetti, Sergio; Cox, Bradley; Francis, Brian; Hirosky, Robert; Ledovskoy, Alexander; Lin, Chuanzhe; Neu, Christopher; Yohay, Rachel; Gollapinni, Sowjanya; Harr, Robert; Karchin, Paul Edmund; Mattson, Mark; Milstène, Caroline; Sakharov, Alexandre; Anderson, Michael; Bachtis, Michail; Bellinger, James Nugent; Carlsmith, Duncan; Dasu, Sridhara; Efron, Jonathan; Gray, Lindsey; Grogg, Kira Suzanne; Grothe, Monika; Hall-Wilton, Richard; Herndon, Matthew; Klabbers, Pamela; Klukas, Jeffrey; Lanaro, Armando; Lazaridis, Christos; Leonard, Jessica; Lomidze, David; Loveless, Richard; Mohapatra, Ajit; Parker, William; Reeder, Don; Ross, Ian; Savin, Alexander; Smith, Wesley H.; Swanson, Joshua; Weinberg, Marc


    Measurements of primary charged hadron multiplicity distributions are presented for non-single-diffractive events in proton-proton collisions at centre-of-mass energies of sqrt(s) = 0.9, 2.36, and 7 TeV, in five pseudorapidity ranges from |eta|<0.5 to |eta|<2.4. The data were collected with the minimum-bias trigger of the CMS experiment during the LHC commissioning runs in 2009 and the 7 TeV run in 2010. The multiplicity distribution at sqrt(s) = 0.9 TeV is in agreement with previous measurements. At higher energies the increase of the mean multiplicity with sqrt(s) is underestimated by most event generators. The average transverse momentum as a function of the multiplicity is also presented. The measurement of higher-order moments of the multiplicity distribution confirms the violation of Koba-Nielsen-Olesen scaling that has been observed at lower energies.

  2. Position paper, need for additional waste storage capacity and recommended path forward for project W-236a, Multi-function Waste Tank Facility

    International Nuclear Information System (INIS)

    Project W-236a, Multi-function waste Tank Facility (MWTF), was initiated to increase the safe waste storage capacity for the Tank Waste Remediation System (TWRS) by building two new one million gallon underground storage tanks in the 200 West Area and four tanks in the 200 East Area. Construction of the tanks was scheduled to begin in September 1994 with operations beginning in calendar year (CY) 1998. However, recent reviews have raised several issues regarding the mission, scope, and schedule of the MWTF. The decision to build new tanks must consider several elements, such as: Operational risk and needs -- Operational risk and flexibility must be managed such that any identified risk is reduced as soon as practicable; The amount of waste that will be generated in the future -- Additional needed tank capacity must be made available to support operations and maintain currently planned safety improvement activities; Safety issues -- The retrieval of waste from single-shell tanks (SSTs) and watch list tanks will add to the total amount of waste that must be stored in a double-shell tank (DST); Availability of existing DSTs -- The integrity of the 28 existing DSTs must be continuously managed; and Affect on other projects and programs -- Because MWTF systems have been integrated with other projects, a decision on one project will affect another. In addition the W-236a schedule is logically tied to support retrieval and safety program plans. Based on the above, two new tanks are needed for safe waste storage in the 200 West Area, and they need to be built as soon as practicable. Design should continue for the tanks in the 200 East Area with a decision made by September, on whether to construct them. Construction of the cross-site transfer line should proceed as scheduled. To implement this recommendation several actions need to be implemented

  3. Fission coincident neutrons from the reactions p + sup(235,236,238)U with protons between 12,7 and 25.5 MeV

    International Nuclear Information System (INIS)

    With the proton beam of the Hamburg isochronous cyclotron (HAIZY) thin uranium targets with the mass numbers 235, 236, and 238 were bombarded. Both fragments from the fission of the Np reaction systems and the neutrons coincident with the fragments were detected in the plane perpendicular to the beam direction. Measured and stored event by event were for all particles the times of flight. The detection of the neutron succeeded in conventional time-of-flight technique with NE213 liquid scintillators. A fission detector system with plastic scintillator foils was developed. It permits high event rates over long measuring times and allows the choice of so long neutron flight paths that a neutron energy resolution between 2% and 4% could be reached. The determination of the fragment masses is in spite of the short flight paths of 15 respectively 21 cm possible to +-2 amu. The isotropic component das discussed under the assumption that it is composed of prefission and scission neutrons which were emitted befor fission respectively during the fragmentation. From the post fission results the distribution of the excitation energy to both fragments was determined in dependence of Esup(*) and the fragment mass. (orig./HSI)

  4. Early observing HIE pathogenesis of 236 full -term neonates by S100B test combined with NSE test%236例S100B联合NSE检测用于足月新生儿HIE病程早期观察

    Institute of Scientific and Technical Information of China (English)



    Objective; To explore the value of S100B test combined with neuron - specific enolase ( NSE) test for early diagnosis and monitoring of hypoxic - ischemic encephalopathy (HIE) in full - term neonates, and provide more complementary evidences for clinical diagnosis and treatment of HIE. Methods: A total of 236 full - term neonates with HIE who were treated in the hospital from July 2009 lo July 2011 were selected as study objects, and 236 healthy full -term neonates who were born during the same period were selected as control group, electrochemiluminescence was used to monitor the serum levels of S100B and NSE during early course of the disease (at one day, 3-5 days, and 7-10 days after grouping) . Results; The serum levels of S100B and NSE in HIE group were statistically significantly higher than those in control group at different time points ( P 0. 05) , but the serum levels of S100B and NSE in the other groups were still statistically significantly higher than those in control group (P0. 05) .Conclusion; Joint test of S100B and NSE is a reasonable mode for early monitoring and assistant diagnosis of full - term infants with HIE, which is helpful to supply more complementary evidences for clinical diagnosis and treatment.%目的:探讨血清学标志物S100B联合NSE检测在足月新生儿HIE疾病的早期诊断和监测中的价值,为临床诊治提供更多补充性依据.方法:以2009年7月~2011年7月收治的236例足月新生儿HIE患者为研究对象,选择同期出生的236例足月健康新生儿为对照组,应用电化学发光法监测HIE患者病程早期(入组后第1天、第3~5天,第7~ 10天)的血清S100B和NSE水平.结果:HIE组血清S100B和NSE水平显著高于对照组,各观察点P<0.05;第3~5天除轻度组外,S100B和NSE分别在重度组、中度组和重度组有显著性上升,均P<0.05.治疗前后(第7~10天对比第1天)S100B和NSE在各组均有显著性降低,P <0.05;轻度组在初步治疗后S100B

  5. 三氯酚对小椎实螺急性毒性作用和过氧化物酶活性的影响%Effects of 2,3,5-TCP and 2,3,6-TCP on Acute Toxicity and POD Activity of Galba pervia

    Institute of Scientific and Technical Information of China (English)

    宋志慧; 杨鲁娜


    [目的]探讨2,3,5-三氯酚和2,3,6-三氯酚对小椎实螺的毒性指标.[方法]以小椎实螺为供试生物,采用半静态法对小椎实螺进行驯养和试验,测定2,3,5 -TCP和2,3,6-TCP对小椎实螺的半数致死浓度(LC50)、联合毒性作用类型和POD活性的影响.[结果]2,3,5 -TCP和2,3,6-TCP对小椎实螺的96 hLC30分别为0.525和1.925 mg/L,毒性顺序为:2,3,5-TCP >2,3,6-TCP;2,3,5-TCP和2,3,6-TCP的联合作用类型为协同作用;2,3,5-TCP和2,3,6-TCP暴露1d胁迫小椎实螺POD为诱导-抑制效应,暴露3和5d胁迫小椎实螺POD为抑制效应,且随暴露时间的延长,不同酶活性变化显著.[结论]为进一步探讨氧酚对腹足动物的毒性机理以及对氯酚化合物污染的早期诊所与生态风险评级提供了理论依据.%[Objective] To study the toxic effect of 2,3,5-TCP and 2,3,6-TCP on Galbapervia. [ Method] The G. pervia was cultured by semi-static method,the LC50 and joint action of 2,3,5-TCP and 2,3,6-TCP to G. pervia as well as the POD activity were discussed. [Result] The 96 h-LC50, of 2,3,5-TCP and 2,3,6-TCP were 0.525 mg/L and 1.925 mg/L, respectively. The toxicity order of them was 2,3,5-TCP > 2,3,6-TCP,the joint effect of 2,3,5-TCP and 2,3,6-TCP was synergistie; The POD in C.perma exposed to 2,3,5-TCP and 2,3,6-TCP stress was both induced and inhibited,while it was inhibited when the G. pervia was exposed to 2,3,5-TCP and 2,3,6-TCP stress for 3 d and 5 d,the enzyme activities were changed significantly with the extending days of exposure. [ Conclusion ] The study provides theoretical support for further discussing the toxic effect of TCP to G. penna as well as the early diagnosis and risk evaluation of TCP compounds.

  6. 2.9, 2.36, and 1.96 Ga zircons in orthogneiss south of the Red River shear zone in Viet Nam: evidence from SHRIMP U-Pb dating and tectonothermal implications (United States)

    Nam, Tran Ngoc; Toriumi, Mitsuhiro; Sano, Yuji; Terada, Kentaro; Thang, Ta Trong


    Orthogneissic rocks coexisting with migmatites and containing small amphibolite lenses are exposed in the center of the metamorphic belt which runs parallel to the Day Nui Con Voi-Red River shear zone in northern Viet Nam. The orthogneiss complex has given some radiogenic dates of Early Proterozoic and Late Archean, which are the oldest ages ever registered for the Southeast Asian continent. Zircon grains separated from three samples of the orthogneiss complex have been dated to establish the protolith age and the timing of high-grade tectonothermal events in the complex. Sixty-five SHRIMP U-Th-Pb analyses of these zircons define three age groups of 2.84-2.91, 2.36, and 1.96 Ga. The age groups correspond to three periods of zircon generation. The oldest ˜2.9 Ga cores indicate a minimum age for the protolith of the orthogneiss complex. Two younger generations (including ˜2.36 Ga outer-cores and ˜1.96 Ga rims) probably grew during later high-grade tectono-metamorphic events, which were previously suggested by K-Ar and 40Ar/ 39Ar cooling ages of ˜2.0 Ga for synkinematic hornblendes. An early thermal history of the orthogneiss complex has been constrained, including a primary magma-crystallization stage starting at ˜2.9 Ga, followed by two Early Proterozoic (˜2.36 and ˜1.96 Ga) high-grade tectonothermal events. The ca. 2.9 Ga protolith age of the orthogneiss complex documented in this study provides new convincing evidence for the presence of Archean rocks in Indochina, and clearly indicates that the crustal evolution of northern Viet Nam started as early as Late Archean time.

  7. First Measurement of Bose-Einstein Correlations in Proton-Proton Collisions at $\\sqrt{s}=0.9$ and 2.36 TeV at the LHC

    Energy Technology Data Exchange (ETDEWEB)

    Khachatryan, Vardan; Sirunyan, Albert M.; Tumasyan, Armen; Adam, Wolfgang; Bergauer, Thomas; Dragicevic, Marko; Er, Janos; Fabjan, Christian; Friedl, Markus; Fruehwirth, Rudolf; Ghete, Vasile Mihai; /Yerevan Phys. Inst. /Vienna, OAW /CERN /Minsk, High Energy Phys. Ctr. /Antwerp U., WISINF /Vrije U., Brussels /Brussels U. /Gent U. /Louvain U. /UMH, Mons /Rio de Janeiro, CBPF /Rome U. /INFN, Rome /CERN /Turin U. /INFN, Turin /Piemonte Orientale U., Novara /Trieste U. /INFN, Trieste /CHEP, Taegu /Chonnam Natl. U. /Korea U. /UCLA /CERN /UC, Riverside /Budapest, RMKI /UC, San Diego /UC, Santa Barbara /Caltech /Carnegie Mellon U. /Colorado U. /Cornell U. /Fairfield U.


    Bose-Einstein correlations have been measured using samples of proton-proton collisions at 0.9 and 2.36 TeV center-of-mass energies, recorded by the CMS experiment at the CERN Large Hadron Collider. The signal is observed in the form of an enhancement of pairs of same-sign charged particles with small relative four-momentum. The size of the correlated particle emission region is seen to increase significantly with the particle multiplicity of the event.

  8. First Measurement of Bose-Einstein Correlations in proton-proton Collisions at $\\sqrt{s}$ =0.9 and 2.36 TeV at the LHC

    CERN Document Server

    Khachatryan, Vardan; Tumasyan, Armen; Adam, Wolfgang; Bergauer, Thomas; Dragicevic, Marko; Erö, Janos; Fabjan, Christian; Friedl, Markus; Fruehwirth, Rudolf; Ghete, Vasile Mihai; Hammer, Josef; Haensel, Stephan; Hoch, Michael; Hörmann, Natascha; Hrubec, Josef; Jeitler, Manfred; Kasieczka, Gregor; Kiesenhofer, Wolfgang; Krammer, Manfred; Liko, Dietrich; Mikulec, Ivan; Pernicka, Manfred; Rohringer, Herbert; Schöfbeck, Robert; Strauss, Josef; Taurok, Anton; Teischinger, Florian; Waltenberger, Wolfgang; Walzel, Gerhard; Widl, Edmund; Wulz, Claudia-Elisabeth; Mossolov, Vladimir; Shumeiko, Nikolai; Suarez Gonzalez, Juan; Benucci, Leonardo; Ceard, Ludivine; De Wolf, Eddi A.; Hashemi, Majid; Janssen, Xavier; Maes, Thomas; Mucibello, Luca; Ochesanu, Silvia; Roland, Benoit; Rougny, Romain; Selvaggi, Michele; Van Haevermaet, Hans; Van Mechelen, Pierre; Van Remortel, Nick; Adler, Volker; Beauceron, Stephanie; Blyweert, Stijn; D'Hondt, Jorgen; Devroede, Olivier; Kalogeropoulos, Alexis; Maes, Joris; Maes, Michael; Tavernier, Stefaan; Van Doninck, Walter; Van Mulders, Petra; Villella, Ilaria; Chabert, Eric Christian; Charaf, Otman; Clerbaux, Barbara; De Lentdecker, Gilles; Dero, Vincent; Gay, Arnaud; Hammad, Gregory Habib; Marage, Pierre Edouard; Vander Velde, Catherine; Vanlaer, Pascal; Wickens, John; Costantini, Silvia; Grunewald, Martin; Klein, Benjamin; Marinov, Andrey; Ryckbosch, Dirk; Thyssen, Filip; Tytgat, Michael; Vanelderen, Lukas; Verwilligen, Piet; Walsh, Sinead; Zaganidis, Nicolas; Basegmez, Suzan; Bruno, Giacomo; Caudron, Julien; De Favereau De Jeneret, Jerome; Delaere, Christophe; Demin, Pavel; Favart, Denis; Giammanco, Andrea; Grégoire, Ghislain; Hollar, Jonathan; Lemaitre, Vincent; Militaru, Otilia; Ovyn, Severine; Pagano, Davide; Pin, Arnaud; Piotrzkowski, Krzysztof; Quertenmont, Loic; Schul, Nicolas; Beliy, Nikita; Caebergs, Thierry; Daubie, Evelyne; Alves, Gilvan; Pol, Maria Elena; Henrique Gomes E Souza, Moacyr; Carvalho, Wagner; Da Costa, Eliza Melo; De Jesus Damiao, Dilson; De Oliveira Martins, Carley; Fonseca De Souza, Sandro; Mundim, Luiz; Oguri, Vitor; Santoro, Alberto; Silva Do Amaral, Sheila Mara; Sznajder, Andre; Torres Da Silva De Araujo, Felipe; De Almeida Dias, Flavia; Ferreira Dias, Marco Andre; Tomei, Thiago; De Moraes Gregores, Eduardo; Da Cunha Marinho, Franciole; Novaes, Sergio F.; Padula, Sandra; Darmenov, Nikolay; Dimitrov, Lubomir; Genchev, Vladimir; Iaydjiev, Plamen; Piperov, Stefan; Stoykova, Stefka; Sultanov, Georgi; Trayanov, Rumen; Vankov, Ivan; Dyulendarova, Milena; Hadjiiska, Roumyana; Kozhuharov, Venelin; Litov, Leander; Marinova, Evelina; Mateev, Matey; Pavlov, Borislav; Petkov, Peicho; Bian, Jian-Guo; Chen, Guo-Ming; Chen, He-Sheng; Jiang, Chun-Hua; Liang, Dong; Liang, Song; Wang, Jian; Wang, Xianyou; Wang, Zheng; Yang, Min; Zang, Jingjing; Zhang, Zhen; Ban, Yong; Guo, Shuang; Hu, Zhen; Mao, Yajun; Qian, Si-Jin; Teng, Haiyun; Zhu, Bo; Cabrera, Andrés; Carrillo Montoya, Camilo Andres; Gomez Moreno, Bernardo; Ocampo Rios, Alberto Andres; Osorio Oliveros, Andres Felipe; Sanabria, Juan Carlos; Godinovic, Nikola; Lelas, Damir; Lelas, Karlo; Plestina, Roko; Polic, Dunja; Puljak, Ivica; Antunovic, Zeljko; Dzelalija, Mile; Brigljevic, Vuko; Duric, Senka; Kadija, Kreso; Morovic, Srecko; Attikis, Alexandros; Fereos, Reginos; Galanti, Mario; Mousa, Jehad; Nicolaou, Charalambos; Papadakis, Antonakis; Ptochos, Fotios; Razis, Panos A.; Rykaczewski, Hans; Tsiakkouri, Demetra; Zinonos, Zinonas; Mahmoud, Mohammed; Hektor, Andi; Kadastik, Mario; Kannike, Kristjan; Müntel, Mait; Raidal, Martti; Rebane, Liis; Azzolini, Virginia; Eerola, Paula; Czellar, Sandor; Härkönen, Jaakko; Heikkinen, Mika Aatos; Karimäki, Veikko; Kinnunen, Ritva; Klem, Jukka; Kortelainen, Matti J.; Lampén, Tapio; Lassila-Perini, Kati; Lehti, Sami; Lindén, Tomas; Luukka, Panja-Riina; Mäenpää, Teppo; Tuominen, Eija; Tuominiemi, Jorma; Tuovinen, Esa; Ungaro, Donatella; Wendland, Lauri; Banzuzi, Kukka; Korpela, Arja; Tuuva, Tuure; Sillou, Daniel; Besancon, Marc; Dejardin, Marc; Denegri, Daniel; Descamps, Julien; Fabbro, Bernard; Faure, Jean-Louis; Ferri, Federico; Ganjour, Serguei; Gentit, François-Xavier; Givernaud, Alain; Gras, Philippe; Hamel de Monchenault, Gautier; Jarry, Patrick; Locci, Elizabeth; Malcles, Julie; Marionneau, Matthieu; Millischer, Laurent; Rander, John; Rosowsky, André; Rousseau, Delphine; Titov, Maksym; Verrecchia, Patrice; Baffioni, Stephanie; Bianchini, Lorenzo; Bluj, Michal; Broutin, Clementine; Busson, Philippe; Charlot, Claude; Dobrzynski, Ludwik; Elgammal, Sherif; Granier de Cassagnac, Raphael; Haguenauer, Maurice; Kalinowski, Artur; Miné, Philippe; Paganini, Pascal; Sabes, David; Sirois, Yves; Thiebaux, Christophe; Zabi, Alexandre; Agram, Jean-Laurent; Besson, Auguste; Bloch, Daniel; Bodin, David; Brom, Jean-Marie; Cardaci, Marco; Conte, Eric; Drouhin, Frédéric; Ferro, Cristina; Fontaine, Jean-Charles; Gelé, Denis; Goerlach, Ulrich; Greder, Sebastien; Juillot, Pierre; Karim, Mehdi; Le Bihan, Anne-Catherine; Mikami, Yoshinari; Speck, Joaquim; Van Hove, Pierre; Fassi, Farida; Mercier, Damien; Baty, Clement; Beaupere, Nicolas; Bedjidian, Marc; Bondu, Olivier; Boudoul, Gaelle; Boumediene, Djamel; Brun, Hugues; Chanon, Nicolas; Chierici, Roberto; Contardo, Didier; Depasse, Pierre; El Mamouni, Houmani; Fay, Jean; Gascon, Susan; Ille, Bernard; Kurca, Tibor; Le Grand, Thomas; Lethuillier, Morgan; Mirabito, Laurent; Perries, Stephane; Sordini, Viola; Tosi, Silvano; Tschudi, Yohann; Verdier, Patrice; Xiao, Hong; Roinishvili, Vladimir; Anagnostou, Georgios; Edelhoff, Matthias; Feld, Lutz; Heracleous, Natalie; Hindrichs, Otto; Jussen, Ruediger; Klein, Katja; Merz, Jennifer; Mohr, Niklas; Ostapchuk, Andrey; Perieanu, Adrian; Raupach, Frank; Sammet, Jan; Schael, Stefan; Sprenger, Daniel; Weber, Hendrik; Weber, Martin; Wittmer, Bruno; Actis, Oxana; Ata, Metin; Bender, Walter; Biallass, Philipp; Erdmann, Martin; Frangenheim, Jens; Hebbeker, Thomas; Hinzmann, Andreas; Hoepfner, Kerstin; Hof, Carsten; Kirsch, Matthias; Klimkovich, Tatsiana; Kreuzer, Peter; Lanske, Dankfried; Magass, Carsten; Merschmeyer, Markus; Meyer, Arnd; Papacz, Paul; Pieta, Holger; Reithler, Hans; Schmitz, Stefan Antonius; Sonnenschein, Lars; Sowa, Michael; Steggemann, Jan; Teyssier, Daniel; Zeidler, Clemens; Bontenackels, Michael; Davids, Martina; Duda, Markus; Flügge, Günter; Geenen, Heiko; Giffels, Manuel; Haj Ahmad, Wael; Heydhausen, Dirk; Kress, Thomas; Kuessel, Yvonne; Linn, Alexander; Nowack, Andreas; Perchalla, Lars; Pooth, Oliver; Sauerland, Philip; Stahl, Achim; Thomas, Maarten; Tornier, Daiske; Zoeller, Marc Henning; Aldaya Martin, Maria; Behrenhoff, Wolf; Behrens, Ulf; Bergholz, Matthias; Borras, Kerstin; Campbell, Alan; Castro, Elena; Dammann, Dirk; Eckerlin, Guenter; Flossdorf, Alexander; Flucke, Gero; Geiser, Achim; Hauk, Johannes; Jung, Hannes; Kasemann, Matthias; Katkov, Igor; Kleinwort, Claus; Kluge, Hannelies; Knutsson, Albert; Kuznetsova, Ekaterina; Lange, Wolfgang; Lohmann, Wolfgang; Mankel, Rainer; Marienfeld, Markus; Melzer-Pellmann, Isabell-Alissandra; Meyer, Andreas Bernhard; Mnich, Joachim; Mussgiller, Andreas; Olzem, Jan; Parenti, Andrea; Raspereza, Alexei; Schmidt, Ringo; Schoerner-Sadenius, Thomas; Sen, Niladri; Stein, Matthias; Tomaszewska, Justyna; Volyanskyy, Dmytro; Wissing, Christoph; Autermann, Christian; Draeger, Jula; Eckstein, Doris; Enderle, Holger; Gebbert, Ulla; Kaschube, Kolja; Kaussen, Gordon; Klanner, Robert; Mura, Benedikt; Naumann-Emme, Sebastian; Nowak, Friederike; Sander, Christian; Schettler, Hannes; Schleper, Peter; Schröder, Matthias; Schum, Torben; Schwandt, Joern; Stadie, Hartmut; Steinbrück, Georg; Thomsen, Jan; Wolf, Roger; Bauer, Julia; Buege, Volker; Cakir, Altan; Chwalek, Thorsten; Daeuwel, Daniel; De Boer, Wim; Dierlamm, Alexander; Dirkes, Guido; Feindt, Michael; Gruschke, Jasmin; Hackstein, Christoph; Hartmann, Frank; Heinrich, Michael; Held, Hauke; Hoffmann, Karl-Heinz; Honc, Simon; Kuhr, Thomas; Martschei, Daniel; Mueller, Steffen; Müller, Thomas; Niegel, Martin; Oberst, Oliver; Oehler, Andreas; Ott, Jochen; Peiffer, Thomas; Piparo, Danilo; Quast, Gunter; Rabbertz, Klaus; Ratnikov, Fedor; Renz, Manuel; Sabellek, Andreas; Saout, Christophe; Scheurer, Armin; Schieferdecker, Philipp; Schilling, Frank-Peter; Schott, Gregory; Simonis, Hans-Jürgen; Stober, Fred-Markus Helmut; Troendle, Daniel; Wagner-Kuhr, Jeannine; Zeise, Manuel; Zhukov, Valery; Ziebarth, Eva Barbara; Daskalakis, Georgios; Geralis, Theodoros; Kyriakis, Aristotelis; Loukas, Demetrios; Manolakos, Ioannis; Markou, Athanasios; Markou, Christos; Mavrommatis, Charalampos; Petrakou, Eleni; Gouskos, Loukas; Katsas, Panagiotis; Panagiotou, Apostolos; Evangelou, Ioannis; Kokkas, Panagiotis; Manthos, Nikolaos; Papadopoulos, Ioannis; Patras, Vaios; Triantis, Frixos A.; Aranyi, Attila; Bencze, Gyorgy; Boldizsar, Laszlo; Debreczeni, Gergely; Hajdu, Csaba; Horvath, Dezso; Kapusi, Anita; Krajczar, Krisztian; Laszlo, Andras; Sikler, Ferenc; Vesztergombi, Gyorgy; Beni, Noemi; Molnar, Jozsef; Palinkas, Jozsef; Szillasi, Zoltan; Veszpremi, Viktor; Raics, Peter; Trocsanyi, Zoltan Laszlo; Ujvari, Balazs; Bansal, Sunil; Beri, Suman Bala; Bhatnagar, Vipin; Jindal, Monika; Kaur, Manjit; Kohli, Jatinder Mohan; Mehta, Manuk Zubin; Nishu, Nishu; Saini, Lovedeep Kaur; Sharma, Archana; Sharma, Richa; Singh, Anil; Singh, Jas Bir; Singh, Supreet Pal; Ahuja, Sudha; Bhattacharya, Satyaki; Chauhan, Sushil; Choudhary, Brajesh C.; Gupta, Pooja; Jain, Shilpi; Jain, Sandhya; Kumar, Ashok; Ranjan, Kirti; Shivpuri, Ram Krishen; Choudhury, Rajani Kant; Dutta, Dipanwita; Kailas, Swaminathan; Kataria, Sushil Kumar; Mohanty, Ajit Kumar; Pant, Lalit Mohan; Shukla, Prashant; Suggisetti, Praveenkumar; Aziz, Tariq; Guchait, Monoranjan; Gurtu, Atul; Maity, Manas; Majumder, Devdatta; Majumder, Gobinda; Mazumdar, Kajari; Mohanty, Gagan Bihari; Saha, Anirban; Sudhakar, Katta; Wickramage, Nadeesha; Banerjee, Sudeshna; Dugad, Shashikant; Mondal, Naba Kumar; Arfaei, Hessamaddin; Bakhshiansohi, Hamed; Fahim, Ali; Jafari, Abideh; Mohammadi Najafabadi, Mojtaba; Paktinat Mehdiabadi, Saeid; Safarzadeh, Batool; Zeinali, Maryam; Abbrescia, Marcello; Barbone, Lucia; Colaleo, Anna; Creanza, Donato; De Filippis, Nicola; De Palma, Mauro; Dimitrov, Anton; Fedele, Francesca; Fiore, Luigi; Iaselli, Giuseppe; Lusito, Letizia; Maggi, Giorgio; Maggi, Marcello; Manna, Norman; Marangelli, Bartolomeo; My, Salvatore; Nuzzo, Salvatore; Pierro, Giuseppe Antonio; Pompili, Alexis; Pugliese, Gabriella; Romano, Francesco; Roselli, Giuseppe; Selvaggi, Giovanna; Silvestris, Lucia; Trentadue, Raffaello; Tupputi, Salvatore; Zito, Giuseppe; Abbiendi, Giovanni; Benvenuti, Alberto; Bonacorsi, Daniele; Braibant-Giacomelli, Sylvie; Capiluppi, Paolo; Castro, Andrea; Cavallo, Francesca Romana; Codispoti, Giuseppe; Cuffiani, Marco; Fanfani, Alessandra; Fasanella, Daniele; Giacomelli, Paolo; Giunta, Marina; Grandi, Claudio; Marcellini, Stefano; Masetti, Gianni; Montanari, Alessandro; Navarria, Francesco; Odorici, Fabrizio; Perrotta, Andrea; Rossi, Antonio; Rovelli, Tiziano; Siroli, Gianni; Travaglini, Riccardo; Albergo, Sebastiano; Cappello, Gigi; Chiorboli, Massimiliano; Costa, Salvatore; Tricomi, Alessia; Tuve, Cristina; Barbagli, Giuseppe; Broccolo, Giuseppe; Ciulli, Vitaliano; Civinini, Carlo; D'Alessandro, Raffaello; Focardi, Ettore; Frosali, Simone; Gallo, Elisabetta; Genta, Chiara; Lenzi, Piergiulio; Meschini, Marco; Paoletti, Simone; Sguazzoni, Giacomo; Tropiano, Antonio; Benussi, Luigi; Bianco, Stefano; Colafranceschi, Stefano; Fabbri, Franco; Piccolo, Davide; Fabbricatore, Pasquale; Musenich, Riccardo; Benaglia, Andrea; Cerati, Giuseppe Benedetto; De Guio, Federico; Di Matteo, Leonardo; Ghezzi, Alessio; Govoni, Pietro; Malberti, Martina; Malvezzi, Sandra; Martelli, Arabella; Massironi, Andrea; Menasce, Dario; Miccio, Vincenzo; Moroni, Luigi; Negri, Pietro; Paganoni, Marco; Pedrini, Daniele; Ragazzi, Stefano; Redaelli, Nicola; Sala, Silvano; Salerno, Roberto; Tabarelli de Fatis, Tommaso; Tancini, Valentina; Taroni, Silvia; Buontempo, Salvatore; Cimmino, Anna; De Cosa, Annapaola; De Gruttola, Michele; Fabozzi, Francesco; Iorio, Alberto Orso Maria; Lista, Luca; Noli, Pasquale; Paolucci, Pierluigi; Azzi, Patrizia; Bacchetta, Nicola; Bellan, Paolo; Bisello, Dario; Carlin, Roberto; Checchia, Paolo; Conti, Enrico; De Mattia, Marco; Dorigo, Tommaso; Dosselli, Umberto; Gasparini, Fabrizio; Gasparini, Ugo; Giubilato, Piero; Gresele, Ambra; Lacaprara, Stefano; Lazzizzera, Ignazio; Margoni, Martino; Mazzucato, Mirco; Meneguzzo, Anna Teresa; Nespolo, Massimo; Perrozzi, Luca; Pozzobon, Nicola; Ronchese, Paolo; Simonetto, Franco; Torassa, Ezio; Tosi, Mia; Vanini, Sara; Zotto, Pierluigi; Zumerle, Gianni; Baesso, Paolo; Berzano, Umberto; Riccardi, Cristina; Torre, Paola; Vitulo, Paolo; Viviani, Claudio; Biasini, Maurizio; Bilei, Gian Mario; Caponeri, Benedetta; Fanò, Livio; Lariccia, Paolo; Lucaroni, Andrea; Mantovani, Giancarlo; Menichelli, Mauro; Nappi, Aniello; Santocchia, Attilio; Servoli, Leonello; Valdata, Marisa; Volpe, Roberta; Azzurri, Paolo; Bagliesi, Giuseppe; Bernardini, Jacopo; Boccali, Tommaso; Castaldi, Rino; Dagnolo, Raffaele Tito; Dell'Orso, Roberto; Fiori, Francesco; Foà, Lorenzo; Giassi, Alessandro; Kraan, Aafke; Ligabue, Franco; Lomtadze, Teimuraz; Martini, Luca; Messineo, Alberto; Palla, Fabrizio; Palmonari, Francesco; Segneri, Gabriele; Serban, Alin Titus; Spagnolo, Paolo; Tenchini, Roberto; Tonelli, Guido; Venturi, Andrea; Verdini, Piero Giorgio; Barone, Luciano; Cavallari, Francesca; Del Re, Daniele; Di Marco, Emanuele; Diemoz, Marcella; Franci, Daniele; Grassi, Marco; Longo, Egidio; Organtini, Giovanni; Palma, Alessandro; Pandolfi, Francesco; Paramatti, Riccardo; Rahatlou, Shahram; Amapane, Nicola; Arcidiacono, Roberta; Argiro, Stefano; Arneodo, Michele; Biino, Cristina; Botta, Cristina; Cartiglia, Nicolo; Castello, Roberto; Costa, Marco; Demaria, Natale; Graziano, Alberto; Mariotti, Chiara; Marone, Matteo; Maselli, Silvia; Migliore, Ernesto; Mila, Giorgia; Monaco, Vincenzo; Musich, Marco; Obertino, Maria Margherita; Pastrone, Nadia; Pelliccioni, Mario; Romero, Alessandra; Ruspa, Marta; Sacchi, Roberto; Solano, Ada; Staiano, Amedeo; Trocino, Daniele; Vilela Pereira, Antonio; Ambroglini, Filippo; Belforte, Stefano; Cossutti, Fabio; Della Ricca, Giuseppe; Gobbo, Benigno; Montanino, Damiana; Penzo, Aldo; Chang, Sunghyun; Chung, Jin Hyuk; Kim, Dong Hee; Kim, Gui Nyun; Kim, Ji Eun; Kong, Dae Jung; Park, Hyangkyu; Son, Dong-Chul; Kim, Jaeho; Kim, Jae Yool; Song, Sanghyeon; Hong, Byung-Sik; Kim, Hyunchul; Kim, Ji Hyun; Kim, Tae Jeong; Lee, Kyong Sei; Moon, Dong Ho; Park, Sung Keun; Rhee, Han-Bum; Sim, Kwang Souk; Choi, Minkyoo; Kang, Seokon; Kim, Hyunyong; Park, Chawon; Park, Inkyu; Park, Sangnam; Choi, Suyong; Choi, Young-Il; Choi, Young Kyu; Goh, Junghwan; Lee, Jongseok; Lee, Sungeun; Seo, Hyunkwan; Yu, Intae; Janulis, Mindaugas; Martisiute, Dalia; Petrov, Pavel; Sabonis, Tomas; Castilla Valdez, Heriberto; De La Cruz Burelo, Eduard; Lopez-Fernandez, Ricardo; Sánchez Hernández, Alberto; Villaseñor-Cendejas, Luis Manuel; Carrillo Moreno, Salvador; Salazar Ibarguen, Humberto Antonio; Casimiro Linares, Edgar; Morelos Pineda, Antonio; Reyes-Santos, Marco A.; Allfrey, Philip; Krofcheck, David; Tam, Jason; Butler, Philip H.; Signal, Tony; Williams, Jennifer C.; Ahmad, Muhammad; Ahmed, Ijaz; Asghar, Muhammad Irfan; Hoorani, Hafeez R.; Khan, Wajid Ali; Khurshid, Taimoor; Qazi, Shamona; Cwiok, Mikolaj; Dominik, Wojciech; Doroba, Krzysztof; Konecki, Marcin; Krolikowski, Jan; Frueboes, Tomasz; Gokieli, Ryszard; Górski, Maciej; Kazana, Malgorzata; Nawrocki, Krzysztof; Szleper, Michal; Wrochna, Grzegorz; Zalewski, Piotr; Almeida, Nuno; David Tinoco Mendes, Andre; Faccioli, Pietro; Ferreira Parracho, Pedro Guilherme; Gallinaro, Michele; Mini, Giuliano; Musella, Pasquale; Nayak, Aruna; Raposo, Luis; Ribeiro, Pedro Quinaz; Seixas, Joao; Silva, Pedro; Soares, David; Varela, Joao; Wöhri, Hermine Katharina; Altsybeev, Igor; Belotelov, Ivan; Bunin, Pavel; Finger, Miroslav; Finger Jr., Michael; Golutvin, Igor; Kamenev, Alexey; Karjavin, Vladimir; Kozlov, Guennady; Lanev, Alexander; Moisenz, Petr; Palichik, Vladimir; Perelygin, Victor; Shmatov, Sergey; Smirnov, Vitaly; Volodko, Anton; Zarubin, Anatoli; Bondar, Nikolai; Golovtsov, Victor; Ivanov, Yury; Kim, Victor; Levchenko, Petr; Smirnov, Igor; Sulimov, Valentin; Uvarov, Lev; Vavilov, Sergey; Vorobyev, Alexey; Andreev, Yuri; Gninenko, Sergei; Golubev, Nikolai; Kirsanov, Mikhail; Krasnikov, Nikolai; Matveev, Viktor; Pashenkov, Anatoli; Toropin, Alexander; Troitsky, Sergey; Epshteyn, Vladimir; Gavrilov, Vladimir; Ilina, Natalia; Kaftanov, Vitali; Kossov, Mikhail; Krokhotin, Andrey; Kuleshov, Sergey; Oulianov, Alexei; Safronov, Grigory; Semenov, Sergey; Shreyber, Irina; Stolin, Viatcheslav; Vlasov, Evgueni; Zhokin, Alexander; Boos, Edouard; Dubinin, Mikhail; Dudko, Lev; Ershov, Alexander; Gribushin, Andrey; Kodolova, Olga; Lokhtin, Igor; Obraztsov, Stepan; Petrushanko, Sergey; Sarycheva, Ludmila; Savrin, Viktor; Snigirev, Alexander; Andreev, Vladimir; Dremin, Igor; Kirakosyan, Martin; Rusakov, Sergey V.; Vinogradov, Alexey; Azhgirey, Igor; Bitioukov, Sergei; Datsko, Kirill; Grishin, Viatcheslav; Kachanov, Vassili; Konstantinov, Dmitri; Krychkine, Victor; Petrov, Vladimir; Ryutin, Roman; Slabospitsky, Sergey; Sobol, Andrei; Sytine, Alexandre; Tourtchanovitch, Leonid; Troshin, Sergey; Tyurin, Nikolay; Uzunian, Andrey; Volkov, Alexey; Adzic, Petar; Djordjevic, Milos; Krpic, Dragomir; Maletic, Dimitrije; Milosevic, Jovan; Puzovic, Jovan; Aguilar-Benitez, Manuel; Alcaraz Maestre, Juan; Arce, Pedro; Battilana, Carlo; Calvo, Enrique; Cepeda, Maria; Cerrada, Marcos; Chamizo Llatas, Maria; Colino, Nicanor; De La Cruz, Begona; Diez Pardos, Carmen; Fernandez Bedoya, Cristina; Fernández Ramos, Juan Pablo; Ferrando, Antonio; Flix, Jose; Fouz, Maria Cruz; Garcia-Abia, Pablo; Gonzalez Lopez, Oscar; Goy Lopez, Silvia; Hernandez, Jose M.; Josa, Maria Isabel; Merino, Gonzalo; Puerta Pelayo, Jesus; Redondo, Ignacio; Romero, Luciano; Santaolalla, Javier; Willmott, Carlos; Albajar, Carmen; de Trocóniz, Jorge F; Cuevas, Javier; Fernandez Menendez, Javier; Gonzalez Caballero, Isidro; Lloret Iglesias, Lara; Vizan Garcia, Jesus Manuel; Cabrillo, Iban Jose; Calderon, Alicia; Chuang, Shan-Huei; Diaz Merino, Irma; Diez Gonzalez, Carlos; Duarte Campderros, Jordi; Fernandez, Marcos; Gomez, Gervasio; Gonzalez Sanchez, Javier; Gonzalez Suarez, Rebeca; Jorda, Clara; Lobelle Pardo, Patricia; Lopez Virto, Amparo; Marco, Jesus; Marco, Rafael; Martinez Rivero, Celso; Martinez Ruiz del Arbol, Pablo; Matorras, Francisco; Rodrigo, Teresa; Ruiz Jimeno, Alberto; Scodellaro, Luca; Sobron Sanudo, Mar; Vila, Ivan; Vilar Cortabitarte, Rocio; Abbaneo, Duccio; Auffray, Etiennette; Baillon, Paul; Ball, Austin; Barney, David; Beaudette, Florian; Bellan, Riccardo; Benedetti, Daniele; Bernet, Colin; Bialas, Wojciech; Bloch, Philippe; Bocci, Andrea; Bolognesi, Sara; Breuker, Horst; Brona, Grzegorz; Bunkowski, Karol; Camporesi, Tiziano; Cano, Eric; Cattai, Ariella; Cerminara, Gianluca; Christiansen, Tim; Coarasa Perez, Jose Antonio; Covarelli, Roberto; Curé, Benoît; Dahms, Torsten; De Roeck, Albert; Elliott-Peisert, Anna; Funk, Wolfgang; Gaddi, Andrea; Gennai, Simone; Gerwig, Hubert; Gigi, Dominique; Gill, Karl; Giordano, Domenico; Glege, Frank; Gomez-Reino Garrido, Robert; Gowdy, Stephen; Guiducci, Luigi; Hansen, Magnus; Hartl, Christian; Harvey, John; Hegner, Benedikt; Henderson, Conor; Hoffmann, Hans Falk; Honma, Alan; Innocente, Vincenzo; Janot, Patrick; Lecoq, Paul; Leonidopoulos, Christos; Lourenco, Carlos; Macpherson, Alick; Maki, Tuula; Malgeri, Luca; Mannelli, Marcello; Masetti, Lorenzo; Mavromanolakis, Georgios; Meijers, Frans; Mersi, Stefano; Meschi, Emilio; Moser, Roland; Mozer, Matthias Ulrich; Mulders, Martijn; Nesvold, Erik; Orsini, Luciano; Perez, Emmanuelle; Petrilli, Achille; Pfeiffer, Andreas; Pierini, Maurizio; Pimiä, Martti; Racz, Attila; Rolandi, Gigi; Rovelli, Chiara; Rovere, Marco; Sakulin, Hannes; Schäfer, Christoph; Schwick, Christoph; Segoni, Ilaria; Sharma, Archana; Siegrist, Patrice; Simon, Michal; Sphicas, Paraskevas; Spiga, Daniele; Spiropulu, Maria; Stöckli, Fabian; Traczyk, Piotr; Tropea, Paola; Tsirou, Andromachi; Veres, Gabor Istvan; Vichoudis, Paschalis; Voutilainen, Mikko; Zeuner, Wolfram Dietrich; Bertl, Willi; Deiters, Konrad; Erdmann, Wolfram; Gabathuler, Kurt; Horisberger, Roland; Ingram, Quentin; Kaestli, Hans-Christian; König, Stefan; Kotlinski, Danek; Langenegger, Urs; Meier, Frank; Renker, Dieter; Rohe, Tilman; Sibille, Jennifer; Starodumov, Andrei; Caminada, Lea; Chen, Zhiling; Cittolin, Sergio; Dissertori, Günther; Dittmar, Michael; Eugster, Jürg; Freudenreich, Klaus; Grab, Christoph; Hervé, Alain; Hintz, Wieland; Lecomte, Pierre; Lustermann, Werner; Marchica, Carmelo; Meridiani, Paolo; Milenovic, Predrag; Moortgat, Filip; Nardulli, Alessandro; Nef, Pascal; Nessi-Tedaldi, Francesca; Pape, Luc; Pauss, Felicitas; Punz, Thomas; Rizzi, Andrea; Ronga, Frederic Jean; Sala, Leonardo; Sanchez, Ann - Karin; Sawley, Marie-Christine; Schinzel, Dietrich; Stieger, Benjamin; Tauscher, Ludwig; Thea, Alessandro; Theofilatos, Konstantinos; Treille, Daniel; Weber, Matthias; Wehrli, Lukas; Weng, Joanna; Amsler, Claude; Chiochia, Vincenzo; De Visscher, Simon; Ivova Rikova, Mirena; Millan Mejias, Barbara; Regenfus, Christian; Robmann, Peter; Rommerskirchen, Tanja; Schmidt, Alexander; Tsirigkas, Dimitrios; Wilke, Lotte; Chang, Yuan-Hann; Chen, Kuan-Hsin; Chen, Wan-Ting; Go, Apollo; Kuo, Chia-Ming; Li, Syue-Wei; Lin, Willis; Liu, Ming-Hsiung; Lu, Yun-Ju; Wu, Jing-Han; Yu, Shin-Shan; Bartalini, Paolo; Chang, Paoti; Chang, You-Hao; Chang, Yu-Wei; Chao, Yuan; Chen, Kai-Feng; Hou, George Wei-Shu; Hsiung, Yee; Kao, Kai-Yi; Lei, Yeong-Jyi; Lin, Sheng-Wen; Lu, Rong-Shyang; Shiu, Jing-Ge; Tzeng, Yeng-Ming; Ueno, Koji; Wang, Chin-chi; Wang, Minzu; Wei, Jui-Te; Adiguzel, Aytul; Ayhan, Aydin; Bakirci, Mustafa Numan; Cerci, Salim; Demir, Zahide; Dozen, Candan; Dumanoglu, Isa; Eskut, Eda; Girgis, Semiray; Gökbulut, Gül; Güler, Yalcin; Gurpinar, Emine; Hos, Ilknur; Kangal, Evrim Ersin; Karaman, Turker; Kayis Topaksu, Aysel; Nart, Alisah; Önengüt, Gülsen; Ozdemir, Kadri; Ozturk, Sertac; Polatöz, Ayse; Sahin, Ozge; Sengul, Ozden; Sogut, Kenan; Tali, Bayram; Topakli, Huseyin; Uzun, Dilber; Vergili, Latife Nukhet; Vergili, Mehmet; Zorbilmez, Caglar; Akin, Ilina Vasileva; Aliev, Takhmasib; Bilmis, Selcuk; Deniz, Muhammed; Gamsizkan, Halil; Guler, Ali Murat; Ocalan, Kadir; Ozpineci, Altug; Serin, Meltem; Sever, Ramazan; Surat, Ugur Emrah; Yildirim, Eda; Zeyrek, Mehmet; Deliomeroglu, Mehmet; Demir, Durmus; Gülmez, Erhan; Halu, Arda; Isildak, Bora; Kaya, Mithat; Kaya, Ozlem; Özbek, Melih; Ozkorucuklu, Suat; Sonmez, Nasuf; Levchuk, Leonid; Bell, Peter; Bostock, Francis; Brooke, James John; Cheng, Teh Lee; Cussans, David; Frazier, Robert; Goldstein, Joel; Hansen, Maria; Heath, Greg P.; Heath, Helen F.; Hill, Christopher; Huckvale, Benedickt; Jackson, James; Kreczko, Lukasz; Mackay, Catherine Kirsty; Metson, Simon; Newbold, Dave M.; Nirunpong, Kachanon; Smith, Vincent J.; Ward, Simon; Basso, Lorenzo; Bell, Ken W.; Belyaev, Alexander; Brew, Christopher; Brown, Robert M.; Camanzi, Barbara; Cockerill, David J.A.; Coughlan, John A.; Harder, Kristian; Harper, Sam; Kennedy, Bruce W.; Olaiya, Emmanuel; Petyt, David; Radburn-Smith, Benjamin Charles; Shepherd-Themistocleous, Claire; Tomalin, Ian R.; Womersley, William John; Worm, Steven; Bainbridge, Robert; Ball, Gordon; Ballin, Jamie; Beuselinck, Raymond; Buchmuller, Oliver; Colling, David; Cripps, Nicholas; Cutajar, Michael; Davies, Gavin; Della Negra, Michel; Foudas, Costas; Fulcher, Jonathan; Futyan, David; Guneratne Bryer, Arlo; Hall, Geoffrey; Hatherell, Zoe; Hays, Jonathan; Iles, Gregory; Karapostoli, Georgia; Lyons, Louis; Magnan, Anne-Marie; Marrouche, Jad; Nandi, Robin; Nash, Jordan; Nikitenko, Alexander; Papageorgiou, Anastasios; Pesaresi, Mark; Petridis, Konstantinos; Pioppi, Michele; Raymond, David Mark; Rompotis, Nikolaos; Rose, Andrew; Ryan, Matthew John; Seez, Christopher; Sharp, Peter; Sparrow, Alex; Stoye, Markus; Tapper, Alexander; Tourneur, Stephane; Vazquez Acosta, Monica; Virdee, Tejinder; Wakefield, Stuart; Wardrope, David; Whyntie, Tom; Barrett, Matthew; Chadwick, Matthew; Cole, Joanne; Hobson, Peter R.; Khan, Akram; Kyberd, Paul; Leslie, Dawn; Reid, Ivan; Teodorescu, Liliana; Bose, Tulika; Clough, Andrew; Heister, Arno; St. John, Jason; Lawson, Philip; Lazic, Dragoslav; Rohlf, James; Sulak, Lawrence; Andrea, Jeremy; Avetisyan, Aram; Bhattacharya, Saptaparna; Chou, John Paul; Cutts, David; Esen, Selda; Heintz, Ulrich; Jabeen, Shabnam; Kukartsev, Gennadiy; Landsberg, Greg; Narain, Meenakshi; Nguyen, Duong; Speer, Thomas; Tsang, Ka Vang; Borgia, Maria Assunta; Breedon, Richard; Calderon De La Barca Sanchez, Manuel; Cebra, Daniel; Chertok, Maxwell; Conway, John; Cox, Peter Timothy; Dolen, James; Erbacher, Robin; Friis, Evan; Ko, Winston; Kopecky, Alexandra; Lander, Richard; Liu, Haidong; Maruyama, Sho; Miceli, Tia; Nikolic, Milan; Pellett, Dave; Robles, Jorge; Schwarz, Thomas; Searle, Matthew; Smith, John; Squires, Michael; Tripathi, Mani; Vasquez Sierra, Ricardo; Veelken, Christian; Andreev, Valeri; Arisaka, Katsushi; Cline, David; Cousins, Robert; Deisher, Amanda; Erhan, Samim; Farrell, Chris; Felcini, Marta; Hauser, Jay; Ignatenko, Mikhail; Jarvis, Chad; Plager, Charles; Rakness, Gregory; Schlein, Peter; Tucker, Jordan; Valuev, Vyacheslav; Wallny, Rainer; Babb, John; Clare, Robert; Ellison, John Anthony; Gary, J William; Hanson, Gail; Jeng, Geng-Yuan; Kao, Shih-Chuan; Liu, Feng; Liu, Hongliang; Luthra, Arun; Nguyen, Harold; Pasztor, Gabriella; Satpathy, Asish; Shen, Benjamin C.; Stringer, Robert; Sturdy, Jared; Sumowidagdo, Suharyo; Wilken, Rachel; Wimpenny, Stephen; Andrews, Warren; Branson, James G.; Dusinberre, Elizabeth; Evans, David; Golf, Frank; Holzner, André; Kelley, Ryan; Lebourgeois, Matthew; Letts, James; Mangano, Boris; Muelmenstaedt, Johannes; Padhi, Sanjay; Palmer, Christopher; Petrucciani, Giovanni; Pi, Haifeng; Pieri, Marco; Ranieri, Riccardo; Sani, Matteo; Sharma, Vivek; Simon, Sean; Tu, Yanjun; Vartak, Adish; Würthwein, Frank; Yagil, Avraham; Barge, Derek; Blume, Michael; Campagnari, Claudio; D'Alfonso, Mariarosaria; Danielson, Thomas; Garberson, Jeffrey; Incandela, Joe; Justus, Christopher; Kalavase, Puneeth; Koay, Sue Ann; Kovalskyi, Dmytro; Krutelyov, Vyacheslav; Lamb, James; Lowette, Steven; Pavlunin, Viktor; Rebassoo, Finn; Ribnik, Jacob; Richman, Jeffrey; Rossin, Roberto; Stuart, David; To, Wing; Vlimant, Jean-Roch; Witherell, Michael; Bornheim, Adolf; Bunn, Julian; Gataullin, Marat; Kcira, Dorian; Litvine, Vladimir; Ma, Yousi; Newman, Harvey B.; Rogan, Christopher; Shin, Kyoungha; Timciuc, Vladlen; Veverka, Jan; Wilkinson, Richard; Yang, Yong; Zhu, Ren-Yuan; Akgun, Bora; Carroll, Ryan; Ferguson, Thomas; Jang, Dong Wook; Jun, Soon Yung; Paulini, Manfred; Russ, James; Terentyev, Nikolay; Vogel, Helmut; Vorobiev, Igor; Cumalat, John Perry; Dinardo, Mauro Emanuele; Drell, Brian Robert; Ford, William T.; Heyburn, Bernadette; Luiggi Lopez, Eduardo; Nauenberg, Uriel; Smith, James; Stenson, Kevin; Ulmer, Keith; Wagner, Stephen Robert; Zang, Shi-Lei; Agostino, Lorenzo; Alexander, James; Blekman, Freya; Chatterjee, Avishek; Das, Souvik; Eggert, Nicholas; Fields, Laura Johanna; Gibbons, Lawrence Kent; Heltsley, Brian; Hopkins, Walter; Khukhunaishvili, Aleko; Kreis, Benjamin; Kuznetsov, Valentin; Nicolas Kaufman, Gala; Patterson, Juliet Ritchie; Puigh, Darren; Riley, Daniel; Ryd, Anders; Shi, Xin; Sun, Werner; Teo, Wee Don; Thom, Julia; Thompson, Joshua; Vaughan, Jennifer; Weng, Yao; Wittich, Peter; Biselli, Angela; Cirino, Guy; Winn, Dave; Abdullin, Salavat; Albrow, Michael; Anderson, Jacob; Apollinari, Giorgio; Atac, Muzaffer; Bakken, Jon Alan; Banerjee, Sunanda; Bauerdick, Lothar A.T.; Beretvas, Andrew; Berryhill, Jeffrey; Bhat, Pushpalatha C.; Bloch, Ingo; Borcherding, Frederick; Burkett, Kevin; Butler, Joel Nathan; Chetluru, Vasundhara; Cheung, Harry; Chlebana, Frank; Cihangir, Selcuk; Demarteau, Marcel; Eartly, David P.; Elvira, Victor Daniel; Fisk, Ian; Freeman, Jim; Gao, Yanyan; Gottschalk, Erik; Green, Dan; Gutsche, Oliver; Hahn, Alan; Hanlon, Jim; Harris, Robert M.; James, Eric; Jensen, Hans; Johnson, Marvin; Joshi, Umesh; Khatiwada, Rakshya; Kilminster, Benjamin; Klima, Boaz; Kousouris, Konstantinos; Kunori, Shuichi; Kwan, Simon; Limon, Peter; Lipton, Ron; Lykken, Joseph; Maeshima, Kaori; Marraffino, John Michael; Mason, David; McBride, Patricia; McCauley, Thomas; Miao, Ting; Mishra, Kalanand; Mrenna, Stephen; Musienko, Yuri; Newman-Holmes, Catherine; O'Dell, Vivian; Popescu, Sorina; Pordes, Ruth; Prokofyev, Oleg; Saoulidou, Niki; Sexton-Kennedy, Elizabeth; Sharma, Seema; Smith, Richard P.; Soha, Aron; Spalding, William J.; Spiegel, Leonard; Tan, Ping; Taylor, Lucas; Tkaczyk, Slawek; Uplegger, Lorenzo; Vaandering, Eric Wayne; Vidal, Richard; Whitmore, Juliana; Wu, Weimin; Yumiceva, Francisco; Yun, Jae Chul; Acosta, Darin; Avery, Paul; Bourilkov, Dimitri; Chen, Mingshui; Di Giovanni, Gian Piero; Dobur, Didar; Drozdetskiy, Alexey; Field, Richard D.; Fu, Yu; Furic, Ivan-Kresimir; Gartner, Joseph; Kim, Bockjoo; Klimenko, Sergey; Konigsberg, Jacobo; Korytov, Andrey; Kotov, Khristian; Kropivnitskaya, Anna; Kypreos, Theodore; Matchev, Konstantin; Mitselmakher, Guenakh; Pakhotin, Yuriy; Piedra Gomez, Jonatan; Prescott, Craig; Remington, Ronald; Schmitt, Michael; Scurlock, Bobby; Sellers, Paul; Wang, Dayong; Yelton, John; Zakaria, Mohammed; Ceron, Cristobal; Gaultney, Vanessa; Kramer, Laird; Lebolo, Luis Miguel; Linn, Stephan; Markowitz, Pete; Martinez, German; Mesa, Dalgis; Rodriguez, Jorge Luis; Adams, Todd; Askew, Andrew; Chen, Jie; Diamond, Brendan; Gleyzer, Sergei V; Haas, Jeff; Hagopian, Sharon; Hagopian, Vasken; Jenkins, Merrill; Johnson, Kurtis F.; Prosper, Harrison; Sekmen, Sezen; Veeraraghavan, Venkatesh; Baarmand, Marc M.; Guragain, Samir; Hohlmann, Marcus; Kalakhety, Himali; Mermerkaya, Hamit; Ralich, Robert; Vodopiyanov, Igor; Adams, Mark Raymond; Anghel, Ioana Maria; Apanasevich, Leonard; Bazterra, Victor Eduardo; Betts, Russell Richard; Callner, Jeremy; Cavanaugh, Richard; Dragoiu, Cosmin; Garcia-Solis, Edmundo Javier; Gerber, Cecilia Elena; Hofman, David Jonathan; Khalatian, Samvel; Lacroix, Florent; Shabalina, Elizaveta; Smoron, Agata; Strom, Derek; Varelas, Nikos; Akgun, Ugur; Albayrak, Elif Asli; Bilki, Burak; Cankocak, Kerem; Clarida, Warren; Duru, Firdevs; Lae, Chung Khim; McCliment, Edward; Merlo, Jean-Pierre; Mestvirishvili, Alexi; Moeller, Anthony; Nachtman, Jane; Newsom, Charles Ray; Norbeck, Edwin; Olson, Jonathan; Onel, Yasar; Ozok, Ferhat; Sen, Sercan; Wetzel, James; Yetkin, Taylan; Yi, Kai; Barnett, Bruce Arnold; Blumenfeld, Barry; Bonato, Alessio; Eskew, Christopher; Fehling, David; Giurgiu, Gavril; Gritsan, Andrei; Guo, Zijin; Hu, Guofan; Maksimovic, Petar; Rappoccio, Salvatore; Swartz, Morris; Tran, Nhan Viet; Whitbeck, Andrew; Baringer, Philip; Bean, Alice; Benelli, Gabriele; Grachov, Oleg; Murray, Michael; Radicci, Valeria; Sanders, Stephen; Wood, Jeffrey Scott; Zhukova, Victoria; Bandurin, Dmitry; Bolton, Tim; Chakaberia, Irakli; Ivanov, Andrew; Kaadze, Ketino; Maravin, Yurii; Shrestha, Shruti; Svintradze, Irakli; Wan, Zongru; Gronberg, Jeffrey; Lange, David; Wright, Douglas; Baden, Drew; Boutemeur, Madjid; Eno, Sarah Catherine; Ferencek, Dinko; Hadley, Nicholas John; Kellogg, Richard G.; Kirn, Malina; Mignerey, Alice; Rossato, Kenneth; Rumerio, Paolo; Santanastasio, Francesco; Skuja, Andris; Temple, Jeffrey; Tonjes, Marguerite; Tonwar, Suresh C.; Twedt, Elizabeth; Alver, Burak; Bauer, Gerry; Bendavid, Joshua; Busza, Wit; Butz, Erik; Cali, Ivan Amos; Chan, Matthew; D'Enterria, David; Everaerts, Pieter; Gomez Ceballos, Guillelmo; Goncharov, Maxim; Hahn, Kristan Allan; Harris, Philip; Kim, Yongsun; Klute, Markus; Lee, Yen-Jie; Li, Wei; Loizides, Constantinos; Luckey, Paul David; Ma, Teng; Nahn, Steve; Paus, Christoph; Roland, Christof; Roland, Gunther; Rudolph, Matthew; Stephans, George; Sumorok, Konstanty; Sung, Kevin; Wenger, Edward Allen; Wyslouch, Bolek; Xie, Si; Yilmaz, Yetkin; Yoon, Sungho; Zanetti, Marco; Cole, Perrie; Cooper, Seth; Cushman, Priscilla; Dahmes, Bryan; De Benedetti, Abraham; Dudero, Phillip Russell; Franzoni, Giovanni; Haupt, Jason; Klapoetke, Kevin; Kubota, Yuichi; Mans, Jeremy; Rekovic, Vladimir; Rusack, Roger; Sasseville, Michael; Singovsky, Alexander; Cremaldi, Lucien Marcus; Godang, Romulus; Kroeger, Rob; Perera, Lalith; Rahmat, Rahmat; Sanders, David A; Sonnek, Peter; Summers, Don; Bloom, Kenneth; Bose, Suvadeep; Butt, Jamila; Claes, Daniel R.; Dominguez, Aaron; Eads, Michael; Keller, Jason; Kelly, Tony; Kravchenko, Ilya; Lazo-Flores, Jose; Lundstedt, Carl; Malbouisson, Helena; Malik, Sudhir; Snow, Gregory R.; Baur, Ulrich; Iashvili, Ia; Kharchilava, Avto; Kumar, Ashish; Smith, Kenneth; Strang, Michael; Zennamo, Joseph; Alverson, George; Barberis, Emanuela; Baumgartel, Darin; Boeriu, Oana; Reucroft, Steve; Swain, John; Wood, Darien; Zhang, Jinzhong; Anastassov, Anton; Kubik, Andrew; Ofierzynski, Radoslaw Adrian; Pozdnyakov, Andrey; Schmitt, Michael; Stoynev, Stoyan; Velasco, Mayda; Won, Steven; Antonelli, Louis; Berry, Douglas; Hildreth, Michael; Jessop, Colin; Karmgard, Daniel John; Kolb, Jeff; Kolberg, Ted; Lannon, Kevin; Lynch, Sean; Marinelli, Nancy; Morse, David Michael; Ruchti, Randy; Slaunwhite, Jason; Valls, Nil; Warchol, Jadwiga; Wayne, Mitchell; Ziegler, Jill; Bylsma, Ben; Durkin, Lloyd Stanley; Gu, Jianhui; Killewald, Phillip; Ling, Ta-Yung; Williams, Grayson; Adam, Nadia; Berry, Edmund; Elmer, Peter; Gerbaudo, Davide; Halyo, Valerie; Hunt, Adam; Jones, John; Laird, Edward; Lopes Pegna, David; Marlow, Daniel; Medvedeva, Tatiana; Mooney, Michael; Olsen, James; Piroué, Pierre; Stickland, David; Tully, Christopher; Werner, Jeremy Scott; Zuranski, Andrzej; Acosta, Jhon Gabriel; Huang, Xing Tao; Lopez, Angel; Mendez, Hector; Oliveros, Sandra; Ramirez Vargas, Juan Eduardo; Zatzerklyaniy, Andriy; Alagoz, Enver; Barnes, Virgil E.; Bolla, Gino; Borrello, Laura; Bortoletto, Daniela; Everett, Adam; Garfinkel, Arthur F.; Gecse, Zoltan; Gutay, Laszlo; Jones, Matthew; Koybasi, Ozhan; Laasanen, Alvin T.; Leonardo, Nuno; Liu, Chang; Maroussov, Vassili; Merkel, Petra; Miller, David Harry; Neumeister, Norbert; Potamianos, Karolos; Shipsey, Ian; Silvers, David; Yoo, Hwi Dong; Zablocki, Jakub; Zheng, Yu; Jindal, Pratima; Parashar, Neeti; Cuplov, Vesna; Ecklund, Karl Matthew; Geurts, Frank J.M.; Liu, Jinghua H.; Morales, Jafet; Padley, Brian Paul; Redjimi, Radia; Roberts, Jay; Betchart, Burton; Bodek, Arie; Chung, Yeon Sei; de Barbaro, Pawel; Demina, Regina; Flacher, Henning; Garcia-Bellido, Aran; Gotra, Yury; Han, Jiyeon; Harel, Amnon; Miner, Daniel Carl; Orbaker, Douglas; Petrillo, Gianluca; Vishnevskiy, Dmitry; Zielinski, Marek; Bhatti, Anwar; Demortier, Luc; Goulianos, Konstantin; Hatakeyama, Kenichi; Lungu, Gheorghe; Mesropian, Christina; Yan, Ming; Atramentov, Oleksiy; Gershtein, Yuri; Gray, Richard; Halkiadakis, Eva; Hidas, Dean; Hits, Dmitry; Lath, Amitabh; Rose, Keith; Schnetzer, Steve; Somalwar, Sunil; Stone, Robert; Thomas, Scott; Cerizza, Giordano; Hollingsworth, Matthew; Spanier, Stefan; Yang, Zong-Chang; York, Andrew; Asaadi, Jonathan; Eusebi, Ricardo; Gilmore, Jason; Gurrola, Alfredo; Kamon, Teruki; Khotilovich, Vadim; Montalvo, Roy; Nguyen, Chi Nhan; Pivarski, James; Safonov, Alexei; Sengupta, Sinjini; Toback, David; Weinberger, Michael; Akchurin, Nural; Bardak, Cemile; Damgov, Jordan; Jeong, Chiyoung; Kovitanggoon, Kittikul; Lee, Sung Won; Mane, Poonam; Roh, Youn; Sill, Alan; Volobouev, Igor; Wigmans, Richard; Yazgan, Efe; Appelt, Eric; Brownson, Eric; Engh, Daniel; Florez, Carlos; Gabella, William; Johns, Willard; Kurt, Pelin; Maguire, Charles; Melo, Andrew; Sheldon, Paul; Velkovska, Julia; Arenton, Michael Wayne; Balazs, Michael; Buehler, Marc; Conetti, Sergio; Cox, Bradley; Hirosky, Robert; Ledovskoy, Alexander; Neu, Christopher; Yohay, Rachel; Gollapinni, Sowjanya; Gunthoti, Kranti; Harr, Robert; Karchin, Paul Edmund; Mattson, Mark; Milstène, Caroline; Sakharov, Alexandre; Anderson, Michael; Bachtis, Michail; Bellinger, James Nugent; Carlsmith, Duncan; Dasu, Sridhara; Dutta, Suchandra; Efron, Jonathan; Gray, Lindsey; Grogg, Kira Suzanne; Grothe, Monika; Herndon, Matthew; Klabbers, Pamela; Klukas, Jeffrey; Lanaro, Armando; Lazaridis, Christos; Leonard, Jessica; Lomidze, David; Loveless, Richard; Mohapatra, Ajit; Polese, Giovanni; Reeder, Don; Savin, Alexander; Smith, Wesley H.; Swanson, Joshua; Weinberg, Marc


    Bose-Einstein correlations have been measured using samples of proton-proton collisions at 0.9 and 2.36 TeV center-of-mass energies, recorded by the CMS experiment at the CERN Large Hadron Collider. The signal is observed in the form of an enhancement of pairs of same-sign charged particles with small relative four-momentum. The size of the correlated particle emission region is seen to increase significantly with the particle multiplicity of the event.

  9. Integral Fission Cross Section Ratios of Th232, U236 and U238 Relative to U235 in the Neutron Spectrum Produced by 23.2 MeV Deuterons Incident on a Thick Be Metal Target

    International Nuclear Information System (INIS)

    Integral neutron fission cross section ratios have been measured for Th232 /U238 , U23S/U235 and U236/U235 in the neutron field produced by bombardment of a thick Be metal target with 23.2 MeV deuterons. Validation of Th232, U236, U23S fission cross sections in a high energy neutron continuum spectrum is the object of this work. The neutron spectrum in the irradiation site has been obtained by unfolding of the neutron induced activity of eleven selected reactions. The average standard deviation between calculated activities with SAND-II unfolding code and the experimental input activities was 2.5%. Calculated values of the fission cross section ratios were obtained from, the ENDF/B-y evaluated library of cross sections and the measured spectrum. These ratios were not sensitive (<0.7%) to quite different SAND-II input spectra assumed in the low energy spectrum range (0.5 to 2. MeV). Analysis of error sources, errors propagation and their correlations was made and the correlation matrix of the experimental results was calculated. The experimental and calculated values obtained are consistent within the errors. Examination of the fissile ratios measured in other continuum neutron spectra shows a similar consistency in the spectrum produced by 7 MeV deuterons on Be. However in Cf252 and thermal U235 fission neutron spectra, a large discrepancy is found for Th232. (author)

  10. SNS vil høre om det supplerende materiale giver anledning til ændringer i de tidligere fremsendte risikovurderinger. Gossypium hirsutum (281-24-236/3006-210-23). Supplerende materiale til sagen (Four questions: Molecular characterisation / Food-feed assessment). Modtaget 12-12-2005, deadline 16

    DEFF Research Database (Denmark)

    Kjellsson, Gøsta; Damgaard, Christian; Strandberg, Morten Tune


    "DMU finder at det nye materiale om den molekulære karakterisering af 281-24-236x3006-210-23 bomulden, ikke giver anledning til at ændre den tidligere riskovurdering. Vedr. spørgsmål 1 er det i svaret fra anmelderen blevet tilfredsstillende redegjort for hvilket materiale der blev anvendt. Vedr s...

  11. The fission cross sections of 230Th, 232Th, 233U, 234U, 236U, 238U, 237Np, 239Pu and 242Pu relative 235U at 14.74 MeV neutron energy

    International Nuclear Information System (INIS)

    The measurement of the fission cross section ratios of nine isotopes relative to 235U at an average neutron energy of 14.74 MeV is described with particular attention to the determination of corrections and to sources of error. The results are compared to ENDF/B-V and to other measurements of the past decade. The ratio of the neutron induced fission cross section for these isotopes to the fission cross section for 235U are: 230Th - 0.290 +- 1.9%; 232Th - 0.191 +- 1.9%; 233U - 1.132 +- 0.7%; 234U - 0.998 +- 1.0%; 236U - 0.791 +- 1.1%; 238U - 0.587 +- 1.1%; 237Np - 1.060 +- 1.4%; 239Pu - 1.152 +- 1.1%; 242Pu - 0.967 +- 1.0%. 40 refs., 11 tabs., 9 figs

  12. Phylogenetic-Derived Insights into the Evolution of Sialylation in Eukaryotes: Comprehensive Analysis of Vertebrate β-Galactoside α2,3/6-Sialyltransferases (ST3Gal and ST6Gal) (United States)

    Teppa, Roxana E.; Petit, Daniel; Plechakova, Olga; Cogez, Virginie; Harduin-Lepers, Anne


    Cell surface of eukaryotic cells is covered with a wide variety of sialylated molecules involved in diverse biological processes and taking part in cell–cell interactions. Although the physiological relevance of these sialylated glycoconjugates in vertebrates begins to be deciphered, the origin and evolution of the genetic machinery implicated in their biosynthetic pathway are poorly understood. Among the variety of actors involved in the sialylation machinery, sialyltransferases are key enzymes for the biosynthesis of sialylated molecules. This review focus on β-galactoside α2,3/6-sialyltransferases belonging to the ST3Gal and ST6Gal families. We propose here an outline of the evolutionary history of these two major ST families. Comparative genomics, molecular phylogeny and structural bioinformatics provided insights into the functional innovations in sialic acid metabolism and enabled to explore how ST-gene function evolved in vertebrates. PMID:27517905

  13. Determination of 234U/238U, 235U/238U and 236U/238U Isotope Ratios in Urine Using Sector Field Inductively Coupled Plasma Mass Spectrometry (SF-ICP-MS) (United States)

    Xiao, Ge; Jones, Robert L.; Saunders, David; Caldwell, Kathleen L.


    Quantification of the isotopic composition of uranium in urine at low levels of concentration is important for assessing both military and civilian populations’ exposures to uranium. However, until now there has been no convenient, precise method established for rapid determination of multiple uranium isotope ratios. Here we report a new method to measure 234U/238U, 235U/238U and 236U/238U. It uses solid phase chelation extraction (via TRU columns) of actinides from the urine matrix, followed by measurement using a magnetic sector field inductively coupled plasma mass spectrometer (SF-ICP-MS - Thermo Element XR) equipped with a high efficiency nebulizer (Apex PFA microflow) and coupled with a membrane desolvating introduction system (Aridus II™). This method provides rapid and reliable results, and has been used successfully to analyze Certified Reference Materials (CRM). PMID:24563523

  14. Co-evolution of monsoonal precipitation in East Asia and the tropical Pacific ENSO system since 2.36 Ma: New insights from high-resolution clay mineral records in the West Philippine Sea (United States)

    Yu, Zhaojie; Wan, Shiming; Colin, Christophe; Yan, Hong; Bonneau, Lucile; Liu, Zhifei; Song, Lina; Sun, Hanjie; Xu, Zhaokai; Jiang, Xuejun; Li, Anchun; Li, Tiegang


    Clay mineralogical analysis and scanning electron microscope (SEM) analysis were performed on deep-sea sediments cored on the Benham Rise (core MD06-3050) in order to reconstruct long-term evolution of East Asian Summer Monsoon (EASM) rainfall in the period since 2.36 Ma. Clay mineralogical variations are due to changes in the ratios of smectite, which derive from weathering of volcanic rocks in Luzon Island during intervals of intensive monsoon rainfall, and illite- and chlorite-rich dusts, which are transported from East Asia by winds associated with the East Asian Winter Monsoon (EAWM). Since Luzon is the main source of smectite to the Benham Rise, long-term consistent variations in the smectite/(illite + chlorite) ratio in core MD06-3050 as well as ODP site 1146 in the Northern South China Sea suggest that minor contributions of eolian dust played a role in the variability of this mineralogical ratio and indicate strengthening EASM precipitation in SE Asia during time intervals from 2360 to 1900 kyr, 1200 to 600 kyr, and after 200 kyr. The EASM rainfall record displays a 30 kyr periodicity suggesting the influence of El Niño-Southern Oscillation (ENSO). These intervals of rainfall intensification on Luzon Island are coeval with a reduction in precipitation over central China and an increase in zonal SST gradient in the equatorial Pacific Ocean, implying a reinforcement of La Niña-like conditions. In contrast, periods of reduced rainfall on Luzon Island are associated with higher precipitation in central China and a weakening zonal SST gradient in the equatorial Pacific Ocean, thereby suggesting the development of dominant El Niño-like conditions. Our study, therefore, highlights for the first time a long-term temporal and spatial co-evolution of monsoonal precipitation in East Asia and of the tropical Pacific ENSO system over the past 2.36 Ma.

  15. Capture cross section measurement analysis in the Californium-252 spectrum with the Monte Carlo method

    International Nuclear Information System (INIS)

    Absolute average capture cross sections of gold, thorium, tantalum, molybdenum, copper and strontium in 252Cf spontaneous fission neutron spectrum were simulated for two types of experiment setups preformed by Z. Dezso and J. Csikai and by L. Green. The experiments were simulated with MCNP5 using cross section data from the ENDF/B-VII.0 library. The determination of neutron backscattering was calculated with the use of neutron flagging. Correction factors to experimentally measured values were determined to obtain average cross sections in a pure 252Cf spontaneous fission spectrum. Influence of concrete wall thickness, air moisture and room size on the average cross section was analyzed. Correction factors amounted to about 30%. Corrected values corresponding to average cross sections in a pure 252Cf spectrum were calculated for 197Au, 232Th, 181Ta, 98Mo, 65Cu and 84Sr. Average cross sections were also calculated with the RR-UNC software using IRDFF-v.1.05 and ENDF/B-VII.0 libraries. The revised average radiative capture cross sections are 75.5±0.1 mb for 197Au, 87.0±1.6 mb for 232Th , 98.0±4.5 mb for 181Ta, 21.2±0.5 mb for 98Mo, 10.3±0.3 mb for 63Cu, and 34.9±6.5 mb for 84Sr. - Highlights: • Average capture cross sections in 252Cf spontaneous fission spectrum were simulated. • Calculations were done using MCNP5 code and ENDF/B-VII.0 library. • Correction factors for self-shielding and room return effects were taken into account. • The revised average radiative capture cross sections for different materials are published

  16. Multi-element neutron activation analysis of sediment using a californium-252 source

    International Nuclear Information System (INIS)

    The application of a 252Cf source to the neutron activation analysis of several elements in small (approximately 1.5 in. in dia) cores was studied using high-resolution gamma ray spectroscopy and manual data reduction. (U.S.)

  17. OER of californium-252 at low dose rate for growth inhibition in Vicia faba

    International Nuclear Information System (INIS)

    OER of 252Cf, at low dose rate, has been determined for growth inhibition in Vicia faba roots. A new strain ''BelB'' was used; it was found to be more resistant to prolonged anoxia. Two sets of linear 252Cf sources were used (linear activity 0.31 and 0.47 (μ in somewhat different geometrical arrangements. The (n+γ) 252Cf dose rates at the level of the root tips were 0.11 and 0.13 Gy.h-1 respectively. The relative contribution of the γ component Dsub(γ) to the total absorbed dose Dsub(n+γ) at the level of the root tips was evaluated Dsub(γ)/Dsub(n+γ)=0.35 for the first source-geometry and 0.42 for the second source-geometry. The reference radiation was the γ emission of 192Ir, used in the same geometrical conditions and for similar irradiation times. Irradiations performed in aerobic and anoxic conditions were alternated. OER values of 1.4 +- 0.1 and 1.5 +- 0.1 were observed for the 252Cf emission with the first and second source-geometry respectively. The corresponding OER values for 192Ir were 2.3 +- 0.2 and 2.6 +- 0.1; the derived oxygen gain factors were then equal to 1.6 and 1.7 repectively

  18. Fission Fragment Folding Angle Distributions for the Systems 11B+237Np, 12C+236U, and 16O+232Th in the Energy Range 1.1B<2.1

    International Nuclear Information System (INIS)

    Fission fragment folding angle distributions have been measured for the systems 11B+237Np, 12C+236U, and 16O+232Th, populating the same compound nucleus (248Cf) and at similar excitation energies (Ex 45-100 MeV). The full momentum transfer and incomplete momentum transfer fusion-fission components have been separated over the bombarding energy range 1.1c.m/VB 2.1. It is observed that the largest value of the ratio of the transfer fission to the total fission is around 10 to 15% at the highest energy investigated. Over the energy range mentioned above, it is found that the transfer fission corrected fission fragment anisotropies are not significantly different from the values already obtained from the analysis of the total fission data reported earlier and hence the conclusions reached from the inclusive data remain unchanged. The anisotropy data were analyzed for the two cases corresponding to fission events with sizable fission barriers (Bf>T) and with smaller fission barriers (Bf>T). It was interesting to find that the effective moment of inertia (Jeff) values deduced from the latter component were consistent with the values from Sierk prescription used in the former case

  19. Angular correlations of fission fragments from the reactions 232Th(p,p'f) and 236U(p,p'f) at a projectile energy of 26.5 MeV

    International Nuclear Information System (INIS)

    Angular correlations of fission fragments from the reactions 232Th(p,p'f) and 236U(p,p'f) have been measured at a projectile energy of Ep=26.5 MeV and excitation energies up to the second chance fission. The scattered protons have been detected by a semiconductor telescope positioned at two different angles (vTel=90 and vTel=60 ). The fission fragments have been measured by a parallel plate avalanche detector, which was position sensitive in two dimensions. The data continuously cover the angular ranges of about -15 up to +95 for vTel=90 and about -5 up to +50 for vTel=60 with respect to the kinematical recoil axis. It succeeded to describe the changes of the angular distribution with increasing excitation energy in terms of the Transition State Model by a uniform increase of the contributions with K≠0 for both compound systems and both excitation reactions. (orig./DG)

  20. 9 CFR 2.36 - Annual report. (United States)


    ... to, during, and following actual research, teaching, testing, surgery, or experimentation were... actual research, testing, teaching, or experimentation, or held for these purposes; (5) State the common... of animals being bred, conditioned, or held for use in teaching, testing, experiments, research,...

  1. 10 CFR 600.236 - Procurement. (United States)


    ..., and as supplemented in Department of Labor regulations (41 CFR chapter 60). (All construction... (29 CFR Part 3). (All contracts and subgrants for construction or repair) (5) Compliance with the Davis-Bacon Act (40 U.S.C. 276a to 276a-7) as supplemented by Department of Labor regulations (29...

  2. 49 CFR 236.903 - Definitions. (United States)


    ... safety aspects of the product, including but not limited to procedures for its development, installation... the new product being less safe than the previous condition is very small. Human factors refers to a... management control plan means a plan designed to ensure that the proper and intended product...

  3. 8 CFR 236.11 - Definitions. (United States)


    .... In this subpart, the term: Eligible immigrant means a qualified immigrant who is the spouse or... Adjustment); or (3) Is a naturalized U.S. citizen who was a permanent resident under section 210 or 245A of the Act or section 202 of the Immigrant Reform and Control Act of 1986 (IRCA)...

  4. 28 CFR 2.36 - Rescission guidelines. (United States)


    ... time spent in custody on a new offense that has not been credited towards service of the original... unlawful possession of a firearm or explosives in a prison facility, other than a community corrections center, as Category Six. Grade unlawful possession of a firearm in a community corrections center...

  5. 49 CFR 236.336 - Locking bed. (United States)


    ..., MAINTENANCE, AND REPAIR OF SIGNAL AND TRAIN CONTROL SYSTEMS, DEVICES, AND APPLIANCES Interlocking Rules and... rail shall be rigidly secured in place and alined to permit free operation of locking....

  6. 49 CFR 236.2 - Grounds. (United States)


    ... OF SIGNAL AND TRAIN CONTROL SYSTEMS, DEVICES, AND APPLIANCES Rules and Instructions: All Systems... circuit, except circuits which include any track rail and except the common return wires of single-wire, single-break, signal control circuits using a grounded common, and alternating current power...

  7. The determination of americium, curium and californium in biological samples by combined solvent extraction-liquid scintillation counting

    International Nuclear Information System (INIS)

    A method has been developed to extract Am, Cm and Cf from ashed biological samples dissolved in 8 M LiN03-10-2 M HN03 into a liquid/scintillation cocktail. This new method reduces tissue and instrument background and allows use of a larger sample for analysis than when using a commercial gelling cocktail. The extractant cocktail is 20% N,N,N-trioctyl-N-methylammonium chloride dissolved in toluene containing the scintillators p-terphenyl and 1,4-bis-2-(5-phenyl-oxazolyl)-benzene. Several different types of biological samples were analyzed and radionuclide recoveries greater than 90% were obtained in all cases. (author)

  8. Oxidation-reduction properties of americium, curium, berkelium, californium, einsteinium and fermium, and thermodynamic consequences for the 5f series

    International Nuclear Information System (INIS)

    The amalgamation of 5f elements from Am to Fm has been studied by using 241Am, 244Cm, 249Bk, 249Cf, 252Cf, 253Es, 254Es, 252Fm and 255Fm with two electrochemical methods, radiocoulometry and radiopolarography, perfectly adapted to investigate extremely diluted solutions when the concentration of electroactive species is as low as 10-16M. The theory of radiocoulometry has been developed in the general cases of reversible and irreversible electrode process. It has been used to interpret the experimental data on the kinetic curves of amalgamation, and to estimate the standard rate constant of the electrode process in complexing medium (citric). On the other hand the radiopolarographic method has been applied to study the mechanism of reduction at the dropping mercury electrode of cations M3+ in aqueous medium to the metal M with formation of amalgam. The results are exploited into two directions: 1- Acquisition of some data concerning the oxidation-reduction properties of elements from Am to Fm. Therefore the standard electrode E0 [M(III-0)] potentials for Bk, Cf and Es, and the standard electrode E0 [M(II-0)] potential for Fm are estimated and the relative stability of each oxidation state (from II to VII) of 5f elements is discussed; 2- Acquisition of unknown thermodynamic data on transcalifornium elements. Correlations between 4f and 5f elements are precised and some divergences appear for the second half of 4f and 5f series (i.e. for 65<=Z<=71 and 97<=Z<=103)

  9. Raman and absorption spectrophotometric studies of selected lanthanide, californium-doped lanthanide, and actinide trihalides in the solid state

    International Nuclear Information System (INIS)

    The solid-state absorption spectra of Cf(III) ions as a dopant in lanthanide trihalide hosts (LnCl3: Ln = Ce, Sm, and Y; LnBr3: Ln = Ce, Sm, Tb, and Y; LnI3: Ln = Ce and Y) have been recorded. The spectra of Cf(III) have been correlated with the various crystal structures. The phonon Raman spectra and solid-state absorption spectra of PmF3, PmCl3, PmBr3, and two crystal modifications of PmI3 have been recorded. Symmetry assignments have been made for the Raman-active bands for these trihalides and also the sesquioxide. The room-temperature absorption spectra have been correlated to crystal field effects. The symmetry assignments of the Raman-active phonon modes have been made based on polarized Raman spectra from single crystals of YF3-type orthorhombic TbF3 and PuBr3-type orthorhombic NdBr3. Raman spectra of other isostructural lanthanide compounds have been recorded and compared. Symmetry assignments for these compounds have been made by analogy to the single-crystal assignments. Raman spectra have been obtained and catalogued for a number of actinide compounds. Symmetry assignments have been made for the observed Raman-active phonon bands in this work based on the assignments made for isostructural lanthanide compounds. 29 figs., 22 tabs

  10. Optical Transitions in Highly Charged Californium Ions with High Sensitivity to Variation of the Fine-Structure Constant (United States)

    Berengut, J. C.; Dzuba, V. A.; Flambaum, V. V.; Ong, A.


    We study electronic transitions in highly charged Cf ions that are within the frequency range of optical lasers and have very high sensitivity to potential variations in the fine-structure constant, α. The transitions are in the optical range despite the large ionization energies because they lie on the level crossing of the 5f and 6p valence orbitals in the thallium isoelectronic sequence. Cf16+ is a particularly rich ion, having several narrow lines with properties that minimize certain systematic effects. Cf16+ has very large nuclear charge and large ionization energy, resulting in the largest α sensitivity seen in atomic systems. The lines include positive and negative shifters.

  11. Optical transitions in highly-charged californium ions with high sensitivity to variation of the fine-structure constant

    CERN Document Server

    Berengut, J C; Flambaum, V V; Ong, A


    We study electronic transitions in highly-charged Cf ions that are within the frequency range of optical lasers and have very high sensitivity to potential variations in the fine-structure constant, alpha. The transitions are in the optical despite the large ionisation energies because they lie on the level-crossing of the 5f and 6p valence orbitals in the thallium isoelectronic sequence. Cf16+ is a particularly rich ion, having several narrow lines with properties that minimize certain systematic effects. Cf16+ has very large nuclear charge and large ionisation energy, resulting in the largest alpha-sensitivity seen in atomic systems. The lines include positive and negative shifters.

  12. Integral range, energy, residual range, and linear energy transfer distributions for Californium fission fragments in microelectronics materials

    International Nuclear Information System (INIS)

    This report discusses the advantages and limitations of using Cf-252 radiation sources for single event testing of microelectronics for space environments. Integral distributions for the range, energy, residual range, and linear energy transfer of Cf-252 fission fragments in absorber and microelectronic materials have been calculated. Techniques are suggested for determining when single event testing using Cf-252 is appropriate; also, techniques are given for estimating the saturation cross section and thresh old linear energy transfer from test data. 10 refs., 25 figs., 2 tabs

  13. Research and experimental work at Groote Schuur Hospital and the University of Cape Town using californium-252 sources

    International Nuclear Information System (INIS)

    Experiments have been undertaken to determine the high-LET and low-LET components of the absorbed dose from neutron beams. This is achieved by measuring the fluxes of the high-LET and low-LET radiations in a tissue-equivalent phantom individually and simultaneously using a scintillation probe fitted with a pulse shape discriminator. This system was successfully used with a 22 MeV neutron beam from the T(d,n) reaction and has been employed with 252Cf sources. Results obtained in the low-energy ranges (up to 3 MeV) indicate that the electron counts exceed the high-LET counts by a factor of 2 to 3. These results are related to the absorbed dose. Calculations have also been undertaken to establish whether the Paterson-Parker system could be used for the design of 252Cf treatments and the optimum needle activities to yield the desired dose. Experiments are under way to determine the variation of RBE and OER for 252Cf radiations around the source. The inhibition of root growth in Vicia Faba is being used to determine any such effects. Dose rates comparable to that employed in interstitial radiotherapy are being aimed at. A study of dose fractionation effects is also being undertaken. (author)

  14. Test and evaluation results of the 252Cf shuffler at the Savannah River Plant

    International Nuclear Information System (INIS)

    The 252Cf Shuffler, a nondestructive assay instrument employing californium neutron source irradiation and delayed-neutron counting, was developed for measuring 235U content of scrap and waste items generated at the Savannah River Plant (SRP) reactor fuel fabrication facility. The scrap and waste items include high-purity uranium-aluminum alloy ingots as well as pieces of castings, saw and lathe chips from machining operations, low-purity items such as oxides of uranium or uranium intermixed with flux materials found in recovery operations, and materials not recoverable at SRP such as floor sweepings or residues from the uranium scrap recovery operation. The uranium contains about 60% 235U with the remaining isotopes being 236U, 238U, and 234U in descending order. The test and evaluation at SRP concluded that the accuracy, safety, reliability, and ease of use made the 252Cf Shuffler a suitable instrument for routine use in an industrial, production-oriented plant

  15. Plutonium reclamation facility (PRF, building 236-Z) layup plan

    International Nuclear Information System (INIS)

    This document reviews each system inside PRF to determine the operation and maintenance requirements necessary to maintain safe and predictable system performance for facility systems needed to remain operational while minimizing the maintenance and surveillance being performed. Also covered are the actions required to place PRF in a safe layup configuration while minimizing hazards and taking into account the need for reactivation of certain equipment when cleanup work commences in the future

  16. 48 CFR 852.236-88 - Contract changes-supplement. (United States)


    ... of tier. When certified cost or pricing data are required under FAR Subpart 15.403, the cost or... of tier. When certified cost or pricing data or information other than cost or pricing data are... subcontractors will be based on the net increased cost to the prime contractor or upper-tier subcontractor,...

  17. 49 CFR 236.1039 - Operations and Maintenance Manual. (United States)


    ... software versions, revisions, and revision dates. Plans must be legible and correct. (c) Hardware, software... specified in the PTCDP and PTCSP. (d) Safety-critical components, including spare equipment, must...

  18. Permitting plan for project W-236B, initial pretreatment module

    International Nuclear Information System (INIS)

    The Tank Waste Remediation System pretreatment process mission is to separate high-level and low-level waste fractions. A comprehensive review of environmental regulations has indicated that several environmental reviews, permits, and approvals are required before construction and operation of the facility. This revised document provides a summary of permit application data requirements, alternative strategies for permit completion and approval, as well as the probability of success for each alternative for the Initial Pretreatment Module resulting from recent revisions to the Tri-Party Agreement

  19. 49 CFR 236.110 - Results of tests. (United States)


    ... tests that pertain to installation or modification must be retained for the life-cycle of the equipment... tracking systems used to meet the requirements contained in paragraph (a) of this section must be capable... automated tracking system in lieu of preprinted forms if FRA finds that the electronic or automated...

  20. Crossflow Filtration: EM-31, WP-2.3.6

    International Nuclear Information System (INIS)

    In the interest of accelerating waste treatment processing, the DOE has funded studies to better understand filtration with the goal of improving filter fluxes in existing crossflow equipment. The Savannah River National Laboratory (SRNL) performed some of those studies, with a focus on start-up techniques, filter cake development, the application of filter aids (cake forming solid precoats), and body feeds (flux enhancing polymers). This paper discusses the progress of those filter studies. Crossflow filtration is a key process step in many operating and planned waste treatment facilities to separate undissolved solids from supernate solutions. This separation technology generally has the advantage of self-cleaning through the action of wall shear stress created by the flow of waste slurry through the filter tubes. However, the ability of filter wall self-cleaning depends on the slurry being filtered. Many of the alkaline radioactive wastes are extremely challenging to filtration, e.g., those containing compounds of aluminum and iron, which have particles whose size and morphology reduce permeability. Unfortunately, low filter flux can be a bottleneck in waste processing facilities such as the Savannah River Integrated Salt Disposition Process and the Hanford Waste Treatment Plant. Any improvement to the filtration rate would lead directly to increased throughput of the entire process. To date increased rates are generally realized by either increasing the crossflow filter feed flow rate, limited by pump capacity, or by increasing filter surface area, limited by space and increasing the required pump load. SRNL set up both dead-end and crossflow filter tests to better understand filter performance based on filter media structure, flow conditions, filter cleaning, and several different types of filter aids and body feeds. Using non-radioactive simulated wastes, both chemically and physically similar to the actual radioactive wastes, the authors performed several tests to evaluate methods to improve filter performance. With the proper use of filter flow conditions and filter enhancers, filter flow rates can be increased over rates currently realized today. Experiments that use non-radioactive simulants for actual waste always carry the inherent risk of not eliciting prototypic results; however, they will assist in focusing the scope needed to minimize radioactive testing and thus maximize safety. To that end this investigation has determined: (1) Waste simulant SB6 was found to be more challenging to filtration than a SRS Tank 8F simulant; (2) Higher solids concentration presents a greater challenge to filtration; (3) Filter cake is something that should be properly developed in initial filter operation; (4) Backpulsing is not necessary to maintain a good filter flux with salt wastes; (5) Scouring a filter without cleaning will lead to improved filter performance; (6) The presence of a filter cake can improve the solids separation by an order of magnitude as determined by turbidity; (7) A well developed cake with periodic scouring may allow a good filter flux to be maintained for long periods of time; and (8) Filtrate flux decline is reversible when the concentration of the filtering slurry drops and the filter is scoured.

  1. 49 CFR 236.909 - Minimum performance standard. (United States)


    ... physical or operating conditions on the railroad prior to or within the expected life cycle of the product... as the total residual risk in the system over its expected life-cycle after implementation of all... Administrator for Safety to be equally suitable. (2) For the previous condition and for the life-cycle of...

  2. 49 CFR 236.1023 - Errors and malfunctions. (United States)


    ... appropriate risk analysis, the railroad shall: (1) Notify the applicable vendor or supplier and FRA of the..., or components. (2) A vendor or supplier, on receipt of a report of any safety-critical failure to... component. (3) The notification from a supplier to any railroad shall include explanation from the...

  3. 24 CFR 236.254 - Termination of mortgage insurance. (United States)



  4. 49 CFR 236.339 - Mechanical locking, maintenance requirements. (United States)


    ... connections shall be maintained so that, when a lever or latch is mechanically locked the following will be prevented: (a) Mechanical machine—(1) Latch-operated locking. Raising lever latch block so that bottom thereof is within three-eighths inch of top of quadrant. (2) Lever-operated locking. Moving lever...

  5. 49 CFR 236.923 - Task analysis and basic requirements. (United States)


    ... training curriculum that includes classroom, simulator, computer-based, hands-on, or other formally... classroom, simulator, computer-based, hands-on, or other formally structured training and testing, except with respect to basic skills for which proficiency is known to remain high as a result of...

  6. Dicty_cDB: CFI236 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available lainnkk Translated Amino Acid sequence (All Frames) Frame A: ncwwwisr*cisiiirtkris...4509 |AL844509.1 Plasmodium falciparum chromosome 13. 44 2e-04 22 AJ011856 |AJ011856.1 Saccharomyces cerevisiae complete mitochondri...nhsthpplinhlim iisiifiknikriekqilmlllkwqlktflkcvimlvmlysfsrkrlniy*klnslhvil vvmn*flsqlnhtlmlkklv*q...nssyrkktkte*ky*skin*fsiirswcknidkdric** yikdcntner*ndsfir*csnissiqfrfk*tfi*citsiik**it*tyreigkc...*ihil *cl*iy*feamynsnsrfqsnnrsihnhrlrwcllcrqriygeigqtrllpilfkawl*g tlhtkrpksnisnrqkltshl--- ---vshapfsshstvh*vshp*tqekrltnslkiis

  7. 24 CFR 91.236 - Special case; District of Columbia. (United States)


    ... and Urban Development CONSOLIDATED SUBMISSIONS FOR COMMUNITY PLANNING AND DEVELOPMENT PROGRAMS Local... planning purposes, the District of Columbia must follow the requirements applicable to local jurisdictions... requirements dealing with the use of Low Income Housing Tax Credits (§ 91.315(j)). (Approved by the Office...

  8. 7 CFR 2.36 - Director, Office of Communications. (United States)


    ... execution of the Department's programs. (vii) Plan and direct communication research and training for the... authority to determine policy for all USDA communication activities and agency information activities...

  9. Dicty_cDB: SHH236 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available W376326.1 fsbb001f054c14f0 Sorghum methylation filtered library (LibID: 104) Sorghum bicolor genomic clone f...sbb001f054c14, genomic survey sequence. 52 0.023 1 CW143479 |CW143479.1 104_535_11137435_148_34958_076 Sorghum methylation filter

  10. Dicty_cDB: VSJ236 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available lete sequence. 40 1.1 3 CC159955 |CC159955.1 ig05h07.g1 WGS-ZmaysF (DH5a methyl filtered) Zea mays genomic c...lone ig05h07, DNA sequence. 34 2.3 2 CC159954 |CC159954.1 ig05h07.b1 WGS-ZmaysF (DH5a methyl filter

  11. 49 CFR 236.913 - Filing and approval of PSPs. (United States)


    ... what circumstances must a PSP be prepared? A PSP must be prepared for each product covered by this subpart. A joint PSP must be prepared when: (1) The territory on which a product covered by this subpart... PSP involves a change in method of operation. (b) Under what circumstances must a railroad submit...

  12. 49 CFR 236.1031 - Previously approved PTC systems. (United States)


    ... railroad, and consistent with available safety data, be credited toward satisfaction of the safety case... implemented for control of train operations under an FRA order or waiver, after review of safety case documentation for the implementation. (g) Upon receipt of an REC, FRA will consider all safety case...

  13. 40 CFR 180.236 - Triphenyltin hydroxide; tolerances for residues. (United States)


    ... Horse, kidney 2.0 Horse, liver 4.0 Horse, meat 0.5 Milk 0.06 Pecan 0.05 Potato 0.05 Sheep, fat 0.2 Sheep, kidney 2.0 Sheep, liver 4.0 Sheep, meat 0.5 (b) Section 18 emergency exemptions. (c) Tolerances with....0 Cattle, fat 0.2 Cattle, kidney 2.0 Cattle, liver 4.0 Cattle, meat 0.5 Goat, fat 0.2 Goat, kidney...


    Energy Technology Data Exchange (ETDEWEB)

    Duignan, M.; Nash, C.; Poirier, M.


    In the interest of accelerating waste treatment processing, the DOE has funded studies to better understand filtration with the goal of improving filter fluxes in existing crossflow equipment. The Savannah River National Laboratory (SRNL) performed some of those studies, with a focus on start-up techniques, filter cake development, the application of filter aids (cake forming solid precoats), and body feeds (flux enhancing polymers). This paper discusses the progress of those filter studies. Crossflow filtration is a key process step in many operating and planned waste treatment facilities to separate undissolved solids from supernate solutions. This separation technology generally has the advantage of self-cleaning through the action of wall shear stress created by the flow of waste slurry through the filter tubes. However, the ability of filter wall self-cleaning depends on the slurry being filtered. Many of the alkaline radioactive wastes are extremely challenging to filtration, e.g., those containing compounds of aluminum and iron, which have particles whose size and morphology reduce permeability. Unfortunately, low filter flux can be a bottleneck in waste processing facilities such as the Savannah River Integrated Salt Disposition Process and the Hanford Waste Treatment Plant. Any improvement to the filtration rate would lead directly to increased throughput of the entire process. To date increased rates are generally realized by either increasing the crossflow filter feed flow rate, limited by pump capacity, or by increasing filter surface area, limited by space and increasing the required pump load. SRNL set up both dead-end and crossflow filter tests to better understand filter performance based on filter media structure, flow conditions, filter cleaning, and several different types of filter aids and body feeds. Using non-radioactive simulated wastes, both chemically and physically similar to the actual radioactive wastes, the authors performed several tests to evaluate methods to improve filter performance. With the proper use of filter flow conditions and filter enhancers, filter flow rates can be increased over rates currently realized today. Experiments that use non-radioactive simulants for actual waste always carry the inherent risk of not eliciting prototypic results; however, they will assist in focusing the scope needed to minimize radioactive testing and thus maximize safety. To that end this investigation has determined: (1) Waste simulant SB6 was found to be more challenging to filtration than a SRS Tank 8F simulant; (2) Higher solids concentration presents a greater challenge to filtration; (3) Filter cake is something that should be properly developed in initial filter operation; (4) Backpulsing is not necessary to maintain a good filter flux with salt wastes; (5) Scouring a filter without cleaning will lead to improved filter performance; (6) The presence of a filter cake can improve the solids separation by an order of magnitude as determined by turbidity; (7) A well developed cake with periodic scouring may allow a good filter flux to be maintained for long periods of time; and (8) Filtrate flux decline is reversible when the concentration of the filtering slurry drops and the filter is scoured.

  15. 49 CFR 236.51 - Track circuit requirements. (United States)


    ..., MAINTENANCE, AND REPAIR OF SIGNAL AND TRAIN CONTROL SYSTEMS, DEVICES, AND APPLIANCES Rules and Instructions..., or cab signal system shall be deenergized in the rear of the point where any of the following conditions exist: (a) When a rail is broken or a rail or switch-frog is removed except when a rail is...

  16. 49 CFR 236.1011 - PTC Implementation Plan content requirements. (United States)


    ... INSTALLATION, INSPECTION, MAINTENANCE, AND REPAIR OF SIGNAL AND TRAIN CONTROL SYSTEMS, DEVICES, AND APPLIANCES... (including presence or absence of a block signal system), number of tracks, and maximum allowable train... additional rail lines on its own network, and rail lines of entities that it controls or engages in...

  17. 42 CFR 456.236 - Continued stay review process. (United States)


    ... (CONTINUED) MEDICAL ASSISTANCE PROGRAMS UTILIZATION CONTROL Utilization Control: Mental Hospitals Ur Plan... each continued stay of a recipient in the mental hospital, the committee, subgroup or designee reviews... committee, subgroup or designee finds that a recipient's continued stay in the mental hospital is...

  18. Accurate determination of Curium and Californium isotopic ratios by inductively coupled plasma quadrupole mass spectrometry (ICP-QMS) in 248Cm samples for transmutation studies

    International Nuclear Information System (INIS)

    The French Atomic Energy Commission has carried out several experiments including the mini-INCA (INcineration of Actinides) project for the study of minor-actinide transmutation processes in high intensity thermal neutron fluxes, in view of proposing solutions to reduce the radiotoxicity of long-lived nuclear wastes. In this context, a Cm sample enriched in 248Cm (∼97 %) was irradiated in thermal neutron flux at the High Flux Reactor (HFR) of the Laue-Langevin Institute (ILL). This work describes a quadrupole ICP-MS (ICP-QMS) analytical procedure for precise and accurate isotopic composition determination of Cm before sample irradiation and of Cm and Cf after sample irradiation. The factors that affect the accuracy and reproducibility of isotopic ratio measurements by ICP-QMS, such as peak centre correction, detector dead time, mass bias, abundance sensitivity and hydrides formation, instrumental background, and memory blank were carefully evaluated and corrected. Uncertainties of the isotopic ratios, taking into account internal precision of isotope ratio measurements, peak tailing, and hydrides formations ranged from 0.3% to 1.3%. This uncertainties range is quite acceptable for the nuclear data to be used in transmutation studies.

  19. Radiological Characterization Technical Report on Californium-252 Sealed Source Transuranic Debris Waste for the Off-Site Source Recovery Project at Los Alamos National Laboratory

    Energy Technology Data Exchange (ETDEWEB)

    Feldman, Alexander [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)


    This document describes the development and approach for the radiological characterization of Cf-252 sealed sources for shipment to the Waste Isolation Pilot Plant. The report combines information on the nuclear material content of each individual source (mass or activity and date of manufacture) with information and data on the radionuclide distributions within the originating nuclear material. This approach allows for complete and accurate characterization of the waste container without the need to take additional measurements. The radionuclide uncertainties, developed from acceptable knowledge (AK) information regarding the source material, are applied to the summed activities in the drum. The AK information used in the characterization of Cf-252 sealed sources has been qualified by the peer review process, which has been reviewed and accepted by the Environmental Protection Agency.

  20. The development and medical applications of a simple facility for partial body in vivo neutron activation analysis using californium-252 sources

    International Nuclear Information System (INIS)

    A simple and cheap facility for partial body neutron activation analysis has been designed, based on the use of two 100 μg 252Cf neutron sources. The results reported show that calcium can be measured in parts of the body such as the tibia with a precision as good as +- 1.6 % for a radiation dose of 2 rem. The uniformity of the thermal neutron flux density is better than +- 3 % over 10 cm. Some applications of this irradiation facility for studies of trace elements, in particular cadmium in liver and aluminium in liver or brain, have also been explored. However, the sensitivity attainable is not yet sufficient for the study of normal levels, but could be of interest in toxicological investigations

  1. Accurate determination of Curium and Californium isotopic ratios by inductively coupled plasma quadrupole mass spectrometry (ICP-QMS) in Cm-248 samples for transmutation studies

    International Nuclear Information System (INIS)

    The French Atomic Energy Commission has carried out several experiments including the mini-INCA (Incineration of Actinides) project for the study of minor-actinide transmutation processes in high intensity thermal neutron fluxes, in view of proposing solutions to reduce the radiotoxicity of long-lived nuclear wastes. In this context, a Cm sample enriched in 248Cm (similar to 97%) was irradiated in thermal neutron flux at the High Flux Reactor (HFR) of the Laue-Langevin Institute (ILL). This work describes a quadrupole ICP-MS (ICP-QMS) analytical procedure for precise and accurate isotopic composition determination of Cm before sample irradiation and of Cm and Cf after sample irradiation. The factors that affect the accuracy and reproducibility of isotopic ratio measurements by ICP-QMS, such as peak centre correction, detector dead time, mass bias, abundance sensitivity and hydrides formation, instrumental background, and memory blank were carefully evaluated and corrected. Uncertainties of the isotopic ratios, taking into account internal precision of isotope ratio measurements, peak tailing, and hydrides' formations ranged from 0. 3% to 1. 3%. This uncertainties' range is quite acceptable for the nuclear data to be used in transmutation studies. (authors)

  2. Pu236(n,f) , Pu237(n,f) , and Pu238(n,f) cross sections deduced from (p,t) , (p,d) , and (p,p') surrogate reactions

    Energy Technology Data Exchange (ETDEWEB)

    Hughes, R. O. [Univ. of Richmond, VA (United States); Beausang, C. W. [Univ. of Richmond, VA (United States); Ross, T. J. [Univ. of Richmond, VA (United States); Burke, J. T. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Casperson, R. J. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Cooper, N. [Yale Univ., New Haven, CT (United States); Escher, J. E. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Gell, K. [Univ. of Richmond, VA (United States); Good, E. [Univ. of Richmond, VA (United States); Humby, P. [Yale Univ., New Haven, CT (United States); McCleskey, M. [Texas A & M Univ., College Station, TX (United States); Saastimoinen, A. [Texas A & M Univ., College Station, TX (United States); Tarlow, T. D. [Univ. of Richmond, VA (United States); Thompson, I. J. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)


    The Pu236(n,f), Pu237(n,f) and Pu238(n,f) cross sections have been inferred by utilizing the surrogate ratio method. Targets of Pu239 and U235 were bombarded with 28.5-MeV protons, and the light ion recoils, as well as fission fragments, were detected using the STARS detector array at the K150 Cyclotron at the Texas A&M cyclotron facility. The (p, tf) reaction on Pu239 and U235 targets was used to deduce the σ (Pu236(n,f))/σ(U232(n,f)) ratio, and the Pu236(n,f) cross section was subsequently determined for En=0.5–7.5 MeV. Similarly, the (p,df) reaction on the same two targets was used to deduce the σ(Pu237(n,f))/σ(U233(n,f)) ratio, and the Pu237(n,f) cross section was extracted in the energy range En=0.5–7 MeV. The Pu238(n,f) cross section was also deduced by utilizing the (p,p') reaction channel on the same targets. There is good agreement with the recent ENDF/B-VII.1 evaluated cross section data for Pu238(n,f) in the range En=0.5–10.5 MeV and for Pu237(n,f) in the range En=0.5–7 MeV; however, the Pu236(n,f) cross section deduced in the present work is higher than the evaluation between 2 and 7 MeV.

  3. Experimental model of ultrasound thermotherapy in rats inoculated with Walker-236 tumor Modelo experimental de termoterapia ultrassônica em ratos inoculados com tumor de Walker-236

    Directory of Open Access Journals (Sweden)

    José Antonio Carlos Otaviano David Morano


    Full Text Available PURPOSE: To develop a model to evaluate the effects of focal pulsed ultrasound (US waves as a source of heat for treatment of murine subcutaneous implanted Walker tumor. METHODS: An experimental, controlled, comparative study was conducted. Twenty male Wistar rats (160-300 g randomized in 2 equal groups (G-1: Control and G-2: Hyperthermia were inoculated with Walker-256 carcinosarcoma tumor. After 5 days G-2 rats were submitted to 45ºC hyperthermia. Heat was delivered directly to the tumor by an ultrasound (US equipment (3 MHz frequency, 1,5W/cm³. Tumor temperature reached 45º C in 3 minutes and was maintained at this level for 5 minutes. Tumor volume was measured on days 5, 8, 11, 14 e 17 post inoculation in both groups. Unpaired t-test was used for comparison. POBJETIVO: Desenvolver um modelo para avaliar os efeitos do ultra-som focal pulsado como fonte de calor para o tratamento de tumores de Walker subcutâneos implantados em ratos. MÉTODOS: Um estudo experimental, controlado, comparativo foi realizado. Vinte ratos Wistar machos (160-300 g divididos em dois grupos (G-1: Controle e G-2: hipertermia foram inoculados com tumor de Walker carcinossarcoma-256. Após cinco dias os ratos do grupo G-2 ratos foram submetidos a hipertermia (45ºC. O calor foi aplicado diretamente no tumor por um equipamento de ultrassonografia (3 MHz, 1,5 W/cm³. A temperatura no tumor atingiu 45ºC em 3 minutos e foi mantida nesse nível por 5 minutos. O volume do tumor foi medido nos dias 5, 8, 11, 14 e 17 após a inoculação, em ambos os grupos. Teste t não pareado foi utilizado para comparação. P <0,05 foi considerado significante. RESULTADOS: O volume do tumor foi significativamente maior no 5º dia e diminuiu nos dias 11, 14 e 17 nos ratos tratados. Animais submetidos à hipertermia sobreviveram mais tempo que os animais do grupo controle. No 29º dia após a inoculação do tumor, 40% dos ratos do grupo controle e 77,78% dos ratos tratados com hipertermia permaneceram vivos. CONCLUSÃO: Os resultados obtidos mostram que o modelo proposto é bastante simples e pode ser utilizado em laboratórios menos sofisticados para estudar os efeitos da hipertermia focal no tratamento dos tumores malignos implantados ou em estudos de sobrevida.

  4. Järve Keskus : Tallinn, Pärnu mnt. 236 = Järve Centre : 236 Pärnu Rd., Tallinn / Jaak Huimerind

    Index Scriptorium Estoniae

    Huimerind, Jaak, 1957-


    Projekteerija: Arhitektuuribüroo Studio Paralleel. Arhitektid Jaak Huimerind, Indrek Saarepera. Kaastöötajad Kristi Põldme, Indrek Laos, Reet Viigipuu. Avalike ruumide sisekujundus: Mari Kurismaa. Konstruktiivne osa: E-Inseneribüroo. Projekt 2000-2002, valmis 2002. Asendi-, I ja II korruse plaan, 6 vaadet

  5. Radiochemical method for the simultaneous determination of 233U, 236U, 237Np, 236Pu, 238Pu, and 239Pu in biological materials

    International Nuclear Information System (INIS)

    A radiochemical method has been developed for the determination of multiple isotopes of uranium, neptunium, and plutonium in biological materials. The elements are separated from the other sample constituents and from each other by anion exchange in halide media. Their recoveries are monitored by isotopic diluents. The amounts of the analyte and diluent isotopes of each element are measured alpha spectrometrically. The interelemental separation factors are generally greater than 102, and the recovery of each element ranges from 60% to 90%. 4 references, 1 table

  6. 48 CFR 552.236-83 - Requirement for a Project Labor Agreement. (United States)


    ... contract or provide for any pricing adjustment by the Government. (d) The Government shall not participate... from competing for contracts or subcontracts on this project without discrimination based on union or... cooperation to advance the Government's procurement interest in cost, efficiency, and quality. (b)...

  7. Can Higher Education Foster Economic Growth? A Conference Summary. Chicago Fed Letter. Number 236a (United States)

    Mattoon, Richard H.


    On October 30, 2006, the Federal Reserve Bank of Chicago and the Midwest Higher Education Compact held a conference on higher education and economic growth. Speakers included Michael Moskow, Richard Lester, Michael Luger, Sean Safford, Larry Isaak, Stefanie Lenway, Rod Shrader, Brian Fabes, Arthur Rothkopf, Randy Eberts, Gary Fethke, Victor…

  8. Multi-Function Waste Tank Facility Quality Assurance Program Plan, Project W-236A. Revision 2

    Energy Technology Data Exchange (ETDEWEB)

    Hall, L.R.


    This document describes the Quality Assurance (QA) program for the Multi-Function Waste Tank Facility (MWTF) Project. The purpose of this QA program is to control project activities in such a manner as to achieve the mission of the MWTF Project in a safe and reliable manner. The QA program for the MWTF Project is founded on DOE Order 5700.6C, Quality Assurance, and implemented through the use of ASME NQA-1, Quality Assurance Program Requirements for Nuclear Facilities (ASME 1989 with addenda la-1989, lb-1991 and lc-1992). This document describes the program and planned actions which the Westinghouse Hanford Company (WHC) will implement to demonstrate and ensure that the project meets the requirements of DOE Order 5700.6C through the interpretive guidance of ASME NQA-1.

  9. 49 CFR 236.504 - Operation interconnected with automatic block-signal system. (United States)


    ... 49 Transportation 4 2010-10-01 2010-10-01 false Operation interconnected with automatic block... Operation interconnected with automatic block-signal system. (a) A continuous inductive automatic train stop... be so interconnected with the signal system as to perform its intended function in event of...

  10. Multi-Function Waste Tank Facility Quality Assurance Program Plan, Project W-236A. Revision 2

    International Nuclear Information System (INIS)

    This document describes the Quality Assurance (QA) program for the Multi-Function Waste Tank Facility (MWTF) Project. The purpose of this QA program is to control project activities in such a manner as to achieve the mission of the MWTF Project in a safe and reliable manner. The QA program for the MWTF Project is founded on DOE Order 5700.6C, Quality Assurance, and implemented through the use of ASME NQA-1, Quality Assurance Program Requirements for Nuclear Facilities (ASME 1989 with addenda la-1989, lb-1991 and lc-1992). This document describes the program and planned actions which the Westinghouse Hanford Company (WHC) will implement to demonstrate and ensure that the project meets the requirements of DOE Order 5700.6C through the interpretive guidance of ASME NQA-1

  11. 49 CFR Appendix D to Part 236 - Independent Review of Verification and Validation (United States)


    ... and risk estimates for the product, and the supplier's confidence interval in these estimates; (2... supplier may request advice and assistance of the reviewer concerning the actions identified in paragraphs... reviewer's independence and maintain the supplier's proprietary right to the product. (c) The...

  12. Water vapour total columns from SCIAMACHY spectra in the 2.36 μm window


    Schrijver, H.; Gloudemans, A. M. S.; Frankenberg, C.; Aben, I.


    The potential of the shortwave infrared channel of the atmospheric spectrometer SCIAMACHY on Envisat to provide accurate measurements of total atmospheric water vapour columns is explored. It is shown that good quality results can be obtained for cloud free scenes above the continents using the Iterative Maximum Likelihood Method. In addition to the standard cloud filter employed in this method, further cloud screening is obtained by comparing simultaneously retrieved methane columns with val...

  13. 48 CFR 3052.236-70 - Special precautions for work at operating airports. (United States)


    ... supported as required. All other construction markings on roads and adjacent parking lots may be either... Contracting Officer. (c) All equipment and material in the construction areas or when moved outside the... work at operating airports. As prescribed in (HSAR) 48 CFR 3036.570, insert the following...

  14. 49 CFR 236.1006 - Equipping locomotives operating in PTC territory. (United States)


    ... segment equipped with a PTC system shall be controlled by a locomotive equipped with an onboard PTC... III railroad, including a tourist or excursion railroad, and controlled by a locomotive not equipped... controlling locomotive being equipped with an onboard PTC system after December 31, 2020, and each...

  15. 49 CFR 236.1015 - PTC Safety Plan content requirements and PTC System Certification. (United States)


    ... the safety case and analysis. (f) When determining whether the PTCSP fulfills the requirements under... proposed changes. In any case where the PTCSP lacks adequate data regarding safety impacts of the proposed... FRA's satisfaction; and (ii) Have a PTCSP establishing, with a high degree of confidence, that...

  16. 49 CFR Appendix E to Part 236 - Human-Machine Interface (HMI) Design (United States)


    ... rules and regulations are codified in Title 47 of the Code of Federal Regulations (CFR). (1) Electronics... governing PCS transmitters may be found in 47 CFR, Parts 0 to 19. (iv) OET Bulletin 62 (December 1993... Regulations (47 CFR 1.1307(b), 1.1310, 2.1091, 2.1093). The following documentation is applicable...

  17. 24 CFR 236.252 - First, second, and third mortgage insurance premiums. (United States)



  18. 49 CFR 236.203 - Hand operated crossover between main tracks; protection. (United States)


    ...) Facing point locks on both switches of the crossover, with both locks operated by a single lever, or (c... matter on the rail prevents effective shunting; (2) Where facing point locks with a single lever...

  19. Yeast Interacting Proteins Database: YMR236W, YGL112C [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available as prey Rows with this prey as prey (2) Rows with this prey as bait Rows with this prey as bait (1) Literature on bait (YPD) 40 Lite...rature on prey (YPD) 42 Literature shared by bait and prey 36 Literature sharing sc

  20. Yeast Interacting Proteins Database: YGL112C, YMR236W [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available as prey Rows with this prey as prey (1) Rows with this prey as bait Rows with this prey as bait (2) Literature on bait (YPD) 42 Lite...rature on prey (YPD) 40 Literature shared by bait and prey 36 Literature sharing sc

  1. 49 CFR Appendix C to Part 236 - Safety Assurance Criteria and Processes (United States)


    ... software or in any monitored input or output hardware. If the diverse operations do not agree or if the... failure to perform a logical operation, or absence of a logical input, output or decision shall not cause... hardware be tested with Self-Checking routines. Permissive outputs are allowed only if the results of...

  2. SU-E-T-236: Monte Carlo Calculations for Radiosurgery of the Clivus

    International Nuclear Information System (INIS)

    Purpose: We sought to determine if dosimetric differences exist between Ray-Trace (RT) and Monte-Carlo (MC) calculation algorithms for radiosurgery for tumors of the clivus, given their proximity to air-tissue inhomogeneity. Methods: We retrospectively identified 10 patients with a tumor of the clivus where the target was located near an air-tissue interface. CyberKnife treatment was delivered in 1 to 5 fractions. Plans originally calculated with the RT algorithm were re-calculated with the same monitor units (MU) with the MC algorithm. Similarly, plans originally calculated with MC were recalculated with RT. MC calculations were performed using High Resolution with 2% uncertainty on the MultiPlan 4.6 planning system. If the RT plans were originally calculated using water-air density model, they were re-calculated with Body standard density model, and then compared with MC plans computed with Body standard density model. The maximum dose (Dmax) to the planning target volumes (PTV) and critical structures, minimum dose (Dmin) and coverage percentage for the PTV were calculated. Results: For 8 cases, MC PTV Dmin was a median 5% (range 0–10%) and Dmax a median 6% (range 3–9%) higher than for RT. For 2 cases, MC PTV Dmin was 6 and 2% and Dmax was 1 and 3% lower than for RT. MC PTV Dmin and Dmax maybe higher or lower than for RT even though the target coverage for MC was less than for RT (median 4%, range 0–13%) with the same MU used. The degree of differences depends on the location of the target relative to the air-tissue inhomogeneity. Examples are shown that the targets are underdosed near the air-tissue inhomogenity. Conclusion: Monte Carlo dose calculations are recommended for targets near tissue homogeneity such as the clivus. Assuming that Monte Carlo more closely approximates the true dosimetry, the use of Ray Trace could overestimate target coverage

  3. 48 CFR 852.236-83 - Payments under fixed-price construction contracts (including NAS). (United States)


    ... waste and trash) 5 Sewage treatment plant equipment 5 Water treatment plant equipment 5 Washers (dish, cage, glass, etc.) 5 Sterilizing equipment 5 Water distilling equipment 5 Prefab temperature rooms... boiler plant system (Specified under 700 Sections) 5 General supply conveyors 10 Food service...

  4. 50 CFR 23.6 - What are the roles of the Management and Scientific Authorities? (United States)


    ... and Scientific Authorities? Under Article IX of the Treaty, each Party must designate a Management and... designated the Scientific Authority and Management Authority, which for purposes of this section includes FWS... primarily with management and regulatory issues and the Scientific Authority is responsible for...

  5. Supplemental design requirements document, Multifunction Waste Tank Facility, Project W-236A. Revision 1

    International Nuclear Information System (INIS)

    The Multi-Function Waste Tank Facility (MWTF) consists of four, nominal 1 million gallon, underground double-shell tanks, located in the 200-East area, and two tanks of the same capacity in the 200-West area. MWTF will provide environmentally safe storage capacity for wastes generated during remediation/retrieval activities of existing waste storage tanks. This document delineates in detail the information to be used for effective implementation of the Functional Design Criteria requirements

  6. Preliminary design requirements document (DRD) for Project W-236B, ''Initial Pretreatment Module''

    International Nuclear Information System (INIS)

    The scope of this Design Requirements Document (DRD) is to identify and define the functions, with associated requirements, which must be performed to separate Hanford Site tank waste supernatants into low-level and high-level fractions. This documents sets forth function requirements, performance requirements, and design constraints necessary to begin conceptual design for the Initial Pretreatment Module (IPM). System and physical interfaces between the IPM project and the Tank Waste Remediation System (TWRS) are identified. The constraints, performance requirements, and transfer of information and data across a technical interface will be documented in an Interface Control Document. Supplemental DRDs will be prepared to provide more detailed requirements specific to systems described in the DRD

  7. 48 CFR 852.236-82 - Payments under fixed-price construction contracts (without NAS). (United States)


    ... Percent Pneumatic Tube System 10 Incinerators (medical waste and trash) 5 Sewage treatment plant equipment...) 5 General supply conveyors 10 Food service conveyors 10 Pneumatic soiled linen and trash system 10... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Payments under...

  8. 49 CFR 236.1007 - Additional requirements for high-speed service. (United States)


    ... THE INSTALLATION, INSPECTION, MAINTENANCE, AND REPAIR OF SIGNAL AND TRAIN CONTROL SYSTEMS, DEVICES... block signal system meeting the requirements of this part, including appropriate fouling circuits and broken rail detection (or equivalent safeguards). (b) In addition to the requirements of paragraph (a)...

  9. 19 CFR 10.236 - Maintenance of records and submission of Certificate by importer. (United States)


    ... include the original Certificate of Origin referred to in § 10.235(a) and any other relevant documents or... port director, a copy of the Certificate of Origin pertaining to the article. A Certificate of Origin... knowledge of the relevant facts; (3) Must be completed either in the English language or in the language...

  10. Ethyl 2-{3-[(6-chloropyridin-3-ylmethyl]-2-(nitroiminoimidazolidin-1-yl}acetate

    Directory of Open Access Journals (Sweden)

    Kamini Kapoor


    Full Text Available In the title compound, C13H16ClN5O4, the imidazole ring is in a slight envelope conformation. The dihedral angle between the pyridine ring and the four essentially planar atoms [maximum deviation 0.015 (2 Å] of the imidazole ring is 80.8 (1°. In, the crystal, weak C—H...O and C—H...N hydrogen bonds are present. In addition, there are weak π–π stacking interactions between symmetry-related pyridine rings with a centroid–centroid distance of 3.807 (1 Å.

  11. Supplemental design requirements document, Multifunction Waste Tank Facility, Project W-236A. Revision 1

    Energy Technology Data Exchange (ETDEWEB)

    Groth, B.D.


    The Multi-Function Waste Tank Facility (MWTF) consists of four, nominal 1 million gallon, underground double-shell tanks, located in the 200-East area, and two tanks of the same capacity in the 200-West area. MWTF will provide environmentally safe storage capacity for wastes generated during remediation/retrieval activities of existing waste storage tanks. This document delineates in detail the information to be used for effective implementation of the Functional Design Criteria requirements.

  12. Uranium-236 as an indicator of fuel-cycle uranium in ground water

    International Nuclear Information System (INIS)

    Environmental monitoring on and around the Hanford Site includes regular sampling of onsite monitoring wells and offsite farm wells. Uranium has been identified in the ground water onsite and also in water from farm wells located on the east side of the Columbia River, across from the Hanford Site. Information on the hydrology of the area indicates that the source of the offsite uranium is not the Hanford Site. This study evaluated the isotopic composition of the uranium in water from the various wells to differentiate the onsite uranium contamination from natural uranium offsite. 5 refs., 2 figs., 2 tabs

  13. Project W-236A multi-function waste tank facility waste feed projections

    International Nuclear Information System (INIS)

    A review of Hanford Underground Waste Storage Tank Chemistry, coupled with planned remediation actions and retrieval sequences was conducted in order to predict the chemistry of the waste to be stored in the MWTF tanks. All projected waste solutions to be transferred to the MWTF tanks were found to be in compliance with current tank chemistry specifications; therefore, the waste and the tank materials of construction are expected to be compatible

  14. Freeze drying method for preparing radiation source material

    International Nuclear Information System (INIS)

    Fabrication of a neutron source is specifically claimed. A palladium/californium solution is freeze dried to form a powder which, through conventional powder metallurgy, is shaped into a source containing the californium evenly distributed through a palladium metal matrix. (E.C.B.)

  15. Review of RBE and OER values for Cf-neutrons

    International Nuclear Information System (INIS)

    Californium-252, an isotope emitting neutrons, gamma photons and alpha particles, is being investigated for its practical use in intracavitary and interstitial brachytherapy. A review of published RBE and OER values for californium neutrons as a function of dose rate for a variety of biological endpoints is given. (Auth.)

  16. Economic and Performance Analysis of Gear Box Failures. Cooperative Research and Development Final Report, CRADA Number CRD-07-236

    Energy Technology Data Exchange (ETDEWEB)

    Keller, Jonathan [National Renewable Energy Lab. (NREL), Golden, CO (United States)


    The National Renewable Energy Laboratory (NREL) in Golden, CO, USA is forming a collaborative within the wind energy industry to address reliability issues on wind turbines. The National Wind Technology Center (NWTC), leading the collaborative effort, will allow gearbox manufacturers, bearing manufacturers, wind turbine owner/operators, and wind turbine manufacturers to team up for joint projects that address specific issues regarding design and reliability of wind turbine gearboxes. The primary means of investigation will be through full scale testing and analysis of actual gearboxes, both in the field and in the NREL 2.5 MW dynamometer test facility. These teams would contribute resources into a campaign that is intended to serve the mutual interests of a majority of the wind and gearbox industry stakeholders in addition to the specific project team objectives. that address specific issues regarding design and reliability of wind turbine gearboxes. The primary means of investigation will be through full scale testing and analysis of actual gearboxes, both in the field and in the NREL 2.5 MW dynamometer test facility. These teams would contribute resources into a campaign that is intended to serve the mutual interests of a majority of the wind and gearbox industry stakeholders in addition to the specific project team objectives.

  17. Progress towards the production of the 236gNp standard sources and competing fission fragment production (United States)

    Larijani, C.; Pickford, O. L.; Collins, S. M.; Ivanov, P.; Jerome, S. M.; Keightley, J. D.; Pearce, A. K.; Regan, P. H.


    The isobaric distribution of fission residues produced following the bombardment of a natural uranium target with a beam of 25 MeV protons has been evaluated. Decay analysis of thirteen isobarically distinct fission residues were carried out using high-resolution γ-spectrometry at the UK National Physical Laboratory. Stoichiometric abundances were calculated via the determination of absolute activity concentrations associated with the longest-lived members of each isobaric chain. This technique was validated by computational modelling of likely sequential decay processes through an isobaric decay chain. The results were largely in agreement with previously published values for neutron bombardments on 238U at energies of 14 MeV. Higher yields of products with mass numbers A~110-130 were found, consistent with the increasing yield of these radionuclides as the bombarding energy is increased.

  18. 2008-09 Baccalaureate and beyond Longitudinal Study (B&B:08/09). First Look. NCES 2011-236 (United States)

    Cataldi, Emily Forrest; Green, Caitlin; Henke, Robin; Lew, Terry; Woo, Jennie; Shepherd, Bryan; Siegel, Peter


    This "First Look" presents findings from the 2008-09 Baccalaureate and Beyond Longitudinal Study (B&B:08/09), which describes the enrollment and employment experiences, 1 year after they graduated, of a national sample of college graduates who completed a bachelor's degree in the 2007-08 academic year. The tables in this report provide a sampling…

  19. The Evaluation of Uranium-236 Isotopic Dilution with the Addition of Depleted Uranium to Supernatant Liquid Waste

    International Nuclear Information System (INIS)

    This paper describes laboratory-scale results on experiments performed to examine the feasibility of isotopic dilution of uranium-235 in supernatant liquid storage tanks at the Savannah River Site. The isotopic dilution tests were accomplished by adding an alkaline depleted uranium solution to small portions of simulated and actual storage tank waste solutions with enriched U-235 compositions. Based on the laboratory observations, recommendations were made, which involved the addition of significant quantities of uranyl carbonate solution to over four million liters of U-235 enriched waste stored in Tank 43H at SRS to reduce the risk for criticality. A post-uranyl carbonate addition analysis on the tank supernate confirmed the effectiveness of depleted uranium in isotopic dilution of U-235. The U-235 enrichment in the Tank 43H was isotopically diluted from an original high of over 4 wt percent down to less than 0.5 wt percent as predicted from the laboratory investigations

  20. SU-E-J-236: Audiovisual Biofeedback Improves Breath-Hold Lung Tumor Position Reproducibility Measured with 4D MRI

    International Nuclear Information System (INIS)

    Purpose: Audiovisual biofeedback breath-hold (AVBH) was employed to reproduce tumor position on inhale and exhale breath-holds for 4D tumor information. We hypothesize that lung tumor position will be more consistent using AVBH compared with conventional breath-hold (CBH). Methods: Lung tumor positions were determined for seven lung cancer patients (age: 25 – 74) during to two separate 3T MRI sessions. A breathhold training session was performed prior to the MRI sessions to allow patients to become comfortable with AVBH and their exhale and inhale target positions. CBH and AVBH 4D image datasets were obtained in the first MRI session (pre-treatment) and the second MRI session (midtreatment) within six weeks of the first session. Audio-instruction (MRI: Siemens Skyra) in CBH and verbal-instruction (radiographer) in AVBH were used. A radiation oncologist contoured the lung tumor using Eclipse (Varian Medical Systems); tumor position was quantified as the centroid of the contoured tumor after rigid registration based on vertebral anatomy across two MRI sessions. CBH and AVBH were compared in terms of the reproducibility assessed via (1) the difference between the two exhale positions for the two sessions and the two inhale positions for the sessions. (2) The difference in amplitude (exhale to inhale) between the two sessions. Results: Compared to CBH, AVBH improved the reproducibility of two exhale (or inhale) lung tumor positions relative to each other by 33%, from 6.4±5.3 mm to 4.3±3.0 mm (p=0.005). Compared to CBH, AVBH improved the reproducibility of exhale and inhale amplitude by 66%, from 5.6±5.9 mm to 1.9±1.4 mm (p=0.005). Conclusions: This study demonstrated that audiovisual biofeedback can be utilized for improving the reproducibility of breath-hold lung tumor position. These results are advantageous towards achieving more accurate emerging radiation treatment planning methods, in addition to imaging and treatment modalities utilizing breath-hold procedures

  1. AB236. The effect of Xuanju compound capsule combined with bromocriptine on erectile dysfunction due to hyperprolactinemia (United States)

    Bian, Jun; Liu, Cundong; Sun, Xiangzhou; Deng, Chunhua; Huang, Yanping; Ye, Yunlin


    Objective To investigate the effect of Xuanju compound capsule combined with bromocriptine on erectile dysfunction due to hyperprolactinemia. Methods Forty-six patients with erectile dysfunction due to hyperprolactinemia were divided into a treatment group (n=23) and a control group (n=23), both treated by bromocriptine and the former given Xuanju compound capsule in addition. After treatment for 12 weeks, comparison were made in erectile function, serum prolactin level and serum testosterone in two groups. Results Compared with those before treatment, the erectile function after treatment was significantly improved in two groups (P0.05). Serum testosterone after treatment in treatment group was significantly higher than that in control group (Phyperprolactinemia, and the effect was better than bromocriptine.

  2. SU-E-J-236: Feasibility of Using Infrared Imaging to Verify the Accuracy of the Radiotherapy Delivery

    Energy Technology Data Exchange (ETDEWEB)

    Tang, X; Cullip, T; Dooley, J; Potter, L; Chera, B; Lian, J; Chang, S; Zhu, X [UNC School of Medicine, Chapel Hill, NC (United States)


    Purpose: To assess whether infrared imaging can be used to verify the accuracy of the radiation treatment delivery. Methods: Radiation treatment induced skin reactions include acute changes (erythema and pigmentation) and chronic changes (telangiectasia and ulceration). Thermal imaging can detect these reactions before they become visible. A thermal camera with infrared spectral band 7.5 μm to 14 μm, and temperature measurement range from −20 °C to +150 °C and accuracy of ±2 °C was used. Beams-eye-view images were taken by the end of each treatment for a head and neck patient. The temperature changes of three points were monitored throughout the treatment course, including two points in the field (canthus and vessel) and one point outside of the field. The thermal images were warped and registered to the corresponding planning CT skin rendering. Dose map was exported from the treatment planning system and warped and registered to the planning CT skin rendering as well. The correlation between these two warped and registered images was calculated. The time spent to take the images was recorded. Results: The temperatures of the two points inside the field were always higher than the temperature of the point outside of the field. The temperature inside the field tended to increase as more fractions delivered to the patient. A correlation of 0.90 was found between the registered thermal image and the 3D dose map. On average, half minute was needed to take the images after each treatment. Conclusion: Thermal imaging can monitor the temperature variations of the skin, and the temperatures were proportional to the dose map. It can therefore potentially be an inexpensive and non-ionization tool to verify the accuracy of the radiation treatment delivery.

  3. SU-E-J-236: Audiovisual Biofeedback Improves Breath-Hold Lung Tumor Position Reproducibility Measured with 4D MRI

    Energy Technology Data Exchange (ETDEWEB)

    Lee, D; Pollock, S; Keall, P [Radiation Physics Laboratory, Sydney Medical School, The University of Sydney, NSW (Australia); Greer, P [School of Mathematical and Physical Sciences, The University of Newcastle, Newcastle, NSW (Australia); Department of Radiation Oncology, Calvary Mater Newcastle, Newcastle, NSW (Australia); Lapuz, C; Ludbrook, J [Department of Radiation Oncology, Calvary Mater Newcastle, Newcastle, NSW (Australia); Kim, T [Radiation Physics Laboratory, Sydney Medical School, The University of Sydney, NSW (Australia); Department of Radiation Oncology, University of Virginia Health System, Charlottesville, VA (United States)


    Purpose: Audiovisual biofeedback breath-hold (AVBH) was employed to reproduce tumor position on inhale and exhale breath-holds for 4D tumor information. We hypothesize that lung tumor position will be more consistent using AVBH compared with conventional breath-hold (CBH). Methods: Lung tumor positions were determined for seven lung cancer patients (age: 25 – 74) during to two separate 3T MRI sessions. A breathhold training session was performed prior to the MRI sessions to allow patients to become comfortable with AVBH and their exhale and inhale target positions. CBH and AVBH 4D image datasets were obtained in the first MRI session (pre-treatment) and the second MRI session (midtreatment) within six weeks of the first session. Audio-instruction (MRI: Siemens Skyra) in CBH and verbal-instruction (radiographer) in AVBH were used. A radiation oncologist contoured the lung tumor using Eclipse (Varian Medical Systems); tumor position was quantified as the centroid of the contoured tumor after rigid registration based on vertebral anatomy across two MRI sessions. CBH and AVBH were compared in terms of the reproducibility assessed via (1) the difference between the two exhale positions for the two sessions and the two inhale positions for the sessions. (2) The difference in amplitude (exhale to inhale) between the two sessions. Results: Compared to CBH, AVBH improved the reproducibility of two exhale (or inhale) lung tumor positions relative to each other by 33%, from 6.4±5.3 mm to 4.3±3.0 mm (p=0.005). Compared to CBH, AVBH improved the reproducibility of exhale and inhale amplitude by 66%, from 5.6±5.9 mm to 1.9±1.4 mm (p=0.005). Conclusions: This study demonstrated that audiovisual biofeedback can be utilized for improving the reproducibility of breath-hold lung tumor position. These results are advantageous towards achieving more accurate emerging radiation treatment planning methods, in addition to imaging and treatment modalities utilizing breath-hold procedures.

  4. 48 CFR 652.236-72 - Statement of Qualifications for the Omnibus Diplomatic Security and Antiterrorism Act. (United States)


    ... boards of directors who do not have operational responsibilities do not occupy “principal management... may include such items as certificates of incorporation, partnership agreements, resolutions of boards of directors, etc.). 4. Section 402(c)(2)(D): “The term ‘United States person’ means a person...

  5. Cryogenic gamma detectors enable direct detection of 236U and minor actinides for non-destructive assay

    International Nuclear Information System (INIS)

    We demonstrate the utility of a superconducting transition edge sensor (TES) γ-ray detector with high energy resolution and low Compton background for nondestructive assay (NDA) of a uranium sample from reprocessed nuclear fuel. We show that TES γ-detectors can separate low-energy actinide γ-emissions from the background and nearby lines, even from minor isotopes whose signals are often obscured in NDA with conventional Ge detectors. Superconducting γ-detectors may therefore bridge the gap between high-accuracy destructive assay (DA) and easier-to-use NDA. (author)

  6. A new shipping container for an intense neutron emitter

    International Nuclear Information System (INIS)

    Californium-252 is an intense neutron emitter (2.34 x 1012 n/s·g) used in medicine, research, and industry. The western world's sole source of this rare radioisotope is the Californium Facility at Oak Ridge National Laboratory's Radiochemical Engineering Development Center (REDC). A project has been initiated at the REDC to design a new Type B Californium Shipping Container. This effort is essential for future transportation of californium to meet the needs of users all over the world. The shipping container must meet all requirements for transport by motor freight, air, vessel, and rail, both domestic and foreign. There are unique problems in the design, fabrication, and licensing of a new Type B shipping container that will accommodate up to 60 milligrams of californium-252. One of the first challenges in the design phase of the project is the selection of a material to shield the high neutron flux. The more stringent safety precautions of today's world impel us to consider more exotic materials for such a purpose. The candidate materials must be examined not just for their neutron shielding properties, but also in conjunction with other properties such as thermal and structural requirements to withstand the hypothetical accident conditions. The design and building of such a container is a formidable task requiring much planning. The licensing process, with the complex, interactive federal codes, is a special challenge and may be the biggest on the project in terms of time and money

  7. Application of Cf for the quantitative measurement of nuclear reactor fuel materials

    International Nuclear Information System (INIS)

    Sensitive and rapid measurements of the quantity and geometric distribution of nuclear reactor fuel materials can be made using neutrons from californium. The neutron-induced fission rate in these materials may be measured by detection of either prompt radiations from fission or delayed radiations from radioactive fission products. A number of californium-based instruments are presently in use by the nuclear industry for purposes of process control, quality control, nuclear materials safeguards, and environmentl assessment. An Automated Fuel Rod Scanner (AFRS) is used for high-speed measurement of the uniformity of loading and total fissile content of reactor fuel rods. The fuel rods are moved first through an irradiator containing about 1 mg of californium, and subsequently through high-efficiency detectors for the measurement of fission-product gamma-rays. Multiple detectors on each of two irradiation channels are used to reduce the californium source strength requirement. The fuel loading of each 15-mm-long pellet is tested to +-10% on 100% of the plant throughput. By summing the response over length, the total fissile material content of the fuel rod is measured to better than 0.5%. An on-line computer for data processing allows the instrument to measure about 150 rods per hour with a single operator. The same activation concept is used with a 25-μg californium source in a Small Sample Assay System (SSAS) which measures the fissile content of fuel pellet sized samples with a precision of 0.5%

  8. 贝尔麻痹236例疗效及影响预后的相关因素分析

    Institute of Scientific and Technical Information of China (English)

    罗霄鹏; 曾国华; 包正军


    @@ 贝尔麻痹(Bell palsy)是神经内科的常见病、多发病,以急性进展的面部表情肌麻痹为主要临床特点,一般预后较好,但仍有部分患者恢复差,留有后遗症,严重影响面部外观,给患者造成生理与心理的伤害.为此,我们对贝尔麻痹的临床特点、疗效及影响预后的相关因素进行分析,旨在为临床治疗提供依据.

  9. Accurate measurements of fission-fragment yields in $^{234,235,236,238}$U(γ,f) with the SOFIA set-up


    Chatillon A.; Taïeb J.; MARTIN J. - F.; Pellereau E.; Boutoux G.; Gorbinet T.; Grente L.; Bélier G.; Laurent B.; Alvarez-Pol H.; Ayyad Y.; Benlliure J.; Caamaño M.; Audouin L.; Casarejos E.


    SOFIA (Studies On Fission with Aladin) is a new experimental set-up dedicated to accurate measurement of fission-fragments isotopic yields. It is located at GSI, the only place to use inverse kinematics at relativistic energies in order to study the (γ,f) electromagnetic-induced fission. The SOFIA set-up is a large-acceptance magnetic spectrometer, which allows to fully identify both fission fragments in coincidence on the whole fission-fragment range. This paper will report on fission yields...

  10. In 2012 Qinghai Newly Discovered 2.36 Million Tonnes of Copper, Lead and Zinc and 440,000 tonnes of Nickel in 14 ore fields

    Institute of Scientific and Technical Information of China (English)


    <正>The reporter learned from the Land and Resource Department of Qinghai Province that in 2012, by revolving around the target of acquiring new progress and new achievements in three years, making significant breakthroughs in five years, and developing new patterns in prospecting and development in eight years, Qinghai Province allocated large-scale investment and massive labor force, and actively

  11. Thulium laser enucleation of the prostate is a safe and a highly effective modality for the treatment of benign prostatic hyperplasia - Our experience of 236 patients


    Ketan P Vartak; Prashant H Salvi


    Context: Thulium LASER is fast emerging as a safe and effective modality for benign prostatic hyperplasia (BPH). Still, compared to holmium laser transurethral enucleation of the prostate (HoLEP) the number of institutes all over the world using Thulium LASER are limited. This is our effort to bring the statistical facts about the safety and effectivity of Thulium LASER. Aims: To study the efficacy of thulium laser enucleation of the prostate (ThuLEP). Settings and Design: All patients ...

  12. 49 CFR Appendix F to Part 236 - Minimum Requirements of FRA Directed Independent Third-Party Assessment of PTC System Safety... (United States)


    ... the supplier's MTTHE and risk estimates for the PTC system, and the supplier's confidence interval in... this part, and any other previously agreed-upon controlling documents or standards. (b) The supplier... efforts in order to preserve the reviewer's independence and maintain the supplier's proprietary right...

  13. The sensitivity of calculated critical masses of small fast systems to changes in the U236 and U238 neutron-scattering data

    International Nuclear Information System (INIS)

    The sensitivity of the calculated critical masses of a number of simple systems, to changes in the basic neutron scattering data, have been investigated. The systems considered are spheres of 29% U235 and 93.5% U235, both bare, and reflected by thick natural uranium. The calculations have been carried out using the Carlson Sn method with 4 energy groups, and the percentage changes in the calculated critical masses of the different systems, due to specified changes in the various aspects of the neutron scattering data, have been obtained. The results are presented and discussed with particular reference to the adjustment of the basic data to give good agreement with experimental critical sizes. The basic data on which these calculations have been based are those given in AWRE Report 0-28/60. (author)

  14. Effects of Polychlorinated Biphenyl Congener Concentration and Sediment Supplementation on Rates of Methanogenesis and 2,3,6-Trichlorobiphenyl Dechlorination in an Anaerobic Enrichment


    Boyle, Alfred W.; Blake, Cheryl K.; Price, W. Allen; May, Harold D.


    We have employed a method of enrichment that allows us to significantly increase the rate of reductive polychlorinated biphenyl (PCB) dechlorination. This method shortens the time required to investigate the effects that culture conditions have on dechlorination and provides an estimate of the potential activity of the PCB-dechlorinating anaerobes. The periodic supplementation of sterile sediment and PCB produced an enhanced, measurable, and sustained rate of dechlorination. We observed volum...

  15. Costing of severe pneumonia in hospitalized infants and children aged 2-36 months, at a secondary and tertiary level hospital of a not-for-profit organization

    DEFF Research Database (Denmark)

    Madsen, Helle Ostergaard; Hanehøj, Malin; Das, Ashima Rani;


    comprised travel, accommodation and special food during the period of illness, and indirect costs of productivity loss for family members. Patient specific resource consumption and related charges were recorded from charts, nursing records, pharmacy lists and hospital bills, and the providers view point of......OBJECTIVES: To determine health care provider cost and household cost of the treatment of severe pneumonia in infants and young children admitted to secondary and tertiary level health care facilities. METHODS: The study was done in a private, not-for-profit medical college hospital, in Vellore...... the costs was estimated. Unit cost estimates for bed days, treatment and investigation inputs were calculated. RESULTS: Total cost to health care provider for one episode of hospitalized childhood pneumonia treated at secondary level was US$ 83.89 (INR 3524) and US$ 146.59 (INR 6158) at tertiary level...

  16. Retraction notice to: Artificial intelligence in pharmaceutical product formulation: Neural computing [Chem. Ind. Chem. Eng. Q. 15(4 (2009 227-236

    Directory of Open Access Journals (Sweden)

    Ibrić Svetlana


    Full Text Available This article has been retracted at the request of the authors. The retraction has been made because the authors admitted that they took the text and rawings from the review article written by R. Rowe and E. Colbourn, Future Medicinal Chemistry 1(4 (2009 713-726, without their permission and even did not include this article in the list of references. One of the conditions of submission of a paper for publication are that authors confirm that their work is entirely originally written, someone else’s data and/or text are appropriately cited or quoted and permission has been obtained for use of copyrighted material from other sources. Therefore, the retracted article represents a severe improperly usage of the scientific publishing system. Apologies are offered to readers of the Chem. Ind. Chem. Eng. Q. that this abuse was not detected during the submission process.

    Link to the retracted article 10.2298/CICEQ0904227I

  17. Synthesis and in vitro cytotoxic evaluation of 2-hydrazinylpyrido[2,3-6]pyrazin-3(4H)-one derivatives

    Institute of Scientific and Technical Information of China (English)

    Guo Gang Zhang; Ya Jing Liu; Xiao Guang Ma; Hao Dong; Ju Li; Ping Gong


    A series of novel 2-hydrazinylpyrido[2,3-b]pyrazin-3(4H)-one derivatives were synthesized and evaluated for their cytotoxic activities against A549, MDA-MB-231 and HT-29 cell lines in vitro. Pharmacological data indicated that compounds 5b, 5c, 10a and 10g possessed marked cytotoxicity, especially 10a (with IC50 values of 0.81, 2.56 and 1.63 μmol/L against A549, MDA-MB-231 and HT29 cell lines, respectively), which had emerged as a lead compound.

  18. Crystal structure of (2',3,6'-tri-chloro-biphenyl-2-yl)boronic acid tetra-hydro-furan monosolvate. (United States)

    Durka, Krzysztof; Kliś, Tomasz; Serwatowski, Janusz


    The title compound, C12H8BCl3O2·C4H8O, crystallizes as a tetra-hydro-furan monosolvate. The boronic acid group adopts a syn-anti conformation and is significantly twisted along the carbon-boron bond by 69.2 (1)°, due to considerable steric hindrance from the 2',6'-di-chloro-phenyl group that is located ortho to the boronic acid substituent. The phenyl rings of the biphenyl are almost perpendicular to one another, with a dihedral angle of 87.9 (1)° between them. In the crystal, adjacent mol-ecules are linked via O-H⋯O inter-actions to form centrosymmetric dimers with R 2 (2)(8) motifs, which have recently been shown to be energetically very favourable. The hy-droxy groups are in an anti conformation and are also engaged in hydrogen-bonding inter-actions with the O atom of the tetra-hydro-furan solvent mol-ecule. Cl⋯Cl halogen-bonding inter-actions [Cl⋯Cl = 3.464 (1) Å] link neigbouring dimers into chains running along [010]. Further aggregation occurs due to an additional Cl⋯Cl halogen bond [Cl⋯Cl = 3.387 (1) Å]. PMID:26870407

  19. Gamma-Ray Emission Spectra as a Constraint on Calculations of 234,236,238U Neutron-Capture Cross Sections

    Energy Technology Data Exchange (ETDEWEB)

    Ullmann, John Leonard [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Kawano, Toshihiko [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Bredeweg, Todd Allen [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Baramsai, Bayarbadrakh [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Couture, Aaron Joseph [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Haight, Robert Cameron [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Jandel, Marian [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Mosby, Shea Morgan [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); O' Donnell, John M. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Rundberg, Robert S. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Vieira, David J. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Wilhelmy, Jerry B. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Becker, John A. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Wu, Ching-Yen [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Krticka, Milan [Charles Univ., Prague (Czech Republic)


    Neutron capture cross sections in the “continuum” region (>≈1 keV) and gamma-emission spectra are of importance to basic science and many applied fields. Careful measurements have been made on most common stable nuclides, but physicists must rely on calculations (or “surrogate” reactions) for rare or unstable nuclides. Calculations must be benchmarked against measurements (cross sections, gamma-ray spectra, and <Γγ>). Gamma-ray spectrum measurements from resolved resonances were made with 1 - 2 mg/cm2 thick targets; cross sections at >1 keV were measured using thicker targets. The results show that the shape of capture cross section vs neutron energy is not sensitive to the form of the strength function (although the magnitude is); the generalized Lorentzian E1 strength function is not sufficient to describe the shape of observed gamma-ray spectra; MGLO + “Oslo M1” parameters produces quantitative agreement with the measured 238U(n,γ) cross section; additional strength at low energies (~ 3 MeV) -- likely M1-- is required; and careful study of complementary results on low-lying giant resonance strength is needed to consistently describe observations.

  20. Decompressive craniectomy in traumatic brain injury: A single-center, multivariate analysis of 1,236 patients at a tertiary care hospital in India

    Directory of Open Access Journals (Sweden)

    Sumit Sinha


    Conclusions: The severity of head injury, performing a duraplasty rather than a slit durotomy, avoidance of a contralateral DC, and the presence of preoperative hypotension, infarct, and/or pupillary asymmetry have the highest odds of predicting the short term GOS at the time of discharge, after a DC in patients with TBI. Although DC carries a high risk of mortality, the probability of the survivors having a favorable outcome is significantly more as compared to those who remain in a PVS.

  1. Acha, Omar y Quiroga, Nicolás, El Hecho Maldito… conversaciones para otra historia del peronismo, Rosario, Argentina, Prohistoria, 2012, 236 p.


    Aldao, Joaquín


    Uno de los puntos fuertes de El hecho maldito… radica en la actualidad de los trabajos que analiza, un recorrido desde los autores clásicos hasta las ponencias presentadas en los Congresos de Estudios sobre Peronismo y en las Jornadas Interescuelas de Historia. Otro punto fuerte es el énfasis en una escritura heterodoxa, trabajando no sólo lo argumentativo, sino también lo estético como elemento de subversión significante, nuevas prosas para nuevos sentidos. Por último, el libro apuesta a lo ...

  2. Application of PGNAA to preincineration assay of combustible waste for chlorine

    Energy Technology Data Exchange (ETDEWEB)

    Gehrke, R.J.; Pawelko, R.J.; Greenwood, R.C. [Idaho National Engineering Lab., Idaho Falls, ID (United States)


    A prompt gamma neutron activation analysis method is being developed for on-stream pre-incineration assay of low level radioactive combustible waste for it`s chlorine content. The assay system consists of three californium 252 sources and a germanium or scintillation gamma-ray spectrometer.

  3. Magnetic measurements of the transuranium elements. Progress report, January 1, 1984-December 31, 1984

    International Nuclear Information System (INIS)

    Measurements of the magnetic properties of dhcp californium-249 metal indicated the presence of three regions of differing magnetic character. Additional measurements are also reported. Magnetic moments and valence states of terbium in TbF3, BaTbO3, and TbO18 are discussed. Progress on high-field operation of the micro-magnetic susceptometer is reported

  4. Source storage and transfer cask: Users Guide

    International Nuclear Information System (INIS)

    The storage and shield cask for the dual californium source is designed to shield and transport up to 3.7 mg (2 Ci) of 252Cf. the cask meets Department of Transportation (DOT) license requirements for Type A materials (DOT-7A). The cask is designed to transfer sources to and from the Flourinel and Fuel Storage (FAST) facility delayed-neutron interrogator. Californium sources placed in the cask must be encapsulated in the SR-CF-100 package and attached to Teleflex cables. The cask contains two source locations. Each location contains a gear box that allows a Teleflex cable to be remotely moved by a hand crank into and out of the cask. This transfer procedure permits sources to be easily removed and inserted into the delayed-neutron interrogator and reduces personnel radiation exposure during transfer. The radiation dose rate with the maximum allowable quantity of californium (3.7 mg) in the cask is 30 mR/h at the surface and less than 2 mR/h 1 m from the cask surface. This manual contains information about the cask, californium sources, describes the method to ship the cask, and how to insert and remove sources from the cask. 28 figs

  5. Discovery of Isotopes of the Transuranium Elements with 93 <= Z <= 98


    Fry, C; Thoennessen, M


    One hundred and five isotopes of the transuranium elements neptunium, plutonium, americium, curium, berkelium and californium have so far been observed; the discovery of these isotopes is discussed. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  6. 49 CFR 234.275 - Processor-based systems. (United States)


    ... made subject to 49 CFR part 236, subpart H, by submitting a Product Safety Plan as prescribed in § 236... justifications. The Product Safety Plan in accordance with 49 CFR 236.907—or a PTC Development Plan and PTC Safety Plan required to be filed in accordance with 49 CFR 236.1013 and 236.1015—must explain how...

  7. Confluences Méditerranée, n° 81, 2012/2, 236 p.Dossier : Algérie, 50 ans après


    Mohammedi, Sidi Mohammed


    « L’Algérie fête cette année les 50 ans de son indépendance, une occasion pour revenir sur son parcours à la fois politique, économique et culturel. C’est l’objectif recherché par la revue Confluences Méditerranée à travers ce numéro consacré à « L’Algérie, 50 ans après » (p. 09). C’est ainsi qu’a ouvert Sid-Ahmed Souiah sa présentation en attirant l’attention que l’exhaustivité n’était pas recherchée pour choisir les thématiques retenues mais, plutôt, de présenter une variété de contribution...


    Energy Technology Data Exchange (ETDEWEB)



    The U.S. Department of Energy (DOE) Oak Ridge Office of Environmental Management selected Oak Ridge Associated Universities (ORAU), through the Oak Ridge Institute for Science and Education (ORISE) contract, to perform independent verification (IV) at Zone 2 of the East Tennessee Technology Park (ETTP) in Oak Ridge, Tennessee. ORAU has concluded IV surveys, per the project-specific plan (PSP) (ORAU 2013a) covering exposure units (EUs) Z2-24, -31, -32, and -36. The objective of this effort was to verify the following. • Target EUs comply with requirements in the Zone 2 Record of Decision (ROD) (DOE 2005), as implemented by using the dynamic verification strategy presented in the dynamic work plan (DWP) (BJC 2007) • Commitments in the DWP were adequately implemented, as verified via IV surveys and soil sampling The Zone 2 ROD establishes maximum remediation level (RLmax) values and average RL (RLavg) values for the primary contaminants of concern (COCs) U-234, U-235, U-238, Cs-137, Np-237, Ra-226, Th-232, arsenic, mercury, and polychlorinated biphenyls (PCBs). Table 1.1 lists Zone 2 COCs with associated RLs. Additional radiological and chemical contaminants were also identified during past characterization and monitoring actions, though the ROD does not present RLs for these potential contaminants. IV activities focused on the identification and quantification of ROD-specific COCs in surface soils, but also generated data for other analytes to support future decisions. ORAU personnel also reviewed EU-specific phased construction completion reports (PCCRs) to focus IV activities and identify potential judgmental sample locations, if any.

  9. Postoperative consumption of opioid analgesics following correction of pectus excavatum is influenced by pectus severity: a single-centre study of 236 patients undergoing minimally invasive correction of pectus excavatum

    DEFF Research Database (Denmark)

    Grosen, Kasper; Pfeiffer-Jensen, Mogens; Pilegaard, Hans


    Objective: Surgical correction of pectus excavatum (PE) is primarily performed to achieve cosmetic and psychological benefits for the patient. Minimally invasive repair of PE is often associated with severe postoperative pain. This study estimates the effect of the severity of PE on the postopera......Objective: Surgical correction of pectus excavatum (PE) is primarily performed to achieve cosmetic and psychological benefits for the patient. Minimally invasive repair of PE is often associated with severe postoperative pain. This study estimates the effect of the severity of PE on the...

  10. Faculty Knowledge of Information Literacy Standards Has an Impact in the Classroom. A Review of: Saunders, L. (2012. Faculty perspectives on information literacy as a student learning outcome. The Journal of Academic Librarianship, 38(4, 226-236.

    Directory of Open Access Journals (Sweden)

    Giovanna Badia


    Full Text Available Objective – To discover how faculty perceives information literacy and examine whether professors in different disciplines view and approach information literacy differently. Particularly, the study seeks to address the following questions:• “How do faculty members define or understand information literacy?o Are they familiar with existing standards such as [those from the Association of College and Research Libraries] ACRL?o Does the development of a local definition of information literacy impact faculty understanding?• How important do instructors believe information literacy to be for their students? How do they addressinformation literacy, or expect it to be addressed within the curriculum?• Are there disciplinary differences in faculty attitudes toward and approaches to information literacy?” (p. 227Design – Survey, i.e., an online questionnaire followed by interviews. Setting – Colleges and universities in the United States. Subjects – 834 faculty members in anthropology, the natural sciences, computer science, English literature, psychology, and political science from a sample of 50 American colleges and universities with undergraduate degree programs. Methods – An email, containing a link to a brief online survey, was sent to 834 professors from academic institutions across the United States. Three faculty members from each department in six different disciplines from each institution were contacted. The survey contained a mix of closed and open-ended questions and could be completed in less than 10 minutes. Respondents were asked to supply their contact information if they agreed to be phoned for a follow-up interview. The interview consisted of six questions that were posed to all participants, with some changes depending on the answers given.Main Results – Regardless of discipline, the majority of faculty members who responded to the survey thought that information literacy competencies were important for their students to master. The majority also rated their students as only “somewhat strong” in “identifying scholarly materials, identifying reliable/authoritative information, finding relevant information, citing sources properly, synthesizing information, and searching databases” (p. 229. Professors’ answers differed within different disciplines when it came to showing their own knowledge of information literacy standards, such as those of ACRL, and assessing the abilities of their students. For example, biology students’ web searching skills were rated higher than students in English literature and anthropology. When faculty were asked their opinions about who should be responsible for information literacy instruction, there was no straight answer. Many professors agreed that it is the responsibility of both faculty and librarians. Those faculty members who were knowledgeable about information literacy standards were also among the ones who included information literacy instruction in their courses and thought it was important for their students to learn.Conclusion – According to the author, the study results show that possibilities continue to exist for librarians to be part of information literacy endeavours, but it is still up to the librarians to start and maintain conversations with faculty on this topic. Because faculty members have not yet found systematic methods for integrating information literacy into the curriculum, they might be open to librarians’ suggestions and ideas on this topic. “Perhaps the most important finding of this study is that knowledge of and familiarity with information literacy standards is more closely associated with whether faculty address information literacy in their courses than any other variable including disciplinary area” (p. 232. Therefore, it is the librarian’s responsibility to engage in discussions with faculty about information literacy.

  11. Information, communication and control systems for vehicle, road and traffic management. Contribution OECD Seminar on Micro-electronics for Road and Traffic Management. Tokyo, October 29 - November 2, 1984, Session V, p. 236-241.

    NARCIS (Netherlands)

    Oei, H.-l.


    The application of micro-electronics for vehicle, road and traffic management has increased rapidly in the past 10 to 15 years. The approach, however, is very often rather isolated, resulting in problems regarding consistency, continuity, uniformity and compatibility. The whole field of possible a

  12. Drug: D04883 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D04883 Drug Medetomidine hydrochloride (USAN) C13H16N2. HCl 236.108 236.7405 D04883.gif Analgesic [veterinar...y]; Sedative [veterinary] veterinary medicine alpha2-adrenergic receptor agonist [H

  13. Oxidation of microquantities of transplutonium elements to tetravalent state in mineral acid solutions and their stability

    International Nuclear Information System (INIS)

    Kinetics of americium(3) microquantity oxidation and stability of forming americium(4), as well as possibility of curium and californium oxidation to tetravalent state in solutions of sulfuric and nitric acids depending on the concentration of mineral acid, potassium tungstophosphate and ammonium persulfate are studied by the extraction method. It is shown that curium(3) and californium(3) in solutions of 0.05-2.5 mol/l H2SO4 and HNO3 containing 10-3 mol/l potassium tungstophosphate is not practically oxidized by the mixture of silver nitrate and ammonium persulfate. Americium(3) is oxidized to the utmost to Am(4) for 2-3 min at room temperature, but stability of Am(4) depends on the concentration of sulfuric acid and potassium tungstophosphate

  14. Characterization of berkelium(III) dipicolinate and borate compounds in solution and the solid state. (United States)

    Silver, Mark A; Cary, Samantha K; Johnson, Jason A; Baumbach, Ryan E; Arico, Alexandra A; Luckey, Morgan; Urban, Matthew; Wang, Jamie C; Polinski, Matthew J; Chemey, Alexander; Liu, Guokui; Chen, Kuan-Wen; Van Cleve, Shelley M; Marsh, Matthew L; Eaton, Teresa M; van de Burgt, Lambertus J; Gray, Ashley L; Hobart, David E; Hanson, Kenneth; Maron, Laurent; Gendron, Frédéric; Autschbach, Jochen; Speldrich, Manfred; Kögerler, Paul; Yang, Ping; Braley, Jenifer; Albrecht-Schmitt, Thomas E


    Berkelium is positioned at a crucial location in the actinide series between the inherently stable half-filled 5f(7) configuration of curium and the abrupt transition in chemical behavior created by the onset of a metastable divalent state that starts at californium. However, the mere 320-day half-life of berkelium's only available isotope, (249)Bk, has hindered in-depth studies of the element's coordination chemistry. Herein, we report the synthesis and detailed solid-state and solution-phase characterization of a berkelium coordination complex, Bk(III)tris(dipicolinate), as well as a chemically distinct Bk(III) borate material for comparison. We demonstrate that berkelium's complexation is analogous to that of californium. However, from a range of spectroscopic techniques and quantum mechanical calculations, it is clear that spin-orbit coupling contributes significantly to berkelium's multiconfigurational ground state. PMID:27563098

  15. Neutron activation determination of gold in technogenic raw materials with different mineral composition


    Yudakov Aleksandr A.; Ivannikov Sergey I.; Zheleznov Veniamin V.; Taskin Andrei V.; Tsybulskaya Oksana N.


    The methods used to determine the gold content in the technogenic objects of gold mining were analyzed regarding their non-homogeneity and complexity of chemical and mineral compositions. A possible application of the neutron activation analysis with the use of the californium source of neutrons for determining the content of fine-grained and extra-fine-grained gold in the technogenic objects, including the bottom-ash waste of energy providers, is considere...

  16. Jak bylo objeveno spontánní štěpení

    Czech Academy of Sciences Publication Activity Database

    Vobecký, Miloslav

    Praha: Spektroskopická společnost J.M. Marci, 2010 - (Vobecký, M.), s. 5-10 ISBN 978-80-904539-0-6. [Seminář Radioanalytické metody IAA 10. Praha (CZ), 30.06.2010-01.07.2010] Institutional research plan: CEZ:AV0Z40310501 Keywords : spontaneous fission * fission -track dating method * californium 252 neutron source Subject RIV: CB - Analytical Chemistry, Separation

  17. Study of heavy particle decay from superheavy elements by SK model

    International Nuclear Information System (INIS)

    Heavy nuclei usually decay by alpha decay or spontaneous fission. These two decay modes are generally the most probable competing processes. Another less probable decay process is cluster radioactivity in which nuclei from carbon to silicon are emitted from Radium to Californium leading to the most stable daughter nucleus, lead. This work reports such a study using the cubic plus Yukawa plus exponential model of Shanmugam and Kamalaharan (SK)

  18. Measurement of the energy spectra of fission fragments using nuclear track detectors and digital image processing

    International Nuclear Information System (INIS)

    Energy spectra of fission fragments were determined using a Nuclear Track Methodology (NTM) supported by digital image analysis and numerical data processing using a standard personal computer. The analysis of a californium (252Cf) spectrum with this approach shows improvement compared with the values reported previously using the standard procedure, in terms of resolution and accuracy. This new method adds full automation to the technical advantages and cost effectiveness of an NTM.

  19. Heavy ion tests on programmable VLSI

    International Nuclear Information System (INIS)

    The radiation from space environment induces operation damages in onboard computers systems. The definition of a strategy, for the Very Large Scale Integrated Circuitry (VLSI) qualification and choice, is needed. The 'upset' phenomena is known to be the most critical integrated circuit radiation effect. The strategies for testing integrated circuits are reviewed. A method and a test device were developed and applied to space applications candidate circuits. Cyclotron, synchrotron and Californium source experiments were carried out

  20. Properties of neutron sources

    International Nuclear Information System (INIS)

    The Conference presentations were divided into sessions devoted to the following topics: white neutron sources, primarily pulsed (6 papers); fast neutron fields (5 papers); Californium-252 prompt fission neutron spectra (14 papers); monoenergetic sources and filtered beams (11 papers); 14 MeV neutron sources (10 papers); selected special application (one paper); and a general interest session (4 papers). Individual abstracts were prepared separately for the papers

  1. Neutron multiplicities for the transplutonium nuclides

    International Nuclear Information System (INIS)

    This paper continues, with respect to the transplutonium nuclides, earlier efforts to collate and evaluate data from the scientific literature on the prompt neutron multiplicity distribution from fission and its first moment = ΣnuPnu. The isotopes considered here for which P/sub nu/ and or data (or both) were found in the literature are of americium (Am), curium (Cm), berkelium (Bk), californium (Cf), einsteinium (Es), fermium (Fm), and nobelium (No)

  2. Protein (Cyanobacteria): 442829 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)


  3. Protein (Cyanobacteria): 442830 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)


  4. Dependence of metal partition coefficients in D2EHPA capacity on extraction from acid solutions

    International Nuclear Information System (INIS)

    In devising solvent-extraction schemes for extracting the transplutonium elements (TPE), one usually employs the partition coefficients K/sub p/ for trace amounts; when the results are transferred to weighable amounts of the elements, there are difficulties because one lacks capacity characteristics for the extractants under the conditions used. They have determined the capacity of D2EHPA over a wide range in acidity (0.001-2 mole/liter) in relation to dysprosium (the analog of californium) in the system formed by D2EHPA with nitric acid by saturating a set volume of the extractant with dysprosium in nitric acid containing the necessary amount of free acid


    Energy Technology Data Exchange (ETDEWEB)

    Albrecht-Schmitt, Thomas


    This grant supported the exploratory synthesis of new actinide materials with all of the actinides from thorium to californium with the exceptions of protactinium and berkelium. We developed detailed structure-property relationships that allowed for the identification of novel materials with selective ion-exchange, selective oxidation, and long-range magnetic ordering. We found novel bonding motifs and identified periodic trends across the actinide series. We identified structural building units that would lead to desired structural features and novel topologies. We also characterized many different spectroscopic trends across the actinide series. The grant support the preparation of approximately 1200 new compounds all of which were structurally characterized.


    International Nuclear Information System (INIS)

    Prompt gamma-ray neutron activation analysis (PGNAA) is now a proven method for the identification of chemical warfare agents and explosives in military projectiles and storage containers. Idaho National Laboratory is developing a next-generation PGNAA instrument based on the new Ortec Detective mechanically-cooled HPGe detector and a neutron generator. In this paper we review PGNAA analysis of suspect chemical warfare munitions, and we discuss the advantages and disadvantages of replacing the californium-252 radioisotopic neutron source with a compact accelerator neutron generator


    Energy Technology Data Exchange (ETDEWEB)

    T. R. Twomey; A. J. Caffrey; D. L. Chichester


    Prompt gamma-ray neutron activation analysis (PGNAA) is now a proven method for the identification of chemical warfare agents and explosives in military projectiles and storage containers. Idaho National Laboratory is developing a next-generation PGNAA instrument based on the new Ortec Detective mechanically-cooled HPGe detector and a neutron generator. In this paper we review PGNAA analysis of suspect chemical warfare munitions, and we discuss the advantages and disadvantages of replacing the californium-252 radioisotopic neutron source with a compact accelerator neutron generator.

  8. Composition containing transuranic elements for use in the homeopathic treatment of aids

    International Nuclear Information System (INIS)

    A homeopathic remedy consisting of a composition containing one or more transuranic elements, particularly plutonium, for preventing and treating acquired immunodeficiency syndrome (AIDS) in humans, as well as seropositivity for human immunodeficiency virus (HIV). Said composition is characterized in that it uses any chemical or isotopic form of one or more transuranic elements (neptunium, plutonium, americium, curium, berkelium, californium or einsteinium), particularly plutonium, said form being diluted and dynamized according to conventional homeopathic methods, particularly the so-called Hahnemann and Korsakov methods, and provided preferably but not exclusively in the form of lactose and/or saccharose globules or granules impregnated with the active principle of said composition. (author)

  9. Neutron nondestructive essay of the plutonium metal parts

    International Nuclear Information System (INIS)

    Based on the principle of neutron multiplicity and data unfolding mathematics, this paper developed the software which can execute the neutron multiplicity analysis, neutron attenuation analysis, parameter calibration, Pu mass solution with the neutron pulse sequence acquisition method. The measurement system consisted of detector,nuclear electronic apparatus, pulsed sequence acquisition and analysis software was tested and calibrated by californium source. Three mental plutonium components with different mass were used for experimental assay and validation, which showed that the assay bias was within 15% against the nominal value of the samples. (authors)

  10. Physical-chemical studies of transuranium elements. Progress report, April 1, 1982-March 31, 1983

    International Nuclear Information System (INIS)

    Progress is reported on the following topics: electrochemical and spectroscopic studies of less-stable higher oxidation states of transuranium elements in complexing aqueous media; spectroscopic and electrochemical studies of selected lanthanides and actinides in molten dimethyl sulfone; spectroelectronchemical studies of the Ce(IV)/Ce(III) couple in aqueous carbonate solutions; characterization of actinide orthophosphates by Raman and absorption spectrophotometries and by x-ray diffraction; relativistic multiple scattering calculations on transuranium element compounds; Raman spectroscopic studies of natural minerals containing the uranyl ion; and solution calorimetry of californium metal

  11. Transuranium element production. II. Chemical processing of targets

    International Nuclear Information System (INIS)

    The chemical processing described concerns small experimental targets irradiated in OSIRIS or EL-III and industrial targets irradiated in the CELESTIN reactors. In view of the difficulties encountered when processing highly irradiated targets ( by liquid-liquid extraction (interface sludges leading to stable emulsion) the new processes developed are based on inverse phase chromatography. This technique applied to targets of americium 241, plutonium 239 and a plutonium mixture rich in isotope 242 has given tens of milligrams of curium 242, grams of americium 243 and curium 244 and micrograms of californium 252

  12. Detection of rare earth elements in Powder River Basin sub-bituminous coal ash using laser-induced breakdown spectroscopy (LIBS)

    Energy Technology Data Exchange (ETDEWEB)

    Tran, Phuoc [National Energy Technology Lab. (NETL), Pittsburgh, PA, (United State; Mcintyre, Dustin [National Energy Technology Lab. (NETL), Pittsburgh, PA, (United State


    We reported our preliminary results on the use of laser-induced breakdown spectroscopy to analyze the rare earth elements contained in ash samples from Powder River Basin sub-bituminous coal (PRB-coal). We have identified many elements in the lanthanide series (cerium, europium, holmium, lanthanum, lutetium, praseodymium, promethium, samarium, terbium, ytterbium) and some elements in the actinide series (actinium, thorium, uranium, plutonium, berkelium, californium) in the ash samples. In addition, various metals were also seen to present in the ash samples

  13. Radiation protection data sheet. Radiation protection data sheets for the use of radionuclides in unsealed sources

    International Nuclear Information System (INIS)

    These radiation protection data sheet are devoted to responsible persons and employees of various laboratories or medical, pharmaceutical, university and industrial departments where radionuclides are handled as well as all the persons who attend to satisfy in this field. They contain the essential radiation protection data for the use of unsealed sources: physical characteristics, risk assessment, administrative procedures, recommendations, regulations and bibliography. This new series includes the following radionuclides: californium 252, curium 244, gallium 67, indium 113m, plutonium 238, plutonium 239, polonium 210, potassium 42, radium 226, thorium 232, uranium 238 and zinc 65. (O.M.)

  14. Study by thermochromatography of fluorides of transuranium elements

    International Nuclear Information System (INIS)

    Thermochromatography was made suitable for fluoride study. So, an investigation of actinide tetrafluorides was accomplished from uranium to californium. Pentavalent and hexavalent fluorospecies of uranium, neptunium, plutonium and ruthenium were studied. Some new compounds have been identified in gaseous phase, whose: PuF5, PuOF3 and PaOF3. Furthermore, some presomptions as for the existence in gaseous phase of EsF4 and of an heptavalent fluorospecies of plutonium have been established. An important analogy between plutonium and ruthenium behaviour with fluorine have been shown, these results could explain the difficulties encountered in the fluoride-volatility processes


    Energy Technology Data Exchange (ETDEWEB)

    Seaborg, Glenn T.; Street Jr., Kenneth; Thompson, Stanley G.; Ghiorso, Albert


    This volume includes the talks given on January 20, 1975, at a symposium in Berkeley on the occasion of the celebration of the 25th anniversary of the discovery of berkelium and californium. Talks were given at this symposium by the four people involved in the discovery of these elements and by a number of people who have made significant contributions in the intervening years to the investigation of their nuclear and chemical properties. The papers are being published here, without editing, in the form in which they were submitted by the authors in the months following the anniversary symposium, and they reflect rather faithfully the remarks made on that occasion.

  16. Method for measuring multiple scattering corrections between liquid scintillators (United States)

    Verbeke, J. M.; Glenn, A. M.; Keefer, G. J.; Wurtz, R. E.


    A time-of-flight method is proposed to experimentally quantify the fractions of neutrons scattering between scintillators. An array of scintillators is characterized in terms of crosstalk with this method by measuring a californium source, for different neutron energy thresholds. The spectral information recorded by the scintillators can be used to estimate the fractions of neutrons multiple scattering. With the help of a correction to Feynman's point model theory to account for multiple scattering, these fractions can in turn improve the mass reconstruction of fissile materials under investigation.

  17. Surface fission tracks in diamond

    International Nuclear Information System (INIS)

    Scanning Probe Microscope (SPM) images reveal important fingerprint features of latent tracks induced in diamond by fission fragments from a californium source. Collimated fission fragments with a binary distribution of the predominant energies of 79.4 and 103.8 MeV, are assumed. Cavities, reticular formations around these cavities, and black spots of graphite were found. A brief discussion on the possible track formation mechanism is given on the basis of the explosion spike theory; an attempt to determine latent track core and halo parameters is included

  18. Use of trioctylphosphine oxide for transplutonium element extraction and purification

    International Nuclear Information System (INIS)

    Investigated was extraction of tri-valent curium, berkelium, californium, einsteinium as well as cerium and europium with trioctylphosphin oxide from lactic acid solutions, containing DTPA and aluminium nitrate depending on the aluminium nitrate and TOPO concentrations and nitric acid solutions of variable concentration as well. Under optimum conditions of extraction chromatography of berkelium studied was the distribution of cobalt, nickel, chromium, iron, aluminium, titanium, zirconium and niobium ions, and the coefficients of berkelium purification from cations investigated were determined. The effect of weight quantities of cation impurities on extraction chromatographic yield of berkelium has been investigated. Examples of practice application of the extraction chromatography with the use of TOPO are given

  19. Reinterpreting Islamic Historiography: Hārūn al-Rashīd and the Narrative of the ‘Abbāsid Caliphate, Cambridge Studies in Islamic Civilisation, Cambridge, Cambridge University Press, 1999, x-236 p., table généalogique, index.


    Szuppe, Maria


    Le regain d’intérêt pour l’historiographie de l’époque islamique peut-être situé dans le cadre des nouvelles approches pour l’étude de l’histoire des sociétés musulmanes, approches pluridisciplinaires mettant à profit des données nouvelles (archéologiques, numismati­ques ...), et les nouvelles interprétations des sources connues. L’ouvrage de T. el-Hibri se situe dans ce même courant auquel appartiennent aussi le livre de J. Scott Meisami, Persian Historiography to the End of the Twelth Centu...

  20. The absolute total delayed neutron yields, relative abundances and half-lives of delayed neutron groups in 6- and 8-group model format from neutron induced fission of 232Th, 233U, 236U, 239Pu, and 241Am in the energy range from 0.35 MeV (or threshold energy) to 5 MeV

    International Nuclear Information System (INIS)

    The latest evaluation of delayed neutron constants was made for main fuel nuclides (235U, 238U, 239Pu) within an working group under the auspices of the Nuclear Energy Agency’s (NEA) Working Party on International Evaluation Cooperation (WPEC), Subgroup 6 (SG6) in 1999 [1]. As a result of this work the total delayed yields for the above nuclides were essentially corrected as compared with Tuttle’s recommended data set [2]. For the total delayed yields from 238U correction is +5.6%, for thermal induced fission of 239Pu - +3.4% and for fast neutron induced fission of 239Pu - +3.2%. This is a direct indication that there is a need for a continuing effort on delayed neutron data improving. From now, this will be mainly directed at satisfying new requirements emerging from the current trends in reactor technology, such as: the use of high burn-up fuel, the burning of plutonium stocks, the general growing interest in fuel recycling strategies, and new concept of actinide burners

  1. Exploring preconcentration of volatile hydrides in quartz trap for ICP-MS

    Czech Academy of Sciences Publication Activity Database

    Matoušek, Tomáš; Kašpar, M.; Kratzer, Jan; Musil, Stanislav; Dědina, Jiří

    2014. s. 236-236. [Rio Symposium on Atomic Spectrometry /13./. 19.10.2014-24.10.2014, Merida, Yucatan] R&D Projects: GA ČR GA14-23532S; GA ČR(CZ) GPP206/11/P002 Institutional support: RVO:68081715 Keywords : Arsenic * antimony * hydride generation Subject RIV: CB - Analytical Chemistry, Separation

  2. 77 FR 13624 - Notice of Intent To Repatriate Cultural Items: U.S. Fish and Wildlife Service, Office of Law... (United States)


    ... of Law Enforcement, Lakewood, CO AGENCY: National Park Service, Interior. ACTION: Notice. SUMMARY... Enforcement, 134 Union Blvd., Room 550, Lakewood, CO 80228, telephone (303) 236-7540. SUPPLEMENTARY... Enforcement, 134 Union Blvd., Room 550, Lakewood, CO 80228; telephone (303) 236-7540, April 6,...

  3. Antecedents and correlates of Sense of Coherence: a longitudinal perspective.

    Czech Academy of Sciences Publication Activity Database

    Blatný, Marek; Millová, Katarína; Slezáčková, Alena; Jelínek, Martin; Šolcová, Iva

    Philadelphia: International Positive Psychology Association, 2011. s. 236-236. [Second World Congress on Positive Psychology. 23.07.2011-26.07.2011, Philadelphia, Pennsylvania] R&D Projects: GA ČR GAP407/10/2410 Institutional research plan: CEZ:AV0Z70250504 Keywords : sense of coherence * middle adulthood * longitudinal perspective Subject RIV: AN - Psychology

  4. NCBI nr-aa BLAST: CBRC-OPRI-01-1405 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OPRI-01-1405 ref|NP_477758.1| wsv236 [Shrimp white spot syndrome virus] gb|AAL...33240.1| wsv236 [shrimp white spot syndrome virus] gb|AAL89160.1| WSSV292 [shrimp white spot syndrome virus] NP_477758.1 2.4 29% ...

  5. Deprese v dětství a její vztah k problémům chování

    Czech Academy of Sciences Publication Activity Database

    Čermák, Ivo; Klimusová, Helena; Vízdalová, H.


    Roč. 49, 223-236 (2005), s. 223-236. ISSN 0009-062X Institutional research plan: CEZ:AV0Z70250504 Keywords : child´s depression * behavior disorders * CBCL * CDI Subject RIV: AN - Psychology Impact factor: 0.241, year: 2005

  6. 48 CFR 836.513 - Accident prevention. (United States)


    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Accident prevention. 836... prevention. The contracting officer must insert the clause at 852.236-87, Accident Prevention, in solicitations and contracts for construction that contain the clause at FAR 52.236-13, Accident Prevention....

  7. 77 FR 28285 - Positive Train Control Systems (RRR) (United States)


    ... signal and train control systems. See 70 FR 11,052 (Mar. 7, 2005) (codified at 49 CFR part 236, subpart H... implementation on other lines. 75 FR 2598 (Jan. 15, 2010). Under RSIA, such PTC system implementation must be... to a new Sec. 236.1020. See 75 FR 59,108 (Sept. 27, 2010). Under this test, the railroad...

  8. AcEST: BP912483 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000019_A03 532 Adiantum capillus-veneris mRNA. clone: YMU001_000019_A03. BP912483 CL2387C ... --TIAKERKLLQNKRLDLDA 174 Query: 236 LKEKIVKEVDVEWKSAMD WELRVLHS-----VNVTQLTPNQINAQWQH 108 K ++ K E KS+ + E ... --TIAKERKLLQNKRLDLDA 174 Query: 236 LKEKIVKEVDVEWKSAMD WELRVLHS-----VNVTQLTPNQINAQWQH 108 K ++ K E KS+ + E ...

  9. Monte Carlo aided enhanced design of an neutron scatterometer

    International Nuclear Information System (INIS)

    This paper will present a particular example for the use of the Monte Carlo Method to enhance the performance of a neutron scatterometer, currently employed to detect the void fraction in fast-transient high-pressure water-vapour flow in a rod-bundle channel. The scatterometer relies on measuring the slowing-down of californium-252 neutrons by the hydrogen in the water to determine the liquid, hence vapour (void) content. However, californium-252 is a relatively fast-decaying source and alternative isotopic sources are typically too energetic to provide sufficient moderation given the small amount of liquid in the channel. Monte Carlo simulation were utilized to examine various design enhancement possibilities, including: filtering out unthermalized fast neutrons, amplifying by a fissionable material the amount of detected thermal neutrons, adding a dissolvable contrast material to the liquid phase, or relying on the scattering of fast neutrons by oxygen in water. In addition, methods to determine the distribution of the pattern of liquid-vapour phase in the channel are devised

  10. Features of isotopic composition of uranium in natural objects of the Chernobyl' NPP area

    International Nuclear Information System (INIS)

    It was shown that isotopic composition of U-natural objects of the zone (238U/235U, 235U/236U, 234U/238U) was shifted in reference to natural values and could be used for estimation of 'contamination' of environment by fuel. U content in 'contaminated' natural objects was not in excess of middle natural values. Correlation of the isotopic relationships 238U/236U and 235U/236U pointed to the fact that ejection of the fuel with high degree of burnup was lacking. 6 refs., 2 figs., 5 tabs

  11. Comparison of fission and capture cross sections of minor actinides

    CERN Document Server

    Nakagawa, T


    The fission and capture cross sections of minor actinides given in JENDL-3.3 are compared with other evaluated data and experimental data. The comparison was made for 32 nuclides of Th-227, 228, 229, 230, 233, 234, Pa-231, 232, 233, U-232, 234, 236, 237, Np-236, 237, 238, Pu-236, 237, 238, 242, 244, Am-241, 242, 242m, 243, Cm-242, 243, 244, 245, 246, 247 and 248. Given in the present report are figures of these cross sections and tables of cross sections at 0.0253 eV and resonance integrals.

  12. AcEST: DK944327 [AcEST

    Lifescience Database Archive (English)


  13. Comparison of fission and capture cross sections of minor actinides

    International Nuclear Information System (INIS)

    The fission and capture cross sections of minor actinides given in JENDL-3.3 are compared with other evaluated data and experimental data. The comparison was made for 32 nuclides of Th-227, 228, 229, 230, 233, 234, Pa-231, 232, 233, U-232, 234, 236, 237, Np-236, 237, 238, Pu-236, 237, 238, 242, 244, Am-241, 242, 242m, 243, Cm-242, 243, 244, 245, 246, 247 and 248. Given in the present report are figures of these cross sections and tables of cross sections at 0.0253 eV and resonance integrals. (author)

  14. Komisjoni kiuste avaldas Holland valimistulemuse / Arko Olesk

    Index Scriptorium Estoniae

    Olesk, Arko, 1981-


    Euroopa Komisjoni keelule ja karistusähvardusele vaatamata avaldasid Hollandi võimud europarlamendi valimiste tulemused, mille kohaselt said valitsevad kristlikud demokraadid 24,4 protsenti ja opositsioonilised sotsiaaldemokraadid 23,6 protsenti häältest

  15. Komentář k překladu

    Czech Academy of Sciences Publication Activity Database

    Bakešová, Alena


    Roč. 54, č. 2 (2006), s. 235-236. ISSN 0015-1831 Institutional research plan: CEZ:AV0Z90090514 Keywords : hermeneutics * situated subject * normativity in the modernism and postmodernism Subject RIV: AA - Philosophy ; Religion

  16. Gene : CBRC-FRUB-02-0859 [SEVENS

    Lifescience Database Archive (English)


  17. Konzervace středověkého nože ze Senic

    Czech Academy of Sciences Publication Activity Database

    Hošek, Jiří; Šilhová, Alena


    Roč. 37, - (2004), s. 229-236. ISSN 0231-5769 Institutional research plan: CEZ:AV0Z8002910 Keywords : archaeometallurgy * knife * Middle Age * conservation science Subject RIV: AC - Archeology, Anthropology, Ethnology

  18. Miroslav (okr. Znojmo)

    Czech Academy of Sciences Publication Activity Database

    Jelínková, Dagmar


    Roč. 43, - (2002), s. 236-239. ISSN 1211-7250 Institutional research plan: CEZ:AV0Z8001916 Keywords : Late Roman Period * incineration graves * Roman-provincial products Subject RIV: AC - Archeology, Anthropology, Ethnology

  19. Heritability estimates for growth-related traits using microsatellite parentage assignment in juvenile common carp (Cyprinus carpio L.)

    Czech Academy of Sciences Publication Activity Database

    Vandeputte, M.; Kocour, Martin; Mauger, S.; Duppont Nivet, M.; De Guerry, D.; Rodina, Marek; Gela, David; Vallod, D.; Chevassus, B.; Linhart, Otomar


    Roč. 235, - (2004), s. 223-236. ISSN 0044-8486 Institutional research plan: CEZ:AV0Z5045916 Keywords : common carp * Cyprinus carpio * heritability Subject RIV: ED - Physiology Impact factor: 1.627, year: 2004

  20. Progress report 1987: predator control to enhance the production of Greater Sandhill Cranes on Malheur National Wildlife Refuge (United States)

    US Fish and Wildlife Service, Department of the Interior — The nesting population of greater sandhill cranes on Malheur National Wildlife Refuge, Oregon has declined from 236 pairs in 1971 to 181 pairs in 1986. Nesting...